BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86947_g1_i1 len=1114 path=[1092:0-1113]

Length=1114
                                                                      Score     E

ref|XP_010314971.1|  PREDICTED: separase isoform X2                     357   3e-107   
ref|XP_010314969.1|  PREDICTED: separase isoform X1                     357   6e-107   
ref|XP_006349439.1|  PREDICTED: separase-like                           354   4e-106   
ref|XP_009777792.1|  PREDICTED: separase isoform X2                     350   4e-105   
ref|XP_009777791.1|  PREDICTED: separase isoform X1                     350   9e-105   
ref|XP_009589664.1|  PREDICTED: separase isoform X1                     345   6e-103   
ref|XP_009589680.1|  PREDICTED: separase isoform X3                     345   6e-103   
ref|XP_009589674.1|  PREDICTED: separase isoform X2                     345   8e-103   
ref|XP_010657825.1|  PREDICTED: separase isoform X4                     268   3e-76    
emb|CBI23880.3|  unnamed protein product                                269   3e-76    
ref|XP_010657823.1|  PREDICTED: separase isoform X1                     268   5e-76    
ref|XP_010657824.1|  PREDICTED: separase isoform X3                     268   5e-76    
ref|XP_002273874.2|  PREDICTED: separase isoform X2                     268   6e-76    Vitis vinifera
ref|XP_006491877.1|  PREDICTED: separase-like isoform X3                250   1e-69    
ref|XP_006491876.1|  PREDICTED: separase-like isoform X2                249   1e-69    
ref|XP_006491875.1|  PREDICTED: separase-like isoform X1                249   1e-69    
ref|XP_006431950.1|  hypothetical protein CICLE_v10000008mg             248   2e-69    
ref|XP_007225661.1|  hypothetical protein PRUPE_ppa000043mg             249   2e-69    
ref|XP_006431949.1|  hypothetical protein CICLE_v10000008mg             249   2e-69    
gb|KDO41134.1|  hypothetical protein CISIN_1g0001101mg                  247   5e-69    
ref|XP_008339285.1|  PREDICTED: separase                                248   6e-69    
ref|XP_008361643.1|  PREDICTED: separase-like                           248   6e-69    
emb|CDO97522.1|  unnamed protein product                                238   9e-66    
ref|XP_007041565.1|  Separase, putative                                 237   2e-65    
ref|XP_002529003.1|  separase, putative                                 236   4e-65    Ricinus communis
ref|XP_008218969.1|  PREDICTED: separase                                235   1e-64    
ref|XP_010245920.1|  PREDICTED: separase isoform X4                     233   5e-64    
ref|XP_010245919.1|  PREDICTED: separase isoform X3                     233   5e-64    
ref|XP_010245918.1|  PREDICTED: separase isoform X2                     233   6e-64    
ref|XP_010245917.1|  PREDICTED: separase isoform X1                     233   6e-64    
ref|XP_011008695.1|  PREDICTED: separase                                233   6e-64    
ref|XP_002303173.2|  hypothetical protein POPTR_0003s01610g             223   1e-60    Populus trichocarpa [western balsam poplar]
ref|XP_008445506.1|  PREDICTED: separase isoform X1                     223   2e-60    
ref|XP_008445507.1|  PREDICTED: separase isoform X2                     223   2e-60    
ref|XP_004144269.1|  PREDICTED: uncharacterized protein LOC101203087    219   3e-59    
ref|XP_004163947.1|  PREDICTED: uncharacterized LOC101203087            219   3e-59    
ref|XP_010671406.1|  PREDICTED: separase                                216   3e-58    
ref|XP_004295930.1|  PREDICTED: uncharacterized protein LOC101294643    216   4e-58    
emb|CDX94142.1|  BnaC07g37760D                                          212   1e-56    
ref|XP_006413594.1|  hypothetical protein EUTSA_v10024187mg             211   2e-56    
ref|XP_008776341.1|  PREDICTED: separase                                210   5e-56    
ref|XP_010068188.1|  PREDICTED: separase                                210   7e-56    
emb|CDX98781.1|  BnaA03g45660D                                          209   1e-55    
ref|XP_009137707.1|  PREDICTED: separase-like                           208   2e-55    
gb|KFK39266.1|  hypothetical protein AALP_AA3G222100                    206   1e-54    
emb|CDY10832.1|  BnaC01g14470D                                          205   3e-54    
ref|XP_010433961.1|  PREDICTED: separase-like                           201   4e-53    
ref|XP_003547059.2|  PREDICTED: separase-like                           201   5e-53    
gb|KHN33472.1|  Separin                                                 201   5e-53    
ref|XP_010445194.1|  PREDICTED: separase-like                           201   5e-53    
ref|XP_009136537.1|  PREDICTED: separase isoform X2                     200   2e-52    
ref|XP_009136528.1|  PREDICTED: separase isoform X1                     200   2e-52    
ref|XP_010448795.1|  PREDICTED: separase isoform X1                     199   2e-52    
emb|CDY41265.1|  BnaA01g12740D                                          199   2e-52    
ref|XP_010448796.1|  PREDICTED: separase isoform X2                     199   2e-52    
ref|XP_010448800.1|  PREDICTED: separase isoform X5                     199   2e-52    
ref|XP_010448798.1|  PREDICTED: separase isoform X3                     199   2e-52    
ref|XP_006585469.1|  PREDICTED: separase-like isoform X1                199   3e-52    
ref|XP_006286190.1|  hypothetical protein CARUB_v10007755mg             199   3e-52    
ref|XP_006585470.1|  PREDICTED: separase-like isoform X2                199   3e-52    
ref|NP_194028.2|  separase-like protein                                 199   3e-52    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190804.1|  separase-like protein                              199   3e-52    
ref|XP_007148477.1|  hypothetical protein PHAVU_006G212000g             198   6e-52    
ref|XP_011088127.1|  PREDICTED: separase                                198   7e-52    
gb|KHN26699.1|  Separin                                                 197   1e-51    
ref|XP_010908769.1|  PREDICTED: separase                                196   2e-51    
gb|EYU18539.1|  hypothetical protein MIMGU_mgv1a018611mg                196   4e-51    
gb|KGN47608.1|  hypothetical protein Csa_6G364113                       195   8e-51    
ref|XP_006396846.1|  hypothetical protein EUTSA_v10029518mg             195   8e-51    
ref|XP_002867740.1|  hypothetical protein ARALYDRAFT_492569             195   9e-51    
gb|KEH21880.1|  separase-like protein                                   193   3e-50    
gb|AES63348.2|  separase-like protein                                   191   2e-49    
ref|XP_003593097.1|  Separin                                            191   2e-49    
ref|XP_010540479.1|  PREDICTED: separase isoform X2                     190   3e-49    
ref|XP_010540470.1|  PREDICTED: separase isoform X1                     190   3e-49    
ref|XP_004486240.1|  PREDICTED: uncharacterized protein LOC101501526    189   1e-48    
gb|KCW63049.1|  hypothetical protein EUGRSUZ_G00634                     189   1e-48    
ref|XP_009417821.1|  PREDICTED: separase-like                           188   2e-48    
emb|CAN76327.1|  hypothetical protein VITISV_014221                     171   7e-45    Vitis vinifera
ref|XP_006829069.1|  hypothetical protein AMTR_s00001p00258830          167   3e-41    
emb|CDY68508.1|  BnaCnng59290D                                          161   7e-40    
gb|KFK31931.1|  hypothetical protein AALP_AA6G177700                    161   3e-39    
ref|XP_010448799.1|  PREDICTED: separase isoform X4                     159   2e-38    
gb|EMT21871.1|  Separin                                                 152   2e-36    
ref|XP_010236897.1|  PREDICTED: separase                                150   9e-36    
emb|CAA19812.1|  putative protein                                       146   2e-34    Arabidopsis thaliana [mouse-ear cress]
emb|CDY67480.1|  BnaCnng55190D                                          144   8e-34    
gb|EMS65712.1|  Separin                                                 143   3e-33    
ref|XP_004955230.1|  PREDICTED: uncharacterized protein LOC101777770    143   3e-33    
ref|XP_008679271.1|  PREDICTED: separase isoform X3                     143   3e-33    
ref|XP_008679270.1|  PREDICTED: separase isoform X2                     142   4e-33    
ref|XP_008679269.1|  PREDICTED: separase isoform X1                     142   5e-33    
gb|EEC74078.1|  hypothetical protein OsI_09098                          137   2e-31    Oryza sativa Indica Group [Indian rice]
gb|EEE57877.1|  hypothetical protein OsJ_08535                          135   2e-30    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010439035.1|  PREDICTED: separase-like isoform X1                130   2e-30    
ref|XP_010103846.1|  hypothetical protein L484_024148                   130   3e-29    
ref|XP_002454624.1|  hypothetical protein SORBIDRAFT_04g034460          125   2e-27    Sorghum bicolor [broomcorn]
gb|AFW64316.1|  hypothetical protein ZEAMMB73_008938                    125   3e-27    
ref|XP_008378851.1|  PREDICTED: separase-like                           119   8e-26    
gb|ABN08433.1|  peptidase , related                                     112   3e-24    Medicago truncatula
emb|CCG89179.1|  separase protein                                       107   1e-21    
gb|ABN08434.1|  peptidase , related                                   85.5    9e-15    Medicago truncatula
ref|XP_010439037.1|  PREDICTED: separase-like isoform X2              72.4    9e-11    
ref|XP_001759110.1|  predicted protein                                65.9    3e-08    
ref|XP_002451792.1|  hypothetical protein SORBIDRAFT_04g007851        60.1    7e-08    Sorghum bicolor [broomcorn]
ref|XP_004967289.1|  PREDICTED: uncharacterized protein LOC101782294  60.5    2e-06    
ref|XP_002964047.1|  hypothetical protein SELMODRAFT_405667           53.1    3e-04    
ref|XP_002975469.1|  hypothetical protein SELMODRAFT_442839           53.1    3e-04    



>ref|XP_010314971.1| PREDICTED: separase isoform X2 [Solanum lycopersicum]
Length=2038

 Score =   357 bits (917),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 259/373 (69%), Gaps = 5/373 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++ LS H GE++ S EYW   +KESQP LVGFQQSF +  ALSS+   N++
Sbjct  902   CTSPVNEMFIKTLSNHCGELSKSVEYWMKCMKESQPQLVGFQQSFFLTLALSSKVSHNNQ  961

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI++DKVKLTAS+LI  VPLSSGSAFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  962   SLFHCDITEDKVKLTASELIQAVPLSSGSAFLSAYLYYDLSERLILNGRLIEALAYAKEA  1021

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             +RLR  LL  NF    EQQ E   L  F+I DSVA ++WF G VS DF+   LTPWNVLQ
Sbjct  1022  HRLRSKLLQENFQYQIEQQAEVYGLTKFQIYDSVAAKAWFPGSVSFDFDGSTLTPWNVLQ  1081

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  GKDISC QSL LFI+SF C+LG++Y K+ L E
Sbjct  1082  CYLESILQVGTVHEMLGNGTEAKTLLVWGKDISCFQSLPLFIISFCCMLGKLYAKQHLLE  1141

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE + AK+ L +N   +SC KCR + EVSID L GD++R+Q C     ST + ++  
Sbjct  1142  LAEKELNTAKQTLAENYDDISCLKCRTILEVSIDLLLGDLWRRQHCNT--TSTVEFVSSV  1199

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHES-CSLSYSATDHMVLKEVASRNRKHE  1075
             KEKY+S+ +KL    W +  G      S+H KH++  S +  +TD   LKE  S++ K E
Sbjct  1200  KEKYRSSFEKLNNFGWEDSVGCSLGACSQHTKHQARYSFANGSTDPSDLKEFPSQD-KLE  1258

Query  1076  NAVETIMARKTKE  1114
              AVE    RKTK+
Sbjct  1259  KAVEGRTTRKTKK  1271



>ref|XP_010314969.1| PREDICTED: separase isoform X1 [Solanum lycopersicum]
Length=2128

 Score =   357 bits (915),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 259/373 (69%), Gaps = 5/373 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++ LS H GE++ S EYW   +KESQP LVGFQQSF +  ALSS+   N++
Sbjct  902   CTSPVNEMFIKTLSNHCGELSKSVEYWMKCMKESQPQLVGFQQSFFLTLALSSKVSHNNQ  961

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI++DKVKLTAS+LI  VPLSSGSAFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  962   SLFHCDITEDKVKLTASELIQAVPLSSGSAFLSAYLYYDLSERLILNGRLIEALAYAKEA  1021

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             +RLR  LL  NF    EQQ E   L  F+I DSVA ++WF G VS DF+   LTPWNVLQ
Sbjct  1022  HRLRSKLLQENFQYQIEQQAEVYGLTKFQIYDSVAAKAWFPGSVSFDFDGSTLTPWNVLQ  1081

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  GKDISC QSL LFI+SF C+LG++Y K+ L E
Sbjct  1082  CYLESILQVGTVHEMLGNGTEAKTLLVWGKDISCFQSLPLFIISFCCMLGKLYAKQHLLE  1141

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE + AK+ L +N   +SC KCR + EVSID L GD++R+Q C     ST + ++  
Sbjct  1142  LAEKELNTAKQTLAENYDDISCLKCRTILEVSIDLLLGDLWRRQHCNT--TSTVEFVSSV  1199

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHES-CSLSYSATDHMVLKEVASRNRKHE  1075
             KEKY+S+ +KL    W +  G      S+H KH++  S +  +TD   LKE  S++ K E
Sbjct  1200  KEKYRSSFEKLNNFGWEDSVGCSLGACSQHTKHQARYSFANGSTDPSDLKEFPSQD-KLE  1258

Query  1076  NAVETIMARKTKE  1114
              AVE    RKTK+
Sbjct  1259  KAVEGRTTRKTKK  1271



>ref|XP_006349439.1| PREDICTED: separase-like [Solanum tuberosum]
Length=2148

 Score =   354 bits (909),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 204/373 (55%), Positives = 259/373 (69%), Gaps = 5/373 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++ LS H GE++ S EYW   +KESQP LVGFQQSF +  +LSS+   +++
Sbjct  919   CTSPVNEMFIKTLSNHCGELSKSVEYWMKCMKESQPQLVGFQQSFFLTLSLSSKVSHSNQ  978

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +F   DI++DKVKLTAS+LI  VPLSSGSAFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  979   SFFHCDITEDKVKLTASELIHAVPLSSGSAFLSAYLYYDLSERLILNGRLIEALAYAKEA  1038

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             +RLR  LL  NF    EQQ E   L  F+I DSVA ++WF   VS DF+   LTPWN+LQ
Sbjct  1039  HRLRSKLLQENFQYQIEQQGEVYGLTKFQIYDSVAAKAWFPASVSFDFDGSMLTPWNILQ  1098

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  GKDISC QSL LFI+SF C+LG++Y K+ L E
Sbjct  1099  CYLESILQVGTVHEMLGNGTEAKTLLVWGKDISCFQSLPLFIISFCCMLGKLYAKQHLLE  1158

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE + AK+ L +N   +SC KCR + EVSID L GD++R+Q C     ST + +   
Sbjct  1159  LAEKELNTAKQTLAENYDDISCLKCRIILEVSIDLLLGDLWRRQHCNT--TSTVEFVYSV  1216

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESC-SLSYSATDHMVLKEVASRNRKHE  1075
             KEKY+S+ +KL    W +  G      S+H KH++  S +  +TD   LKE  S++ K E
Sbjct  1217  KEKYRSSFEKLNNFGWEDSVGCSLGASSQHTKHQATYSFANGSTDPSDLKEFPSQD-KLE  1275

Query  1076  NAVETIMARKTKE  1114
             NAVE    RKTK+
Sbjct  1276  NAVEGRRTRKTKK  1288



>ref|XP_009777792.1| PREDICTED: separase isoform X2 [Nicotiana sylvestris]
Length=1784

 Score =   350 bits (899),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 260/372 (70%), Gaps = 2/372 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  ++ALS H GE+++S +YW   ++ SQP L+GFQQSF +  ALSS+   +H+
Sbjct  551   CTSPVNDMFIKALSNHCGELSESLKYWMKCMEVSQPQLIGFQQSF-LTLALSSKVSRSHQ  609

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +FL  D++DDKVKLTA++LI  VPLSSG+AFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  610   SFLHCDMTDDKVKLTAAELIHTVPLSSGAAFLSAYLYYDLSERLILNGRLAEALAYAKEA  669

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             +RLR  LL  NF    E+Q E   L +F+I D VA ++WF  +VS DF+   LTPW +LQ
Sbjct  670   HRLRSKLLQENFFYQIEEQSEVYGLTAFQIYDPVAAKAWFPENVSFDFDGSILTPWTILQ  729

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  G++IS  QSL LFI+SF C+LG++Y K+ LWE
Sbjct  730   CYLESILQVGTVHEMLGNGTEAKTLLVWGENISSNQSLPLFIISFCCMLGKLYIKQHLWE  789

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE + AK+ L +N   +SC KCR + EVSID L GD++R   C    +ST + L   
Sbjct  790   LAEKELNTAKQTLAENYDAISCLKCRIILEVSIDLLIGDLWRLHHCDAVNSSTVEFLYSV  849

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVLKEVASRNRKHEN  1078
             KEKY+SA +KL    W +  G P    S+H KH++ S +  A D   LKE+ S+  K ++
Sbjct  850   KEKYRSAFEKLNNFGWEDSVGWPLGASSQHTKHQATSFANGAKDPSGLKELPSQMGKLDD  909

Query  1079  AVETIMARKTKE  1114
             AVE    RKTK+
Sbjct  910   AVEGRRTRKTKK  921



>ref|XP_009777791.1| PREDICTED: separase isoform X1 [Nicotiana sylvestris]
Length=2148

 Score =   350 bits (899),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 260/372 (70%), Gaps = 2/372 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  ++ALS H GE+++S +YW   ++ SQP L+GFQQSF +  ALSS+   +H+
Sbjct  915   CTSPVNDMFIKALSNHCGELSESLKYWMKCMEVSQPQLIGFQQSF-LTLALSSKVSRSHQ  973

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +FL  D++DDKVKLTA++LI  VPLSSG+AFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  974   SFLHCDMTDDKVKLTAAELIHTVPLSSGAAFLSAYLYYDLSERLILNGRLAEALAYAKEA  1033

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             +RLR  LL  NF    E+Q E   L +F+I D VA ++WF  +VS DF+   LTPW +LQ
Sbjct  1034  HRLRSKLLQENFFYQIEEQSEVYGLTAFQIYDPVAAKAWFPENVSFDFDGSILTPWTILQ  1093

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  G++IS  QSL LFI+SF C+LG++Y K+ LWE
Sbjct  1094  CYLESILQVGTVHEMLGNGTEAKTLLVWGENISSNQSLPLFIISFCCMLGKLYIKQHLWE  1153

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE + AK+ L +N   +SC KCR + EVSID L GD++R   C    +ST + L   
Sbjct  1154  LAEKELNTAKQTLAENYDAISCLKCRIILEVSIDLLIGDLWRLHHCDAVNSSTVEFLYSV  1213

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVLKEVASRNRKHEN  1078
             KEKY+SA +KL    W +  G P    S+H KH++ S +  A D   LKE+ S+  K ++
Sbjct  1214  KEKYRSAFEKLNNFGWEDSVGWPLGASSQHTKHQATSFANGAKDPSGLKELPSQMGKLDD  1273

Query  1079  AVETIMARKTKE  1114
             AVE    RKTK+
Sbjct  1274  AVEGRRTRKTKK  1285



>ref|XP_009589664.1| PREDICTED: separase isoform X1 [Nicotiana tomentosiformis]
Length=2156

 Score =   345 bits (886),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 255/372 (69%), Gaps = 4/372 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++ LS H GE++ S EYW   ++ SQP L+GFQQSF +  ALSS+   +H+
Sbjct  925   CTSPVNEMFIKTLSNHCGELSKSLEYWMKCMEASQPQLIGFQQSF-LTLALSSKVSRSHQ  983

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +FL  DI+DDKVKLTA++LI  VPLSSG+AFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  984   SFLHCDITDDKVKLTAAELIHTVPLSSGAAFLSAYLYYDLSERLILNGRLVEALAYAKEA  1043

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             + LR  LL  NF    E+Q E   L +F+I D VA ++WF   VS DF+   LTPW +LQ
Sbjct  1044  HCLRSKLLQENFFYQIEEQSEVYGLTAFQIYDPVAAKAWFPESVSFDFDGSILTPWTILQ  1103

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  GK+ISC QSL LFI+SF C+LG++Y K+ LWE
Sbjct  1104  CYLESILQVGTVHEMLGNGTEAKALLVWGKNISCNQSLPLFIISFCCMLGKLYTKQHLWE  1163

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAE+E + AK+ L +N   +SC KCR + EVSID L GD++R   C    +ST + L   
Sbjct  1164  LAERELNTAKQTLAENYDAISCLKCRIILEVSIDLLIGDLWRLHHCDAVNSSTVEFLYSV  1223

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVLKEVASRNRKHEN  1078
             KEKY+SA +KL    W +  G P    S+H KH++ S +  A D   LKE+ S   K ++
Sbjct  1224  KEKYRSAFEKLNNFGWEDSVGWPVGSSSQHTKHQATSFANGAKDPSGLKELPS--GKLDD  1281

Query  1079  AVETIMARKTKE  1114
             AVE     KTK+
Sbjct  1282  AVEGRRTGKTKK  1293



>ref|XP_009589680.1| PREDICTED: separase isoform X3 [Nicotiana tomentosiformis]
Length=1838

 Score =   345 bits (884),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 255/372 (69%), Gaps = 4/372 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++ LS H GE++ S EYW   ++ SQP L+GFQQSF +  ALSS+   +H+
Sbjct  607   CTSPVNEMFIKTLSNHCGELSKSLEYWMKCMEASQPQLIGFQQSF-LTLALSSKVSRSHQ  665

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +FL  DI+DDKVKLTA++LI  VPLSSG+AFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  666   SFLHCDITDDKVKLTAAELIHTVPLSSGAAFLSAYLYYDLSERLILNGRLVEALAYAKEA  725

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             + LR  LL  NF    E+Q E   L +F+I D VA ++WF   VS DF+   LTPW +LQ
Sbjct  726   HCLRSKLLQENFFYQIEEQSEVYGLTAFQIYDPVAAKAWFPESVSFDFDGSILTPWTILQ  785

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  GK+ISC QSL LFI+SF C+LG++Y K+ LWE
Sbjct  786   CYLESILQVGTVHEMLGNGTEAKALLVWGKNISCNQSLPLFIISFCCMLGKLYTKQHLWE  845

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAE+E + AK+ L +N   +SC KCR + EVSID L GD++R   C    +ST + L   
Sbjct  846   LAERELNTAKQTLAENYDAISCLKCRIILEVSIDLLIGDLWRLHHCDAVNSSTVEFLYSV  905

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVLKEVASRNRKHEN  1078
             KEKY+SA +KL    W +  G P    S+H KH++ S +  A D   LKE+ S   K ++
Sbjct  906   KEKYRSAFEKLNNFGWEDSVGWPVGSSSQHTKHQATSFANGAKDPSGLKELPS--GKLDD  963

Query  1079  AVETIMARKTKE  1114
             AVE     KTK+
Sbjct  964   AVEGRRTGKTKK  975



>ref|XP_009589674.1| PREDICTED: separase isoform X2 [Nicotiana tomentosiformis]
Length=2150

 Score =   345 bits (885),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 255/372 (69%), Gaps = 4/372 (1%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++ LS H GE++ S EYW   ++ SQP L+GFQQSF +  ALSS+   +H+
Sbjct  919   CTSPVNEMFIKTLSNHCGELSKSLEYWMKCMEASQPQLIGFQQSF-LTLALSSKVSRSHQ  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +FL  DI+DDKVKLTA++LI  VPLSSG+AFLSAYLYYDLSERLIL+G+L EAL+YAKEA
Sbjct  978   SFLHCDITDDKVKLTAAELIHTVPLSSGAAFLSAYLYYDLSERLILNGRLVEALAYAKEA  1037

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             + LR  LL  NF    E+Q E   L +F+I D VA ++WF   VS DF+   LTPW +LQ
Sbjct  1038  HCLRSKLLQENFFYQIEEQSEVYGLTAFQIYDPVAAKAWFPESVSFDFDGSILTPWTILQ  1097

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S+LQVGT++EMLGNG  AK LL  GK+ISC QSL LFI+SF C+LG++Y K+ LWE
Sbjct  1098  CYLESILQVGTVHEMLGNGTEAKALLVWGKNISCNQSLPLFIISFCCMLGKLYTKQHLWE  1157

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAE+E + AK+ L +N   +SC KCR + EVSID L GD++R   C    +ST + L   
Sbjct  1158  LAERELNTAKQTLAENYDAISCLKCRIILEVSIDLLIGDLWRLHHCDAVNSSTVEFLYSV  1217

Query  899   KEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVLKEVASRNRKHEN  1078
             KEKY+SA +KL    W +  G P    S+H KH++ S +  A D   LKE+ S   K ++
Sbjct  1218  KEKYRSAFEKLNNFGWEDSVGWPVGSSSQHTKHQATSFANGAKDPSGLKELPS--GKLDD  1275

Query  1079  AVETIMARKTKE  1114
             AVE     KTK+
Sbjct  1276  AVEGRRTGKTKK  1287



>ref|XP_010657825.1| PREDICTED: separase isoform X4 [Vitis vinifera]
Length=1945

 Score =   268 bits (686),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 235/367 (64%), Gaps = 8/367 (2%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PINE  +   ++H GE +   ++W + +K SQPLLVGF Q F  +FA   Q  C++K
Sbjct  944   CTSPINEAFIMTFTEHCGENSKVIDFWISCIKGSQPLLVGFLQIFSFLFANLPQGSCHYK  1003

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK TA  LIS VP+SS S FL+ YLYYDL ERL  +G+L EALS+AK+A
Sbjct  1004  SSFRVDITIDEVKDTAEKLISRVPVSSHSVFLAGYLYYDLCERLTSNGRLIEALSFAKQA  1063

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             ++LR  L    F       + +  L +F++   VATE W    +S + ESC L+PWNVL+
Sbjct  1064  HQLRSKLFQEKFSQKYTSGLSD--LQTFRL---VATEVWSFSTISWELESCDLSPWNVLR  1118

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S LQVG I+EM+GNG  A+ LL  GK IS +Q L LFIVSFS +LG++YCK+++W+
Sbjct  1119  CYLESTLQVGIIHEMIGNGTEAEALLCWGKMISSSQDLPLFIVSFSSMLGKLYCKKRIWD  1178

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE   AK+ +VD+S+ +SC KCR + E +IDQ  GD+YR       EN + + L+ A
Sbjct  1179  LAEKELQTAKQVMVDSSADISCLKCRLILEATIDQQLGDLYRSHLDCTTENLSIKRLSFA  1238

Query  899   KEKYKSAVDKLALSEWNNFSGGPK--AVGSEHAKHESCSLSYSATDHMVLKEVASRNRKH  1072
             +  YKSA+DKL LSEW N    P+     S  ++++  +++  +T  +   ++ +++RK 
Sbjct  1239  ENLYKSALDKLNLSEWKNSVSSPEESCAASILSRNQLDAVTLFSTGEVTKVKMENKSRKA  1298

Query  1073  ENAVETI  1093
             + A + +
Sbjct  1299  KKASQIL  1305



>emb|CBI23880.3| unnamed protein product [Vitis vinifera]
Length=2158

 Score =   269 bits (687),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 235/367 (64%), Gaps = 8/367 (2%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PINE  +   ++H GE +   ++W + +K SQPLLVGF Q F  +FA   Q  C++K
Sbjct  890   CTSPINEAFIMTFTEHCGENSKVIDFWISCIKGSQPLLVGFLQIFSFLFANLPQGSCHYK  949

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK TA  LIS VP+SS S FL+ YLYYDL ERL  +G+L EALS+AK+A
Sbjct  950   SSFRVDITIDEVKDTAEKLISRVPVSSHSVFLAGYLYYDLCERLTSNGRLIEALSFAKQA  1009

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             ++LR  L    F       + +  L +F++   VATE W    +S + ESC L+PWNVL+
Sbjct  1010  HQLRSKLFQEKFSQKYTSGLSD--LQTFRL---VATEVWSFSTISWELESCDLSPWNVLR  1064

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S LQVG I+EM+GNG  A+ LL  GK IS +Q L LFIVSFS +LG++YCK+++W+
Sbjct  1065  CYLESTLQVGIIHEMIGNGTEAEALLCWGKMISSSQDLPLFIVSFSSMLGKLYCKKRIWD  1124

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE   AK+ +VD+S+ +SC KCR + E +IDQ  GD+YR       EN + + L+ A
Sbjct  1125  LAEKELQTAKQVMVDSSADISCLKCRLILEATIDQQLGDLYRSHLDCTTENLSIKRLSFA  1184

Query  899   KEKYKSAVDKLALSEWNNFSGGPK--AVGSEHAKHESCSLSYSATDHMVLKEVASRNRKH  1072
             +  YKSA+DKL LSEW N    P+     S  ++++  +++  +T  +   ++ +++RK 
Sbjct  1185  ENLYKSALDKLNLSEWKNSVSSPEESCAASILSRNQLDAVTLFSTGEVTKVKMENKSRKA  1244

Query  1073  ENAVETI  1093
             + A + +
Sbjct  1245  KKASQIL  1251



>ref|XP_010657823.1| PREDICTED: separase isoform X1 [Vitis vinifera]
Length=2198

 Score =   268 bits (685),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 235/367 (64%), Gaps = 8/367 (2%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PINE  +   ++H GE +   ++W + +K SQPLLVGF Q F  +FA   Q  C++K
Sbjct  944   CTSPINEAFIMTFTEHCGENSKVIDFWISCIKGSQPLLVGFLQIFSFLFANLPQGSCHYK  1003

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK TA  LIS VP+SS S FL+ YLYYDL ERL  +G+L EALS+AK+A
Sbjct  1004  SSFRVDITIDEVKDTAEKLISRVPVSSHSVFLAGYLYYDLCERLTSNGRLIEALSFAKQA  1063

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             ++LR  L    F       + +  L +F++   VATE W    +S + ESC L+PWNVL+
Sbjct  1064  HQLRSKLFQEKFSQKYTSGLSD--LQTFRL---VATEVWSFSTISWELESCDLSPWNVLR  1118

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S LQVG I+EM+GNG  A+ LL  GK IS +Q L LFIVSFS +LG++YCK+++W+
Sbjct  1119  CYLESTLQVGIIHEMIGNGTEAEALLCWGKMISSSQDLPLFIVSFSSMLGKLYCKKRIWD  1178

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE   AK+ +VD+S+ +SC KCR + E +IDQ  GD+YR       EN + + L+ A
Sbjct  1179  LAEKELQTAKQVMVDSSADISCLKCRLILEATIDQQLGDLYRSHLDCTTENLSIKRLSFA  1238

Query  899   KEKYKSAVDKLALSEWNNFSGGPK--AVGSEHAKHESCSLSYSATDHMVLKEVASRNRKH  1072
             +  YKSA+DKL LSEW N    P+     S  ++++  +++  +T  +   ++ +++RK 
Sbjct  1239  ENLYKSALDKLNLSEWKNSVSSPEESCAASILSRNQLDAVTLFSTGEVTKVKMENKSRKA  1298

Query  1073  ENAVETI  1093
             + A + +
Sbjct  1299  KKASQIL  1305



>ref|XP_010657824.1| PREDICTED: separase isoform X3 [Vitis vinifera]
Length=2197

 Score =   268 bits (685),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 235/367 (64%), Gaps = 8/367 (2%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PINE  +   ++H GE +   ++W + +K SQPLLVGF Q F  +FA   Q  C++K
Sbjct  944   CTSPINEAFIMTFTEHCGENSKVIDFWISCIKGSQPLLVGFLQIFSFLFANLPQGSCHYK  1003

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK TA  LIS VP+SS S FL+ YLYYDL ERL  +G+L EALS+AK+A
Sbjct  1004  SSFRVDITIDEVKDTAEKLISRVPVSSHSVFLAGYLYYDLCERLTSNGRLIEALSFAKQA  1063

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             ++LR  L    F       + +  L +F++   VATE W    +S + ESC L+PWNVL+
Sbjct  1064  HQLRSKLFQEKFSQKYTSGLSD--LQTFRL---VATEVWSFSTISWELESCDLSPWNVLR  1118

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S LQVG I+EM+GNG  A+ LL  GK IS +Q L LFIVSFS +LG++YCK+++W+
Sbjct  1119  CYLESTLQVGIIHEMIGNGTEAEALLCWGKMISSSQDLPLFIVSFSSMLGKLYCKKRIWD  1178

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE   AK+ +VD+S+ +SC KCR + E +IDQ  GD+YR       EN + + L+ A
Sbjct  1179  LAEKELQTAKQVMVDSSADISCLKCRLILEATIDQQLGDLYRSHLDCTTENLSIKRLSFA  1238

Query  899   KEKYKSAVDKLALSEWNNFSGGPK--AVGSEHAKHESCSLSYSATDHMVLKEVASRNRKH  1072
             +  YKSA+DKL LSEW N    P+     S  ++++  +++  +T  +   ++ +++RK 
Sbjct  1239  ENLYKSALDKLNLSEWKNSVSSPEESCAASILSRNQLDAVTLFSTGEVTKVKMENKSRKA  1298

Query  1073  ENAVETI  1093
             + A + +
Sbjct  1299  KKASQIL  1305



>ref|XP_002273874.2| PREDICTED: separase isoform X2 [Vitis vinifera]
Length=2197

 Score =   268 bits (685),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 235/367 (64%), Gaps = 8/367 (2%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PINE  +   ++H GE +   ++W + +K SQPLLVGF Q F  +FA   Q  C++K
Sbjct  943   CTSPINEAFIMTFTEHCGENSKVIDFWISCIKGSQPLLVGFLQIFSFLFANLPQGSCHYK  1002

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK TA  LIS VP+SS S FL+ YLYYDL ERL  +G+L EALS+AK+A
Sbjct  1003  SSFRVDITIDEVKDTAEKLISRVPVSSHSVFLAGYLYYDLCERLTSNGRLIEALSFAKQA  1062

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
             ++LR  L    F       + +  L +F++   VATE W    +S + ESC L+PWNVL+
Sbjct  1063  HQLRSKLFQEKFSQKYTSGLSD--LQTFRL---VATEVWSFSTISWELESCDLSPWNVLR  1117

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S LQVG I+EM+GNG  A+ LL  GK IS +Q L LFIVSFS +LG++YCK+++W+
Sbjct  1118  CYLESTLQVGIIHEMIGNGTEAEALLCWGKMISSSQDLPLFIVSFSSMLGKLYCKKRIWD  1177

Query  722   laekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
             LAEKE   AK+ +VD+S+ +SC KCR + E +IDQ  GD+YR       EN + + L+ A
Sbjct  1178  LAEKELQTAKQVMVDSSADISCLKCRLILEATIDQQLGDLYRSHLDCTTENLSIKRLSFA  1237

Query  899   KEKYKSAVDKLALSEWNNFSGGPK--AVGSEHAKHESCSLSYSATDHMVLKEVASRNRKH  1072
             +  YKSA+DKL LSEW N    P+     S  ++++  +++  +T  +   ++ +++RK 
Sbjct  1238  ENLYKSALDKLNLSEWKNSVSSPEESCAASILSRNQLDAVTLFSTGEVTKVKMENKSRKA  1297

Query  1073  ENAVETI  1093
             + A + +
Sbjct  1298  KKASQIL  1304



>ref|XP_006491877.1| PREDICTED: separase-like isoform X3 [Citrus sinensis]
Length=2213

 Score =   250 bits (638),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 212/342 (62%), Gaps = 14/342 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +  L++  GE++ S E+W   L+ SQPLLVGFQQS   +FA SS      K
Sbjct  928   CISPVNDAFLVNLAEQCGELSKSIEFWMGCLRGSQPLLVGFQQSLLFLFANSSHGCYISK  987

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             + + P I+   VK  AS+LIS+VP++  S FL  YLYYDL ERLI +G+L EALSYAKEA
Sbjct  988   SSVQPCITIHDVKEAASELISSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAKEA  1047

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F    E  ++            +     FK   SVA+E W     S + 
Sbjct  1048  HRLRTQLFQEKFSYSVENSVKEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNV  1107

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             + C L+PWNVLQCYL S+LQVG I+E++GNG  A+  L  GK ISCTQSL  FIV+FS I
Sbjct  1108  DGCYLSPWNVLQCYLESVLQVGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSI  1167

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRK-QFCR  859
             LG++Y K+QLW+ AEKE   AK+ LV+ S  +SC KCR + EV++DQ  GD+ R    C 
Sbjct  1168  LGKLYRKKQLWDQAEKELKNAKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCD  1227

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE  985
             +  N+  + L+ A++ YKSA+DKL LSEW N    P+   SE
Sbjct  1228  DRGNTLIERLSNAEKLYKSALDKLNLSEWKNSISLPEEARSE  1269



>ref|XP_006491876.1| PREDICTED: separase-like isoform X2 [Citrus sinensis]
Length=2214

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 212/342 (62%), Gaps = 14/342 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +  L++  GE++ S E+W   L+ SQPLLVGFQQS   +FA SS      K
Sbjct  927   CISPVNDAFLVNLAEQCGELSKSIEFWMGCLRGSQPLLVGFQQSLLFLFANSSHGCYISK  986

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             + + P I+   VK  AS+LIS+VP++  S FL  YLYYDL ERLI +G+L EALSYAKEA
Sbjct  987   SSVQPCITIHDVKEAASELISSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAKEA  1046

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F    E  ++            +     FK   SVA+E W     S + 
Sbjct  1047  HRLRTQLFQEKFSYSVENSVKEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNV  1106

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             + C L+PWNVLQCYL S+LQVG I+E++GNG  A+  L  GK ISCTQSL  FIV+FS I
Sbjct  1107  DGCYLSPWNVLQCYLESVLQVGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSI  1166

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRK-QFCR  859
             LG++Y K+QLW+ AEKE   AK+ LV+ S  +SC KCR + EV++DQ  GD+ R    C 
Sbjct  1167  LGKLYRKKQLWDQAEKELKNAKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCD  1226

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE  985
             +  N+  + L+ A++ YKSA+DKL LSEW N    P+   SE
Sbjct  1227  DRGNTLIERLSNAEKLYKSALDKLNLSEWKNSISLPEEARSE  1268



>ref|XP_006491875.1| PREDICTED: separase-like isoform X1 [Citrus sinensis]
Length=2215

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 212/342 (62%), Gaps = 14/342 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +  L++  GE++ S E+W   L+ SQPLLVGFQQS   +FA SS      K
Sbjct  928   CISPVNDAFLVNLAEQCGELSKSIEFWMGCLRGSQPLLVGFQQSLLFLFANSSHGCYISK  987

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             + + P I+   VK  AS+LIS+VP++  S FL  YLYYDL ERLI +G+L EALSYAKEA
Sbjct  988   SSVQPCITIHDVKEAASELISSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAKEA  1047

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F    E  ++            +     FK   SVA+E W     S + 
Sbjct  1048  HRLRTQLFQEKFSYSVENSVKEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNV  1107

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             + C L+PWNVLQCYL S+LQVG I+E++GNG  A+  L  GK ISCTQSL  FIV+FS I
Sbjct  1108  DGCYLSPWNVLQCYLESVLQVGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSI  1167

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRK-QFCR  859
             LG++Y K+QLW+ AEKE   AK+ LV+ S  +SC KCR + EV++DQ  GD+ R    C 
Sbjct  1168  LGKLYRKKQLWDQAEKELKNAKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCD  1227

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE  985
             +  N+  + L+ A++ YKSA+DKL LSEW N    P+   SE
Sbjct  1228  DRGNTLIERLSNAEKLYKSALDKLNLSEWKNSISLPEEARSE  1269



>ref|XP_006431950.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
 gb|ESR45190.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
Length=1584

 Score =   248 bits (634),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 167/401 (42%), Positives = 235/401 (59%), Gaps = 36/401 (9%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +  L++  GE++ S E+W   L+ SQPLLVGFQQS   +FA SS      K
Sbjct  472   CISPVNDAFLVNLAEQCGELSKSIEFWMGCLQGSQPLLVGFQQSLLFLFANSSHGCYIRK  531

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             + + P I+ + VK  AS+LIS+VP++  S FL  YLYYDL ERLI +G+L EALSYA EA
Sbjct  532   SSVQPCITINDVKEAASELISSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAIEA  591

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F    E  ++            +     FK   SVA+E W     S + 
Sbjct  592   HRLRTQLFQEKFSYSVENSVKEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNV  651

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             + C L+PWNVLQCYL S+LQVG I+E++GNG  A+  L  GK ISCTQSL  FIV+FS I
Sbjct  652   DGCYLSPWNVLQCYLESVLQVGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSI  711

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRK-QFCR  859
             LG++Y K+QLW+ AEKE   AK+ LV+ S  +SC KCR + EV++DQ  GD+ R    C 
Sbjct  712   LGKLYRKKQLWDQAEKELKNAKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCD  771

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE------------------  985
             +  N+  + L+ A++ YKSA+DKL LSEW N    P+   SE                  
Sbjct  772   DRGNTLIERLSNAEKLYKSALDKLNLSEWKNSISLPEEARSESILPKKPSIQNVEHGAGN  831

Query  986   ---HAK-HESCSLSYSATDHMVLKEVASRNRKHENAVETIM  1096
                H+  H+  ++  +A + +  K   ++ RK +NA+++++
Sbjct  832   TSVHSTLHQPDTVELTARNQLSAKVGGTKCRKTKNALKSLV  872



>ref|XP_007225661.1| hypothetical protein PRUPE_ppa000043mg [Prunus persica]
 gb|EMJ26860.1| hypothetical protein PRUPE_ppa000043mg [Prunus persica]
Length=2170

 Score =   249 bits (636),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 233/387 (60%), Gaps = 28/387 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA P+NE  +  LS H GE + S E+W + LKES+PLL+ FQ +   +     +  CN++
Sbjct  883   CASPVNEAFIMNLSDHCGENSKSIEFWVDCLKESKPLLLAFQYNLSSVSPNFPRGSCNYE  942

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK  A +LIS+VP+ S SA+++ YLYYDL ERL+ +G+L EALSYAKEA
Sbjct  943   SSFRSDITIDEVKEAAFELISSVPVLSSSAYIAGYLYYDLCERLVSNGRLIEALSYAKEA  1002

Query  362   YRLRHALLNRNFLCHTEQQIENC-------RLVSFKICD-----SVATESWFCGDVSSDF  505
             Y+LR  L    F+  +EQ  + C         +++ I D     SVA+E W       D 
Sbjct  1003  YQLRAKLFREKFMYSSEQS-KTCNEAGGSGEKLTYHIQDMHMHISVASEFWSFDASLCDL  1061

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+PWNVLQCYL S LQ+G I+E++GN   A+  LQLGK ISC+QSL LFI+ FS +
Sbjct  1062  ERCYLSPWNVLQCYLESTLQIGVIHEIIGNRAGAEGFLQLGKAISCSQSLPLFIIVFSTV  1121

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K+QLW+ AEKE   AK+ L  +S+ +SC KCR + E +++Q  GD+++  F  N
Sbjct  1122  LGKLYHKQQLWDFAEKELQSAKQYLRASSTDISCLKCRLMLEATVNQNLGDLFQSMF-YN  1180

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVL  1042
               N++  +L+ A+  YKSA+ KL LSEW N    P     E    ES  L  +     +L
Sbjct  1181  TRNTSLDKLSLAENLYKSAIAKLNLSEWKNSVSCP-----EQGWVESTRLRKT-----IL  1230

Query  1043  KEV---ASRNRKHENAVETIMARKTKE  1114
             K+V   AS    H    +  + + T+E
Sbjct  1231  KDVGSCASSTFTHSEENQEDIGKPTRE  1257



>ref|XP_006431949.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
 gb|ESR45189.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
Length=2168

 Score =   249 bits (635),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 167/401 (42%), Positives = 235/401 (59%), Gaps = 36/401 (9%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +  L++  GE++ S E+W   L+ SQPLLVGFQQS   +FA SS      K
Sbjct  881   CISPVNDAFLVNLAEQCGELSKSIEFWMGCLQGSQPLLVGFQQSLLFLFANSSHGCYIRK  940

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             + + P I+ + VK  AS+LIS+VP++  S FL  YLYYDL ERLI +G+L EALSYA EA
Sbjct  941   SSVQPCITINDVKEAASELISSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAIEA  1000

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F    E  ++            +     FK   SVA+E W     S + 
Sbjct  1001  HRLRTQLFQEKFSYSVENSVKEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNV  1060

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             + C L+PWNVLQCYL S+LQVG I+E++GNG  A+  L  GK ISCTQSL  FIV+FS I
Sbjct  1061  DGCYLSPWNVLQCYLESVLQVGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSI  1120

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRK-QFCR  859
             LG++Y K+QLW+ AEKE   AK+ LV+ S  +SC KCR + EV++DQ  GD+ R    C 
Sbjct  1121  LGKLYRKKQLWDQAEKELKNAKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCD  1180

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE------------------  985
             +  N+  + L+ A++ YKSA+DKL LSEW N    P+   SE                  
Sbjct  1181  DRGNTLIERLSNAEKLYKSALDKLNLSEWKNSISLPEEARSESILPKKPSIQNVEHGAGN  1240

Query  986   ---HAK-HESCSLSYSATDHMVLKEVASRNRKHENAVETIM  1096
                H+  H+  ++  +A + +  K   ++ RK +NA+++++
Sbjct  1241  TSVHSTLHQPDTVELTARNQLSAKVGGTKCRKTKNALKSLV  1281



>gb|KDO41134.1| hypothetical protein CISIN_1g0001101mg, partial [Citrus sinensis]
Length=1462

 Score =   247 bits (630),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 167/401 (42%), Positives = 234/401 (58%), Gaps = 36/401 (9%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +  L++  GE++ S E+W   L+ SQPLLVGFQQS   +FA SS      K
Sbjct  873   CISPVNDAFLVNLAEQCGELSKSIEFWMGCLQGSQPLLVGFQQSLLFLFANSSHGCYISK  932

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             + + P I+   VK  AS+LIS+VP++  S FL  YLYYDL ERLI +G+L EALSYA EA
Sbjct  933   SSVQPCITIHDVKEAASELISSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAIEA  992

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F    E  ++            +     FK   SVA+E W     S + 
Sbjct  993   HRLRTQLFQEKFSYSVENSVKEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNV  1052

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             + C L+PWNVLQCYL S+LQVG I+E++GNG  A+  L  GK ISCTQSL  FIV+FS I
Sbjct  1053  DGCYLSPWNVLQCYLESVLQVGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSI  1112

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRK-QFCR  859
             LG++Y K+QLW+ AEKE   AK+ LV+ S  +SC KCR + EV++DQ  GD+ R    C 
Sbjct  1113  LGKLYRKKQLWDQAEKELKNAKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCD  1172

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE------------------  985
             +  N+  + L+ A++ YKSA+DKL LSEW N    P+   SE                  
Sbjct  1173  DRGNTLIERLSNAEKLYKSALDKLNLSEWKNSISLPEEARSESILPKKPSIQNVEHGAGN  1232

Query  986   ---HAK-HESCSLSYSATDHMVLKEVASRNRKHENAVETIM  1096
                H+  H+  ++  +A + +  K   ++ RK +NA+++++
Sbjct  1233  TFVHSTLHQPDTVELTARNQLSAKVGGTKCRKTKNALKSLV  1273



>ref|XP_008339285.1| PREDICTED: separase [Malus domestica]
Length=2217

 Score =   248 bits (632),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 229/385 (59%), Gaps = 21/385 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA P+NE  +  LS H GE++  + +W + LK+S PLL+ FQ SF  +F   S+ P NH+
Sbjct  922   CASPVNETFIMNLSDHCGELS-KYAFWIDSLKDSTPLLLXFQHSFSFLFPNFSRGPWNHQ  980

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D+VK  A +LIS  P+S+ SA+++ YLYYDLSERL+ +G+L EALSYAKEA
Sbjct  981   NLFRSDITIDEVKEAAFELISQAPVSTWSAYIAGYLYYDLSERLVSNGRLIEALSYAKEA  1040

Query  362   YRLRHALLNRNFLCHTEQQIEN------CRLVSFKICD-----SVATESWFCGDVSSDFE  508
             + LR  L    F+  +E+Q +       C+ +++ I D     SVA+E W     S D E
Sbjct  1041  HNLRAKLFGGKFMFSSERQPKKYNEGGICQELTYSIHDMHMQRSVASEVWLFDTSSCDLE  1100

Query  509   SCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCIL  688
             S  L+PWN LQCYL S LQVG I E++G G  A+  LQ GK  SC+QSL LF + FS +L
Sbjct  1101  SYYLSPWNALQCYLESTLQVGVILEIIGKGAEAZGFLQFGKAFSCSQSLPLFTIVFSTVL  1160

Query  689   GQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNP  865
             G++Y K+QLW+LAEKE   AK+     S+ +SC KCR L E +++Q  GD+Y+  F  N 
Sbjct  1161  GKLYHKQQLWDLAEKELQSAKQYFGXCSTDLSCMKCRLLLEATVNQNLGDLYQSIF-ENT  1219

Query  866   ENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSL---SYSATDHM  1036
              +++S +L+ A+  YKSA+  L LSEW N    P+    E       SL    Y A+   
Sbjct  1220  RSTSSDKLSHAENLYKSAIAILNLSEWKNSVSCPEEECVEWTMPGKASLKDVGYCASSIY  1279

Query  1037  VLKEVASRNRKHENAVETIMARKTK  1111
              + E     ++H+N   T    K+K
Sbjct  1280  TVSE----EKQHDNRKTTKEGLKSK  1300



>ref|XP_008361643.1| PREDICTED: separase-like [Malus domestica]
Length=2217

 Score =   248 bits (632),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 229/385 (59%), Gaps = 21/385 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA P+NE  +  LS H GE++  + +W + LK+S PLL+ FQ SF  +F   S+ P NH+
Sbjct  922   CASPVNETFIMNLSDHCGELS-KYAFWIDSLKDSTPLLLXFQHSFSFLFPNFSRGPWNHQ  980

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D+VK  A +LIS  P+S+ SA+++ YLYYDLSERL+ +G+L EALSYAKEA
Sbjct  981   NLFRSDITIDEVKEAAFELISQAPVSTWSAYIAGYLYYDLSERLVSNGRLIEALSYAKEA  1040

Query  362   YRLRHALLNRNFLCHTEQQIEN------CRLVSFKICD-----SVATESWFCGDVSSDFE  508
             + LR  L    F+  +E+Q +       C+ +++ I D     SVA+E W     S D E
Sbjct  1041  HNLRAKLFGGKFMFSSERQPKKYNEGGICQELTYSIHDMHMQRSVASEVWLFDTSSCDLE  1100

Query  509   SCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCIL  688
             S  L+PWN LQCYL S LQVG I E++G G  A+  LQ GK  SC+QSL LF + FS +L
Sbjct  1101  SYYLSPWNALQCYLESTLQVGVILEIIGKGAEAEGFLQFGKAFSCSQSLPLFTIVFSTVL  1160

Query  689   GQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNP  865
             G++Y K+QLW+LAEKE   AK+     S+ +SC KCR L E +++Q  GD+Y+  F  N 
Sbjct  1161  GKLYHKQQLWDLAEKELQSAKQYFGACSTDLSCMKCRLLLEATVNQNLGDLYQSIF-ENT  1219

Query  866   ENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSL---SYSATDHM  1036
              +++S +L+ A+  YKSA+  L LSEW N    P+    E       SL    Y A+   
Sbjct  1220  RSTSSDKLSHAENLYKSAIAILNLSEWKNSVSCPEEECVEWTMPGKASLKDVGYCASSIY  1279

Query  1037  VLKEVASRNRKHENAVETIMARKTK  1111
              + E     ++H+N   T    K+K
Sbjct  1280  TVSE----EKQHDNRKTTKEGLKSK  1300



>emb|CDO97522.1| unnamed protein product [Coffea canephora]
Length=2165

 Score =   238 bits (608),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 160/385 (42%), Positives = 227/385 (59%), Gaps = 18/385 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA PI+E  V  LS+H+G+V++   YW   ++ S  LLVGF+Q F     +S+Q     +
Sbjct  904   CASPISETLVSKLSQHYGKVSEFIGYWIKCMQPSHALLVGFKQRFFSTLPVSAQNSFELE  963

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    +I+DD++K  ASD   +VP SS   FLSA+LYYDLSERLI+ GQ+ EALSYA+EA
Sbjct  964   SL---EITDDEIKSVASDPTFHVPESSTGCFLSAHLYYDLSERLIMQGQVVEALSYAREA  1020

Query  362   YRLRHALLNRNFLCHTEQQIE-----------NC-RLVSFKICDSVATESWFCGDVSSDF  505
             Y+ R  LL   FL   + Q E           +C  L +F++ + VATE+W  G    DF
Sbjct  1021  YQCRTKLLREKFLYSVKNQAETNHENGDGTQKHCYSLENFQMHNLVATEAWNYG-APCDF  1079

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             ES  LT WN+LQCYL S LQV  I+E+LG    A+ LL  GKDI+  Q L LF++SF+ +
Sbjct  1080  ESFVLTSWNILQCYLESTLQVANIHEILGEALEAEALLLWGKDIAIRQCLPLFVISFTSM  1139

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K  LWELAE+E   A + + DN +++SC KCR L E +I Q  GD+Y+ + C N
Sbjct  1140  LGKLYHKRMLWELAERELKAASQLMADNCNMISCSKCRMLLECTIYQQLGDLYKSRLCSN  1199

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWN-NFSGGPKAVGSEHAKHESCSLSYSATDHMV  1039
               N + + L+ A EK++SA+ KL   EW+ + S  P A   +       S    + D + 
Sbjct  1200  MTNPSFEMLSYAVEKHRSALHKLNNFEWDYSTSCFPDATSEQDEYRTRSSFFSCSIDPLD  1259

Query  1040  LKEVASRNRKHENAVETIMARKTKE  1114
               E+ S+N   +   +    RKTK+
Sbjct  1260  TIELPSKNELPDRKTQMKRPRKTKK  1284



>ref|XP_007041565.1| Separase, putative [Theobroma cacao]
 gb|EOX97396.1| Separase, putative [Theobroma cacao]
Length=2198

 Score =   237 bits (605),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 157/388 (40%), Positives = 221/388 (57%), Gaps = 27/388 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +  LS+H GE + S ++W   L  SQP L+GFQQ+    F   + R   H+
Sbjct  919   CVSPVNEAFIATLSEHCGETSKSIDFWIGCLSGSQPGLLGFQQNLICFFNTFTHRFKTHE  978

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                   +  + VK   S+LIS+ P+ S S FL+ YLYYDL ER + SGQL E LSYAKEA
Sbjct  979   RDFKSAVPVNNVKQIVSELISSDPVRSHSLFLAGYLYYDLCERCVSSGQLFEGLSYAKEA  1038

Query  362   YRLRHALLNRNFLCHTEQQIENCR------LVSFKICD---------SVATESWFCGDVS  496
             ++LR  L  R F    E+Q+E C        ++ K+ +         +VA+E W     S
Sbjct  1039  FQLRSQLFKRKFAFSIEEQVEKCNETGDIGEIALKVINGPKDLQVQRTVASELWSFDSSS  1098

Query  497   SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
              D   C L+PWNVLQCYL S+LQVG INEM GNG  A+  L  GK ISC+QSL LF  +F
Sbjct  1099  WDLCGCYLSPWNVLQCYLESILQVGYINEMTGNGVEAETFLVWGKSISCSQSLPLFEATF  1158

Query  677   SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQF  853
             S +LG++Y K+QLW  AEKE   AK+ LV +SS  SC KCR + E+++DQ  GD++   F
Sbjct  1159  SSVLGKLYRKKQLWHFAEKELQSAKQILVGSSSYYSCIKCRLMLEINLDQQLGDLFCNLF  1218

Query  854   CRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDH  1033
                  N++ + L+ A+  YKSA++KL  SEW       K +  +    E+ ++  +  + 
Sbjct  1219  DSTIINNSKERLSHAEFLYKSALEKLNHSEW-------KRISFDEENDENITIKTTTINS  1271

Query  1034  MVLKEVASRNRKHE-NAVETIMARKTKE  1114
                ++VA     H  N  E + ARK+++
Sbjct  1272  ---EDVAGNAANHPANQPEAVGARKSRK  1296



>ref|XP_002529003.1| separase, putative [Ricinus communis]
 gb|EEF33373.1| separase, putative [Ricinus communis]
Length=2153

 Score =   236 bits (603),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 147/352 (42%), Positives = 206/352 (59%), Gaps = 19/352 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPC---  172
             C  P+ +  +  LS+ +GE   S  +W + LK S PLLVGFQQ+F  +F   +  PC   
Sbjct  877   CISPVYDELLMNLSRDYGEQFKSTGFWIHCLKASPPLLVGFQQNFSYLF---TSVPCSSG  933

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
             +H+     DI+ D VK  A +L+S  P++S S F +  LYYDL E+LI SG + EALSYA
Sbjct  934   DHETPFQSDITVDDVKQAALELVSRAPVTSCSIFFAGCLYYDLCEKLIASGHIFEALSYA  993

Query  353   KEAYRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVS  496
             KEA+RLR  L    F    EQQ E               + + ++  S+A + W+    S
Sbjct  994   KEAHRLRTKLFQEKFTYSVEQQTEKHIEVGDHSQKLTYAIRNLRVNKSIACKLWYSDGKS  1053

Query  497   SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
             SD E   L+PW +LQCYL S LQVGT++E++GNG  A+  L  GKDISC QSL LF+V+F
Sbjct  1054  SDEEVYYLSPWKILQCYLESTLQVGTVHEIVGNGGEAETFLLWGKDISCQQSLPLFVVAF  1113

Query  677   SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQF  853
             S +LG++Y K++ W+L++KE   AK+ L   SS  SC KCR + EV++DQ   D+ R   
Sbjct  1114  SSVLGKVYRKKRSWDLSQKELQSAKQNLESRSSAFSCLKCRLILEVTVDQQLADLSRNCI  1173

Query  854   CRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCS  1009
                  N + + L+ A+  YKS++DKL LSEW N +  P+ V        +CS
Sbjct  1174  FDAARNVSLERLSHAESLYKSSLDKLNLSEWKNSTSFPEKVDDGTTNKCACS  1225



>ref|XP_008218969.1| PREDICTED: separase [Prunus mume]
Length=2212

 Score =   235 bits (600),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 215/336 (64%), Gaps = 15/336 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA P+NE  +  LS H GE + S E+W + LK S+PLL+ FQ +F  +     +  CN++
Sbjct  926   CASPVNEAFIMNLSDHCGENSKSIEFWVDCLKGSKPLLLAFQYNFSSVSPNFPRGSCNYE  985

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+VK  A +LIS+VP+SS SA+++ YLYYDL ERL+ +G+L EALSYAKEA
Sbjct  986   SSFRSDITIDEVKEAAFELISSVPVSSSSAYIAGYLYYDLCERLVSNGRLIEALSYAKEA  1045

Query  362   YRLRHALLNRNFLCHTEQQIENC-------RLVSFKICD-----SVATESWFCGDVSSDF  505
             Y+LR  L    F+ ++ +Q + C         +++ I D     SVA E W       D 
Sbjct  1046  YQLRAKLFREKFM-YSAEQSKTCNEAGGSGEKLTYHIQDMHMHISVAREFWSFDASLCDL  1104

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+PWNVLQCYL S LQVG I+E++GN   A+  LQLGK ISC+QSL LFI+ FS +
Sbjct  1105  ERCYLSPWNVLQCYLESTLQVGVIHEIIGNRAEAEGFLQLGKAISCSQSLPLFIIVFSTV  1164

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K+QLW+ AEKE    K+ L  +S+ +SC KCR + E +++Q  GD+++  F  N
Sbjct  1165  LGKLYHKQQLWDFAEKELQSTKQYLGASSTDLSCLKCRLMLEATVNQNLGDLFQSMF-YN  1223

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPK  970
               N++ ++L  A+  YKSA+ KL LSEW N    P+
Sbjct  1224  TRNTSLEKLYLAENLYKSAIAKLNLSEWKNSVSCPE  1259



>ref|XP_010245920.1| PREDICTED: separase isoform X4 [Nelumbo nucifera]
Length=2193

 Score =   233 bits (595),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 208/348 (60%), Gaps = 23/348 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHM---IFALSSQRPC  172
             C  P++E  +   ++ +G   +S ++W + LKES+PLL+GFQQ F +   IF L S  P 
Sbjct  968   CISPVDEAFIVDFTEQYGVHCNSIDFWISCLKESKPLLIGFQQKFSLSSSIFPLRSHHP-  1026

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               K++L  +++ D+VK   SDL+S VP+   SAFL+ YL YDL+ERLI SG+L EALSYA
Sbjct  1027  --KSYLGIELTLDEVKEVVSDLMSRVPVPKHSAFLAGYLCYDLAERLISSGRLLEALSYA  1084

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESW--FCGD  490
             +EA  LR  LL   F+ ++ +Q  NC               +  I  SVATE W      
Sbjct  1085  REARSLRSKLLKEKFI-YSIEQTRNCSESGEATECHKYGHFNLAILGSVATEVWPGVTNS  1143

Query  491   VSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIV  670
              S D E C L+PWNVLQCYL S LQVG I E +GNG  A+ LL  GK ISC Q L+LF +
Sbjct  1144  ESWDMEDCILSPWNVLQCYLESTLQVGVIYEAIGNGAEAEALLLGGKSISCIQGLQLFNI  1203

Query  671   SFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRK  847
             +FS  LG+IY  ++ W+LAE E +  K+ LVD S+ +SCK C+   EVSIDQ   D+ R 
Sbjct  1204  AFSSTLGKIYHNKKHWDLAENELNICKQTLVDVSTTISCKQCKLALEVSIDQQIADLTRS  1263

Query  848   QFCRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHA  991
             +F    E S+ + L  A + YKS+++K+  SEW N    P  + +  A
Sbjct  1264  RF-SCTEQSSLKSLTFAIDLYKSSLEKINPSEWENSLSIPVNISTVEA  1310



>ref|XP_010245919.1| PREDICTED: separase isoform X3 [Nelumbo nucifera]
Length=2226

 Score =   233 bits (595),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 208/348 (60%), Gaps = 23/348 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHM---IFALSSQRPC  172
             C  P++E  +   ++ +G   +S ++W + LKES+PLL+GFQQ F +   IF L S  P 
Sbjct  959   CISPVDEAFIVDFTEQYGVHCNSIDFWISCLKESKPLLIGFQQKFSLSSSIFPLRSHHP-  1017

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               K++L  +++ D+VK   SDL+S VP+   SAFL+ YL YDL+ERLI SG+L EALSYA
Sbjct  1018  --KSYLGIELTLDEVKEVVSDLMSRVPVPKHSAFLAGYLCYDLAERLISSGRLLEALSYA  1075

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESW--FCGD  490
             +EA  LR  LL   F+ ++ +Q  NC               +  I  SVATE W      
Sbjct  1076  REARSLRSKLLKEKFI-YSIEQTRNCSESGEATECHKYGHFNLAILGSVATEVWPGVTNS  1134

Query  491   VSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIV  670
              S D E C L+PWNVLQCYL S LQVG I E +GNG  A+ LL  GK ISC Q L+LF +
Sbjct  1135  ESWDMEDCILSPWNVLQCYLESTLQVGVIYEAIGNGAEAEALLLGGKSISCIQGLQLFNI  1194

Query  671   SFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRK  847
             +FS  LG+IY  ++ W+LAE E +  K+ LVD S+ +SCK C+   EVSIDQ   D+ R 
Sbjct  1195  AFSSTLGKIYHNKKHWDLAENELNICKQTLVDVSTTISCKQCKLALEVSIDQQIADLTRS  1254

Query  848   QFCRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHA  991
             +F    E S+ + L  A + YKS+++K+  SEW N    P  + +  A
Sbjct  1255  RF-SCTEQSSLKSLTFAIDLYKSSLEKINPSEWENSLSIPVNISTVEA  1301



>ref|XP_010245918.1| PREDICTED: separase isoform X2 [Nelumbo nucifera]
Length=2234

 Score =   233 bits (595),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 208/348 (60%), Gaps = 23/348 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHM---IFALSSQRPC  172
             C  P++E  +   ++ +G   +S ++W + LKES+PLL+GFQQ F +   IF L S  P 
Sbjct  967   CISPVDEAFIVDFTEQYGVHCNSIDFWISCLKESKPLLIGFQQKFSLSSSIFPLRSHHP-  1025

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               K++L  +++ D+VK   SDL+S VP+   SAFL+ YL YDL+ERLI SG+L EALSYA
Sbjct  1026  --KSYLGIELTLDEVKEVVSDLMSRVPVPKHSAFLAGYLCYDLAERLISSGRLLEALSYA  1083

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESW--FCGD  490
             +EA  LR  LL   F+ ++ +Q  NC               +  I  SVATE W      
Sbjct  1084  REARSLRSKLLKEKFI-YSIEQTRNCSESGEATECHKYGHFNLAILGSVATEVWPGVTNS  1142

Query  491   VSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIV  670
              S D E C L+PWNVLQCYL S LQVG I E +GNG  A+ LL  GK ISC Q L+LF +
Sbjct  1143  ESWDMEDCILSPWNVLQCYLESTLQVGVIYEAIGNGAEAEALLLGGKSISCIQGLQLFNI  1202

Query  671   SFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRK  847
             +FS  LG+IY  ++ W+LAE E +  K+ LVD S+ +SCK C+   EVSIDQ   D+ R 
Sbjct  1203  AFSSTLGKIYHNKKHWDLAENELNICKQTLVDVSTTISCKQCKLALEVSIDQQIADLTRS  1262

Query  848   QFCRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHA  991
             +F    E S+ + L  A + YKS+++K+  SEW N    P  + +  A
Sbjct  1263  RF-SCTEQSSLKSLTFAIDLYKSSLEKINPSEWENSLSIPVNISTVEA  1309



>ref|XP_010245917.1| PREDICTED: separase isoform X1 [Nelumbo nucifera]
Length=2235

 Score =   233 bits (594),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 208/348 (60%), Gaps = 23/348 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHM---IFALSSQRPC  172
             C  P++E  +   ++ +G   +S ++W + LKES+PLL+GFQQ F +   IF L S  P 
Sbjct  968   CISPVDEAFIVDFTEQYGVHCNSIDFWISCLKESKPLLIGFQQKFSLSSSIFPLRSHHP-  1026

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               K++L  +++ D+VK   SDL+S VP+   SAFL+ YL YDL+ERLI SG+L EALSYA
Sbjct  1027  --KSYLGIELTLDEVKEVVSDLMSRVPVPKHSAFLAGYLCYDLAERLISSGRLLEALSYA  1084

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESW--FCGD  490
             +EA  LR  LL   F+ ++ +Q  NC               +  I  SVATE W      
Sbjct  1085  REARSLRSKLLKEKFI-YSIEQTRNCSESGEATECHKYGHFNLAILGSVATEVWPGVTNS  1143

Query  491   VSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIV  670
              S D E C L+PWNVLQCYL S LQVG I E +GNG  A+ LL  GK ISC Q L+LF +
Sbjct  1144  ESWDMEDCILSPWNVLQCYLESTLQVGVIYEAIGNGAEAEALLLGGKSISCIQGLQLFNI  1203

Query  671   SFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRK  847
             +FS  LG+IY  ++ W+LAE E +  K+ LVD S+ +SCK C+   EVSIDQ   D+ R 
Sbjct  1204  AFSSTLGKIYHNKKHWDLAENELNICKQTLVDVSTTISCKQCKLALEVSIDQQIADLTRS  1263

Query  848   QFCRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHA  991
             +F    E S+ + L  A + YKS+++K+  SEW N    P  + +  A
Sbjct  1264  RF-SCTEQSSLKSLTFAIDLYKSSLEKINPSEWENSLSIPVNISTVEA  1310



>ref|XP_011008695.1| PREDICTED: separase [Populus euphratica]
Length=2205

 Score =   233 bits (594),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 146/332 (44%), Positives = 197/332 (59%), Gaps = 21/332 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +       GE   S + W + LK S PLLVGFQQ+F  +F      P NHK
Sbjct  941   CVSPVNDALIMTSPGFSGEQFRSIDSWIHCLKGSPPLLVGFQQNFSYLFTNFHCDPDNHK  1000

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
              +   DI+ D VK  A  LIS+VP +S S F++ +LYYDL ERLI +G+L EALSYAKEA
Sbjct  1001  PY-KSDITVDDVKEAAFKLISSVPATSYSFFIAGHLYYDLCERLIANGRLFEALSYAKEA  1059

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F+   E+Q ENC             L   ++  S+A E W    +  D 
Sbjct  1060  HRLRTKLFKDKFMYTVEKQSENCTGAGSDMQKHTYGLSDVRMQKSIACEVWSFDTLPQDM  1119

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             ++C L+PW +LQCYL S LQVGTI+E++GNG  A+  L+ GKDISC+Q L LFIV+FS +
Sbjct  1120  DACYLSPWKILQCYLESTLQVGTIHELIGNGIEAEIFLRWGKDISCSQCLPLFIVAFSSV  1179

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++YC +  W+L+EKE   AK  LV   +  SC KC  + E +IDQ  GD+    F   
Sbjct  1180  LGKLYCNKGSWDLSEKELQNAKHVLVHGCADFSCLKCGLMLEATIDQQLGDLSHSLF---  1236

Query  863   PENSTS--QELACAKEKYKSAVDKLALSEWNN  952
               N+T   + L+ A+  Y+SA+D+L   EW N
Sbjct  1237  --NTTRSIERLSLAERLYRSALDRLGHPEWKN  1266



>ref|XP_002303173.2| hypothetical protein POPTR_0003s01610g [Populus trichocarpa]
 gb|EEE78152.2| hypothetical protein POPTR_0003s01610g [Populus trichocarpa]
Length=2202

 Score =   223 bits (569),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 194/332 (58%), Gaps = 21/332 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+N+  +       GE   S + W + LK S PLLVGFQ +F  +F      P N K
Sbjct  941   CVSPVNDALIMTSPGFSGEQFRSIDSWIHCLKGSPPLLVGFQHNFSYLFTNFHCDPDNQK  1000

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
              +   DI+ D VK  A  LIS+VP +S S F++ +LYYDL ERL+ +G+L EALSYAKEA
Sbjct  1001  PY-KSDITVDDVKEAAFKLISSVPATSYSFFIAGHLYYDLCERLLANGRLFEALSYAKEA  1059

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F+   E+Q ENC             L   ++  SVA E W    +  D 
Sbjct  1060  HRLRTKLFKEKFMYTVEKQSENCTGAGSDMQKNTYGLSDVRMQKSVACEVWSFDTLPQDM  1119

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             ++C L+PW +LQCYL S LQVGTI+E++GNG  A+  L+ GKDIS +Q L LFIV+FS +
Sbjct  1120  DACYLSPWKILQCYLESTLQVGTIHELIGNGIEAEIFLRWGKDISRSQCLPLFIVAFSSV  1179

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++YC +  W+L+EKE   AK  LV   +  SC KC  + E +IDQ  GD+    F   
Sbjct  1180  LGKLYCNKGSWDLSEKELRNAKHVLVHGCADFSCLKCGLMLEATIDQRLGDLSHSLF---  1236

Query  863   PENSTS--QELACAKEKYKSAVDKLALSEWNN  952
               N+T   + L+ A+  Y+SA+D+L   EW N
Sbjct  1237  --NTTRSIERLSLAESLYRSALDRLGHPEWKN  1266



>ref|XP_008445506.1| PREDICTED: separase isoform X1 [Cucumis melo]
Length=2177

 Score =   223 bits (567),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 194/334 (58%), Gaps = 15/334 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P NE  +  LS+H GE+  SFE WTN LK    +LVGFQQ+F  +    +Q  C  +
Sbjct  933   CTTPANEIVIAQLSEHLGELPKSFELWTNCLKTLPGMLVGFQQTFSFLCPNYTQSSCKRE  992

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               +   ++ D+VK  AS LIS++P  + S FL+ +LYYDL ERLI  G L EALS AKEA
Sbjct  993   KSVQLYVTIDEVKEAASKLISHIPACTSSIFLAGHLYYDLCERLISEGCLIEALSCAKEA  1052

Query  362   YRLRHALLNRNFLCHTEQQIE-NCRLV-----------SFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F+   EQ +E +C +            + +   S A + W    +S D 
Sbjct  1053  HRLRSKLFKEKFMYTVEQHLEKDCEMAYVSQKPAYGIKNLQKNRSAARDVWSFDKISWDV  1112

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+P+N+LQCYL S LQVG ++E++GNG+ A+ LL  GK ISC QSL LF V+FS  
Sbjct  1113  EGCYLSPFNILQCYLESTLQVGLVHEIIGNGSEAETLLMWGKSISCLQSLPLFEVAFSSA  1172

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW  ++KE   AK+ L D  S+ SC KCR + EV + Q  GD+ R  +   
Sbjct  1173  LGKLYRKKELWSSSQKELEGAKQILKD--SITSCLKCRLVLEVKVHQHLGDLSRDMYVNA  1230

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGG  964
                 + + L  A+  Y  A++KL LS W N   G
Sbjct  1231  KGIISEERLMNAEGFYNLALEKLNLSTWKNSISG  1264



>ref|XP_008445507.1| PREDICTED: separase isoform X2 [Cucumis melo]
Length=2177

 Score =   223 bits (567),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 194/334 (58%), Gaps = 15/334 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P NE  +  LS+H GE+  SFE WTN LK    +LVGFQQ+F  +    +Q  C  +
Sbjct  934   CTTPANEIVIAQLSEHLGELPKSFELWTNCLKTLPGMLVGFQQTFSFLCPNYTQSSCKRE  993

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               +   ++ D+VK  AS LIS++P  + S FL+ +LYYDL ERLI  G L EALS AKEA
Sbjct  994   KSVQLYVTIDEVKEAASKLISHIPACTSSIFLAGHLYYDLCERLISEGCLIEALSCAKEA  1053

Query  362   YRLRHALLNRNFLCHTEQQIE-NCRLV-----------SFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F+   EQ +E +C +            + +   S A + W    +S D 
Sbjct  1054  HRLRSKLFKEKFMYTVEQHLEKDCEMAYVSQKPAYGIKNLQKNRSAARDVWSFDKISWDV  1113

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+P+N+LQCYL S LQVG ++E++GNG+ A+ LL  GK ISC QSL LF V+FS  
Sbjct  1114  EGCYLSPFNILQCYLESTLQVGLVHEIIGNGSEAETLLMWGKSISCLQSLPLFEVAFSSA  1173

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW  ++KE   AK+ L D  S+ SC KCR + EV + Q  GD+ R  +   
Sbjct  1174  LGKLYRKKELWSSSQKELEGAKQILKD--SITSCLKCRLVLEVKVHQHLGDLSRDMYVNA  1231

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGG  964
                 + + L  A+  Y  A++KL LS W N   G
Sbjct  1232  KGIISEERLMNAEGFYNLALEKLNLSTWKNSISG  1265



>ref|XP_004144269.1| PREDICTED: uncharacterized protein LOC101203087 [Cucumis sativus]
Length=2142

 Score =   219 bits (559),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 194/334 (58%), Gaps = 15/334 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P NE  +  LS+H GE+  SFE WTN LK     LV FQQ+F  +    +Q  C H+
Sbjct  894   CTTPANEIVIAQLSEHLGELPKSFELWTNCLKTLPGTLVVFQQTFSFLCPNYTQSSCKHE  953

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               +   ++ D+VK  AS LIS++P  + S FL+ +LYYDL E+LI  G L EALS AKEA
Sbjct  954   KSVRLYVTVDEVKEAASKLISHIPACTSSIFLAGHLYYDLCEKLISEGCLIEALSCAKEA  1013

Query  362   YRLRHALLNRNFLCHTEQQIE-NCRLV-----------SFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F+   EQ +E +C +            + +   S A + W    +S D 
Sbjct  1014  HRLRSKLFKEKFIYTVEQHLEKDCEMAYISQKPAYGIKNLQKNRSAARDVWSFDKISWDV  1073

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+P+NVLQCYL S LQVG ++E++GNG+ A+ LL  GK ISC QSL LF V+FS  
Sbjct  1074  EGCYLSPFNVLQCYLESTLQVGLVHEIIGNGSEAETLLMWGKSISCLQSLPLFEVAFSSA  1133

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW LA+KE   AK+ L D  S+ SC KCR + EV + Q  GD+ R  +   
Sbjct  1134  LGKLYRKKELWSLAQKELERAKQILKD--SITSCLKCRLVLEVKVHQQLGDLSRDMYVNA  1191

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGG  964
                 + + L  A+  Y  A++KL LS W N   G
Sbjct  1192  KGIISEERLINAEGFYNLALEKLNLSTWKNSISG  1225



>ref|XP_004163947.1| PREDICTED: uncharacterized LOC101203087 [Cucumis sativus]
Length=2165

 Score =   219 bits (559),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 194/334 (58%), Gaps = 15/334 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P NE  +  LS+H GE+  SFE WTN LK     LV FQQ+F  +    +Q  C H+
Sbjct  933   CTTPANEIVIAQLSEHLGELPKSFELWTNCLKTLPGTLVVFQQTFSFLCPNYTQSSCKHE  992

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               +   ++ D+VK  AS LIS++P  + S FL+ +LYYDL E+LI  G L EALS AKEA
Sbjct  993   KSVRLYVTVDEVKEAASKLISHIPACTSSIFLAGHLYYDLCEKLISEGCLIEALSCAKEA  1052

Query  362   YRLRHALLNRNFLCHTEQQIE-NCRLV-----------SFKICDSVATESWFCGDVSSDF  505
             +RLR  L    F+   EQ +E +C +            + +   S A + W    +S D 
Sbjct  1053  HRLRSKLFKEKFIYTVEQHLEKDCEMAYISQKPAYGIKNLQKNRSAARDVWSFDKISWDV  1112

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+P+NVLQCYL S LQVG ++E++GNG+ A+ LL  GK ISC QSL LF V+FS  
Sbjct  1113  EGCYLSPFNVLQCYLESTLQVGLVHEIIGNGSEAETLLMWGKSISCLQSLPLFEVAFSSA  1172

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW LA+KE   AK+ L D  S+ SC KCR + EV + Q  GD+ R  +   
Sbjct  1173  LGKLYRKKELWSLAQKELERAKQILKD--SITSCLKCRLVLEVKVHQQLGDLSRDMYVNA  1230

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGG  964
                 + + L  A+  Y  A++KL LS W N   G
Sbjct  1231  KGIISEERLINAEGFYNLALEKLNLSTWKNSISG  1264



>ref|XP_010671406.1| PREDICTED: separase [Beta vulgaris subsp. vulgaris]
Length=2163

 Score =   216 bits (551),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 151/387 (39%), Positives = 218/387 (56%), Gaps = 19/387 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C +P+NE  V ALS+H+G+  +SF++W + +K+SQPLLVG QQ+F  + +L       +K
Sbjct  919   CVVPVNEAFVTALSEHYGKDAESFDFWISSMKDSQPLLVGLQQNFSYLSSLFPLAFYKNK  978

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               L  +IS D+VK  AS+L+SNV +S  SAF++ YLY+DLSERL   G+  EAL  AKEA
Sbjct  979   HSLQSEISVDEVKEIASNLVSNVSISRCSAFVAGYLYHDLSERLYTGGRTIEALFCAKEA  1038

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVS------------FKICDSVATESWFCGDVSSDF  505
             +RLR  LL  +F    +Q  EN   V             F + + VA  +W    +  D 
Sbjct  1039  HRLRGKLLQEHFSYSIQQHGENHEEVGDTIRKPSACVSQFTVLNHVAIRAWPTPAIPQDS  1098

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             ++  LTPWNVL+CYL S LQVG I+E LGN   A+    LGK ISC+QSL  FIVSFS  
Sbjct  1099  DAISLTPWNVLRCYLESTLQVGLIHERLGNVADAEAQFVLGKSISCSQSLPQFIVSFSSC  1158

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR-  859
             LG+IY    L++LA KE   +++ L  + + ++C +C  + E SI++  G++YRK   R 
Sbjct  1159  LGKIYHGSSLFDLAHKELETSEQVLAVDRNFLTCSRCSLMLESSINEQLGNLYRKGVYRA  1218

Query  860   --NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKH--ESCSLSYSAT  1027
               NP  S+   L  + EK   AV     S   +  G   A+ +E      + CS + S  
Sbjct  1219  SGNPYESSLLSLM-SFEKGDLAVWLQGASLAQSMHGNDVAIDAESGDRIDQECSAAISKP  1277

Query  1028  DHMVLKEVASRNRKHENAVETIMARKT  1108
                     A R+RK +  +E+++  K+
Sbjct  1278  AKTKAGAEAKRSRKTKKEIESLVTVKS  1304



>ref|XP_004295930.1| PREDICTED: uncharacterized protein LOC101294643 [Fragaria vesca 
subsp. vesca]
Length=2166

 Score =   216 bits (550),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 223/386 (58%), Gaps = 28/386 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C+ P+N+  V  LS HFGE+  S E+W + LK S+ L++GFQ +F  +FA    RPC  K
Sbjct  918   CSSPVNDTLVMNLSDHFGELPKSIEFWVDSLKGSRQLVIGFQHNFSFLFANVPGRPCIPK  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  +I+ D+VK  A +LIS+VP+SS S++++AYLYYDL ERL+ +GQL EALSYA EA
Sbjct  978   NLFRCEITVDEVKEAALELISSVPVSSQSSYVTAYLYYDLCERLVSNGQLVEALSYAMEA  1037

Query  362   YRLRHALLNRNFLCHTEQQIENCRLVS-----FKICD-------SVATESWFCGDVSSDF  505
             ++LR  L  + F     Q+ E           F + D       SV+ E W     S + 
Sbjct  1038  HQLRRELFQKKFAYCFVQKTEKYNETGDTYQKFTLNDHNLVLQRSVSREVWSFDTSSCNL  1097

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C L+P+NVLQCYL S LQVG I+E++GNG  A+  LQ GK ISC+QSL LF V+F  +
Sbjct  1098  EKCYLSPYNVLQCYLESTLQVGVIHEIIGNGAEAEVHLQWGKTISCSQSLPLFTVAFCSV  1157

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K+QLW+LAEKE   AK+ L  +   +SC KCR + E +++    D+Y+++   +
Sbjct  1158  LGKLYLKKQLWDLAEKELQSAKQYLDASEKDISCLKCRLMQEATVELNLADLYQRKL-YS  1216

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGP-----KAVGSEHAKHESCSLSYSAT  1027
               +++ ++ +CA+  Y SA+ KL L EW N    P     K VG+            S +
Sbjct  1217  SRSASLEKPSCAESLYNSALTKLNLPEWKNSVSCPGLTVLKEVGNSGG---------STS  1267

Query  1028  DHMVLKEVASRNRKHENAVETIMARK  1105
              H    +V  + +       T  ARK
Sbjct  1268  SHFAETKVEPKGKIEAKKSRTKNARK  1293



>emb|CDX94142.1| BnaC07g37760D [Brassica napus]
Length=2176

 Score =   212 bits (539),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 197/333 (59%), Gaps = 22/333 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI---FALSSQRPC  172
             C  PI++  +  LS+++G+ +   ++W + LK+S+  L+GFQQ+FH++   F  SS++  
Sbjct  893   CPSPISDAFILGLSENWGDKSTCIDFWIDCLKDSKARLIGFQQNFHVLQNDFLRSSKKDK  952

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
              H      DI+ D +   AS+LIS+  LS  S+F +AYLYYDLSERLI  G+L+EALSYA
Sbjct  953   GH---FHSDITIDDITDAASELISSASLSGQSSFTAAYLYYDLSERLISFGKLSEALSYA  1009

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVS  496
             KEAYR+R  L    F    E+Q E               +  F++  S+AT  W CG+ S
Sbjct  1010  KEAYRIRTLLFQEKFKYTAEKQFEKYNDAGKISEIRSYSITDFQVYRSLATNFWPCGNFS  1069

Query  497   SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
              D   C L+ WNVLQCYL S LQVG  NE++GNG  A+ LL  GK ISC+QSL  F+V+F
Sbjct  1070  WDINHCYLSRWNVLQCYLESTLQVGIANELIGNGLEAESLLSWGKAISCSQSLFPFVVAF  1129

Query  677   SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQF  853
             S  LG  Y K+Q  +LAEKE   AK+ LV N    SC KC+   EV++D+  GDI R Q 
Sbjct  1130  SSALGIFYHKKQSLDLAEKEIQNAKEILVTNQREFSCIKCKLRVEVTLDKQLGDISRTQI  1189

Query  854   CRNPENSTSQELACAKEKYKSAVDKLALSEWNN  952
              R    S +     A+  + +A+ K+  S W +
Sbjct  1190  DR---VSQTDGFLHAESLFSAALGKICCSAWKS  1219



>ref|XP_006413594.1| hypothetical protein EUTSA_v10024187mg [Eutrema salsugineum]
 gb|ESQ55047.1| hypothetical protein EUTSA_v10024187mg [Eutrema salsugineum]
Length=2189

 Score =   211 bits (538),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 197/332 (59%), Gaps = 18/332 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI--FALSSQRPCN  175
             C  PI++  + ALS++ G+ +   ++W + LK+S+  L+GFQQ+FH +  F  +S +   
Sbjct  915   CPSPISDVFILALSENCGDRSTCIDFWIDCLKDSKAKLIGFQQNFHDLHDFLRTSNKV--  972

Query  176   HKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAK  355
              K+    DI+ D +   AS+LIS+  LS  S+F +AYLYYDL ERLI  G+L+EALSYAK
Sbjct  973   -KSPFQSDITIDGITDAASELISSASLSGPSSFFAAYLYYDLCERLISFGKLSEALSYAK  1031

Query  356   EAYRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSS  499
             EAYR+R  +    F    E+Q E               + +F++  SVAT+ W CG+   
Sbjct  1032  EAYRIRTLIFQEKFKYTAEKQFEKHNDAGKISEIRTFSITNFQVFKSVATDFWPCGNFLW  1091

Query  500   DFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFS  679
             D     L+ WNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+FS
Sbjct  1092  DINRSYLSRWNVLQCYLESTLQVGIVNELIGNGGEAETLLSWGKAISCSQSLFPFVVAFS  1151

Query  680   CILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFC  856
               LG +Y K+Q  +LAEKE   AK+ ++ N    SC KC+   EV++D+  GDI RKQ  
Sbjct  1152  SALGNLYHKKQSLDLAEKELQNAKEIIIANQREFSCVKCKLRLEVTLDKQLGDISRKQIV  1211

Query  857   RNPENSTSQELACAKEKYKSAVDKLALSEWNN  952
                  S +     A+  + +A+ K+  S W +
Sbjct  1212  NAARVSETDGFLHAESLFSAALGKICCSAWQS  1243



>ref|XP_008776341.1| PREDICTED: separase [Phoenix dactylifera]
Length=1832

 Score =   210 bits (534),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 208/348 (60%), Gaps = 27/348 (8%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQ-RPCNH  178
            C+ PI+E  +  +SK+ G   DSF+YW N  K   P L  FQQ+  +  ++  +   C  
Sbjct  535  CSSPISEDFILDMSKNPGVNADSFDYWINCTKSHPPSLCMFQQNLSLTNSVFPEVSGCTE  594

Query  179  KAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKE  358
            ++F    I+ D+VK  AS L  +VPL + SAF++ YLYYDLSERL  SG+++EALSYA+E
Sbjct  595  RSF-GSQITVDEVKKVASSLTVDVPLPAQSAFIAGYLYYDLSERLFSSGRISEALSYARE  653

Query  359  AYRLRHALLNRNFLCHTEQQ----IENCRL-------VSFKICDSVATESW---FCGDVS  496
            A+RLR  LL R F+   E+Q    I + R+       +  +   SV TE W   F    S
Sbjct  654  AFRLRKKLLQRKFIYSVEKQSAKSIGSARVTQSGHDHICLEAMGSVITEVWPDIFKSGNS  713

Query  497  SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
             DF    LTPW++L CYL S+LQVG I+E +GNG  A++L Q GK IS  Q L +  ++F
Sbjct  714  GDF---ILTPWSILGCYLESILQVGIIHESMGNGTEAENLFQRGKGISSLQGLPILEIAF  770

Query  677  SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQF  853
            + +LGQ+Y ++QLW+LAE E + A+  L  N  ++SCK C+  +EV+ID   GD++R  F
Sbjct  771  TSLLGQLYRRKQLWDLAETEFNNARTLLAKNDMIISCKHCKLAFEVTIDMQIGDLFRNLF  830

Query  854  CRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKH  997
             +  +  +++ L+ A + Y+SA+ KL  +E  ++        +E AKH
Sbjct  831  DKGLKIESTKSLSDALDLYRSALKKLNRAESCSYP-------TEDAKH  871



>ref|XP_010068188.1| PREDICTED: separase [Eucalyptus grandis]
Length=2225

 Score =   210 bits (534),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 136/324 (42%), Positives = 193/324 (60%), Gaps = 14/324 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI+E  +  LS+  GE+  S ++W   LKESQPLLVGFQ     +  L  +  C  +
Sbjct  939   CFSPISEAFITVLSEQRGEIFKSMDHWMCCLKESQPLLVGFQNILSSLLPLYCKESCC-E  997

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               L P I  D VK  A  L+S+VPLS+ + +L+ +L+YDLSER+ILSG L EAL +AKE+
Sbjct  998   ITLEPYIGGDLVKEAAVGLLSSVPLSTRAVYLAGFLHYDLSERMILSGCLHEALLFAKES  1057

Query  362   YRLRHALLNRNFLCHTEQ-----------QIENCRLVSFKICDSVATESWFCGDVSSDFE  508
             + LR  L    F    EQ           Q  N  L S  +  + A E W     S + E
Sbjct  1058  HELRTRLFQEKFTYSVEQTQKHGESGEFAQKHNYSLRSLHVSKTEAAEVWSFDSNSFNVE  1117

Query  509   SCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCIL  688
             SC L+PWN++Q YL S LQVGTI E++GNG  A+  L  GK+IS  Q L  F V+FS +L
Sbjct  1118  SCYLSPWNIMQGYLESTLQVGTILELIGNGTEAETFLLWGKNISQLQDLPQFDVAFSAVL  1177

Query  689   GQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNP  865
             G+IYC+++ W++A KE   A+++L+D  ++ SC KCR L E ++D   GD+ R Q   + 
Sbjct  1178  GKIYCRKRCWDMASKELETARQSLMDCGAIFSCSKCRLLLEATVDLQLGDLVRAQS-DDS  1236

Query  866   ENSTSQELACAKEKYKSAVDKLAL  937
              + ++ +L  A+E Y+ A+D+LAL
Sbjct  1237  SSVSADKLTHAEELYQLALDRLAL  1260



>emb|CDX98781.1| BnaA03g45660D [Brassica napus]
Length=2152

 Score =   209 bits (531),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 197/333 (59%), Gaps = 22/333 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI---FALSSQRPC  172
             C  PI++  + +LS+++G+ +   ++W + LK+S+  L+GFQQ+FH +   F  SS++  
Sbjct  900   CPSPISDAFILSLSENWGDKSTCIDFWIDCLKDSKARLIGFQQNFHDLQNDFLRSSKK--  957

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               K     DI+ D +   AS+L+S+  LS  S+F +AYLYYDLSERLI  G+L+EAL YA
Sbjct  958   -DKGPFHSDITIDDITDAASELVSSASLSGQSSFTAAYLYYDLSERLISFGKLSEALLYA  1016

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVS  496
             KEAYR+R  L    F    E+Q E               +  F++  S+AT+ W CG+ S
Sbjct  1017  KEAYRIRTLLFQEKFKYTAEKQFEKYNDAGKISEIRSYSITDFEVYRSLATDFWPCGNFS  1076

Query  497   SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
              D   C L+ WNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+F
Sbjct  1077  WDINHCYLSRWNVLQCYLESTLQVGIVNELIGNGLEAESLLSWGKAISCSQSLFPFVVAF  1136

Query  677   SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQF  853
             S  LG  Y K+Q  +LAEKE    K+ LV N    SC KC+   EV++D+  GDI R Q 
Sbjct  1137  SSALGNFYLKKQSLDLAEKEIQNGKEILVTNQREFSCVKCKLKLEVTLDKQLGDISRIQM  1196

Query  854   CRNPENSTSQELACAKEKYKSAVDKLALSEWNN  952
              R    S +     A+  + +A+ K+  S W +
Sbjct  1197  DR---ISQTDGFLHAESLFSAALGKICCSGWKS  1226



>ref|XP_009137707.1| PREDICTED: separase-like [Brassica rapa]
Length=2170

 Score =   208 bits (530),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 197/333 (59%), Gaps = 22/333 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI---FALSSQRPC  172
             C  PI++  + +LS+++G+ +   ++W + LK+S+  L+GFQQ+FH +   F  SS++  
Sbjct  894   CPSPISDAFILSLSENWGDKSTCIDFWIDCLKDSKARLIGFQQNFHDLQNDFLRSSKK--  951

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               K     DI+ D +   AS+L+S+  LS  S+F +AYLYYDLSERLI  G+L+EAL YA
Sbjct  952   -DKGPFHSDITIDDITDAASELVSSASLSGQSSFTAAYLYYDLSERLISFGKLSEALLYA  1010

Query  353   KEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVS  496
             KEAYR+R  L    F    E+Q E               +  F++  S+AT+ W CG+ S
Sbjct  1011  KEAYRIRTLLFQEKFKYTAEKQFEKYNDAGKISEIRSYSITDFEVYRSLATDFWPCGNFS  1070

Query  497   SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
              D   C L+ WNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+F
Sbjct  1071  WDINHCYLSRWNVLQCYLESTLQVGIVNELIGNGLEAESLLSWGKAISCSQSLFPFVVAF  1130

Query  677   SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQF  853
             S  LG  Y K+Q  +LAEKE    K+ LV N    SC KC+   EV++D+  GD+ R Q 
Sbjct  1131  SSALGNFYLKKQSLDLAEKEIQNGKEILVTNQREFSCVKCKLKLEVTLDKQLGDVSRIQM  1190

Query  854   CRNPENSTSQELACAKEKYKSAVDKLALSEWNN  952
              R    S +     A+  + +A+ K+  S W +
Sbjct  1191  DR---ISQTDGFLHAESLFSAALGKICCSAWKS  1220



>gb|KFK39266.1| hypothetical protein AALP_AA3G222100 [Arabis alpina]
Length=2167

 Score =   206 bits (524),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 200/336 (60%), Gaps = 21/336 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI---FALSSQRPC  172
             C  PI++  +  LS++ GE +   ++W + LK+S+  L+GFQQ+FH +   F  +S +  
Sbjct  883   CPSPISDAFILNLSENCGEKSRCIDFWIDCLKDSKAKLIGFQQNFHDLHNDFLCTSNK--  940

Query  173   NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
               +     DI+ D++K  AS+LIS+  +S  S+F +AYLYYDL ERLI  G+L+EALS+A
Sbjct  941   -DEGPFHSDITIDEIKDAASELISSASVSGHSSFEAAYLYYDLCERLISFGKLSEALSFA  999

Query  353   KEAYRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVS  496
             KEAYR+R  +    F    E+Q E               + +F++  S AT+ W CG+  
Sbjct  1000  KEAYRIRTLIFKDKFKYTAEKQFEKHNDAGKISEIRTFSIKNFQVFKSPATDFWPCGNFL  1059

Query  497   SDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSF  676
              D   C L+PWNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+F
Sbjct  1060  WDISRCYLSPWNVLQCYLESTLQVGIVNELIGNGLEAETLLSWGKAISCSQSLFPFVVAF  1119

Query  677   SCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQF  853
             S  LG +Y K Q+ +LAEKE   AK  ++ N    SC KC+  ++V++D+  GDI RKQ 
Sbjct  1120  SSALGNLYHKRQILDLAEKELQNAKDIIIANQREFSCVKCKLKFQVTLDKQLGDISRKQM  1179

Query  854   CRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSG  961
               +    +  +   A+  + +A+ K+  S W +  G
Sbjct  1180  --DDARVSQTDALHAESLFSAALGKICCSAWKSCIG  1213



>emb|CDY10832.1| BnaC01g14470D [Brassica napus]
Length=2165

 Score =   205 bits (521),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 193/331 (58%), Gaps = 16/331 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI+   + +LS++ G+ +   ++W + LK+S+  L+GFQQ+FH ++    +     K
Sbjct  881   CPSPISNAFILSLSENCGDKSTCMDFWIDCLKDSKAKLIGFQQNFHELYNDFLRTSVKDK  940

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +   AS+LIS+  LS  S+F++AYLYYDL ERL+  G+L+EALSYAKEA
Sbjct  941   GPFQSDITIDDITDAASELISSASLSGHSSFVAAYLYYDLCERLMSFGKLSEALSYAKEA  1000

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  L    +    E+Q+E               + +F++  S+AT+ W CGD S D 
Sbjct  1001  YRIRTLLFQEKYKYTAEKQLEKHNDAGKISEIRTYSITNFEVYRSLATDFWPCGDFSWDI  1060

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+ WNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+FS  
Sbjct  1061  NRCYLSRWNVLQCYLESTLQVGIVNELIGNGLEAESLLSWGKAISCSQSLFPFVVAFSSA  1120

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG  Y K Q  +LAEKE    K+ L  N    SC KC+   EV++D+  G+I RK+  R 
Sbjct  1121  LGTFYHKRQSLDLAEKELQNVKEILNANKRDFSCGKCKLKLEVTLDKQIGEISRKKLER-  1179

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNF  955
                S +     A+    +A+ K+    W +F
Sbjct  1180  --VSQTDGFLHAEGLLTAALGKICCPAWKSF  1208



>ref|XP_010433961.1| PREDICTED: separase-like [Camelina sativa]
Length=1387

 Score =   201 bits (511),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 134/328 (41%), Positives = 194/328 (59%), Gaps = 16/328 (5%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  108  CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNYLRASNKDE  167

Query  182  AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                 DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  168  GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  227

Query  362  YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
            YR+R  + ++ F    E+Q E               + +F++   VATE W CG+   D 
Sbjct  228  YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGIKNFQVYGWVATEFWPCGNFLWDV  287

Query  506  ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
              C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  288  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFSVAFSSA  347

Query  686  LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
            LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV++D+  GDI RK+  R 
Sbjct  348  LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCVKCKLKLEVTLDKQLGDISRKKIDR-  406

Query  863  PENSTSQELACAKEKYKSAVDKLALSEW  946
               S +     A+  + +A+ K+  S W
Sbjct  407  --ASQTDGFLHAESLFSTALGKVCCSAW  432



>ref|XP_003547059.2| PREDICTED: separase-like [Glycine max]
Length=2186

 Score =   201 bits (512),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 146/388 (38%), Positives = 214/388 (55%), Gaps = 23/388 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F E+++  ++W  YL+ +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  903   CVSPVNEEFIMNSLDEFSELSN-IDFWIRYLQGNQSSLIGFQQNFSFLFASSHRNSCSHG  961

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+V+  A DLISNVP+ S S FL+  L+YDL  RL+ +GQL EALS AKEA
Sbjct  962   SSFQTDITIDEVQKAALDLISNVPVPSHSTFLAGCLFYDLCPRLVANGQLIEALSSAKEA  1021

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV---SFKICD---------SVATESWFCGDVSSDF  505
             +RL   L  R F  + +QQ E   ++   S  + D         SVA E      +S D 
Sbjct  1022  HRLHAKLFQRKFTHNVQQQNEEKNVMVDSSKNLMDGVENIGLNLSVAREVLLFDSISWDL  1081

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             +   L+ W V+QCYL S LQ+G I+EM+G+G  A+  L+ GK ISC+  L  FI+ FS  
Sbjct  1082  KDSYLSAWKVMQCYLESTLQLGIIHEMIGDGAEAETYLKWGKAISCSLKLPFFIIIFSSS  1141

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW+LAEKE   A++ L ++++   C KC+   EV++ +  GD+ + +F   
Sbjct  1142  LGKLYLKKRLWDLAEKELLSAEQILKESNTPFCCSKCKLKLEVTLYEYLGDLCQSKF-DT  1200

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVL  1042
              +   S+E   AK  Y SA+DKL LSEW N    P+      A    C    + T   ++
Sbjct  1201  CDGVMSEE--TAKNWYTSALDKLNLSEWKNPLSCPEDGSDGTATDIKCPAGKTCT-CFIM  1257

Query  1043  KEVASRNRK-----HENAVETIMARKTK  1111
              EV    +K      E  +     RKTK
Sbjct  1258  NEVGESVKKSMKAGRETEIGAKQNRKTK  1285



>gb|KHN33472.1| Separin [Glycine soja]
Length=2111

 Score =   201 bits (512),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 146/388 (38%), Positives = 214/388 (55%), Gaps = 23/388 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F E+++  ++W  YL+ +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  902   CVSPVNEEFIMNSLDEFSELSN-IDFWIRYLQGNQSSLIGFQQNFSFLFASSHRNSCSHG  960

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+V+  A DLISNVP+ S S FL+  L+YDL  RL+ +GQL EALS AKEA
Sbjct  961   SSFQTDITIDEVQKAALDLISNVPVPSHSTFLAGCLFYDLCPRLVANGQLIEALSSAKEA  1020

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV---SFKICD---------SVATESWFCGDVSSDF  505
             +RL   L  R F  + +QQ E   ++   S  + D         SVA E      +S D 
Sbjct  1021  HRLHAKLFQRKFTHNVQQQNEEKNVMVDSSKNLMDGVENIGLNLSVAREVLLFDSISWDL  1080

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             +   L+ W V+QCYL S LQ+G I+EM+G+G  A+  L+ GK ISC+  L  FI+ FS  
Sbjct  1081  KDSYLSAWKVMQCYLESTLQLGIIHEMIGDGAEAETYLKWGKAISCSLKLPFFIIIFSSS  1140

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW+LAEKE   A++ L ++++   C KC+   EV++ +  GD+ + +F   
Sbjct  1141  LGKLYLKKRLWDLAEKELLSAEQILKESNTPFCCSKCKLKLEVTLYEYLGDLCQSKF-DT  1199

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVL  1042
              +   S+E   AK  Y SA+DKL LSEW N    P+      A    C    + T   ++
Sbjct  1200  CDGVMSEE--TAKNWYTSALDKLNLSEWKNPLSCPEDGSDGTATDIKCPAGKTCT-CFIM  1256

Query  1043  KEVASRNRK-----HENAVETIMARKTK  1111
              EV    +K      E  +     RKTK
Sbjct  1257  NEVGESVKKSMKAGRETEIGAKQNRKTK  1284



>ref|XP_010445194.1| PREDICTED: separase-like [Camelina sativa]
Length=1974

 Score =   201 bits (512),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 195/330 (59%), Gaps = 16/330 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  695   CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNYLRASNKDE  754

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  755   GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  814

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  + ++ F    E+Q E               + +F++   VATE W CG+   D 
Sbjct  815   YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGIKNFQVYGWVATEFWPCGNFLWDV  874

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  875   NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFSVAFSSA  934

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV++D+  GDI RK+  R 
Sbjct  935   LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCVKCKLKLEVTLDKQLGDISRKKIDR-  993

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  994   --ASQTDGFLHAESLFSTALGKVCCSAWKS  1021



>ref|XP_009136537.1| PREDICTED: separase isoform X2 [Brassica rapa]
Length=2188

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 182/299 (61%), Gaps = 13/299 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI+   + +LS++ G+ +   ++W + LK+S+  L+GFQQ+FH ++    +     K
Sbjct  909   CPSPISNAFILSLSENCGDKSTCMDFWIDCLKDSKAKLIGFQQNFHDLYNDFLRASVKDK  968

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +   AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  969   GPFQSDITIDDITDAASELISSASLSGHSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1028

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  L    +    E+Q+E               + +F++  S+AT+ W CG+ S D 
Sbjct  1029  YRIRTLLFQEKYKYTAEKQLEKHNDAGKISEIRTYSITNFQVYRSLATDFWPCGNFSWDI  1088

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+ W VLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+FS  
Sbjct  1089  NRCYLSCWKVLQCYLESTLQVGIVNELIGNGLEAESLLSWGKAISCSQSLFPFVVAFSSA  1148

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR  859
             LG  Y K+Q  +LAEKE   AK+ L  N    SC KC+   EV++D+  G+I RK+  R
Sbjct  1149  LGTFYHKKQSLDLAEKELQNAKEILNANKRDFSCGKCKLKLEVTLDKQLGEISRKKLER  1207



>ref|XP_009136528.1| PREDICTED: separase isoform X1 [Brassica rapa]
Length=2189

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 182/299 (61%), Gaps = 13/299 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI+   + +LS++ G+ +   ++W + LK+S+  L+GFQQ+FH ++    +     K
Sbjct  909   CPSPISNAFILSLSENCGDKSTCMDFWIDCLKDSKAKLIGFQQNFHDLYNDFLRASVKDK  968

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +   AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  969   GPFQSDITIDDITDAASELISSASLSGHSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1028

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  L    +    E+Q+E               + +F++  S+AT+ W CG+ S D 
Sbjct  1029  YRIRTLLFQEKYKYTAEKQLEKHNDAGKISEIRTYSITNFQVYRSLATDFWPCGNFSWDI  1088

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+ W VLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+FS  
Sbjct  1089  NRCYLSCWKVLQCYLESTLQVGIVNELIGNGLEAESLLSWGKAISCSQSLFPFVVAFSSA  1148

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR  859
             LG  Y K+Q  +LAEKE   AK+ L  N    SC KC+   EV++D+  G+I RK+  R
Sbjct  1149  LGTFYHKKQSLDLAEKELQNAKEILNANKRDFSCGKCKLKLEVTLDKQLGEISRKKLER  1207



>ref|XP_010448795.1| PREDICTED: separase isoform X1 [Camelina sativa]
Length=2197

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 194/330 (59%), Gaps = 16/330 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  918   CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  978   GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1037

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  + ++ F    E+Q E               L +F++   VAT+ W CG+   D 
Sbjct  1038  YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGLKNFQVYGWVATDFWPCGNFLWDV  1097

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  1098  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFAVAFSSA  1157

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV +D+  GDI RK+  R 
Sbjct  1158  LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCLKCKLKLEVQLDKQLGDISRKKVDR-  1216

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1217  --VSQTDGFLHAESLFSTALGKVCCSAWKS  1244



>emb|CDY41265.1| BnaA01g12740D [Brassica napus]
Length=2139

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 182/299 (61%), Gaps = 13/299 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI+   + +LS++ G+ +   ++W + LK+S+  L+GFQQ+FH ++    +     K
Sbjct  882   CPSPISNAFILSLSENCGDKSTCMDFWIDCLKDSKAKLIGFQQNFHDLYNDFLRASVKDK  941

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +   AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  942   GPFQSDITIDDITDAASELISSASLSGHSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1001

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  L    +    E+Q+E               + +F++  S+AT+ W CG+ S D 
Sbjct  1002  YRIRTLLFQEKYKYTAEKQLEKHNDAGKISEIRTYSITNFQVYRSLATDFWPCGNFSWDI  1061

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+ W VLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+FS  
Sbjct  1062  NRCYLSCWKVLQCYLESTLQVGIVNELIGNGLEAESLLSWGKAISCSQSLFPFVVAFSSA  1121

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR  859
             LG  Y K+Q  +LAEKE   AK+ L  N    SC KC+   EV++D+  G+I RK+  R
Sbjct  1122  LGTFYHKKQSLDLAEKELQNAKEILNANKRDFSCGKCKLKLEVTLDKQLGEISRKKLER  1180



>ref|XP_010448796.1| PREDICTED: separase isoform X2 [Camelina sativa]
Length=2194

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 194/330 (59%), Gaps = 16/330 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  918   CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  978   GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1037

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  + ++ F    E+Q E               L +F++   VAT+ W CG+   D 
Sbjct  1038  YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGLKNFQVYGWVATDFWPCGNFLWDV  1097

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  1098  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFAVAFSSA  1157

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV +D+  GDI RK+  R 
Sbjct  1158  LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCLKCKLKLEVQLDKQLGDISRKKVDR-  1216

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1217  --VSQTDGFLHAESLFSTALGKVCCSAWKS  1244



>ref|XP_010448800.1| PREDICTED: separase isoform X5 [Camelina sativa]
Length=1783

 Score =   199 bits (506),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 194/330 (59%), Gaps = 16/330 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  918   CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  978   GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1037

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  + ++ F    E+Q E               L +F++   VAT+ W CG+   D 
Sbjct  1038  YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGLKNFQVYGWVATDFWPCGNFLWDV  1097

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  1098  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFAVAFSSA  1157

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV +D+  GDI RK+  R 
Sbjct  1158  LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCLKCKLKLEVQLDKQLGDISRKKVDR-  1216

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1217  --VSQTDGFLHAESLFSTALGKVCCSAWKS  1244



>ref|XP_010448798.1| PREDICTED: separase isoform X3 [Camelina sativa]
Length=2185

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 194/330 (59%), Gaps = 16/330 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  918   CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  978   GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1037

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  + ++ F    E+Q E               L +F++   VAT+ W CG+   D 
Sbjct  1038  YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGLKNFQVYGWVATDFWPCGNFLWDV  1097

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  1098  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFAVAFSSA  1157

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV +D+  GDI RK+  R 
Sbjct  1158  LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCLKCKLKLEVQLDKQLGDISRKKVDR-  1216

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1217  --VSQTDGFLHAESLFSTALGKVCCSAWKS  1244



>ref|XP_006585469.1| PREDICTED: separase-like isoform X1 [Glycine max]
Length=2171

 Score =   199 bits (506),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 201/341 (59%), Gaps = 18/341 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F E+++  ++W  YL+ +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  904   CVSPVNEEFIMNSMDEFSELSN-IDFWIRYLQGNQSSLIGFQQNFSFLFASSHKNSCSHG  962

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+  +V+  A DLISNVP+ S S FL+  L+YDL  RL+ +GQL EALS AKEA
Sbjct  963   SSFQTDITIAEVQKAALDLISNVPVPSHSTFLAGCLFYDLCPRLVANGQLIEALSSAKEA  1022

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV---SFKICD---------SVATESWFCGDVSSDF  505
             +RL   L  R F    +QQ E   ++   S  + D         SVA E      +S D 
Sbjct  1023  HRLHAKLFQRKFTHSVQQQNEEQNVIADSSKNLMDGIENIGLNLSVAREVLLFDSISWDL  1082

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E   L+ W V+QCYL S LQVG I+EM+G+G  A+   + GK ISC+ +L  F++ FS  
Sbjct  1083  EDNYLSAWKVMQCYLESTLQVGIIHEMVGDGAEAETYFKWGKAISCSLNLPFFLIVFSSS  1142

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW+LAEKE   A++ L +++++  C KC+   EV++ +  GD+ + +F   
Sbjct  1143  LGKLYVKKRLWDLAEKELRSAEQILKESNTLFCCSKCKLKLEVTLYEYLGDLCQSKF-DT  1201

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE  985
              +   S+E   AK  Y SA+DKL LSEW N    P+ VGS+
Sbjct  1202  CDGVMSEE--TAKNWYTSALDKLNLSEWKNPLSCPE-VGSD  1239



>ref|XP_006286190.1| hypothetical protein CARUB_v10007755mg [Capsella rubella]
 gb|EOA19088.1| hypothetical protein CARUB_v10007755mg [Capsella rubella]
Length=2190

 Score =   199 bits (506),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 197/330 (60%), Gaps = 19/330 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +   ++W + LK+S+  L+GFQQ+FH  F  +S +    +
Sbjct  916   CLSPISDTFIRTLSENSGDKSTRIDFWIDCLKDSKAKLIGFQQNFHDNFLQASNK---EE  972

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+ +EALSYAKE+
Sbjct  973   GPFQSDITIDDIKDAASELISSASLSGNSSFVAAYLYYDLCERLISFGKHSEALSYAKES  1032

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  +    F    E+Q+E               +  F++   +AT+ W CG+   D 
Sbjct  1033  YRIRTLIFKEKFNYTAEKQLEKHNDAGKISEIRTFGIKKFQVYRWLATDFWPCGNFLWDI  1092

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +NE++GNG  A+ +L  GK ISC+QSL  F+V+FS  
Sbjct  1093  NHCYLSPWSVLQCYLESTLQVGILNELIGNGLEAETILSWGKAISCSQSLFPFVVAFSSA  1152

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q  +LAEKE   AK+ L+ N    SC KC    EV++D+  GDI +K+  R 
Sbjct  1153  LGNLYHKKQCLDLAEKELQYAKEILIANQRDFSCVKCNLKLEVTLDKQLGDISQKKIDR-  1211

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1212  --VSQTDGFLHAESFFSTALGKICCSAWKS  1239



>ref|XP_006585470.1| PREDICTED: separase-like isoform X2 [Glycine max]
Length=2170

 Score =   199 bits (506),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 201/341 (59%), Gaps = 18/341 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F E+++  ++W  YL+ +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  903   CVSPVNEEFIMNSMDEFSELSN-IDFWIRYLQGNQSSLIGFQQNFSFLFASSHKNSCSHG  961

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+  +V+  A DLISNVP+ S S FL+  L+YDL  RL+ +GQL EALS AKEA
Sbjct  962   SSFQTDITIAEVQKAALDLISNVPVPSHSTFLAGCLFYDLCPRLVANGQLIEALSSAKEA  1021

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV---SFKICD---------SVATESWFCGDVSSDF  505
             +RL   L  R F    +QQ E   ++   S  + D         SVA E      +S D 
Sbjct  1022  HRLHAKLFQRKFTHSVQQQNEEQNVIADSSKNLMDGIENIGLNLSVAREVLLFDSISWDL  1081

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E   L+ W V+QCYL S LQVG I+EM+G+G  A+   + GK ISC+ +L  F++ FS  
Sbjct  1082  EDNYLSAWKVMQCYLESTLQVGIIHEMVGDGAEAETYFKWGKAISCSLNLPFFLIVFSSS  1141

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW+LAEKE   A++ L +++++  C KC+   EV++ +  GD+ + +F   
Sbjct  1142  LGKLYVKKRLWDLAEKELRSAEQILKESNTLFCCSKCKLKLEVTLYEYLGDLCQSKF-DT  1200

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSE  985
              +   S+E   AK  Y SA+DKL LSEW N    P+ VGS+
Sbjct  1201  CDGVMSEE--TAKNWYTSALDKLNLSEWKNPLSCPE-VGSD  1238



>ref|NP_194028.2| separase-like protein [Arabidopsis thaliana]
 sp|Q5IBC5.1|ESP1_ARATH RecName: Full=Separase; AltName: Full=Protein EXTRA SPINDLE POLES; 
Short=AtESP; AltName: Full=Protein RADIALLY SWOLLEN 4 
[Arabidopsis thaliana]
 gb|AAW32909.1| separase [Arabidopsis thaliana]
 gb|AEE84686.1| separase-like protein [Arabidopsis thaliana]
Length=2180

 Score =   199 bits (506),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 192/330 (58%), Gaps = 23/330 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  +Q LS++  + +   ++W + LK+S+  L+GFQQ+FH +           +
Sbjct  913   CPSPISDAFIQTLSENCADKSTCIDFWMDCLKDSKAKLIGFQQNFHDLHN-------KDE  965

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F +AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  966   GPFQSDITIDDIKDAASELISSASLSGNSSFAAAYLYYDLCERLISFGKLSEALSYAKEA  1025

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  +    F    E+ IE               + +F++   +AT+ W CG+   D 
Sbjct  1026  YRIRTLIFQDKFKYTAEKHIEKHNEDGKISEIRTFSIKNFQVYRLLATDFWPCGNFLWDI  1085

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +NE++GNG  A+ +L  GK  SC+QSL  F+V+FS  
Sbjct  1086  NRCYLSPWSVLQCYLESTLQVGILNELIGNGLEAETILSWGKAFSCSQSLFPFVVAFSSA  1145

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q  +LAEKE   AK+ L+ N    SC KC+   EV++D+  GDI RKQ  R 
Sbjct  1146  LGNLYHKKQCLDLAEKELQNAKEILIANQRDFSCVKCKLKLEVTLDKQLGDISRKQIDR-  1204

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K   S W +
Sbjct  1205  --VSQTDGFLHAESLFSAALGKFCCSAWKS  1232



>ref|NP_001190804.1| separase-like protein [Arabidopsis thaliana]
 gb|AEE84687.1| separase-like protein [Arabidopsis thaliana]
Length=2177

 Score =   199 bits (506),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 192/330 (58%), Gaps = 23/330 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  +Q LS++  + +   ++W + LK+S+  L+GFQQ+FH +           +
Sbjct  913   CPSPISDAFIQTLSENCADKSTCIDFWMDCLKDSKAKLIGFQQNFHDLHN-------KDE  965

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F +AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  966   GPFQSDITIDDIKDAASELISSASLSGNSSFAAAYLYYDLCERLISFGKLSEALSYAKEA  1025

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  +    F    E+ IE               + +F++   +AT+ W CG+   D 
Sbjct  1026  YRIRTLIFQDKFKYTAEKHIEKHNEDGKISEIRTFSIKNFQVYRLLATDFWPCGNFLWDI  1085

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +NE++GNG  A+ +L  GK  SC+QSL  F+V+FS  
Sbjct  1086  NRCYLSPWSVLQCYLESTLQVGILNELIGNGLEAETILSWGKAFSCSQSLFPFVVAFSSA  1145

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q  +LAEKE   AK+ L+ N    SC KC+   EV++D+  GDI RKQ  R 
Sbjct  1146  LGNLYHKKQCLDLAEKELQNAKEILIANQRDFSCVKCKLKLEVTLDKQLGDISRKQIDR-  1204

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K   S W +
Sbjct  1205  --VSQTDGFLHAESLFSAALGKFCCSAWKS  1232



>ref|XP_007148477.1| hypothetical protein PHAVU_006G212000g [Phaseolus vulgaris]
 gb|ESW20471.1| hypothetical protein PHAVU_006G212000g [Phaseolus vulgaris]
Length=1869

 Score =   198 bits (503),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 143/383 (37%), Positives = 218/383 (57%), Gaps = 23/383 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F E+++   +W  YL+ +Q  L+GFQQ+F  +FA S    C+++
Sbjct  615   CVSPVNEEFIMNSLDEFKELSN-INFWIRYLQGNQSSLIGFQQNFSFLFASSHSYSCSNE  673

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+ D+V+  A DLISNVP+ S S FL+  L+YDL  RL+ +GQL EALS AKEA
Sbjct  674   SSFQTDITIDEVQKAALDLISNVPVPSHSIFLAGCLFYDLCPRLVANGQLIEALSSAKEA  733

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV-----SFKICDSVATESWFCGDVSSDFESCKLTP  526
             +RL   L  R F  + +QQ E   ++     +  +  SVA E      +S D +   L+ 
Sbjct  734   HRLFSQLFQRKFTHNVQQQNEEHNVIVDSSKNIGLNLSVAMEILLFDSISWDLKDSYLSA  793

Query  527   WNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCK  706
             W V+Q YL S LQVG I+EM+G+G  A+  L+ GK ISC+ +L  F V+FS  LG++Y K
Sbjct  794   WKVMQYYLESTLQVGIIHEMIGDGAHAESHLKWGKTISCSLNLPFFTVAFSSSLGKLYVK  853

Query  707   EQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQ  883
             ++ W+LAEKE   A++ L ++S    C KC+   E+++ +  GD+++ +F    +   S+
Sbjct  854   KRHWDLAEKELRNAEQILKESSKPFCCSKCKLKLEITLYEYLGDLFQSKF-DTCDGVISK  912

Query  884   ELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHES-----CSLSYSATDHM----  1036
             E   AK+ Y SA+DKL LSEW N    P+    E A   S     C +   A +++    
Sbjct  913   E--TAKKWYMSALDKLNLSEWKNPLSCPEDNNDESATDASGKTCTCFIMNEAGENVNKSV  970

Query  1037  -VLKEV---ASRNRKHENAVETI  1093
                +E+   A +NRK +NA + +
Sbjct  971   KAGREIDTGAKQNRKTKNATKIL  993



>ref|XP_011088127.1| PREDICTED: separase [Sesamum indicum]
Length=2081

 Score =   198 bits (503),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 189/330 (57%), Gaps = 51/330 (15%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA P+N   ++  SKH   +  S E+W  +++E +PL +GF  +                
Sbjct  921   CASPVNHMFLETFSKHQSRLCSSVEFWKTFVEEVKPLFIGFHHT----------------  964

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                     +D++K  ASDL+S VPLSS S FLS+ LYYDLS RLI SG++ EAL+YAKEA
Sbjct  965   --------NDEIKQAASDLLSQVPLSSSSMFLSSNLYYDLSGRLISSGRMIEALTYAKEA  1016

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             +RLR  LL + F    ++  E               + +FK+ D   +        S D+
Sbjct  1017  HRLRSKLLQQKFEYSVQKMTETFDENGEITEKSYYGIQTFKVNDREVSHD------SCDY  1070

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C LTPWNVL CYL S LQVG + E+LGN + A+ LL+ G+D+S  Q L +  +SFS +
Sbjct  1071  EGCVLTPWNVLTCYLESTLQVGFVQEILGNASEAEMLLRWGRDVSRFQGLPILEISFSSV  1130

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++YCK++LW +AEKE   AKK L DN   +SC KC  + E+S++Q FGD+Y    C +
Sbjct  1131  LGKLYCKQKLWRVAEKEMSIAKKILADNCDAISCKKCAYMLEISVNQQFGDLYLSSPCSS  1190

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
               N        A+  Y+SA+DKL LS+W +
Sbjct  1191  LFN--------ARSWYRSALDKLNLSDWQS  1212



>gb|KHN26699.1| Separin [Glycine soja]
Length=2304

 Score =   197 bits (502),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/355 (39%), Positives = 201/355 (57%), Gaps = 17/355 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F E+++  ++W  YL+ +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  1064  CVSPVNEEFIMNSMDEFSELSN-IDFWIRYLQGNQSSLIGFQQNFSFLFASSHKNSCSHG  1122

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    DI+  +V+  A DLISNVP+ S S FL+  L+YDL  RL+ +GQL EALS AKEA
Sbjct  1123  SSFQTDITIAEVQKAALDLISNVPVPSHSTFLAGCLFYDLCPRLVANGQLIEALSSAKEA  1182

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV---SFKICD---------SVATESWFCGDVSSDF  505
             +RL   L  R F    +QQ E   ++   S  + D         SVA E      +S D 
Sbjct  1183  HRLHAKLFQRKFTHSVQQQNEEQNVIADSSKNLMDGIENIGLNLSVAREVLLFDSISWDL  1242

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E   L+ W V+QCYL S LQVG I+EM+G+G  A+   + GK ISC+ +L  F++ FS  
Sbjct  1243  EDNYLSAWKVMQCYLESTLQVGIIHEMVGDGAEAETYFKWGKAISCSLNLPFFLIVFSSS  1302

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW+LAEKE   A++ L +++++  C KC+   EV++ +  GD+ + +F   
Sbjct  1303  LGKLYVKKRLWDLAEKELRSAEQILKESNTLFCCSKCKLKLEVTLYEYLGDLCQSKF-DT  1361

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSAT  1027
              +   S+E   AK  Y SA+DKL LSEW N    P+      A    C    + T
Sbjct  1362  CDGVMSEE--TAKNWYTSALDKLNLSEWKNPLSCPEDGSDGTATDIKCPAGKTCT  1414



>ref|XP_010908769.1| PREDICTED: separase [Elaeis guineensis]
Length=1312

 Score =   196 bits (497),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 196/334 (59%), Gaps = 27/334 (8%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHM---IFALSSQRPC  172
            C+ PI+E  +  +SK+ G   DSF+YW N +K   P L  F Q   +   +F   S   C
Sbjct  13   CSSPISENFILDISKYPGVNADSFDYWINCIKGHPPSLCMFLQKLSLNNSVFPEVSG--C  70

Query  173  NHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYA  352
              +      I+ D+VK  AS LI +VPL + SAF++ YLYYDLSERL   G+++EALSYA
Sbjct  71   TFERSFGSQITVDEVKKVASSLIVDVPLPTQSAFIAGYLYYDLSERLFSRGRISEALSYA  130

Query  353  KEAYRLRHALLNRNFLCHTEQQ----IENCRL-------VSFKICDSVATESWFCGDV--  493
            +EA+RLR  LL R F+   EQQ    I + +        +  +   SV +E W   D+  
Sbjct  131  REAFRLRKKLLQRKFIYSVEQQSAKSIGSGKATQSGHDHICLEAMGSVISEVW--PDIIK  188

Query  494  ---SSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLF  664
               S DF    LTPW +L CYL S+LQVG I+E +GNG  A++L + GK IS  Q L + 
Sbjct  189  SGHSGDF---ILTPWGILGCYLESILQVGMIHESMGNGTEAENLFRRGKVISSLQGLPIL  245

Query  665  IVSFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIY  841
              +F+ +LGQ+Y ++QLW+LAE E + AK  L  N +++SCK C+  +EV+ID   GD++
Sbjct  246  ETAFTSLLGQLYRRKQLWDLAETELNYAKTLLEKNDTIISCKHCKLAFEVTIDMQIGDLF  305

Query  842  RKQFCRNPENSTSQELACAKEKYKSAVDKLALSE  943
            R  F +  +  +++ ++ A   Y+ A+DKL  +E
Sbjct  306  RNLFDKGLKIESTKSISDALVLYRLALDKLNHAE  339



>gb|EYU18539.1| hypothetical protein MIMGU_mgv1a018611mg [Erythranthe guttata]
Length=2105

 Score =   196 bits (498),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 208/384 (54%), Gaps = 45/384 (12%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             CA P+N   +   +KH  + ++S ++W   ++E +PL VGF    H I            
Sbjct  920   CASPVNHMFIDTFAKHQSQFSNSTKFWRTCMEELKPLTVGF----HHI------------  963

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                     + ++K  AS LIS VP SS S FL + LYYD S RL+ SG++ EAL+YAKEA
Sbjct  964   --------NTEIKQAASCLISIVPPSS-SFFLLSNLYYDSSARLVSSGRMIEALAYAKEA  1014

Query  362   YRLRHALLNRNFLCHTEQQIE----NCRLV--------SFKICDSVATESWFCGDVSSDF  505
             + LR  LL +NF    E+  E    + R++        +FK+ DS+  +       S D+
Sbjct  1015  HSLRSKLLKQNFEYSVEKMTETFNEDGRIIEKSYYGIQTFKVADSLGAKG------SCDY  1068

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             E C LTPWNVL CYL S+LQVG I+E+LGN   A+ LL+ G++IS  Q L  F VSFS +
Sbjct  1069  EGCTLTPWNVLSCYLESLLQVGMIHEILGNVLDAEMLLRWGRNISRIQGLPHFEVSFSVM  1128

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++LW  AEKE   AKK L  N+ VVSCK C  + E SI+Q  GD++  +F   
Sbjct  1129  LGKLYRKQKLWNAAEKELSSAKKTLASNADVVSCKRCLCMLESSINQQIGDLFLSRFSST  1188

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSATDHMVL  1042
              E+ + + L  AK  YK A+DKL +  W   +   +    E       SLS    +    
Sbjct  1189  GESPSMKMLVDAKSFYKLALDKLNVFNWRTSNSTSEEARLEQVISRESSLSSCVINPPKA  1248

Query  1043  KEVASRNRKHENAVETIMARKTKE  1114
              +  S N K E  +E   +R+TK+
Sbjct  1249  NDTLS-NAKTETKIEPRRSRRTKK  1271



>gb|KGN47608.1| hypothetical protein Csa_6G364113 [Cucumis sativus]
Length=2264

 Score =   195 bits (495),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 143/387 (37%), Positives = 194/387 (50%), Gaps = 68/387 (18%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P NE  +  LS+H GE+  SFE WTN LK     LV FQQ+F  +    +Q  C H+
Sbjct  968   CTTPANEIVIAQLSEHLGELPKSFELWTNCLKTLPGTLVVFQQTFSFLCPNYTQSSCKHE  1027

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEA-------  340
               +   ++ D+VK  AS LIS++P  + S FL+ +LYYDL E+LI  G L EA       
Sbjct  1028  KSVRLYVTVDEVKEAASKLISHIPACTSSIFLAGHLYYDLCEKLISEGCLIEARNNYKNN  1087

Query  341   ----------------------------------------------LSYAKEAYRLRHAL  382
                                                           LS AKEA+RLR  L
Sbjct  1088  MMELVDIMSVSYSSAMHWTILNRPVKSPKTWSGRAAVNEIVLSFIALSCAKEAHRLRSKL  1147

Query  383   LNRNFLCHTEQQIE-NCRLV-----------SFKICDSVATESWFCGDVSSDFESCKLTP  526
                 F+   EQ +E +C +            + +   S A + W    +S D E C L+P
Sbjct  1148  FKEKFIYTVEQHLEKDCEMAYISQKPAYGIKNLQKNRSAARDVWSFDKISWDVEGCYLSP  1207

Query  527   WNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCK  706
             +NVLQCYL S LQVG ++E++GNG+ A+ LL  GK ISC QSL LF V+FS  LG++Y K
Sbjct  1208  FNVLQCYLESTLQVGLVHEIIGNGSEAETLLMWGKSISCLQSLPLFEVAFSSALGKLYRK  1267

Query  707   EQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNPENSTSQ  883
             ++LW LA+KE   AK+ L D  S+ SC KCR + EV + Q  GD+ R  +       + +
Sbjct  1268  KELWSLAQKELERAKQILKD--SITSCLKCRLVLEVKVHQQLGDLSRDMYVNAKGIISEE  1325

Query  884   ELACAKEKYKSAVDKLALSEWNNFSGG  964
              L  A+  Y  A++KL LS W N   G
Sbjct  1326  RLINAEGFYNLALEKLNLSTWKNSISG  1352



>ref|XP_006396846.1| hypothetical protein EUTSA_v10029518mg, partial [Eutrema salsugineum]
 gb|ESQ38299.1| hypothetical protein EUTSA_v10029518mg, partial [Eutrema salsugineum]
Length=2098

 Score =   195 bits (495),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 124/330 (38%), Positives = 183/330 (55%), Gaps = 13/330 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PIN+  +  LSK+FGE ++S ++W + L+ S+   +GFQ S   +   +       +
Sbjct  901   CPSPINDAVILGLSKYFGEKSESTDFWISCLQFSKAKSIGFQLSLQCLPYETLHTLNKPE  960

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                 PDI+ D V  TAS L+S+ PL S S+F++A LYYDL ER +  G L EALSYAKEA
Sbjct  961   DPHKPDITVDDVNNTASKLVSSDPLPSHSSFVAASLYYDLCERQLSCGNLYEALSYAKEA  1020

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             +R+R  +    +    E+  E               +  F++    A + W CG+   D 
Sbjct  1021  HRIRRLIFKDKYSYVAEKHFEKHNRSGKIIGIPSYIISKFEVSSLGAADVWPCGNFLWDI  1080

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L PW VLQCYL S+LQVG INE++G G  A+  L  GK ISCTQSL+ F+V+FS  
Sbjct  1081  NRCYLNPWIVLQCYLESILQVGVINEIIGEGVEAECFLSWGKAISCTQSLQPFVVAFSLA  1140

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y + Q  ELA KE    K+ L+D+    SC+ CR++ EV++D+  GD+ ++++   
Sbjct  1141  LGNLYKRMQSLELAAKELQNVKELLIDSQRGFSCRNCRSMLEVTLDKQLGDLSQRRYDNT  1200

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                     L+ A+  + +A+ K   S W  
Sbjct  1201  TRICQIDGLSHAESLFGAALRKFCCSAWKG  1230



>ref|XP_002867740.1| hypothetical protein ARALYDRAFT_492569 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43999.1| hypothetical protein ARALYDRAFT_492569 [Arabidopsis lyrata subsp. 
lyrata]
Length=2186

 Score =   195 bits (495),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 191/330 (58%), Gaps = 23/330 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  +Q LS++ G+ +   ++W + LK+S+  L+GFQQ+FH +           +
Sbjct  915   CPSPISDAFIQTLSENCGDKSTCIDFWMDCLKDSKAKLIGFQQNFHDLHN-------KDE  967

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  D +   +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  968   GPFQSDFTIGDIKDAASELISSASLSGNSSFVAAYLYYDLCERLISFGKLSEALSYAKEA  1027

Query  362   YRLRHALLNRNFLCHTEQ------------QIENCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  +    F    E+            +I    + +F++    AT+ W CG+   D 
Sbjct  1028  YRIRTLIFQEKFKYTAEKKFVKHNDAGKISEIRTFGIKNFQVYRLFATDFWPCGNFLWDI  1087

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +NE++GNG  A+ +L  GK  SC+QSL  FIV+FS  
Sbjct  1088  NCCYLSPWSVLQCYLESTLQVGILNELIGNGLEAETILSWGKAFSCSQSLFPFIVAFSSA  1147

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q  +LAE E   AK+ L+ N    SC KC+   EV++D+  GDI RK+  R 
Sbjct  1148  LGNLYHKKQCLDLAEIELQNAKEILIANQRDFSCFKCKLKLEVTLDKQLGDISRKKIDR-  1206

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1207  --VSQTDGFLHAESLFSAALGKVCCSAWKS  1234



>gb|KEH21880.1| separase-like protein [Medicago truncatula]
Length=2148

 Score =   193 bits (491),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 130/355 (37%), Positives = 205/355 (58%), Gaps = 17/355 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++     F ++++   +W + LK ++   +GFQQ+F  +FA S +  C+H 
Sbjct  905   CVSPVNEAFIKNSLDEFSDLSN-INFWMHNLKGNESSFIGFQQNFSFLFASSHKNSCDHG  963

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    +I+ ++V+     LISNVP+ +   FL+ YLY DLS+RL+ +G+L EALS+AKEA
Sbjct  964   STFQVEITVEEVQKAVLKLISNVPVPNHCTFLAGYLYGDLSQRLVANGKLLEALSFAKEA  1023

Query  362   YRLRHALLNRNFLCHTEQQIE-NCRLVSF--KICD---------SVATESWFCGDVSSDF  505
             +RL   L    +    ++ IE N   V+F  K+ D         SV  E +     S D 
Sbjct  1024  HRLHDQLFKVKYRHIFQKHIEANNIPVNFSKKLMDRIDQIEVDMSVVREMFLFDSKSWDL  1083

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             +   L+PW ++QCYL S LQ+G I E+LG+GN A+  LQ GK ISC+  L LFIV+FS +
Sbjct  1084  KDNYLSPWKIMQCYLESTLQIGNIYEILGDGNKAETYLQWGKAISCSLQLPLFIVAFSSL  1143

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y  +++W+LAEKE   AKK L DN++   C KC+ + E ++    GD+++ +F   
Sbjct  1144  LGKLYVTKKIWDLAEKELLYAKKILDDNNTPFCCSKCKLILEATLYGYRGDLFQSKFNAR  1203

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSAT  1027
              E  +++    AK+ Y +A++KL +SEW N    P+  G        C+   + T
Sbjct  1204  DEGISTE---FAKKLYITAMNKLTISEWKNPLSCPEDDGDATITDAKCAAGKTCT  1255



>gb|AES63348.2| separase-like protein [Medicago truncatula]
Length=2182

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/350 (39%), Positives = 196/350 (56%), Gaps = 19/350 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F ++++   +W + LK +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  907   CVSPVNEAFILNSLDDFSDLSN-INFWIHNLKGNQSSLIGFQQNFSFLFASSHRSSCDHG  965

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    +IS D+V+  A  LISNVP+ +   FL+ YLY DL  RLI +GQL EALS+AKEA
Sbjct  966   SSFQVEISVDEVQKAALKLISNVPVPNHCTFLAGYLYSDLCGRLIANGQLIEALSFAKEA  1025

Query  362   YRLRHALLNRNFLCHTEQQ--IENCRLVSF-----------KICDSVATESWFCGDVSSD  502
             +RL   L    F  H  Q+   EN   V F           ++  SV  E +    +S D
Sbjct  1026  HRLHDQLFKVKFR-HIFQKHNEENNITVDFLKNLMEGVDKIEVDTSVVREIFLFDSISRD  1084

Query  503   FESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSC  682
              +   L+PW ++Q YL S LQVG I E++G+G  A+  L+ GK ISC   L LFIV+FS 
Sbjct  1085  LQDNYLSPWKIMQSYLESTLQVGAIYEIIGDGIEAETYLRWGKAISCLLQLPLFIVAFSS  1144

Query  683   ILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR  859
             +LG++Y  ++LW+ A+KE   A++ L DNS+   C KC+ + EV++    GD+ + +F  
Sbjct  1145  LLGKLYATKRLWDSADKELQLAEQILNDNSTPFCCSKCKLILEVTLHGYLGDLCQSKF-N  1203

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCS  1009
               E   S+E   AK  Y SA++KL LSEW N    P+      A    C+
Sbjct  1204  ACEEGVSEE--TAKNWYTSALNKLTLSEWKNPLSCPEDDSDAIATDVKCA  1251



>ref|XP_003593097.1| Separin [Medicago truncatula]
Length=2216

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/350 (39%), Positives = 196/350 (56%), Gaps = 19/350 (5%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  +      F ++++   +W + LK +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  933   CVSPVNEAFILNSLDDFSDLSN-INFWIHNLKGNQSSLIGFQQNFSFLFASSHRSSCDHG  991

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
             +    +IS D+V+  A  LISNVP+ +   FL+ YLY DL  RLI +GQL EALS+AKEA
Sbjct  992   SSFQVEISVDEVQKAALKLISNVPVPNHCTFLAGYLYSDLCGRLIANGQLIEALSFAKEA  1051

Query  362   YRLRHALLNRNFLCHTEQQ--IENCRLVSF-----------KICDSVATESWFCGDVSSD  502
             +RL   L    F  H  Q+   EN   V F           ++  SV  E +    +S D
Sbjct  1052  HRLHDQLFKVKFR-HIFQKHNEENNITVDFLKNLMEGVDKIEVDTSVVREIFLFDSISRD  1110

Query  503   FESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSC  682
              +   L+PW ++Q YL S LQVG I E++G+G  A+  L+ GK ISC   L LFIV+FS 
Sbjct  1111  LQDNYLSPWKIMQSYLESTLQVGAIYEIIGDGIEAETYLRWGKAISCLLQLPLFIVAFSS  1170

Query  683   ILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR  859
             +LG++Y  ++LW+ A+KE   A++ L DNS+   C KC+ + EV++    GD+ + +F  
Sbjct  1171  LLGKLYATKRLWDSADKELQLAEQILNDNSTPFCCSKCKLILEVTLHGYLGDLCQSKF-N  1229

Query  860   NPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCS  1009
               E   S+E   AK  Y SA++KL LSEW N    P+      A    C+
Sbjct  1230  ACEEGVSEE--TAKNWYTSALNKLTLSEWKNPLSCPEDDSDAIATDVKCA  1277



>ref|XP_010540479.1| PREDICTED: separase isoform X2 [Tarenaya hassleriana]
Length=2187

 Score =   190 bits (483),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 193/327 (59%), Gaps = 20/327 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI----FALSSQRP  169
             C   I++  + ++S++ GE + S E+W + LKES+   +GF Q+FH +    F +S++  
Sbjct  899   CPSTISDAFILSISEYCGENSLSVEFWMDCLKESKAKSIGFLQNFHFLHYDFFNISNKYA  958

Query  170   CNHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSY  349
                +    PDI+ D +K TAS+L+S+VP  S  AF +AYLYY L ERLI+ G+ +EALSY
Sbjct  959   ---RRTFQPDITIDDIKNTASELLSSVPPPSHPAFAAAYLYYYLCERLIMHGKFSEALSY  1015

Query  350   AKEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDV  493
             AKEA+R+R       F    E+Q E               + S ++  S+AT+ W CG+ 
Sbjct  1016  AKEAHRIRTLSFQETFKYTAEKQSEKHNNAGRTTEIRVYGIKSLEVVKSIATDFWPCGNF  1075

Query  494   SSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVS  673
               D     L+PWNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+
Sbjct  1076  LWDINRSYLSPWNVLQCYLESTLQVGVVNELIGNGAEAETLLSWGKAISCSQSLSPFVVA  1135

Query  674   FSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQ  850
             FS  LG +Y K+   +LA KE   AK+ L++N    SC KCR + E  +DQ  GD+ ++Q
Sbjct  1136  FSSALGNLYHKKLSLDLAAKELQSAKELLLNNQRDFSCLKCRLMLEAKLDQQLGDLTQRQ  1195

Query  851   FCRNPENSTSQELACAKEKYKSAVDKL  931
             F      S    L+ A+  + SA+ K+
Sbjct  1196  FDSAASLSQIDRLSHAESLFSSALSKI  1222



>ref|XP_010540470.1| PREDICTED: separase isoform X1 [Tarenaya hassleriana]
Length=2187

 Score =   190 bits (483),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 193/327 (59%), Gaps = 20/327 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMI----FALSSQRP  169
             C   I++  + ++S++ GE + S E+W + LKES+   +GF Q+FH +    F +S++  
Sbjct  899   CPSTISDAFILSISEYCGENSLSVEFWMDCLKESKAKSIGFLQNFHFLHYDFFNISNKYA  958

Query  170   CNHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSY  349
                +    PDI+ D +K TAS+L+S+VP  S  AF +AYLYY L ERLI+ G+ +EALSY
Sbjct  959   ---RRTFQPDITIDDIKNTASELLSSVPPPSHPAFAAAYLYYYLCERLIMHGKFSEALSY  1015

Query  350   AKEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDV  493
             AKEA+R+R       F    E+Q E               + S ++  S+AT+ W CG+ 
Sbjct  1016  AKEAHRIRTLSFQETFKYTAEKQSEKHNNAGRTTEIRVYGIKSLEVVKSIATDFWPCGNF  1075

Query  494   SSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVS  673
               D     L+PWNVLQCYL S LQVG +NE++GNG  A+ LL  GK ISC+QSL  F+V+
Sbjct  1076  LWDINRSYLSPWNVLQCYLESTLQVGVVNELIGNGAEAETLLSWGKAISCSQSLSPFVVA  1135

Query  674   FSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQ  850
             FS  LG +Y K+   +LA KE   AK+ L++N    SC KCR + E  +DQ  GD+ ++Q
Sbjct  1136  FSSALGNLYHKKLSLDLAAKELQSAKELLLNNQRDFSCLKCRLMLEAKLDQQLGDLTQRQ  1195

Query  851   FCRNPENSTSQELACAKEKYKSAVDKL  931
             F      S    L+ A+  + SA+ K+
Sbjct  1196  FDSAASLSQIDRLSHAESLFSSALSKI  1222



>ref|XP_004486240.1| PREDICTED: uncharacterized protein LOC101501526 [Cicer arietinum]
Length=2163

 Score =   189 bits (479),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 123/333 (37%), Positives = 193/333 (58%), Gaps = 23/333 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  P+NE  ++     F ++++   +W   L+ +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  895   CVSPVNEAFIRNSLDEFSDLSN-INFWMRNLQGNQSSLIGFQQNFSFLFASSHRNSCDHG  953

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  D++ D+VK  A +L+SNVP+ +   FL+ YLY DL +R   +GQL EALS+AKEA
Sbjct  954   VSFQVDLTVDEVKKAAHELMSNVPVPNHCTFLAGYLYSDLCQRFTANGQLIEALSFAKEA  1013

Query  362   YRLRHALLNRNFLCHTEQQIENCRLV------------SFKICDSVATESWFCGDVSSDF  505
             +RL   L   NF  +  +  E   +               ++  SVA E +    ++ D 
Sbjct  1014  HRLHAKLFKLNFSHNARKSSEEHNVTVDFSKNLMDGIDKMEVNMSVAREVFLFDSITWDL  1073

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             +   L+PW ++QCYL S LQ+G I E++G+G  A+  L+ GK ISC+  L LFIV+FS +
Sbjct  1074  KDNYLSPWKIMQCYLESTLQIGIIYEIIGDGTEAETYLRWGKAISCSLQLPLFIVAFSSL  1133

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++Y K++L +LAEKE   A+K L ++S+   C KC+ + EV++ +  GD+ + +F   
Sbjct  1134  LGKLYVKKRLGDLAEKELECAEKILKNSSTPFCCSKCKLILEVTLFEYRGDLCQSKF---  1190

Query  863   PENSTSQELA---CAKEKYKSAVDKLALSEWNN  952
                +T +E+A    AK  Y SA++ L  SEW N
Sbjct  1191  ---NTCEEVASEETAKNWYTSALNILTFSEWKN  1220



>gb|KCW63049.1| hypothetical protein EUGRSUZ_G00634 [Eucalyptus grandis]
Length=2157

 Score =   189 bits (479),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 129/324 (40%), Positives = 184/324 (57%), Gaps = 24/324 (7%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI+E  +  LS+  GE+  S ++W   LKESQPLLVGFQ     +  L  +  C  +
Sbjct  914   CFSPISEAFITVLSEQRGEIFKSMDHWMCCLKESQPLLVGFQNILSSLLPLYCKESCC-E  972

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
               L P I  D VK  A  L+S+VPLS+ + +L+ +L+YDLSER+ILSG L E +      
Sbjct  973   ITLEPYIGGDLVKEAAVGLLSSVPLSTRAVYLAGFLHYDLSERMILSGCLHEVMV-----  1027

Query  362   YRLRHALLNRNFLCHTEQ-----------QIENCRLVSFKICDSVATESWFCGDVSSDFE  508
                   L    F    EQ           Q  N  L S  +  + A E W     S + E
Sbjct  1028  -----KLFQEKFTYSVEQTQKHGESGEFAQKHNYSLRSLHVSKTEAAEVWSFDSNSFNVE  1082

Query  509   SCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCIL  688
             SC L+PWN++Q YL S LQVGTI E++GNG  A+  L  GK+IS  Q L  F V+FS +L
Sbjct  1083  SCYLSPWNIMQGYLESTLQVGTILELIGNGTEAETFLLWGKNISQLQDLPQFDVAFSAVL  1142

Query  689   GQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNP  865
             G+IYC+++ W++A KE   A+++L+D  ++ SC KCR L E ++D   GD+ R Q   + 
Sbjct  1143  GKIYCRKRCWDMASKELETARQSLMDCGAIFSCSKCRLLLEATVDLQLGDLVRAQS-DDS  1201

Query  866   ENSTSQELACAKEKYKSAVDKLAL  937
              + ++ +L  A+E Y+ A+D+LAL
Sbjct  1202  SSVSADKLTHAEELYQLALDRLAL  1225



>ref|XP_009417821.1| PREDICTED: separase-like [Musa acuminata subsp. malaccensis]
Length=1707

 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 191/326 (59%), Gaps = 12/326 (4%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQP-LLVGFQQSFHMIFALSSQRPCNH  178
             C+ PI+E  V  +S+ FG   +  +YW N +K+  P   +  Q+ F   F LS     + 
Sbjct  987   CSSPIDEVFVLNISEQFGLNVNFLDYWINCIKQHPPSQCMLLQKLFPNDFVLSEATGHSS  1046

Query  179   KAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKE  358
             K      IS ++VK  A+ L++ VP +  SAF++AYLY+DLSERL  +G+++EAL YAKE
Sbjct  1047  KRPFGAQISTEEVKEVATSLVAEVPFTYQSAFIAAYLYHDLSERLFSNGRISEALLYAKE  1106

Query  359   AYRLRHALLNRNFLCHTEQQIENCRL----------VSFKICDSVATESWFCGDVSSDFE  508
             A  LR+ +L R F+    +Q    +           +S     +V T+ W   + S + +
Sbjct  1107  ALCLRNKILRRKFIYTVVEQSAQSKSDGVTQYRNDHISLVPISNVITDVWPDFNKSGNLD  1166

Query  509   SCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCIL  688
                L+PW+VL+CYL S  QVG I+E  GNG  A+ L ++GK+ISC Q   +  ++F+ +L
Sbjct  1167  DSLLSPWSVLRCYLESTFQVGIIHESTGNGAEAECLFRIGKNISCLQGFPVLAIAFTMLL  1226

Query  689   GQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRNP  865
             GQ+Y ++  W+LAE E   AKK LV+  +++SC +C+ + EV+ID   GD+YR  F +  
Sbjct  1227  GQLYRRKHQWDLAENELKSAKKLLVEYDNIISCTRCKMVLEVTIDMQVGDLYRSLFDKGT  1286

Query  866   ENSTSQELACAKEKYKSAVDKLALSE  943
             +  ++  L+ A   Y+SA++KL L+E
Sbjct  1287  QIKSTGSLSDALGLYRSALEKLELAE  1312



>emb|CAN76327.1| hypothetical protein VITISV_014221 [Vitis vinifera]
Length=432

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 165/259 (64%), Gaps = 8/259 (3%)
 Frame = +2

Query  326   QLTEALSYAKEAYRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDF  505
             +L  ALS+AK+A++LR  L    F       + +  L +F++   VATE W    +S + 
Sbjct  52    KLPAALSFAKQAHQLRSKLFQEKFSQKYTSGLSD--LQTFRL---VATEVWSFSTISWEL  106

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             ESC L+PWNVLQCYL S LQVG I+EM+GNG  A+ LL  GK IS +Q L LFIVSFS +
Sbjct  107   ESCDLSPWNVLQCYLESTLQVGIIHEMIGNGTEAEALLCWGKMISSSQDLPLFIVSFSSM  166

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG++YCK+++W+LAEKE   AK+ +VD+S+ +SC KCR + E +IDQ  GD+YR      
Sbjct  167   LGKLYCKKRIWDLAEKELQTAKQVMVDSSADISCLKCRLILEATIDQQLGDLYRSHLDCT  226

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKA--VGSEHAKHESCSLSYSATDHM  1036
              EN + + L+ A+  YKSA+DKL LSEW N    P+     S  ++++  +++  +T  +
Sbjct  227   TENLSIKRLSFAENLYKSALDKLNLSEWKNSVSSPEESCAASILSRNQLDAVTLFSTGEV  286

Query  1037  VLKEVASRNRKHENAVETI  1093
                ++ +++RK + A + +
Sbjct  287   TKVKMENKSRKAKKASQIL  305



>ref|XP_006829069.1| hypothetical protein AMTR_s00001p00258830 [Amborella trichopoda]
 gb|ERM96485.1| hypothetical protein AMTR_s00001p00258830 [Amborella trichopoda]
Length=1441

 Score =   167 bits (422),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 123/334 (37%), Positives = 183/334 (55%), Gaps = 26/334 (8%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  +  LSK F    DSF +W + +K +  LL+GFQQ F ++ ++      N  
Sbjct  727   CTAPIDDAFIAFLSKEFEVSADSFNFWVSCIKGNPYLLLGFQQKFLLVDSIVRDTATNPS  786

Query  182   AFLP--PDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAK  355
                P   DIS +K+   AS+L+SNV   + S F++ YLYYDLSERL+ SG+  EALSYA+
Sbjct  787   KECPLGTDISYEKIIEAASNLVSNVAKDTRSIFIAGYLYYDLSERLVSSGKFLEALSYAR  846

Query  356   EAYRLRHALLNRNFLCHT---------EQQI---ENCRLVSFKICDSVATESWFCGDVSS  499
             ++  LR  LL RNFL  +         +++I   +     S +I  S     W       
Sbjct  847   KSLNLRKKLLQRNFLFSSKSSKTEDIGDEEINVNDKAARFSLEILGSKTRNFW------P  900

Query  500   DFESC-----KLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLF  664
             +F SC      ++PWNVL+ YL S LQVG I E +G  + A+H+L +GK+ISC+Q   LF
Sbjct  901   EFVSCGKFDDSISPWNVLRTYLESALQVGRIYEAIGCSDEAEHILSVGKEISCSQGFILF  960

Query  665   IVSFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCKCRALYEVSIDQL-FGDIY  841
              V+F  ILG++Y ++QLW+ +EKE   AK+ L D+    +C    L   SI ++  G++ 
Sbjct  961   GVTFGSILGELYFRKQLWDQSEKELVNAKQKLDDSKLPFACTLCKLTTYSILEMRIGNLI  1020

Query  842   RKQFCRNPENSTSQELACAKEKYKSAVDKLALSE  943
             +    R  +    Q    A + Y SA +KL  +E
Sbjct  1021  QNYHARVRDVPLKQISGSALDIYTSAQNKLCHAE  1054



>emb|CDY68508.1| BnaCnng59290D, partial [Brassica napus]
Length=1005

 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 167/294 (57%), Gaps = 28/294 (10%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C  PI++  +  LS +F E+++S  +W + L+ S+   +GF+ S H              
Sbjct  694  CPSPIDDAVITGLSCYFDEISESTYFWKSCLQFSKAKSIGFELSIH--------------  739

Query  182  AFLPPDISDDKVKLTASDL------ISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEAL  343
                 DI+ D++K TAS L      +S+ P +  S+F++A LYYDL ER +  G L EAL
Sbjct  740  ---ESDITIDEIKRTASKLDTTSKPVSSDPFTCFSSFVAASLYYDLCERELSCGNLYEAL  796

Query  344  SYAKEAYRLRHALLNRNFLCHTEQ----QIENCRLVSFKICDSVATESWFCGDVSSDFES  511
            SYAKEA+R+R+ LL + F    E     +I       F++     T+SW CG    D   
Sbjct  797  SYAKEAHRIRNFLLQKWFRYGGESTKTVEIMTFVFKKFEVSSLRDTDSWPCGTFLWDISR  856

Query  512  CKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILG  691
            C L+PW +LQC L S+LQ+G I E++G  + A  LL  GK +S  QSL+ F+++FS  LG
Sbjct  857  CYLSPWILLQCCLESVLQLGGIYELMGERDRAGTLLSWGKTVSSIQSLQPFVLAFSLALG  916

Query  692  QIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQ  850
             +Y K Q W+LAEKE   AKK L D+     C+ C+ + EV++D+ FGD+ ++Q
Sbjct  917  NLYNKMQCWDLAEKELQNAKKLLTDSQRDFPCRNCKLMLEVTLDKQFGDLSQRQ  970



>gb|KFK31931.1| hypothetical protein AALP_AA6G177700 [Arabis alpina]
Length=1801

 Score =   161 bits (407),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/258 (40%), Positives = 146/258 (57%), Gaps = 29/258 (11%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNY-LKESQPLLVGFQ--------QSFHMIFAL  154
             C  PIN+  +  LS +FGE ++S ++W    L+ S+   +GFQ        ++ H +  L
Sbjct  811   CPSPINDAVIMGLSGYFGEKSESTDFWIRSCLQFSKAKSIGFQLSLQCSPYEALHTVNKL  870

Query  155   SSQRPCNHKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLT  334
               + P  HK+    DI+ D +  TAS L+S+ P  S S+F++A LYYDL ER +  G L 
Sbjct  871   --EEP--HKS----DITIDDINNTASVLVSSNPAPSPSSFVAASLYYDLCERQLSCGNLY  922

Query  335   EALSYAKEAYRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESW  478
             EALSYAKEA+R+R+ +    F C  E+  E               +  F++  S A + W
Sbjct  923   EALSYAKEAHRIRNLIFEDKFSCVVEKHFEKHNRAGKVIELPTYIISKFEVSSSRAIDVW  982

Query  479   FCGDVSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLR  658
              CG    D   C L+PWNVLQCYL S+LQVG INE++G G  A+  L  GK I+C QSL+
Sbjct  983   PCGKFIWDTSRCSLSPWNVLQCYLESILQVGVINELIGEGVEAECFLSRGKAIACMQSLQ  1042

Query  659   LFIVSFSCILGQIYCKEQ  712
              F+V+FS  LG +Y + Q
Sbjct  1043  PFVVAFSLALGDLYKRMQ  1060



>ref|XP_010448799.1| PREDICTED: separase isoform X4 [Camelina sativa]
Length=2167

 Score =   159 bits (401),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 171/330 (52%), Gaps = 46/330 (14%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  918   CLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  977

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+                              ALSYAKEA
Sbjct  978   GPFQSDITTDDIKDAASELISS------------------------------ALSYAKEA  1007

Query  362   YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
             YR+R  + ++ F    E+Q E               L +F++   VAT+ W CG+   D 
Sbjct  1008  YRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGLKNFQVYGWVATDFWPCGNFLWDV  1067

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
               C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS  
Sbjct  1068  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFAVAFSSA  1127

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCRN  862
             LG +Y K+Q   LAEKE   AK+ L+ N    SC KC+   EV +D+  GDI RK+  R 
Sbjct  1128  LGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCLKCKLKLEVQLDKQLGDISRKKVDR-  1186

Query  863   PENSTSQELACAKEKYKSAVDKLALSEWNN  952
                S +     A+  + +A+ K+  S W +
Sbjct  1187  --VSQTDGFLHAESLFSTALGKVCCSAWKS  1214



>gb|EMT21871.1| Separin [Aegilops tauschii]
Length=2016

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 146/249 (59%), Gaps = 8/249 (3%)
 Frame = +2

Query  209   DKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHALLN  388
             D +   AS L+S VP ++ S +L+ +LYYDLSERL+  GQL +A+SY +EA +LR  LL 
Sbjct  850   DGIVKVASSLVSEVPSNNQSTYLAGWLYYDLSERLLSRGQLLQAISYGREALQLRKKLLK  909

Query  389   R-------NFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQCY  547
             +        F+    +       VS +       E W      S      LTPWNVL+CY
Sbjct  910   KKFKFYLGKFVSKESECSGGQGFVSLEAWGPTMAEIWPDCTRPSSMRDSFLTPWNVLKCY  969

Query  548   LGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwela  727
             L S+LQV  ++E++G+G  A+ LL+ GK+ISC Q L +F V F+  LGQ+YCK QLW+ A
Sbjct  970   LESILQVALMHELIGDGAEAEVLLRTGKEISCFQGLPIFAVVFTSALGQLYCKRQLWDAA  1029

Query  728   ekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACAKE  904
             E E   A+  L +N   +SC+ CR   E+S+D   GD++  QF ++ +  ++  L+ A  
Sbjct  1030  EGELKHARDLLKENGEFISCETCRLTLEISVDVQAGDLFWNQFDKDLQKHSTCNLSRALG  1089

Query  905   KYKSAVDKL  931
              Y+SA++KL
Sbjct  1090  MYRSAMEKL  1098



>ref|XP_010236897.1| PREDICTED: separase [Brachypodium distachyon]
Length=2249

 Score =   150 bits (380),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 169/319 (53%), Gaps = 9/319 (3%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGF-QQSFHMIFALSSQRPCNH  178
             C LP+++  +  + +H G       +W +  K   P L  F QQ + + F  S     + 
Sbjct  950   CHLPMDQQFISYVVQHLGVDCHKTLFWIDCFKGDHPSLSMFLQQLWPIDFFFSQSSEQSF  1009

Query  179   KAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKE  358
             ++      S D+V   AS L+S V  S+ S +L+ YLY+ LSERL+  GQL +A+SY +E
Sbjct  1010  RSQFGFSASVDEVDKVASSLVSEVTSSNRSNYLAGYLYHGLSERLLSRGQLLQAISYGRE  1069

Query  359   AYRLRHALL------NRNFLCHTEQQIENCR-LVSFKICDSVATESWFCGDVSSDFESCK  517
             A +LR  LL      N       E Q    +  VS +       E W     SS      
Sbjct  1070  ALQLRKKLLKKKFKFNLGKFVSGESQCSGGQGFVSLEAWGPTIAEIWPDSTRSSSTSDSF  1129

Query  518   LTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQI  697
              TPWNVL+CYL S+LQV  + E++GNG  A+ LL+ GK+ISC Q L  F V F+  LGQ+
Sbjct  1130  FTPWNVLRCYLESVLQVAVMYELIGNGAEAEVLLRTGKEISCFQGLPFFAVVFTSALGQL  1189

Query  698   YCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENS  874
             Y K QLW+ AE E   A+  LV+N   ++CK C+   E SID   GD++   F ++ +  
Sbjct  1190  YRKRQLWDAAESEIKRARDFLVENDKFITCKLCKLTLETSIDVQAGDLFWNLFEKDFQKQ  1249

Query  875   TSQELACAKEKYKSAVDKL  931
             ++  L+ A   Y+SA++KL
Sbjct  1250  STCNLSSALGMYQSAMEKL  1268



>emb|CAA19812.1| putative protein [Arabidopsis thaliana]
 emb|CAB79252.1| putative protein [Arabidopsis thaliana]
Length=1773

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 183/336 (54%), Gaps = 29/336 (9%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C  PI++  +Q LS++  + +   ++W + LK+S+  L+GFQQ+FH +           +
Sbjct  701   CPSPISDAFIQTLSENCADKSTCIDFWMDCLKDSKAKLIGFQQNFHDLHN-------KDE  753

Query  182   AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                  DI+ D +K  AS+LIS+  LS  S+F +AYLYYDL ERLI  G+L+EALSYAKEA
Sbjct  754   GPFQSDITIDDIKDAASELISSASLSGNSSFAAAYLYYDLCERLISFGKLSEALSYAKEA  813

Query  362   YRLRHALLNRNFLCHTEQQIE------------NCRLVSFKICDSVATESWFCGDVSSDF  505
             YR+R  +    F    E+ IE               + +F++   +AT+ W CG+   D 
Sbjct  814   YRIRTLIFQDKFKYTAEKHIEKHNEDGKISEIRTFSIKNFQVYRLLATDFWPCGNFLWDI  873

Query  506   ESCKLTPWNVLQCYLGSMLQV---GTINEMLG--NGNVAKHLLQLGKDISCTQSLRLFIV  670
               C L+PW+VLQCYL S LQV     I+ ++G  + +V++  ++    +    +  L + 
Sbjct  874   NRCYLSPWSVLQCYLESTLQVLFLFRISSLVGFHHFSVSQFGVKFAGFLIPFVNKLLDLC  933

Query  671   SFSCI-LGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYR  844
             S S I  G +Y K+Q  +LAEKE   AK+ L+ N    SC KC+   EV++D+  GDI R
Sbjct  934   SSSLISQGNLYHKKQCLDLAEKELQNAKEILIANQRDFSCVKCKLKLEVTLDKQLGDISR  993

Query  845   KQFCRNPENSTSQELACAKEKYKSAVDKLALSEWNN  952
             KQ  R    S +     A+  + +A+ K   S W +
Sbjct  994   KQIDR---VSQTDGFLHAESLFSAALGKFCCSAWKS  1026



>emb|CDY67480.1| BnaCnng55190D, partial [Brassica napus]
Length=1561

 Score =   144 bits (364),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 160/293 (55%), Gaps = 40/293 (14%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C  PI++  +  LS +F E+++S ++W + L+ S+   +GF+ S H              
Sbjct  685  CPSPIDDAVITGLSCYFDEISESTDFWKSCLQFSKAKSIGFELSIH--------------  730

Query  182  AFLPPDISDDKVKLTASDL------ISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEAL  343
                 DI+  ++K TAS L      +S+ PL   S+F++A LYYDL ER +  G L +AL
Sbjct  731  ---ESDITIVEIKRTASKLDTTSKPVSSDPLPCFSSFVAASLYYDLCERELSCGNLYKAL  787

Query  344  SYAKEAYRLRHALLNR--NFLCHTEQQIE--NCRLVSFKICDSVATESWFCGDVSSDFES  511
            SYA EA R+R+ LL +   F   T Q +E        F++     T+SW CG    D   
Sbjct  788  SYATEAQRIRNFLLRKWFRFSGKTTQTVEIMTFDFKKFEVSSLRDTDSWPCGTFLWDISR  847

Query  512  CKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILG  691
            C L+PW +LQC L S+LQ+G I E++G  + A +LL  GK +S  QSL+ F+++FS  LG
Sbjct  848  CYLSPWILLQCCLESVLQLGGIWELMGERDRAGNLLSWGKTVSSIQSLQPFVLAFSLALG  907

Query  692  QIYCKEQlwelaekeaheakkalVDNSSVVSCKCRALYEVSIDQLFGDIYRKQ  850
             +Y K Q  +LAEKE   AKK L D             +V++D+ FGD+ ++Q
Sbjct  908  NLYNKMQCRDLAEKELQNAKKLLTD-------------KVTLDKQFGDLSQRQ  947



>gb|EMS65712.1| Separin [Triticum urartu]
Length=2089

 Score =   143 bits (360),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/280 (38%), Positives = 153/280 (55%), Gaps = 14/280 (5%)
 Frame = +2

Query  197   DISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRH  376
             + S D++   AS L+S  P  + S +L+  +YYDLSERL+  GQ+ +A+SY +EA +LR 
Sbjct  691   NASVDEIDKVASSLVSEGPSGNQSTYLAGCIYYDLSERLLSRGQVLQAISYGREALQLRK  750

Query  377   ALLNR-------NFLCHTEQQIENCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNV  535
              LL +        F+    Q       VS +         W      S      LTPWNV
Sbjct  751   KLLKKKFKFNLGKFVSGESQYSGGQGFVSLEAWGPTMAGIWPDCTRPSSMRDSFLTPWNV  810

Query  536   LQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQl  715
             L+CYL S+LQV  ++E++GNG  A+ LL++GK+ISC Q L +F V F+ +LGQIY K  L
Sbjct  811   LRCYLESILQVAVMHELVGNGAEAEVLLRIGKEISCFQGLPIFAVVFTSVLGQIYHKRLL  870

Query  716   welaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELA  892
             W+ AE E   AK  L +N   +SCK C+   ++S+D   GD+    F ++ +  ++  L+
Sbjct  871   WDAAEGELKHAKDLLAENDEFISCKTCKLTLQISVDVQAGDLSWNLFEKDLQKQSTGNLS  930

Query  893   CAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSL  1012
              A   Y+SAV+KL      N SG   + GS    + SC L
Sbjct  931   SALGMYQSAVEKL------NNSGLDFSAGSCDKVNTSCML  964



>ref|XP_004955230.1| PREDICTED: uncharacterized protein LOC101777770 [Setaria italica]
Length=2215

 Score =   143 bits (360),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 117/337 (35%), Positives = 172/337 (51%), Gaps = 37/337 (11%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C LP++E  +  +++H G      E+W    +   P       SF M      QR  +  
Sbjct  918   CHLPLDEQFIY-IAEHLGVDCHQTEFWRKCFEGDHP-------SFFMFL----QRMLHSD  965

Query  182   AFLPP------------DISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSG  325
              F+P             D   D+V+  A  L+S    +  S FL+ YLYYDLSERL+  G
Sbjct  966   LFIPQSCEHSFGRQFSFDAGVDEVREVALSLVSEDTSNDQSTFLAGYLYYDLSERLLSCG  1025

Query  326   QLTEALSYAKEAYRLRHALL------NRNFLCHTEQQIENCRLVSFKICDSVATESWFCG  487
              L +A S+ KEA  LR  LL      N     +T+ Q     LVS +       E W   
Sbjct  1026  LLFQAFSHGKEALDLRKKLLKRKFKLNSGVSANTKSQHCGQDLVSLEAWGPAIAEIWPDC  1085

Query  488   DVSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFI  667
               S+      LTPWNVL+CYL S LQV  ++E++GNG  A+ LL+ GK+IS    L +F 
Sbjct  1086  SRSTSARDSFLTPWNVLRCYLESTLQVAMMHELIGNGTEAEILLRTGKEISDFHGLSVFC  1145

Query  668   VSFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYR  844
             ++F+ +LGQ+Y K  L + A+ E   A+  LV+N +++SCK C+   E+S+D   GD+  
Sbjct  1146  IAFTSLLGQLYRKRYLCDEADSELKYARDLLVENDAIISCKPCKLTMEISVDMQDGDLSW  1205

Query  845   KQFCRN-PENSTSQELACAKEKYKSAVDKLALSEWNN  952
               F ++  E S  +EL+ A  KY+SA++K     WN+
Sbjct  1206  SLFEKDCQEQSGKKELSSALGKYQSAINK-----WNS  1237



>ref|XP_008679271.1| PREDICTED: separase isoform X3 [Zea mays]
Length=1861

 Score =   143 bits (360),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 160/323 (50%), Gaps = 20/323 (6%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C LP++E  +    +H G      E+W N  K   P L  F Q   +  AL   + C H 
Sbjct  575  CYLPLDERFLSIAKEHLGVCCHDIEFWINCFKGDHPSLCMFLQR-TLPSALFIPQSCKHP  633

Query  182  -----AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALS  346
                 +F+    S D+V   AS L+S    +  S FL+  LYYDLSE++   GQL +A S
Sbjct  634  FGRQFSFV---TSVDEVSKVASSLVSGDTSNEQSTFLAGCLYYDLSEKVFSRGQLFQAFS  690

Query  347  YAKEAYRLRHAL------LNRNFLCHTEQQIENC-RLVSFKICDSVATESWFCGDVSSDF  505
            Y  +A  LR  L      +N     + E+Q  +C + +S ++C     E W     S + 
Sbjct  691  YGNKALHLRKKLLKKKFKINSGISGNMERQ--HCGQDISLEVCGPTIVEIWPNSSSSVNT  748

Query  506  ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
            +   LTPWNVL+CYL S LQV  ++E++GNG  A+ LLQ GK+IS    L +F + F+  
Sbjct  749  KDFFLTPWNVLRCYLESTLQVAMMHELIGNGAEAEVLLQTGKEISNFHGLSVFCIVFTSF  808

Query  686  LGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRN  862
            LGQ+YCK Q      +      + LV N + +SCK C     +S+D   GD+    F + 
Sbjct  809  LGQLYCKRQ-LWDEAESELNYARDLVKNDATISCKLCSLTLGISVDMQVGDLSWSLFEKK  867

Query  863  PENSTSQELACAKEKYKSAVDKL  931
                 +  L+     Y+SA+DKL
Sbjct  868  IHKQITAGLSNTLGMYQSAIDKL  890



>ref|XP_008679270.1| PREDICTED: separase isoform X2 [Zea mays]
Length=2208

 Score =   142 bits (359),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 160/323 (50%), Gaps = 20/323 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C LP++E  +    +H G      E+W N  K   P L  F Q   +  AL   + C H 
Sbjct  923   CYLPLDERFLSIAKEHLGVCCHDIEFWINCFKGDHPSLCMFLQR-TLPSALFIPQSCKHP  981

Query  182   -----AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALS  346
                  +F+    S D+V   AS L+S    +  S FL+  LYYDLSE++   GQL +A S
Sbjct  982   FGRQFSFV---TSVDEVSKVASSLVSGDTSNEQSTFLAGCLYYDLSEKVFSRGQLFQAFS  1038

Query  347   YAKEAYRLRHAL------LNRNFLCHTEQQIENC-RLVSFKICDSVATESWFCGDVSSDF  505
             Y  +A  LR  L      +N     + E+Q  +C + +S ++C     E W     S + 
Sbjct  1039  YGNKALHLRKKLLKKKFKINSGISGNMERQ--HCGQDISLEVCGPTIVEIWPNSSSSVNT  1096

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             +   LTPWNVL+CYL S LQV  ++E++GNG  A+ LLQ GK+IS    L +F + F+  
Sbjct  1097  KDFFLTPWNVLRCYLESTLQVAMMHELIGNGAEAEVLLQTGKEISNFHGLSVFCIVFTSF  1156

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRN  862
             LGQ+YCK Q      +      + LV N + +SCK C     +S+D   GD+    F + 
Sbjct  1157  LGQLYCKRQ-LWDEAESELNYARDLVKNDATISCKLCSLTLGISVDMQVGDLSWSLFEKK  1215

Query  863   PENSTSQELACAKEKYKSAVDKL  931
                  +  L+     Y+SA+DKL
Sbjct  1216  IHKQITAGLSNTLGMYQSAIDKL  1238



>ref|XP_008679269.1| PREDICTED: separase isoform X1 [Zea mays]
Length=2209

 Score =   142 bits (359),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 160/323 (50%), Gaps = 20/323 (6%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
             C LP++E  +    +H G      E+W N  K   P L  F Q   +  AL   + C H 
Sbjct  923   CYLPLDERFLSIAKEHLGVCCHDIEFWINCFKGDHPSLCMFLQR-TLPSALFIPQSCKHP  981

Query  182   -----AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALS  346
                  +F+    S D+V   AS L+S    +  S FL+  LYYDLSE++   GQL +A S
Sbjct  982   FGRQFSFV---TSVDEVSKVASSLVSGDTSNEQSTFLAGCLYYDLSEKVFSRGQLFQAFS  1038

Query  347   YAKEAYRLRHAL------LNRNFLCHTEQQIENC-RLVSFKICDSVATESWFCGDVSSDF  505
             Y  +A  LR  L      +N     + E+Q  +C + +S ++C     E W     S + 
Sbjct  1039  YGNKALHLRKKLLKKKFKINSGISGNMERQ--HCGQDISLEVCGPTIVEIWPNSSSSVNT  1096

Query  506   ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCI  685
             +   LTPWNVL+CYL S LQV  ++E++GNG  A+ LLQ GK+IS    L +F + F+  
Sbjct  1097  KDFFLTPWNVLRCYLESTLQVAMMHELIGNGAEAEVLLQTGKEISNFHGLSVFCIVFTSF  1156

Query  686   LGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRN  862
             LGQ+YCK Q      +      + LV N + +SCK C     +S+D   GD+    F + 
Sbjct  1157  LGQLYCKRQ-LWDEAESELNYARDLVKNDATISCKLCSLTLGISVDMQVGDLSWSLFEKK  1215

Query  863   PENSTSQELACAKEKYKSAVDKL  931
                  +  L+     Y+SA+DKL
Sbjct  1216  IHKQITAGLSNTLGMYQSAIDKL  1238



>gb|EEC74078.1| hypothetical protein OsI_09098 [Oryza sativa Indica Group]
Length=2183

 Score =   137 bits (346),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/248 (41%), Positives = 144/248 (58%), Gaps = 8/248 (3%)
 Frame = +2

Query  212   KVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHALLNR  391
             +V   AS L+S+  ++  S FL+ YLY+DLSERL+  G+L +A SY KEA  LR  LL +
Sbjct  944   EVDSVASSLVSDATVNDQSTFLAGYLYFDLSERLLSRGELFQAFSYGKEALHLRKKLLRK  1003

Query  392   NFL------CHTEQQIENCR-LVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQCYL  550
              F          E Q    +  VS +   S  TE W     S+      LTPWNVLQCYL
Sbjct  1004  KFKFNFGKFTSGEAQCSGGKNSVSLEAWGSTITEIWPDSTRSTGTRDSFLTPWNVLQCYL  1063

Query  551   GSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwelae  730
              S+LQV  ++E++GNG  A+ LL+ GKDIS  Q L +F V F+  LGQIY K Q W+ AE
Sbjct  1064  DSILQVALLHELIGNGAEAEVLLRTGKDISQFQGLPVFGVLFASALGQIYRKRQQWDTAE  1123

Query  731   keaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACAKEK  907
              E   A+  L  N++ +SCK C+   ++S+D   GD++   + ++ +  ++  L+ A   
Sbjct  1124  GELKYARDLLAQNATFISCKLCKLTLDISLDVQAGDLFWSLYEKDFQKQSAGNLSNALGM  1183

Query  908   YKSAVDKL  931
             Y+SA+DKL
Sbjct  1184  YQSALDKL  1191



>gb|EEE57877.1| hypothetical protein OsJ_08535 [Oryza sativa Japonica Group]
Length=2183

 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 143/248 (58%), Gaps = 8/248 (3%)
 Frame = +2

Query  212   KVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHALLNR  391
             +V   AS L+S+  ++  S FL+ YLY+DLSERL+  G+L +A SY KEA  LR  LL +
Sbjct  944   EVDSVASSLVSDATVNDQSTFLAGYLYFDLSERLLSRGELFQAFSYGKEALHLRKKLLRK  1003

Query  392   NFL------CHTEQQIENCR-LVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQCYL  550
              F          E Q    +  VS +   S  TE W     S+      LTPW VLQCYL
Sbjct  1004  KFKFNFGKFTSGEAQCSGGQNSVSLEAWGSTITEIWPDSTRSTGTRDSFLTPWTVLQCYL  1063

Query  551   GSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwelae  730
              S+LQV  ++E++GNG  A+ LL+ GKDIS  Q L +F V F+  LGQIY K Q W+ AE
Sbjct  1064  DSILQVALLHELIGNGAEAEVLLRTGKDISQFQGLPVFGVLFASALGQIYRKRQQWDTAE  1123

Query  731   keaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACAKEK  907
              E   A+  L  N++ +SCK C+   ++S+D   GD++   + ++ +  ++  L+ A   
Sbjct  1124  GELKYARDLLAQNATFISCKLCKLTLDISLDVQAGDLFWSLYEKDFQKQSAGNLSNALGM  1183

Query  908   YKSAVDKL  931
             Y+SA+DKL
Sbjct  1184  YQSALDKL  1191



>ref|XP_010439035.1| PREDICTED: separase-like isoform X1 [Camelina sativa]
 ref|XP_010439036.1| PREDICTED: separase-like isoform X1 [Camelina sativa]
Length=411

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 123/238 (52%), Gaps = 42/238 (18%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C  PI+   ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  191  CLSPISVTFIRTLSENCGDKSTCIHFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  250

Query  182  AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                 DI+ D +K  AS+LIS+                              ALSYAKEA
Sbjct  251  GPFQSDITTDDIKDAASELISS------------------------------ALSYAKEA  280

Query  362  YRLRHALLNRNFLCHTEQQIENCR------------LVSFKICDSVATESWFCGDVSSDF  505
            YR+R  +L++ F    E+Q E               + +F++   VAT+ W CG+   D 
Sbjct  281  YRIRTLILHQKFKYSAEKQFEKHNDAGKISKMRTFGIKNFQVYSWVATDFWPCGNFLWDV  340

Query  506  ESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFS  679
              C L+PW+VLQCYL S LQVG +N+++GNG  A+  L  GK ISC+QSL  F V+FS
Sbjct  341  NCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKAISCSQSLFPFAVAFS  398



>ref|XP_010103846.1| hypothetical protein L484_024148 [Morus notabilis]
 gb|EXB97287.1| hypothetical protein L484_024148 [Morus notabilis]
Length=1414

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 97/156 (62%), Gaps = 12/156 (8%)
 Frame = +2

Query  257  SSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHALLNRNFLCHTEQQIE----  424
            +S SAF++ YL+ DLSERLI +G++TEAL+YAKEA+RLR  +    F    EQQ E    
Sbjct  540  ASSSAFVAGYLFSDLSERLISNGRITEALTYAKEAHRLRSKMFEEKFKFSVEQQPEKSNE  599

Query  425  --------NCRLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQCYLGSMLQVGTIN  580
                    +C L   ++  SVA E W    +S D ESC L+PW +LQCYL S LQVG   
Sbjct  600  TRDVVQKLSCSLHDLQVRRSVANEFWSFDTISLDLESCYLSPWIILQCYLESTLQVGIAY  659

Query  581  EMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCIL  688
            E++GNG  A+     GK I+ +Q+L LF++SFS +L
Sbjct  660  ELIGNGAEAEGYYLWGKSIAHSQNLPLFMISFSSVL  695



>ref|XP_002454624.1| hypothetical protein SORBIDRAFT_04g034460 [Sorghum bicolor]
 gb|EES07600.1| hypothetical protein SORBIDRAFT_04g034460 [Sorghum bicolor]
Length=1945

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 146/260 (56%), Gaps = 6/260 (2%)
 Frame = +2

Query  200   ISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHA  379
             +S D V   AS L+S V  +  S FL++ LYYDLSERL   G+L +A SYAKE+  LR  
Sbjct  856   LSFDDVSKAASSLVSEVTSNDQSIFLASCLYYDLSERLYSRGELFQAFSYAKESLHLRKK  915

Query  380   LLNRNFLCHT----EQQIENCRL-VSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQC  544
             LL + F   +      + + CR   S ++C     E W     S+      LTPW+VL+ 
Sbjct  916   LLKKKFKLKSGISGNMERKPCRQDFSLEVCGPTIVEIWPDSSRSASMRDSFLTPWSVLRY  975

Query  545   YLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwel  724
             YL S LQV  + E++GN   A+  L+ GK+IS      +F + F+  LGQ+YCK+QLW+ 
Sbjct  976   YLESTLQVAMMYELIGNAAEAEVHLRTGKEISNFHGFPVFCIVFTSCLGQLYCKQQLWDE  1035

Query  725   aekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACAK  901
             A+ E + A+  LV N +++SC+ C+    +S+D   GD+    F +  +  ++ +L+ A 
Sbjct  1036  AKSEFNLARDLLVKNDAIISCRICKLTLGISVDVQVGDLSWNLFEKKFQKQSTADLSNAL  1095

Query  902   EKYKSAVDKLALSEWNNFSG  961
               Y+ A++KL  ++   F+G
Sbjct  1096  RMYRCAIEKLNSTDLEYFNG  1115



>gb|AFW64316.1| hypothetical protein ZEAMMB73_008938 [Zea mays]
Length=2092

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 132/251 (53%), Gaps = 11/251 (4%)
 Frame = +2

Query  203   SDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHAL  382
             S D+V   AS L+S    +  S FL+  LYYDLSE++   GQL +A SY  +A  LR  L
Sbjct  874   SVDEVSKVASSLVSGDTSNEQSTFLAGCLYYDLSEKVFSRGQLFQAFSYGNKALHLRKKL  933

Query  383   ------LNRNFLCHTEQQIENC-RLVSFKICDSVATESWFCGDVSSDFESCKLTPWNVLQ  541
                   +N     + E+Q  +C + +S ++C     E W     S + +   LTPWNVL+
Sbjct  934   LKKKFKINSGISGNMERQ--HCGQDISLEVCGPTIVEIWPNSSSSVNTKDFFLTPWNVLR  991

Query  542   CYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwe  721
             CYL S LQV  ++E++GNG  A+ LLQ GK+IS    L +F + F+  LGQ+YCK Q   
Sbjct  992   CYLESTLQVAMMHELIGNGAEAEVLLQTGKEISNFHGLSVFCIVFTSFLGQLYCKRQ-LW  1050

Query  722   laekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACA  898
                +      + LV N + +SCK C     +S+D   GD+    F +      +  L+  
Sbjct  1051  DEAESELNYARDLVKNDATISCKLCSLTLGISVDMQVGDLSWSLFEKKIHKQITAGLSNT  1110

Query  899   KEKYKSAVDKL  931
                Y+SA+DKL
Sbjct  1111  LGMYQSAIDKL  1121



>ref|XP_008378851.1| PREDICTED: separase-like [Malus domestica]
Length=770

 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            CA P+NE  +  +S H GE++ S  +W + LK+S+ LL+ FQ SF  +F   S+ PCNH+
Sbjct  509  CASPVNETFIMNISDHCGELSKSISFWIDCLKDSKQLLLAFQHSFSFLFPNFSRGPCNHE  568

Query  182  AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
            +      SD +VK  A +LIS  P+S+ SA+++ YLYYDLSERL+ +G+L EALSYAKEA
Sbjct  569  SLFR---SDTEVKQAAFELISQAPVSTWSAYVAGYLYYDLSERLVSNGRLIEALSYAKEA  625

Query  362  YRLRHAL  382
            +    +L
Sbjct  626  HNFSQSL  632


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 9/149 (6%)
 Frame = +2

Query  503  FESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSC  682
            FE     P +    Y+   L       ++ NG + + L    +  + +QSL LF   FS 
Sbjct  582  FELISQAPVSTWSAYVAGYLYYDLSERLVSNGRLIEALSYAKEAHNFSQSLPLFTNVFST  641

Query  683  ILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFGDIYRKQFCR  859
            +LG++Y K+Q W+LA+KE   AK+   D+SS +SC KCR + E +++ +F  I       
Sbjct  642  VLGKLYHKQQHWDLAQKELQSAKEYFGDSSSDISCWKCRLMLEATVNPVFLKI-------  694

Query  860  NPENSTSQELACAKEKYKSAVDKLALSEW  946
               +++S +L+ A+  YKSA+ KL LSEW
Sbjct  695  -QGSTSSDKLSHAENLYKSAIAKLNLSEW  722



>gb|ABN08433.1| peptidase , related [Medicago truncatula]
Length=420

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 125/220 (57%), Gaps = 18/220 (8%)
 Frame = +2

Query  335  EALSYAKEAYRLRHALLNRNFLCHTEQQ--IENCRLVSF-----------KICDSVATES  475
            +ALS+AKEA+RL   L    F  H  Q+   EN   V F           ++  SV  E 
Sbjct  6    QALSFAKEAHRLHDQLFKVKFR-HIFQKHNEENNITVDFLKNLMEGVDKIEVDTSVVREI  64

Query  476  WFCGDVSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSL  655
            +    +S D +   L+PW ++Q YL S LQVG I E++G+G  A+  L+ GK ISC   L
Sbjct  65   FLFDSISRDLQDNYLSPWKIMQSYLESTLQVGAIYEIIGDGIEAETYLRWGKAISCLLQL  124

Query  656  RLFIVSFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSC-KCRALYEVSIDQLFG  832
             LFIV+FS +LG++Y  ++LW+ A+KE   A++ L DNS+   C KC+ + EV++    G
Sbjct  125  PLFIVAFSSLLGKLYATKRLWDSADKELQLAEQILNDNSTPFCCSKCKLILEVTLHGYLG  184

Query  833  DIYRKQFCRNPENSTSQELACAKEKYKSAVDKLALSEWNN  952
            D+ + +F    E   S+E   AK  Y SA++KL LSEW N
Sbjct  185  DLCQSKF-NACEEGVSEE--TAKNWYTSALNKLTLSEWKN  221



>emb|CCG89179.1| separase protein [Picea abies]
Length=2307

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 173/380 (46%), Gaps = 33/380 (9%)
 Frame = +2

Query  2     CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQS--FHMIFALSSQRPCN  175
             C + +++ S+  L + FG   +S  +W N +K++   ++ FQQ   +     + S R   
Sbjct  945   CCVSVSQKSLSILMEKFGIAVNSINFWENCVKDNPGSVLEFQQKLMYDEFLEVQSDRGLE  1004

Query  176   HKAFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAK  355
               +      + + +K  A  L+SN   +  SAFL++ ++Y LS++    GQL  AL Y+K
Sbjct  1005  TSSLSSSVCTVEVLKERALTLVSNGLKTRESAFLASSMFYMLSKKYRRKGQLLAALRYSK  1064

Query  356   EAYRLRHALLNRNFLCHTEQQIENCR--------------LVSFKICDSVATESWFC-GD  490
             EA  +R  +L+R F    ++ I+  R               +  +   SV T  W    D
Sbjct  1065  EALLIRTKVLHRKFKFLDKKSIQVARDNSAEFKNESNEVGGIYLEALGSVTTNVWPTFSD  1124

Query  491   VSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIV  670
                D E    + W VL  YL +++QVG + EM+G+G+ A+++ Q G  IS  Q L L   
Sbjct  1125  AEKDGEYWP-SQWVVLGNYLENLMQVGVLCEMVGDGDEAENIFQEGLKISNAQDLPLGQA  1183

Query  671   SFSCILGQIYCKEQlwelaekeaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRK  847
             +F   LG+IY K   WE AE+    AK+        + CK C+   E ++D   GD+ R 
Sbjct  1184  AFGSCLGEIYRKRHSWEKAEEILKNAKQVFHRQDLKLVCKLCQVTVEATLDMRIGDLVR-  1242

Query  848   QFCRNPENSTSQELACAKEKYKSAVDKLALSEWNNFSGGPKAVGSEHAKHESCSLSYSAT  1027
                R P+  T+       E   SA+D   L+  N      KA  +E       SL Y+A 
Sbjct  1243  ---RCPKEKTNVHFP---ENPTSAIDVYTLARENLCKEMSKAQLAE-------SLGYTAI  1289

Query  1028  DHMVLKEVASRNRKHENAVE  1087
             D    +    R +K    V+
Sbjct  1290  DVKKKRGTGQRGQKSSRRVD  1309



>gb|ABN08434.1| peptidase , related [Medicago truncatula]
Length=736

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C  P+NE  +      F ++++   +W + LK +Q  L+GFQQ+F  +FA S +  C+H 
Sbjct  605  CVSPVNEAFILNSLDDFSDLSN-INFWIHNLKGNQSSLIGFQQNFSFLFASSHRSSCDHG  663

Query  182  AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALS  346
            +    +IS D+V+  A  LISNVP+ +   FL+ YLY DL  RLI +GQL EA S
Sbjct  664  SSFQVEISVDEVQKAALKLISNVPVPNHCTFLAGYLYSDLCGRLIANGQLIEASS  718



>ref|XP_010439037.1| PREDICTED: separase-like isoform X2 [Camelina sativa]
Length=348

 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 75/128 (59%), Gaps = 0/128 (0%)
 Frame = +2

Query  2    CALPINEFSVQALSKHFGEVTDSFEYWTNYLKESQPLLVGFQQSFHMIFALSSQRPCNHK  181
            C  PI+   ++ LS++ G+ +    +W + LK+S+  L+GFQQ+FH +     +     +
Sbjct  191  CLSPISVTFIRTLSENCGDKSTCIHFWIDCLKDSKAKLIGFQQNFHDLHNNFLRASNKDE  250

Query  182  AFLPPDISDDKVKLTASDLISNVPLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEA  361
                 DI+ D +K  AS+LIS+  LS  S+F++AYLYYDL ERLI  G+++E   +  + 
Sbjct  251  GPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCERLISFGKISEETLFHMQK  310

Query  362  YRLRHALL  385
              + + LL
Sbjct  311  KPIGYGLL  318



>ref|XP_001759110.1| predicted protein [Physcomitrella patens]
 gb|EDQ76179.1| predicted protein [Physcomitrella patens]
Length=2426

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 81/173 (47%), Gaps = 26/173 (15%)
 Frame = +2

Query  251   PLSSGSAFLSAYLYYDLSERLILSGQLTEALSYAKEAYRLRHALLNRNF------LCHTE  412
             P SSG     A L+Y L+E  +  G+L  A  YAKE+  LR  L++R F         T+
Sbjct  1049  PKSSGEVSKLAILFYMLAEHALDEGKLRVACKYAKESLNLRLRLVSRMFQTKYTGTVSTD  1108

Query  413   QQIENCRLVS----------FKICDSVATESWFCGDVSS-----DFESCKLTPWNVLQCY  547
                +N  + +            + DSVAT +W    +SS     DFE     PW VL  Y
Sbjct  1109  SDSDNVEIEAAGQGKSKTGRLHVLDSVATRAW--PKLSSHAKPVDFEP---NPWRVLGDY  1163

Query  548   LGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCK  706
             + S++Q G I+E +G  + A      G  +S TQ+L L   +F   LG++  K
Sbjct  1164  VESLMQNGVISEKVGAVDDALARFSEGYSVSLTQNLPLARAAFKSCLGEVQRK  1216



>ref|XP_002451792.1| hypothetical protein SORBIDRAFT_04g007851 [Sorghum bicolor]
 gb|EES04768.1| hypothetical protein SORBIDRAFT_04g007851 [Sorghum bicolor]
Length=95

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  530  NVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKE  709
            N  +CYL S LQV  ++E++GNG  A+ LL+ GK+IS    L +F + F+  LGQ+YCK 
Sbjct  12   NFSRCYLESTLQVAMMHELIGNGAEAEVLLRTGKEISNLHGLSVFCIVFTSSLGQLYCKR  71

Query  710  Q  712
            Q
Sbjct  72   Q  72



>ref|XP_004967289.1| PREDICTED: uncharacterized protein LOC101782294 [Setaria italica]
Length=1776

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = +2

Query  551  GSMLQVGTINEMLGNGNVAKHLLQLGKDISCTQSLRLFIVSFSCILGQIYCKEQlwelae  730
            G + QV  ++E+ GN   A+ L++ GK+IS    L +F ++F+ +LGQ+Y K QLW+ AE
Sbjct  783  GHLSQVALMHELSGNDAEAEVLVRTGKEISHFHKLPVFHIAFTSLLGQLYRKRQLWDEAE  842

Query  731  keaheakkalVDNSSVVSCK-CRALYEVSIDQLFGDIYRKQFCRNPENSTSQELACAKEK  907
             E   A+  L +N S +SCK CR   ++S+D   GD          +  ++   + A  +
Sbjct  843  SELKYARDFLAENDSFISCKLCRLTLKISLDMKDGD----------KKHSTGNFSGALVR  892

Query  908  YKSAVDKLALSEW  946
            YK+A+DKL  +E+
Sbjct  893  YKAAMDKLNSTEF  905



>ref|XP_002964047.1| hypothetical protein SELMODRAFT_405667 [Selaginella moellendorffii]
 gb|EFJ34380.1| hypothetical protein SELMODRAFT_405667 [Selaginella moellendorffii]
Length=1550

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 94/187 (50%), Gaps = 4/187 (2%)
 Frame = +2

Query  287  LYYDLSERLILSGQLTEALSYAKEAYRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVA  466
            L + L+E  +  G L  A+  A E+ +LR  LLNR FL   +      +    +     A
Sbjct  550  LQFYLAEVFMQRGDLEMAIKLATESLQLRLKLLNRTFLVSKDVSHSTSK-SKVEAVGPSA  608

Query  467  TESWFCGDVSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCT  646
              SW    + S     + + W++L  YL S++QVG+++E LG  + A+   + G  ++  
Sbjct  609  VLSW--PSLLSRNTCYEFSQWHILGDYLESLMQVGSLHEKLGFSDEAERSFREGLWLAKA  666

Query  647  QSLRLFIVSFSCILGQIYCKEQlwelaekeaheakkalVD-NSSVVSCKCRALYEVSIDQ  823
            Q+L    + F+  LG+++ K+ +WE AE+   +A+K L + NS  V   C  + +  +  
Sbjct  667  QNLTFSCIRFTSALGEVHRKQHMWEHAEEGLKDAEKMLEELNSGNVCAGCITMEKCLLKL  726

Query  824  LFGDIYR  844
             FGD+ R
Sbjct  727  RFGDLAR  733



>ref|XP_002975469.1| hypothetical protein SELMODRAFT_442839 [Selaginella moellendorffii]
 gb|EFJ23670.1| hypothetical protein SELMODRAFT_442839 [Selaginella moellendorffii]
Length=1664

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 106/217 (49%), Gaps = 5/217 (2%)
 Frame = +2

Query  287  LYYDLSERLILSGQLTEALSYAKEAYRLRHALLNRNFLCHTEQQIENCRLVSFKICDSVA  466
            L + L+E  +  G L  A+  A E+ +LR  LLNR FL   +      +    +     A
Sbjct  664  LQFYLAEVFMQRGDLEMAIKLATESLQLRLKLLNRTFLVSKDVSHSTSK-SKVEAVGPSA  722

Query  467  TESWFCGDVSSDFESCKLTPWNVLQCYLGSMLQVGTINEMLGNGNVAKHLLQLGKDISCT  646
              SW    + S     + + W++L  YL S++QVG+++E LG  + A+   + G  ++  
Sbjct  723  VLSW--PSLLSRNTCYEFSQWHILGDYLESLMQVGSLHEKLGFSDEAERSFREGLWLAKA  780

Query  647  QSLRLFIVSFSCILGQIYCKEQlwelaekeaheakkalVD-NSSVVSCKCRALYEVSIDQ  823
            Q+L    + F+  LG+++ K+ +WE AE+   +A+K L + NS  V   C  + +  +  
Sbjct  781  QNLTFSCIRFTSALGEVHRKQHMWEHAEEGLKDAEKMLEELNSGNVCAGCITMEKCLLKL  840

Query  824  LFGDIYRKQFCRNPEN-STSQELACAKEKYKSAVDKL  931
             FGD+ R     +  N  T  +L  A   Y+ A++ L
Sbjct  841  RFGDLARHSPKLDGGNICTKTKLDIALMHYEFAIEAL  877



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2665779346464