BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8692_g1_i1 len=870 path=[848:0-438 1287:439-869]

Length=870
                                                                      Score     E

emb|CDP08276.1|  unnamed protein product                                347   2e-116   
ref|XP_004955465.1|  PREDICTED: glutathione S-transferase 3-like        300   3e-98    
gb|EMS47858.1|  putative glutathione S-transferase                      290   3e-94    
ref|XP_002459355.1|  hypothetical protein SORBIDRAFT_02g003090          289   5e-94    Sorghum bicolor [broomcorn]
dbj|BAK02040.1|  predicted protein                                      285   2e-92    
gb|EMT21593.1|  hypothetical protein F775_25446                         278   1e-89    
ref|XP_004955464.1|  PREDICTED: probable glutathione S-transferas...    263   1e-83    
gb|EMT03166.1|  hypothetical protein F775_06717                         262   6e-83    
gb|EMS47854.1|  putative glutathione S-transferase                      261   9e-83    
gb|EMT21595.1|  hypothetical protein F775_06172                         261   1e-82    
gb|EMT21594.1|  hypothetical protein F775_27374                         259   2e-82    
gb|EMS47856.1|  putative glutathione S-transferase                      259   2e-80    
ref|XP_006584638.1|  PREDICTED: glutathione S-transferase GST 9 i...    250   7e-79    
dbj|BAJ97963.1|  predicted protein                                      250   1e-78    
ref|NP_001058907.2|  Os07g0152700                                       249   2e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451814.1|  PREDICTED: probable glutathione S-transferase      247   9e-78    
ref|XP_009347994.1|  PREDICTED: probable glutathione S-transferase      247   1e-77    
gb|KHG29593.1|  putative glutathione S-transferase                      247   1e-77    
gb|AFK34240.1|  unknown                                                 247   1e-77    
ref|XP_010060808.1|  PREDICTED: probable glutathione S-transferase      246   2e-77    
gb|AHI54570.1|  glutathione S-transferase                               246   4e-77    
ref|XP_004147763.1|  PREDICTED: probable glutathione S-transferas...    245   8e-77    
ref|XP_008775488.1|  PREDICTED: probable glutathione S-transferas...    244   1e-76    
ref|XP_004243193.1|  PREDICTED: probable glutathione S-transferas...    244   1e-76    
ref|XP_004251827.1|  PREDICTED: probable glutathione S-transferase      244   1e-76    
gb|EMT03167.1|  hypothetical protein F775_14055                         243   3e-76    
ref|XP_008775490.1|  PREDICTED: probable glutathione S-transferas...    243   4e-76    
ref|XP_006442220.1|  hypothetical protein CICLE_v10022164mg             243   4e-76    
dbj|BAB32446.2|  glutathione S-transferase                              243   4e-76    Matricaria chamomilla
ref|XP_007212030.1|  hypothetical protein PRUPE_ppa011202mg             243   5e-76    
ref|XP_010060812.1|  PREDICTED: probable glutathione S-transferase      242   9e-76    
ref|XP_009344316.1|  PREDICTED: probable glutathione S-transferase      242   1e-75    
ref|XP_009759844.1|  PREDICTED: probable glutathione S-transferas...    242   1e-75    
gb|EMS47855.1|  putative glutathione S-transferase                      242   1e-75    
ref|XP_009616058.1|  PREDICTED: probable glutathione S-transferase      242   1e-75    
ref|XP_011030768.1|  PREDICTED: probable glutathione S-transferase      242   1e-75    
ref|NP_001236486.1|  glutathione S-transferase GST 9                    241   2e-75    
ref|XP_004147764.1|  PREDICTED: probable glutathione S-transferas...    241   2e-75    
ref|XP_008382602.1|  PREDICTED: probable glutathione S-transferase      241   2e-75    
sp|P49332.1|GSTXC_TOBAC  RecName: Full=Probable glutathione S-tra...    241   3e-75    Nicotiana tabacum [American tobacco]
ref|XP_010060816.1|  PREDICTED: glutathione S-transferase U25-like      241   3e-75    
ref|XP_010062724.1|  PREDICTED: probable glutathione S-transferase      243   3e-75    
ref|XP_006349999.1|  PREDICTED: probable glutathione S-transferas...    241   4e-75    
ref|XP_004488707.1|  PREDICTED: probable glutathione S-transferas...    241   4e-75    
ref|XP_008809358.1|  PREDICTED: probable glutathione S-transferas...    240   5e-75    
ref|XP_007212042.1|  hypothetical protein PRUPE_ppa011334mg             240   5e-75    
dbj|BAC21261.1|  glutathione S-transferase                              240   5e-75    Cucurbita maxima [Boston marrow]
ref|XP_008226264.1|  PREDICTED: probable glutathione S-transferase      240   6e-75    
ref|XP_010923803.1|  PREDICTED: probable glutathione S-transferas...    240   6e-75    
ref|XP_010694833.1|  PREDICTED: probable glutathione S-transferase      240   6e-75    
ref|XP_006478015.1|  PREDICTED: probable glutathione S-transferas...    240   7e-75    
ref|XP_008451810.1|  PREDICTED: probable glutathione S-transferas...    240   7e-75    
gb|ABG90381.2|  glutathione S-transferase                               240   8e-75    Caragana korshinskii
ref|XP_002532823.1|  glutathione s-transferase, putative                240   8e-75    Ricinus communis
ref|XP_010040784.1|  PREDICTED: probable glutathione S-transferase      239   1e-74    
ref|XP_006442222.1|  hypothetical protein CICLE_v10022154mg             239   2e-74    
ref|XP_010245128.1|  PREDICTED: probable glutathione S-transferase      239   2e-74    
ref|XP_010694823.1|  PREDICTED: probable glutathione S-transferase      238   2e-74    
ref|XP_007149244.1|  hypothetical protein PHAVU_005G053900g             238   3e-74    
gb|KDP24710.1|  hypothetical protein JCGZ_25701                         238   3e-74    
ref|XP_010103478.1|  putative glutathione S-transferase                 239   3e-74    
ref|XP_008226256.1|  PREDICTED: probable glutathione S-transferas...    238   3e-74    
ref|XP_008226266.1|  PREDICTED: probable glutathione S-transferas...    238   3e-74    
gb|KDP43662.1|  hypothetical protein JCGZ_24120                         238   4e-74    
ref|XP_007214172.1|  hypothetical protein PRUPE_ppa019045mg             238   4e-74    
ref|XP_010103480.1|  putative glutathione S-transferase                 238   4e-74    
ref|XP_007214499.1|  hypothetical protein PRUPE_ppa018063mg             238   4e-74    
pdb|2VO4|A  Chain A, Glutathione Transferase From Glycine Max           238   5e-74    
gb|KHN27766.1|  Glutathione S-transferase 3                             238   5e-74    
ref|XP_011030763.1|  PREDICTED: probable glutathione S-transferas...    238   5e-74    
ref|XP_010923805.1|  PREDICTED: probable glutathione S-transferase      238   5e-74    
ref|XP_002300487.1|  hypothetical protein POPTR_0001s42820g             238   5e-74    Populus trichocarpa [western balsam poplar]
ref|XP_002300483.2|  hypothetical protein POPTR_0001s42760g             238   6e-74    Populus trichocarpa [western balsam poplar]
ref|NP_001237713.1|  2,4-D inducible glutathione S-transferase          238   6e-74    
gb|ADB11314.1|  tau class glutathione transferase GSTU9                 238   6e-74    Populus trichocarpa [western balsam poplar]
gb|AFK35485.1|  unknown                                                 238   6e-74    
ref|XP_002264437.1|  PREDICTED: probable glutathione S-transferase      237   7e-74    Vitis vinifera
ref|XP_010911024.1|  PREDICTED: probable glutathione S-transferas...    237   8e-74    
ref|XP_007212046.1|  hypothetical protein PRUPE_ppa011371mg             236   1e-73    
gb|KHN26783.1|  Glutathione S-transferase 3                             237   1e-73    
ref|XP_004294219.1|  PREDICTED: probable glutathione S-transferas...    236   1e-73    
ref|XP_004243195.1|  PREDICTED: probable glutathione S-transferase      236   1e-73    
ref|XP_007149247.1|  hypothetical protein PHAVU_005G054100g             236   2e-73    
emb|CAA04391.1|  glutathione transferase                                236   2e-73    Carica papaya [mamon]
ref|XP_011036235.1|  PREDICTED: probable glutathione S-transferase      236   2e-73    
ref|XP_002317608.1|  glutathione transferase family protein             236   3e-73    Populus trichocarpa [western balsam poplar]
gb|EYU26249.1|  hypothetical protein MIMGU_mgv1a013392mg                236   3e-73    
ref|XP_008226272.1|  PREDICTED: probable glutathione S-transferas...    236   3e-73    
gb|AEF79856.1|  glutathione-S-transferase tau 1                         236   3e-73    
ref|XP_006477979.1|  PREDICTED: probable glutathione S-transferas...    236   3e-73    
gb|ACI42271.1|  glutathione S-transferase Tau2                          236   3e-73    Citrus sinensis [apfelsine]
gb|AFK42157.1|  unknown                                                 236   3e-73    
emb|CAI48072.1|  glutathione S-transferase/peroxidase                   236   3e-73    Capsicum chinense [bonnet pepper]
ref|XP_002262767.1|  PREDICTED: probable glutathione S-transferase      235   4e-73    Vitis vinifera
ref|XP_008226270.1|  PREDICTED: probable glutathione S-transferas...    235   5e-73    
ref|XP_002265110.1|  PREDICTED: probable glutathione S-transferase      235   5e-73    Vitis vinifera
ref|XP_002264825.1|  PREDICTED: probable glutathione S-transferas...    235   6e-73    Vitis vinifera
ref|XP_009354827.1|  PREDICTED: probable glutathione S-transferase      235   7e-73    
ref|XP_007212347.1|  hypothetical protein PRUPE_ppa014555mg             235   7e-73    
ref|XP_003634749.1|  PREDICTED: probable glutathione S-transferas...    235   7e-73    
ref|XP_010245130.1|  PREDICTED: probable glutathione S-transferas...    234   7e-73    
ref|XP_008226269.1|  PREDICTED: probable glutathione S-transferas...    234   8e-73    
ref|XP_007149246.1|  hypothetical protein PHAVU_005G054000g             234   8e-73    
ref|XP_004294220.1|  PREDICTED: probable glutathione S-transferas...    234   1e-72    
ref|XP_011013656.1|  PREDICTED: probable glutathione S-transferase      234   1e-72    
gb|KDO38596.1|  hypothetical protein CISIN_1g027727mg                   234   1e-72    
ref|XP_003634747.1|  PREDICTED: probable glutathione S-transferas...    234   1e-72    
ref|XP_010087162.1|  putative glutathione S-transferase parC            234   1e-72    
emb|CAN66702.1|  hypothetical protein VITISV_005451                     234   1e-72    Vitis vinifera
ref|XP_006364367.1|  PREDICTED: probable glutathione S-transferas...    234   1e-72    
emb|CAN83043.1|  hypothetical protein VITISV_027913                     234   1e-72    Vitis vinifera
gb|KHF99304.1|  putative glutathione S-transferase                      234   1e-72    
ref|XP_007213037.1|  hypothetical protein PRUPE_ppa020220mg             234   1e-72    
ref|XP_009776045.1|  PREDICTED: probable glutathione S-transferas...    234   2e-72    
ref|XP_003634746.1|  PREDICTED: probable glutathione S-transferase      234   2e-72    
ref|NP_001236181.1|  glutathione S-transferase 3                        234   2e-72    
ref|XP_003634751.1|  PREDICTED: probable glutathione S-transferase      234   2e-72    
ref|XP_002298935.2|  hypothetical protein POPTR_0001s42770g             235   2e-72    Populus trichocarpa [western balsam poplar]
gb|ADB11324.1|  tau class glutathione transferase GSTU33                234   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_004500374.1|  PREDICTED: probable glutathione S-transferas...    234   2e-72    
ref|XP_002263395.1|  PREDICTED: probable glutathione S-transferase      233   2e-72    Vitis vinifera
ref|XP_011098133.1|  PREDICTED: probable glutathione S-transferase      234   2e-72    
gb|ACJ85907.1|  unknown                                                 233   2e-72    Medicago truncatula
gb|AFK49533.1|  unknown                                                 233   2e-72    
ref|XP_003634752.1|  PREDICTED: probable glutathione S-transferas...    233   3e-72    
ref|XP_009612277.1|  PREDICTED: probable glutathione S-transferas...    233   3e-72    
ref|XP_003634776.1|  PREDICTED: probable glutathione S-transferas...    233   3e-72    
ref|XP_008775487.1|  PREDICTED: glutathione S-transferase 3-like        233   4e-72    
ref|XP_010103479.1|  putative glutathione S-transferase                 233   4e-72    
gb|ADB11312.1|  tau class glutathione transferase GSTU3                 233   4e-72    Populus trichocarpa [western balsam poplar]
ref|XP_002298937.1|  hypothetical protein POPTR_0001s42780g             233   5e-72    Populus trichocarpa [western balsam poplar]
ref|XP_011012342.1|  PREDICTED: probable glutathione S-transferase      233   6e-72    
ref|XP_010644726.1|  PREDICTED: probable glutathione S-transferas...    232   6e-72    
emb|CDP06112.1|  unnamed protein product                                232   7e-72    
ref|XP_010941008.1|  PREDICTED: glutathione S-transferase 3-like        232   7e-72    
gb|EMS47857.1|  putative glutathione S-transferase                      234   7e-72    
ref|NP_001236312.1|  glutathione transferase                            232   7e-72    
gb|ADB11352.1|  tau class glutathione transferase GSTU15                232   7e-72    Populus trichocarpa [western balsam poplar]
ref|XP_010923799.1|  PREDICTED: probable glutathione S-transferas...    232   7e-72    
gb|ADC95628.1|  glutathione S-transferase                               232   7e-72    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010044072.1|  PREDICTED: probable glutathione S-transferase      232   8e-72    
gb|ABK94892.1|  unknown                                                 232   8e-72    Populus trichocarpa [western balsam poplar]
ref|XP_007149248.1|  hypothetical protein PHAVU_005G054200g             232   9e-72    
gb|AFK35601.1|  unknown                                                 232   9e-72    
gb|AAO61854.1|  glutathione S-transferase U1                            232   9e-72    Malva pusilla
gb|ACJ84004.1|  unknown                                                 232   1e-71    Medicago truncatula
ref|XP_009418988.1|  PREDICTED: probable glutathione S-transferas...    232   1e-71    
gb|ACL80571.1|  glutathione S-transferase                               232   1e-71    Glycine max [soybeans]
gb|ABL84692.1|  glutathione S-transferase                               232   1e-71    Vitis vinifera
ref|XP_007022199.1|  Glutathione S-transferase TAU 19                   231   1e-71    
ref|XP_011082829.1|  PREDICTED: probable glutathione S-transferase      231   1e-71    
ref|XP_006836372.1|  hypothetical protein AMTR_s00092p00118580          231   1e-71    
ref|XP_009757657.1|  PREDICTED: probable glutathione S-transferas...    231   1e-71    
gb|KEH38377.1|  glutathione S-transferase, amino-terminal domain ...    231   2e-71    
gb|AFK45916.1|  unknown                                                 231   2e-71    
gb|AEB77867.1|  glutathione S-transferase protein                       231   2e-71    
gb|KEH38383.1|  glutathione S-transferase, amino-terminal domain ...    231   2e-71    
ref|XP_011098132.1|  PREDICTED: probable glutathione S-transferase      231   2e-71    
ref|XP_009757658.1|  PREDICTED: probable glutathione S-transferase      231   2e-71    
gb|AAR26529.1|  glutathione S-transferase 2                             231   2e-71    Glycine max [soybeans]
gb|KHN27773.1|  Putative glutathione S-transferase                      231   2e-71    
ref|XP_008794506.1|  PREDICTED: probable glutathione S-transferas...    231   2e-71    
ref|XP_010923806.1|  PREDICTED: glutathione S-transferase U19-like      231   3e-71    
ref|XP_008226263.1|  PREDICTED: probable glutathione S-transferase      231   3e-71    
ref|NP_001275790.1|  glutathione S-transferase                          231   3e-71    
emb|CDP11579.1|  unnamed protein product                                231   3e-71    
gb|EYU26250.1|  hypothetical protein MIMGU_mgv1a022085mg                231   3e-71    
ref|NP_001238712.1|  uncharacterized protein LOC100500477               230   3e-71    
ref|XP_002262644.1|  PREDICTED: probable glutathione S-transferase      230   4e-71    Vitis vinifera
ref|XP_009614585.1|  PREDICTED: probable glutathione S-transferase      230   4e-71    
ref|NP_001234157.1|  glutathione S-transferase-like protein             230   4e-71    
ref|XP_006442221.1|  hypothetical protein CICLE_v10022193mg             230   4e-71    
emb|CAC24549.1|  glutathione S-transferase                              230   4e-71    Cichorium intybus x Cichorium endivia
gb|ADB11349.1|  tau class glutathione transferase GSTU8                 230   5e-71    Populus trichocarpa [western balsam poplar]
ref|NP_001238691.1|  glutathione S-transferase                          230   5e-71    
gb|EYU26251.1|  hypothetical protein MIMGU_mgv1a013400mg                230   5e-71    
gb|KHG06513.1|  putative glutathione S-transferase                      230   6e-71    
gb|AFK44154.1|  unknown                                                 230   6e-71    
ref|XP_004981530.1|  PREDICTED: probable glutathione S-transferas...    230   6e-71    
ref|XP_011030762.1|  PREDICTED: probable glutathione S-transferas...    230   6e-71    
gb|ACU15760.1|  unknown                                                 230   6e-71    Glycine max [soybeans]
ref|XP_004488706.1|  PREDICTED: probable glutathione S-transferas...    230   6e-71    
gb|ACU15945.1|  unknown                                                 229   8e-71    Glycine max [soybeans]
gb|KDP43660.1|  hypothetical protein JCGZ_24118                         229   8e-71    
gb|EYU26253.1|  hypothetical protein MIMGU_mgv1a013454mg                229   8e-71    
ref|XP_002263638.1|  PREDICTED: probable glutathione S-transferase      229   9e-71    Vitis vinifera
ref|XP_004295706.1|  PREDICTED: probable glutathione S-transferas...    229   9e-71    
gb|ACJ84159.1|  unknown                                                 229   9e-71    Medicago truncatula
ref|XP_002300485.1|  hypothetical protein POPTR_0001s42800g             229   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_002266007.2|  PREDICTED: probable glutathione S-transferase      229   1e-70    Vitis vinifera
ref|XP_010044074.1|  PREDICTED: probable glutathione S-transferas...    229   1e-70    
gb|ADB11347.1|  tau class glutathione transferase GSTU5                 229   1e-70    Populus trichocarpa [western balsam poplar]
gb|KEH38387.1|  glutathione S-transferase, amino-terminal domain ...    229   1e-70    
ref|XP_004500375.1|  PREDICTED: probable glutathione S-transferas...    229   1e-70    
ref|XP_011041780.1|  PREDICTED: probable glutathione S-transferas...    229   2e-70    
ref|XP_007214387.1|  hypothetical protein PRUPE_ppb009345mg             229   2e-70    
ref|XP_010087160.1|  putative glutathione S-transferase                 229   2e-70    
gb|AFK39936.1|  unknown                                                 229   2e-70    
ref|XP_007212678.1|  hypothetical protein PRUPE_ppa018428mg             228   2e-70    
ref|XP_006387538.1|  hypothetical protein POPTR_0878s00210g             228   2e-70    
gb|AFK35203.1|  unknown                                                 228   2e-70    
ref|XP_006829366.1|  hypothetical protein AMTR_s00384p00012000          228   2e-70    
ref|XP_006366776.1|  PREDICTED: probable glutathione S-transferas...    228   3e-70    
ref|XP_009591607.1|  PREDICTED: probable glutathione S-transferase      228   3e-70    
ref|XP_010041120.1|  PREDICTED: glutathione S-transferase U25-like      228   3e-70    
gb|EYU26247.1|  hypothetical protein MIMGU_mgv1a013356mg                228   3e-70    
ref|XP_010245129.1|  PREDICTED: probable glutathione S-transferas...    228   4e-70    
ref|XP_008794561.1|  PREDICTED: probable glutathione S-transferase      228   4e-70    
ref|NP_001236587.1|  uncharacterized protein LOC100527221               228   4e-70    
ref|XP_004243196.1|  PREDICTED: probable glutathione S-transferase      228   5e-70    
ref|XP_010644811.1|  PREDICTED: probable glutathione S-transferase      228   5e-70    
ref|XP_009781253.1|  PREDICTED: probable glutathione S-transferase      227   5e-70    
ref|XP_010476861.1|  PREDICTED: glutathione S-transferase U24-like      228   5e-70    
emb|CDP20885.1|  unnamed protein product                                227   5e-70    
ref|XP_006305593.1|  hypothetical protein CARUB_v10010257mg             227   6e-70    
ref|XP_011013655.1|  PREDICTED: probable glutathione S-transferase      227   6e-70    
gb|ADB11329.1|  tau class glutathione transferase GSTU54                227   6e-70    Populus trichocarpa [western balsam poplar]
ref|XP_007133435.1|  hypothetical protein PHAVU_011G178400g             227   6e-70    
gb|ABG73420.1|  glutathione S-transferase isoform 2                     227   8e-70    Castanea crenata [Japanese chestnut]
ref|XP_009420693.1|  PREDICTED: probable glutathione S-transferas...    227   8e-70    
ref|XP_010428964.1|  PREDICTED: glutathione S-transferase U19-like      227   9e-70    
ref|XP_010087165.1|  putative glutathione S-transferase                 227   1e-69    
gb|ADB11350.1|  putative tau class glutathione transferase GSTU10       226   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_010923804.1|  PREDICTED: probable glutathione S-transferas...    226   1e-69    
emb|CDP06114.1|  unnamed protein product                                226   1e-69    
ref|XP_010060804.1|  PREDICTED: glutathione S-transferase U25-like      226   1e-69    
ref|NP_173161.1|  glutathione S-transferase TAU 25                      226   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226262.1|  PREDICTED: probable glutathione S-transferase      226   1e-69    
gb|ACG33497.1|  glutathione S-transferase                               226   1e-69    Zea mays [maize]
ref|XP_004955467.1|  PREDICTED: probable glutathione S-transferas...    226   1e-69    
ref|NP_001146786.1|  GST6 protein                                       226   1e-69    Zea mays [maize]
ref|NP_173160.1|  glutathione S-transferase TAU 24                      226   1e-69    Arabidopsis thaliana [mouse-ear cress]
gb|ADB11318.1|  tau class glutathione transferase GSTU16                226   2e-69    Populus trichocarpa [western balsam poplar]
ref|XP_002270159.1|  PREDICTED: probable glutathione S-transferase      226   2e-69    Vitis vinifera
gb|ACH63238.1|  glutathione-S-transferase 2                             226   2e-69    Rheum australe [Himalayan rhubarb]
gb|AAB38965.1|  auxin-induced protein                                   226   2e-69    Eucalyptus globulus [blue gum]
emb|CDX81807.1|  BnaC08g37940D                                          226   2e-69    
ref|XP_010060810.1|  PREDICTED: probable glutathione S-transferas...    226   2e-69    
ref|XP_004251828.1|  PREDICTED: probable glutathione S-transferas...    226   2e-69    
ref|XP_010044071.1|  PREDICTED: glutathione S-transferase U19-like      226   3e-69    
ref|XP_006389991.1|  hypothetical protein EUTSA_v10019118mg             226   3e-69    
ref|XP_004510706.1|  PREDICTED: probable glutathione S-transferas...    226   3e-69    
gb|KHN22772.1|  Putative glutathione S-transferase parA                 226   3e-69    
ref|XP_007213483.1|  hypothetical protein PRUPE_ppa023395mg             225   4e-69    
gb|KEH38385.1|  glutathione S-transferase, amino-terminal domain ...    225   4e-69    
ref|NP_001105112.1|  glutathione transferase6                           225   4e-69    Zea mays [maize]
ref|XP_010498063.1|  PREDICTED: glutathione S-transferase U24-like      225   4e-69    
gb|ADB11353.1|  tau class glutathione transferase GSTU17                225   4e-69    Populus trichocarpa [western balsam poplar]
ref|XP_002890207.1|  hypothetical protein ARALYDRAFT_471920             225   4e-69    
ref|XP_006303293.1|  hypothetical protein CARUB_v10010098mg             226   5e-69    
gb|ACU13552.1|  unknown                                                 224   5e-69    Glycine max [soybeans]
ref|XP_010060809.1|  PREDICTED: glutathione S-transferase U19-like      225   5e-69    
gb|ABZ80407.1|  tau glutathione S-transferase                           225   6e-69    Casuarina glauca
emb|CDY14615.1|  BnaC02g24980D                                          224   6e-69    
gb|KHN27770.1|  Putative glutathione S-transferase                      224   7e-69    
emb|CDP06113.1|  unnamed protein product                                224   7e-69    
gb|ADB11346.1|  tau class glutathione transferase GSTU4                 224   7e-69    Populus trichocarpa [western balsam poplar]
ref|XP_008451811.1|  PREDICTED: probable glutathione S-transferase      224   7e-69    
emb|CDX68016.1|  BnaA07g20560D                                          224   7e-69    
ref|XP_007022193.1|  Glutathione S-transferase TAU 25                   224   8e-69    
gb|ADB11321.1|  tau class glutathione transferase GSTU29                224   8e-69    Populus trichocarpa [western balsam poplar]
emb|CDX79261.1|  BnaC06g20420D                                          224   8e-69    
ref|XP_009104572.1|  PREDICTED: glutathione S-transferase U19           224   9e-69    
ref|XP_002326070.2|  hypothetical protein POPTR_0019s15100g             224   9e-69    Populus trichocarpa [western balsam poplar]
ref|XP_010472053.1|  PREDICTED: glutathione S-transferase U19-like      224   1e-68    
ref|XP_004294221.1|  PREDICTED: probable glutathione S-transferas...    224   1e-68    
gb|AEI01103.1|  glutathione transferase                                 224   1e-68    
ref|XP_006388266.1|  hypothetical protein POPTR_0256s00210g             224   1e-68    
ref|XP_011098135.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    224   1e-68    
ref|XP_006377754.1|  hypothetical protein POPTR_0011s11440g             224   1e-68    
ref|XP_008240792.1|  PREDICTED: probable glutathione S-transferas...    223   2e-68    
ref|XP_003596129.1|  Glutathione S-transferase                          223   2e-68    
emb|CDP04041.1|  unnamed protein product                                223   2e-68    
emb|CDY26861.1|  BnaA02g18860D                                          223   2e-68    
emb|CAN81905.1|  hypothetical protein VITISV_006049                     223   2e-68    Vitis vinifera
ref|XP_002298938.2|  hypothetical protein POPTR_0001s42790g             223   2e-68    Populus trichocarpa [western balsam poplar]
ref|XP_004147762.1|  PREDICTED: glutathione S-transferase U19-like      223   3e-68    
ref|XP_006302801.1|  hypothetical protein CARUB_v10020928mg             223   3e-68    
ref|XP_009418995.1|  PREDICTED: probable glutathione S-transferas...    223   3e-68    
ref|XP_010060817.1|  PREDICTED: glutathione S-transferase U19-like      223   3e-68    
ref|XP_010498064.1|  PREDICTED: glutathione S-transferase U25-like      223   3e-68    
gb|KDP37215.1|  hypothetical protein JCGZ_06271                         223   3e-68    
ref|XP_004508074.1|  PREDICTED: glutathione S-transferase 3-like        223   3e-68    
gb|AAC28101.1|  glutathione S-transferase                               223   3e-68    
ref|XP_006366777.1|  PREDICTED: probable glutathione S-transferas...    223   4e-68    
ref|XP_010060811.1|  PREDICTED: probable glutathione S-transferas...    223   4e-68    
gb|KFK42224.1|  hypothetical protein AALP_AA2G227300                    222   5e-68    
ref|XP_009354818.1|  PREDICTED: probable glutathione S-transferas...    222   5e-68    
ref|XP_004147761.1|  PREDICTED: probable glutathione S-transferas...    222   5e-68    
ref|XP_011036748.1|  PREDICTED: probable glutathione S-transferase      222   6e-68    
ref|XP_006301003.1|  hypothetical protein CARUB_v10021393mg             222   6e-68    
ref|XP_009354819.1|  PREDICTED: probable glutathione S-transferas...    222   6e-68    
sp|P50471.1|GSTX1_NICPL  RecName: Full=Probable glutathione S-tra...    222   6e-68    
ref|XP_009117719.1|  PREDICTED: glutathione S-transferase U25           222   7e-68    
ref|XP_002515772.1|  glutathione s-transferase, putative                222   7e-68    
ref|XP_010537670.1|  PREDICTED: glutathione S-transferase U19-like      222   7e-68    
ref|NP_001234379.1|  glutathione S-transferase/peroxidase               222   8e-68    
gb|KFK42223.1|  hypothetical protein AALP_AA2G227200                    222   8e-68    
ref|XP_007146897.1|  hypothetical protein PHAVU_006G079600g             221   1e-67    
ref|XP_009783951.1|  PREDICTED: probable glutathione S-transferas...    221   1e-67    
ref|XP_002269705.1|  PREDICTED: probable glutathione S-transferase      221   1e-67    
ref|XP_010459291.1|  PREDICTED: glutathione S-transferase U25-like      221   1e-67    
ref|XP_009418991.1|  PREDICTED: glutathione S-transferase U19-like      221   1e-67    
ref|XP_002316873.1|  hypothetical protein POPTR_0011s11420g             221   1e-67    
ref|XP_004243194.1|  PREDICTED: probable glutathione S-transferase      221   1e-67    
ref|NP_177958.1|  glutathione S-transferase TAU 20                      221   2e-67    
ref|XP_010459288.1|  PREDICTED: glutathione S-transferase U24 iso...    221   2e-67    
ref|XP_010476862.1|  PREDICTED: glutathione S-transferase U25           221   2e-67    
gb|KEH38382.1|  glutathione S-transferase, amino-terminal domain ...    220   2e-67    
ref|NP_001237686.1|  glutathione S-transferase GST 16                   221   3e-67    
ref|XP_009418993.1|  PREDICTED: probable glutathione S-transferas...    220   3e-67    
gb|KFK43910.1|  hypothetical protein AALP_AA1G190000                    220   3e-67    
gb|ABG73419.1|  glutathione S-transferase isoform 1                     220   3e-67    
gb|ADB11313.1|  tau class glutathione transferase GSTU6                 220   3e-67    
ref|XP_010060803.1|  PREDICTED: glutathione S-transferase U25-like      220   3e-67    
ref|XP_007149245.1|  hypothetical protein PHAVU_005G054000g             220   3e-67    
dbj|BAK22528.1|  tau glutathione S-transferase                          220   3e-67    
ref|XP_009344314.1|  PREDICTED: probable glutathione S-transferase      220   3e-67    
ref|XP_008372264.1|  PREDICTED: probable glutathione S-transferase      220   4e-67    
ref|XP_009117717.1|  PREDICTED: glutathione S-transferase U25-like      220   4e-67    
gb|EYU26248.1|  hypothetical protein MIMGU_mgv1a023011mg                220   4e-67    
ref|XP_002264813.1|  PREDICTED: probable glutathione S-transferas...    220   4e-67    
ref|XP_007205876.1|  hypothetical protein PRUPE_ppa011242mg             219   5e-67    
ref|XP_009616059.1|  PREDICTED: probable glutathione S-transferase      219   6e-67    
ref|XP_008451812.1|  PREDICTED: glutathione S-transferase U25-like      219   6e-67    
ref|XP_006360016.1|  PREDICTED: probable glutathione S-transferas...    219   6e-67    
gb|KEH38379.1|  glutathione S-transferase, amino-terminal domain ...    219   7e-67    
gb|AAM64587.1|  2,4-D inducible glutathione S-transferase, putative     219   7e-67    
ref|XP_008360298.1|  PREDICTED: probable glutathione S-transferase      219   8e-67    
ref|XP_010531898.1|  PREDICTED: glutathione S-transferase U25           219   8e-67    
ref|XP_008383009.1|  PREDICTED: probable glutathione S-transferase      219   8e-67    
emb|CDP06116.1|  unnamed protein product                                219   9e-67    
emb|CDY48476.1|  BnaC05g13360D                                          219   9e-67    
ref|XP_010060805.1|  PREDICTED: probable glutathione S-transferase      219   9e-67    
ref|XP_008360299.1|  PREDICTED: probable glutathione S-transferase      219   1e-66    
gb|ACA83740.1|  auxin-induced glutathione S transferase                 219   1e-66    
ref|XP_009783953.1|  PREDICTED: probable glutathione S-transferase      219   1e-66    
ref|XP_008226265.1|  PREDICTED: probable glutathione S-transferase      219   1e-66    
ref|XP_003628404.1|  Glutathione S-transferase                          219   1e-66    
gb|KCW44929.1|  hypothetical protein EUGRSUZ_L01482                     219   1e-66    
tpg|DAA51780.1|  TPA: glutathione transferase                           219   1e-66    
ref|XP_002326068.2|  hypothetical protein POPTR_0019s15100g             219   2e-66    
ref|XP_002460955.1|  hypothetical protein SORBIDRAFT_02g038130          219   2e-66    
ref|XP_011098134.1|  PREDICTED: probable glutathione S-transferas...    218   2e-66    
ref|XP_002268911.1|  PREDICTED: probable glutathione S-transferase      218   2e-66    
ref|XP_009149163.1|  PREDICTED: glutathione S-transferase U25-like      218   2e-66    
emb|CDY21756.1|  BnaA09g45070D                                          218   2e-66    
ref|XP_002300482.1|  hypothetical protein POPTR_0001s42750g             218   2e-66    
ref|XP_010094424.1|  putative glutathione S-transferase parA            218   2e-66    
ref|XP_009759836.1|  PREDICTED: probable glutathione S-transferase      218   2e-66    
gb|KFK42217.1|  hypothetical protein AALP_AA2G226600                    218   3e-66    
ref|XP_009418994.1|  PREDICTED: probable glutathione S-transferas...    218   3e-66    
ref|XP_009418996.1|  PREDICTED: glutathione S-transferase U20-like      218   3e-66    
emb|CDX81810.1|  BnaC08g37910D                                          218   3e-66    
emb|CBI32903.3|  unnamed protein product                                222   3e-66    
ref|XP_006366778.1|  PREDICTED: probable glutathione S-transferas...    217   4e-66    
ref|XP_007212649.1|  hypothetical protein PRUPE_ppa018201mg             218   4e-66    
ref|XP_006364366.1|  PREDICTED: probable glutathione S-transferas...    218   4e-66    
ref|XP_009418987.1|  PREDICTED: probable glutathione S-transferas...    218   4e-66    
emb|CAA45741.1|  C-7                                                    217   4e-66    
ref|NP_001234094.1|  uncharacterized protein LOC543817                  217   4e-66    
ref|XP_006829365.1|  hypothetical protein AMTR_s00384p00007560          217   5e-66    
ref|XP_006370194.1|  hypothetical protein POPTR_0001s40510g             217   5e-66    
ref|XP_008390702.1|  PREDICTED: probable glutathione S-transferase      217   5e-66    
ref|XP_010060806.1|  PREDICTED: glutathione S-transferase U19-lik...    217   6e-66    
ref|XP_006366779.1|  PREDICTED: probable glutathione S-transferas...    217   7e-66    
ref|XP_008775489.1|  PREDICTED: probable glutathione S-transferas...    217   7e-66    
ref|XP_010472052.1|  PREDICTED: glutathione S-transferase U20           217   7e-66    
ref|XP_010087154.1|  putative glutathione S-transferase parA            216   8e-66    
ref|XP_010694944.1|  PREDICTED: probable glutathione S-transferas...    217   8e-66    
ref|XP_006302800.1|  hypothetical protein CARUB_v10020927mg             216   9e-66    
ref|XP_008351205.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    216   9e-66    
ref|XP_009149162.1|  PREDICTED: glutathione S-transferase U24           216   1e-65    
gb|ADB11348.1|  tau class glutathione transferase GSTU7                 216   1e-65    
emb|CDP14180.1|  unnamed protein product                                216   1e-65    
ref|XP_002276792.1|  PREDICTED: probable glutathione S-transferas...    216   1e-65    
ref|XP_011036234.1|  PREDICTED: probable glutathione S-transferase      216   1e-65    
ref|XP_009418992.1|  PREDICTED: probable glutathione S-transferase      216   1e-65    
ref|XP_010428961.1|  PREDICTED: glutathione S-transferase U21-like      216   1e-65    
gb|KDP37218.1|  hypothetical protein JCGZ_06274                         216   2e-65    
ref|XP_009117716.1|  PREDICTED: glutathione S-transferase U25-like      216   2e-65    
ref|XP_009104575.1|  PREDICTED: glutathione S-transferase U23           216   2e-65    
ref|XP_007149238.1|  hypothetical protein PHAVU_005G053300g             216   2e-65    
emb|CDX68019.1|  BnaA07g20590D                                          216   2e-65    
ref|XP_006495112.1|  PREDICTED: probable glutathione S-transferas...    216   2e-65    
emb|CDY26267.1|  BnaA06g11500D                                          216   2e-65    
ref|XP_008222668.1|  PREDICTED: probable glutathione S-transferas...    216   2e-65    
ref|XP_006660574.1|  PREDICTED: probable glutathione S-transferas...    216   2e-65    
emb|CDX81808.1|  BnaC08g37930D                                          216   2e-65    
ref|NP_565178.1|  glutathione S-transferase TAU 19                      215   3e-65    
ref|XP_009106545.1|  PREDICTED: glutathione S-transferase U21           215   3e-65    
ref|XP_009591606.1|  PREDICTED: probable glutathione S-transferase      215   3e-65    
gb|ADB11366.1|  tau class glutathione transferase GSTU39                215   3e-65    
ref|XP_004248222.1|  PREDICTED: probable glutathione S-transferase      215   3e-65    
ref|XP_008226267.1|  PREDICTED: probable glutathione S-transferase      215   4e-65    
ref|XP_009778021.1|  PREDICTED: probable glutathione S-transferase      215   4e-65    
gb|AAY54294.1|  GST                                                     215   4e-65    
emb|CDP01696.1|  unnamed protein product                                215   4e-65    
ref|XP_010044069.1|  PREDICTED: glutathione S-transferase U19-like      214   5e-65    
gb|ABG77522.1|  glutathione S-transferase                               214   6e-65    
emb|CAC94003.1|  glutathione transferase                                214   6e-65    
ref|XP_010682890.1|  PREDICTED: probable glutathione S-transferas...    214   6e-65    
dbj|BAE44477.1|  glutathione-S-transferase                              214   7e-65    
ref|XP_004243192.1|  PREDICTED: probable glutathione S-transferase      214   7e-65    
gb|ADB11381.1|  tau class glutathione transferase GSTU58                214   7e-65    
gb|AAF23357.1|AF109194_1  glutathione-S-transferase                     214   9e-65    
ref|NP_177955.1|  glutathione S-transferase TAU 23                      214   9e-65    
gb|KFK42221.1|  hypothetical protein AALP_AA2G227000                    214   1e-64    
ref|XP_002889188.1|  hypothetical protein ARALYDRAFT_477001             214   1e-64    
emb|CDY21757.1|  BnaA09g45080D                                          214   1e-64    
ref|XP_011048926.1|  PREDICTED: probable glutathione S-transferase      214   1e-64    
ref|XP_006389992.1|  hypothetical protein EUTSA_v10019114mg             213   1e-64    
ref|XP_011082832.1|  PREDICTED: glutathione S-transferase U25-like      213   2e-64    
emb|CAN75492.1|  hypothetical protein VITISV_040292                     213   2e-64    
ref|XP_002516074.1|  glutathione s-transferase, putative                213   2e-64    
ref|XP_006389996.1|  hypothetical protein EUTSA_v10019120mg             213   3e-64    
emb|CDM85101.1|  unnamed protein product                                213   3e-64    
gb|ABI18247.1|  putative glutathione-S-transferase                      213   3e-64    
ref|XP_008226260.1|  PREDICTED: probable glutathione S-transferase      213   3e-64    
gb|AAM64593.1|  glutathione transferase, putative                       213   3e-64    
ref|XP_010472050.1|  PREDICTED: glutathione S-transferase U22           212   4e-64    
ref|XP_010694580.1|  PREDICTED: probable glutathione S-transferas...    213   4e-64    
gb|ABD36807.1|  glutathione S-transferase                               212   4e-64    
ref|XP_003609894.1|  Glutathione S-transferase                          212   5e-64    
ref|NP_177956.1|  glutathione S-transferase TAU 22                      212   5e-64    
ref|XP_009783954.1|  PREDICTED: probable glutathione S-transferase      212   5e-64    
ref|XP_003550998.1|  PREDICTED: glutathione S-transferase U25-like      212   5e-64    
ref|XP_010472049.1|  PREDICTED: glutathione S-transferase U23           212   5e-64    
gb|KFK42219.1|  hypothetical protein AALP_AA2G226800                    212   6e-64    
ref|XP_006388265.1|  hypothetical protein POPTR_0256s00200g             214   6e-64    
emb|CDX68017.1|  BnaA07g20570D                                          212   6e-64    
ref|XP_006437551.1|  hypothetical protein CICLE_v10033587mg             212   7e-64    
ref|XP_009354820.1|  PREDICTED: probable glutathione S-transferase      211   7e-64    
ref|XP_010428962.1|  PREDICTED: glutathione S-transferase U20-like      212   7e-64    
ref|XP_006416732.1|  hypothetical protein EUTSA_v10008735mg             211   8e-64    
ref|XP_004488708.1|  PREDICTED: probable glutathione S-transferas...    211   8e-64    
ref|XP_006432070.1|  hypothetical protein CICLE_v10002423mg             211   9e-64    
gb|KCW67676.1|  hypothetical protein EUGRSUZ_F01416                     211   9e-64    
ref|XP_010060807.1|  PREDICTED: glutathione S-transferase U25-lik...    211   1e-63    
gb|EEE66579.1|  hypothetical protein OsJ_23123                          210   1e-63    
ref|XP_010416820.1|  PREDICTED: glutathione S-transferase U20-like      211   1e-63    
ref|XP_008360297.1|  PREDICTED: probable glutathione S-transferase      211   1e-63    
gb|ACJ86071.1|  unknown                                                 210   1e-63    
gb|AIP98335.1|  putative glutathione S-transferase                      211   1e-63    
ref|XP_009104574.1|  PREDICTED: glutathione S-transferase U22           211   1e-63    
emb|CDP06109.1|  unnamed protein product                                212   1e-63    
emb|CDX79259.1|  BnaC06g20440D                                          211   1e-63    
emb|CAC94002.1|  glutathione transferase                                211   1e-63    
gb|KEH38386.1|  glutathione S-transferase, amino-terminal domain ...    211   1e-63    
ref|XP_009104573.1|  PREDICTED: glutathione S-transferase U20           211   1e-63    
ref|XP_010428955.1|  PREDICTED: glutathione S-transferase U23-like      211   2e-63    
gb|KEH38380.1|  glutathione S-transferase, amino-terminal domain ...    211   2e-63    
ref|XP_008343141.1|  PREDICTED: probable glutathione S-transferase      211   2e-63    
gb|EMS52570.1|  putative glutathione S-transferase GSTU1                211   2e-63    
gb|KFK25183.1|  hypothetical protein AALP_AA8G077600                    210   2e-63    
emb|CDX81809.1|  BnaC08g37920D                                          210   2e-63    
gb|ADB11359.1|  tau class glutathione transferase GSTU27                210   2e-63    
gb|EYU38214.1|  hypothetical protein MIMGU_mgv1a013218mg                211   2e-63    
gb|ACD84881.1|  probable glutathione S-transferase                      210   2e-63    
ref|XP_002526585.1|  glutathione s-transferase, putative                210   3e-63    
ref|XP_009591608.1|  PREDICTED: probable glutathione S-transferas...    210   3e-63    
ref|XP_008390704.1|  PREDICTED: probable glutathione S-transferase      210   3e-63    
ref|XP_011029535.1|  PREDICTED: probable glutathione S-transferas...    210   4e-63    
gb|ABK22827.1|  unknown                                                 210   4e-63    
ref|XP_008390703.1|  PREDICTED: probable glutathione S-transferase      210   4e-63    
ref|XP_009418998.1|  PREDICTED: probable glutathione S-transferase      209   4e-63    
ref|XP_010428956.1|  PREDICTED: glutathione S-transferase U22-like      209   4e-63    
ref|XP_010416816.1|  PREDICTED: glutathione S-transferase U22-like      209   4e-63    
emb|CDP06108.1|  unnamed protein product                                209   5e-63    
gb|AAO61855.1|  glutathione S-transferase U2                            209   5e-63    
emb|CAC94001.1|  glutathione transferase                                209   5e-63    
emb|CDX68018.1|  BnaA07g20580D                                          209   6e-63    
ref|XP_002516073.1|  glutathione s-transferase, putative                215   6e-63    
gb|KFK35682.1|  hypothetical protein AALP_AA4G023500                    209   6e-63    
ref|XP_011030766.1|  PREDICTED: probable glutathione S-transferase      209   6e-63    
gb|KCW67677.1|  hypothetical protein EUGRSUZ_F01416                     208   6e-63    
gb|KDP45710.1|  hypothetical protein JCGZ_17317                         209   7e-63    
ref|XP_006389993.1|  hypothetical protein EUTSA_v10019490mg             209   7e-63    
ref|XP_007226335.1|  hypothetical protein PRUPE_ppa022301mg             209   8e-63    
ref|XP_006302785.1|  hypothetical protein CARUB_v10020906mg             209   8e-63    
gb|AAF71799.1|AC013430_8  F3F9.13                                       216   9e-63    
ref|XP_006302806.1|  hypothetical protein CARUB_v10020933mg             209   1e-62    
gb|ACH87175.1|  glutathione S-transferase                               209   1e-62    
gb|KDP35723.1|  hypothetical protein JCGZ_10495                         209   1e-62    
ref|XP_008390701.1|  PREDICTED: probable glutathione S-transferase      209   1e-62    
ref|XP_009370572.1|  PREDICTED: probable glutathione S-transferase      208   1e-62    
gb|ADB11323.1|  tau class glutathione transferase GSTU31                208   2e-62    
ref|XP_006387667.1|  hypothetical protein POPTR_0700s00200g             208   2e-62    
gb|AAM63471.1|  glutathione transferase, putative                       208   2e-62    
emb|CDX88440.1|  BnaC06g38840D                                          208   2e-62    
ref|XP_006392766.1|  hypothetical protein EUTSA_v10011759mg             208   2e-62    
gb|ACA83743.1|  auxin-induced glutathione S transferase                 207   2e-62    
ref|XP_002890208.1|  predicted protein                                  207   2e-62    
ref|XP_002262607.1|  PREDICTED: probable glutathione S-transferas...    207   3e-62    
dbj|BAJ95021.1|  predicted protein                                      207   3e-62    
ref|XP_006305598.1|  hypothetical protein CARUB_v10010264mg             207   3e-62    
ref|XP_010534998.1|  PREDICTED: glutathione S-transferase U28           207   3e-62    
ref|XP_007217296.1|  hypothetical protein PRUPE_ppa018315mg             207   3e-62    
ref|NP_175772.1|  glutathione S-transferase TAU 28                      207   3e-62    
ref|XP_009110423.1|  PREDICTED: glutathione S-transferase U26           207   4e-62    



>emb|CDP08276.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   347 bits (889),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 186/230 (81%), Gaps = 12/230 (5%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
               V V+DFW NGFGMR+RIALEEKGI Y+Y+EEDL NPQRS LVL+MNPVRKSVPIL+H
Sbjct  6    SSSVVVVDFWGNGFGMRVRIALEEKGIKYEYREEDLTNPQRSQLVLDMNPVRKSVPILIH  65

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNK-----------FF  432
            +G+PVCDS AIL YID+TWKDGFP LLP DPY+RA ARFWTHF+DNK            F
Sbjct  66   QGQPVCDSAAILGYIDETWKDGFPSLLPRDPYDRAIARFWTHFLDNKVRLLKMISTFLVF  125

Query  431  PTQATFLKSKGE-AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYG  255
             TQA FLKSK + AK+E++ ELI ELKQLE VLGD+ YFGG  FG+ DV  IPFSSMFYG
Sbjct  126  STQAMFLKSKSDRAKEESKNELIGELKQLEAVLGDEQYFGGANFGYLDVVLIPFSSMFYG  185

Query  254  YESHGKFKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            YESHG FKLEEECPKL AWVKRC+ R SV K+LPDSV+MYELHK +YG+E
Sbjct  186  YESHGNFKLEEECPKLSAWVKRCLARDSVRKVLPDSVEMYELHKKFYGIE  235



>ref|XP_004955465.1| PREDICTED: glutathione S-transferase 3-like [Setaria italica]
Length=224

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 167/220 (76%), Gaps = 2/220 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
             G V  +DFWANGFGMR RIAL E G+A++Y EEDL   +RS LV  MNPV +SVPILVH
Sbjct  5    AGEVTCVDFWANGFGMRTRIALRELGVAFRYVEEDLRVRERSELVRRMNPVHRSVPILVH  64

Query  578  EGRPVCDSVAILEYIDDTW--KDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKS  405
             GRPVC SV ILEYID+TW   DG P LLP DP +RA ARFW  F+D K F TQ  FLKS
Sbjct  65   GGRPVCGSVNILEYIDETWGKDDGGPRLLPHDPLQRAHARFWADFVDQKVFSTQTRFLKS  124

Query  404  KGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLE  225
            KGE K+ A++EL+++LK+LE+VLGDK++F G++FGF D   IPFSSMF+GYE HG F LE
Sbjct  125  KGEEKEVAKQELLDQLKRLEEVLGDKTFFAGDEFGFLDAVLIPFSSMFHGYEQHGGFSLE  184

Query  224  EECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
             ECP L+ WV+RC ER SV  +LPD  +MYELHK WYG+E
Sbjct  185  TECPNLMRWVRRCKERGSVKSVLPDEDEMYELHKKWYGIE  224



>gb|EMS47858.1| putative glutathione S-transferase [Triticum urartu]
Length=225

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFWANGFGMRMRIAL E G+A++Y EEDL   +RS LV  MNPV +SVPIL+H GR
Sbjct  9    VTCVDFWANGFGMRMRIALREVGVAFEYVEEDLRVCERSELVRRMNPVHRSVPILIHRGR  68

Query  569  PVCDSVAILEYIDDTWK--DGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            PVC S+ ILEYID+ W        LLP DP +RA ARFW  FID+K FP Q  FLKSKGE
Sbjct  69   PVCGSLNILEYIDEVWSALGETRRLLPGDPADRADARFWADFIDHKVFPAQTRFLKSKGE  128

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             K  A++EL+ +LK+L++VLGDK++F G+ FGF DV  IPFSSMF GYE HG F LE EC
Sbjct  129  EKYAAKEELVEQLKRLDEVLGDKAFFSGDAFGFLDVVLIPFSSMFRGYEQHGGFDLEVEC  188

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            P L+ WVKRC ER SV  +LPD  KMYELHK WYG+E
Sbjct  189  PNLMRWVKRCKERESVRAVLPDETKMYELHKEWYGIE  225



>ref|XP_002459355.1| hypothetical protein SORBIDRAFT_02g003090 [Sorghum bicolor]
 gb|EER95876.1| hypothetical protein SORBIDRAFT_02g003090 [Sorghum bicolor]
Length=222

 Score =   289 bits (739),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 166/225 (74%), Gaps = 4/225 (2%)
 Frame = -2

Query  776  MATT-TCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRK  600
            MAT+      V V+DFWANGFGMR RIAL E G+A++Y EEDL   +RS LV  MNPV +
Sbjct  1    MATSEDADHQVTVVDFWANGFGMRARIALRELGVAFRYVEEDLRVRERSELVRRMNPVHR  60

Query  599  SVPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQA  420
            SVPIL+H GRPVC SV IL+Y+D+ W    P L P DP +RA ARFW  F+D K F TQ 
Sbjct  61   SVPILIHGGRPVCGSVNILQYVDEVWG---PTLFPRDPLQRAHARFWADFVDQKVFSTQT  117

Query  419  TFLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHG  240
             FLKSKG+ K+ A+ EL+ +LK+LE+VLGDK++F G++FGF D   IPFSSMF+GYE HG
Sbjct  118  RFLKSKGDEKEAAKGELLEQLKRLEEVLGDKTFFAGDEFGFLDAVLIPFSSMFHGYEQHG  177

Query  239  KFKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
             F L+ ECP L++WV+RC ER SV  +LPD  KMYELHK WYG+E
Sbjct  178  GFDLDVECPSLMSWVRRCKERKSVKGVLPDEDKMYELHKKWYGIE  222



>dbj|BAK02040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 160/218 (73%), Gaps = 2/218 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
             V  +DFWANGFGMR+RIAL E G+A+ Y EEDL   +RS LV  MNPV +SVPIL+H G
Sbjct  8    AVTCVDFWANGFGMRVRIALRELGVAFDYVEEDLRMGERSDLVRRMNPVHRSVPILIHRG  67

Query  572  RPVCDSVAILEYIDDTWK--DGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            RPVC S+ IL+YID+ W        LLP DP  RA ARFW  FID+K F TQ  FLKSKG
Sbjct  68   RPVCGSLNILDYIDEVWSAPGETRRLLPGDPAGRADARFWADFIDHKVFATQTRFLKSKG  127

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E K  A++EL+ +LK+LE+VLGDK +F G++FGF D+  IPFSSMF GYE HG F LE E
Sbjct  128  EEKHVAKEELVEQLKRLEEVLGDKEHFSGDEFGFLDMVLIPFSSMFRGYEQHGGFDLEVE  187

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            CPKL+ WVKRC ER SV  +LPD  KMYELHK WYG+E
Sbjct  188  CPKLMRWVKRCKERESVRAVLPDETKMYELHKEWYGIE  225



>gb|EMT21593.1| hypothetical protein F775_25446 [Aegilops tauschii]
Length=225

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 160/218 (73%), Gaps = 2/218 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
             V  +D WANGFGMR RIAL E G+A++Y EEDL+  +RS LV  MNPV +SVPI +H G
Sbjct  8    AVTCVDKWANGFGMRARIALRELGVAFEYVEEDLHVGERSELVRRMNPVHRSVPIQIHRG  67

Query  572  RPVCDSVAILEYIDDTWKDGFPL--LLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            RPVC S+ ILEYID+ W        LLP DP  RA ARFW  F+D+K FPTQ  FLKSKG
Sbjct  68   RPVCGSLNILEYIDEVWSAPGETRRLLPGDPAGRADARFWADFVDHKVFPTQTRFLKSKG  127

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E K  A++EL+ +LK+L++VLG+K +F G++FGF D+  IPFSSMF GYE HG F LE E
Sbjct  128  EEKDVAKEELVEQLKRLDEVLGEKGFFSGDEFGFLDIVLIPFSSMFRGYEQHGGFDLEVE  187

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            CP L+ WVKRC ER SV ++LPD  KMY+LHK WYG+E
Sbjct  188  CPNLMRWVKRCKERESVREVLPDEAKMYDLHKEWYGIE  225



>ref|XP_004955464.1| PREDICTED: probable glutathione S-transferase-like isoform X1 
[Setaria italica]
Length=231

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            GV  +DFW N FGMR RIAL EK + +++ EEDL   QRS LV  MNPV +S+PIL+H G
Sbjct  12   GVTCVDFWCNEFGMRARIALREKRVPFEFVEEDLRVRQRSDLVRRMNPVHRSIPILIHGG  71

Query  572  RPVCDSVAILEYIDDTWKD----GFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKS  405
            RPVC S+ I+EY+D+ W          LLP DP ERA ARFW  F+D K +  Q  F  S
Sbjct  72   RPVCGSMNIVEYVDEVWSQKEAGAATRLLPADPLERARARFWAEFVDQKVYDAQTRFFTS  131

Query  404  KGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLE  225
            +GE K  A  EL+  L++LE VLG+K++FGG++FGF DVAF+PFS+MFYGYE HG   +E
Sbjct  132  RGEEKMAAMAELLGHLRRLEAVLGNKAFFGGDEFGFLDVAFVPFSAMFYGYEQHGGVDME  191

Query  224  EECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
             ECP LL WV+RC ER SV  +LP  + MYE+H+ +Y +E
Sbjct  192  AECPALLRWVRRCAERESVRDVLPSGLDMYEIHREFYQIE  231



>gb|EMT03166.1| hypothetical protein F775_06717 [Aegilops tauschii]
Length=267

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFW N FGMR+RIAL E G+ ++Y EEDL   +RS LV  MNPV +S+PIL+H GR
Sbjct  54   VTCVDFWCNEFGMRVRIALRELGVPFEYIEEDLRVRKRSELVRRMNPVHRSIPILIHHGR  113

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC SV I+EYID+ W +    LLP DP +RA ARFW  FID+K F TQ  F  SKGE K
Sbjct  114  PVCGSVNIVEYIDEVWGEE-TRLLPGDPADRADARFWADFIDHKVFSTQTKFFTSKGEEK  172

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A++EL+  LK+LE+VLGDK +F G++FGF DV FIPFSSMFYGYE HG   LE ECPK
Sbjct  173  EAAKEELVEHLKRLEEVLGDKCFFSGDEFGFLDVVFIPFSSMFYGYEQHGGIDLEAECPK  232

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            L  W KRC ER SVS++LPD    YELHK +YG+E
Sbjct  233  LTRWEKRCRERESVSEVLPDGKVQYELHKKFYGIE  267



>gb|EMS47854.1| putative glutathione S-transferase [Triticum urartu]
Length=263

 Score =   261 bits (668),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFW N FGMR+RIAL E G+ ++Y EEDL   +RS LV  MNPV +S+PIL+H GR
Sbjct  50   VTCVDFWCNEFGMRVRIALRELGVPFEYIEEDLRVRERSELVRRMNPVHRSIPILIHHGR  109

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC SV I+EYID+ W +    LLP DP +RA +RFW  FID+K F TQ  F  SKGE K
Sbjct  110  PVCGSVNIVEYIDEVWGEE-TRLLPGDPADRADSRFWADFIDHKVFSTQTKFFTSKGEEK  168

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A++EL+  LK+LE+VLGDK +F G++FGF DV FIPFSSMFYGYE HG   LE ECPK
Sbjct  169  EAAKEELVEHLKRLEEVLGDKCFFSGDEFGFLDVVFIPFSSMFYGYEQHGGIDLEAECPK  228

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            L  W KRC ER SVS++LPD    YELHK +YG+E
Sbjct  229  LTRWEKRCRERESVSEVLPDGKVQYELHKKFYGIE  263



>gb|EMT21595.1| hypothetical protein F775_06172 [Aegilops tauschii]
Length=252

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 155/221 (70%), Gaps = 6/221 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFWAN FGMR+ IAL E G++++Y EEDL   +RS LVL MNPV + VPIL+H GR
Sbjct  32   VVCVDFWANLFGMRVLIALRELGVSFEYIEEDLRGRERSDLVLRMNPVHRMVPILIHRGR  91

Query  569  PVCDSVAILEYIDDTW-----KDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKS  405
            P+C+S+ ILEYID+ W     + G   LLP DP ERA+ARFW  F+D+K F T+    KS
Sbjct  92   PICNSINILEYIDEVWGHLHAEAGGTQLLPADPLERASARFWADFVDHKVFNTEMMLFKS  151

Query  404  KGEAKQEAQK-ELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKL  228
             G+ ++EA K ELI +L+QLE  LGDK++F G +FGF D+  IP SSMF  YE  GKF L
Sbjct  152  NGDDQKEAAKGELIRQLRQLEGALGDKNFFSGNEFGFLDIVVIPLSSMFRAYEQQGKFDL  211

Query  227  EEECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            E ECPKL+ W KRC ER SV   LPD  ++Y +HK WYG+E
Sbjct  212  EVECPKLMRWEKRCKERESVKSTLPDEEEVYRMHKKWYGIE  252



>gb|EMT21594.1| hypothetical protein F775_27374 [Aegilops tauschii]
Length=220

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 155/215 (72%), Gaps = 5/215 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFWAN FGMR+RIAL E G+A++Y EEDL   +RS LV  MNPV   VPIL+H GR
Sbjct  11   VTCVDFWANEFGMRVRIALRELGVAFEYVEEDLRVRERSDLVRRMNPVLHMVPILIHHGR  70

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC SV I+EYID+ W +    LLP +P +RA ARFW  F+D+K F  Q  FL+SKGE K
Sbjct  71   PVCGSVNIVEYIDEVWGEE-THLLPGNPVDRADARFWADFVDHKVFGAQVRFLESKGEEK  129

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
             E    L+ +LK+LE+VLGDK++F GE+FGF D+  IPFSSMF+GYE  G+F L+ ECPK
Sbjct  130  DE----LVEQLKRLEEVLGDKAFFSGEEFGFLDIVTIPFSSMFHGYEQLGRFHLDVECPK  185

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            L  W KRC +R SV  +LPD  +MYELHK  YG+E
Sbjct  186  LTQWAKRCKQRESVRAVLPDDTEMYELHKHLYGIE  220



>gb|EMS47856.1| putative glutathione S-transferase [Triticum urartu]
Length=349

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 156/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFWAN FGMR+ I L E G++++Y EE L   +RS LVL MNPV + VPIL+H GR
Sbjct  129  VVCVDFWANLFGMRVLITLRELGVSFEYIEEALRLRERSGLVLRMNPVHRMVPILIHRGR  188

Query  569  PVCDSVAILEYIDDTW-----KDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKS  405
            P+C+S+ ILEYID+ W     + G   LLP DP ERA+ARFW  F+D+K F T+    KS
Sbjct  189  PICNSINILEYIDEVWGHLHAEAGGIQLLPADPLERASARFWADFVDHKVFNTEMRLFKS  248

Query  404  KGEAKQEAQK-ELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKL  228
            KG+ ++EA K ELI +L+QLE VLGDK++F G++FGF D+  IP SSMF  YE  GKF L
Sbjct  249  KGDDEKEAAKGELIRQLRQLESVLGDKNFFSGDEFGFLDIVVIPLSSMFRAYEQEGKFDL  308

Query  227  EEECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            E ECPKL+ W KRC ER SV   LPD  ++Y +HK WYG+E
Sbjct  309  EVECPKLMRWEKRCKERESVKSTLPDEEEVYRMHKKWYGIE  349



>ref|XP_006584638.1| PREDICTED: glutathione S-transferase GST 9 isoform X1 [Glycine 
max]
 gb|ACU18934.1| unknown [Glycine max]
 gb|KHN26786.1| Glutathione S-transferase 3 [Glycine soja]
Length=219

 Score =   250 bits (638),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 152/209 (73%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
              GV ++D WA+ FGMR+RIAL EKG+ Y+YKEE+L N  +S L+L+MNP+ K +P+L+H
Sbjct  2    ADGVVLLDTWASMFGMRVRIALAEKGVEYEYKEENLRN--KSPLLLQMNPIHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S  I++YID+ W D  P+L P DPYERA ARFW  +ID K + T      SKG
Sbjct  60   NGKPICESAIIVQYIDEVWNDKAPIL-PSDPYERAQARFWVDYIDKKVYDTWRKMWLSKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E  +  +KE I+  KQLE+ L DK+Y+G + FGF D+  IPF S FY +E++G FK+EEE
Sbjct  119  EEHEAGKKEFISIFKQLEETLSDKAYYGSDTFGFLDIGLIPFYSWFYTFETYGNFKMEEE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+AW KRCM+R +VSK LPD  K+Y+
Sbjct  179  CPKLVAWAKRCMQREAVSKSLPDEKKVYD  207



>dbj|BAJ97963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=233

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 156/222 (70%), Gaps = 7/222 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  IDFWAN FGMR+ IAL E G++++Y EEDL   +RS LVL MNPV + VPIL+H GR
Sbjct  12   VVCIDFWANLFGMRVLIALRELGVSFKYIEEDLRVCERSDLVLRMNPVHRMVPILIHHGR  71

Query  569  PVCDSVAILEYIDDTW------KDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLK  408
            P+C+S+ ILEYID+ W      + G   LLP DP  RA ARFW  F+DNK F T+ +  K
Sbjct  72   PICNSINILEYIDEVWGHRQETQAGGTRLLPIDPLHRAYARFWADFVDNKVFGTEMSLFK  131

Query  407  SKGEAKQEAQKE-LINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFK  231
            SKGE ++EA KE LI +L QLE+VLGD+ +F G++FGF DV  IP SSMF  YE  GKF 
Sbjct  132  SKGEEEKEAAKEELIRQLGQLEEVLGDQRFFSGDEFGFLDVVIIPLSSMFRAYEQQGKFD  191

Query  230  LEEECPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
            LE ECPKL+ W KRC ER SV   LPD  ++Y +HK WYG+E
Sbjct  192  LEVECPKLMRWEKRCKERESVKSTLPDEEEVYMMHKKWYGIE  233



>ref|NP_001058907.2| Os07g0152700 [Oryza sativa Japonica Group]
 dbj|BAF20821.2| Os07g0152700 [Oryza sativa Japonica Group]
Length=225

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 153/216 (71%), Gaps = 14/216 (6%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V V+DFWAN FGMR RIAL    + + + EEDL   +RS LVL MNPV +SVPIL+H GR
Sbjct  23   VVVVDFWANRFGMRARIALHVLQVGFGFVEEDLRIRERSDLVLRMNPVHRSVPILIHRGR  82

Query  569  PVCDSVAILEYIDDTW-KDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            P+C S+ IL+YID+ W K     LLP DP +RA+ARFW  F+D++ F TQ  FLKSKGE 
Sbjct  83   PICGSINILQYIDEVWAKRVGTRLLPPDPLKRASARFWADFVDHEVFSTQTRFLKSKGEE  142

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            K+ A+ EL+++L++LE VLGD+S+F G++FGF D+  IPFSSMF+GY+ H          
Sbjct  143  KEMAKAELLDQLRRLEGVLGDRSFFSGDEFGFLDIVLIPFSSMFHGYKQH----------  192

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGVE  105
                WVKRC ER SV ++LPD  +MYELHK WYG+E
Sbjct  193  ---MWVKRCKERESVRQVLPDEGEMYELHKKWYGIE  225



>ref|XP_008451814.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=217

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 153/209 (73%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW + FGMR++IAL EKG+AY+Y E+DL N  +S L+L+MNP+ K +P+L+H
Sbjct  2    GEEVKLLDFWPSMFGMRVKIALAEKGVAYEYVEQDLRN--KSPLLLQMNPIHKQIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S  I+EYID+ WKD  PLL P DPYERA ARFW  FID K + +       KG
Sbjct  60   NGKPICESSIIVEYIDEFWKDKAPLL-PSDPYERAQARFWVDFIDKKIYESAKKIYTKKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++  +KE+I  LKQLEQVLG+K+YFGGE FG+ D+  I FSS FY YE+ G F +E E
Sbjct  119  EEQEGGKKEVIEILKQLEQVLGEKAYFGGECFGYLDIGLIGFSSWFYAYETIGNFSIEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL++WVKRC+E+ SVS  LPD  K+ E
Sbjct  179  CPKLISWVKRCLEKESVSNSLPDPKKVCE  207



>ref|XP_009347994.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 151/207 (73%), Gaps = 1/207 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D+WA+ FGMR R+AL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDYWASMFGMRARVALVEKGVKYEYREEDLRNKIKSQLLLQMNPVHKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W+D  PLL P +PY++A +RFW  FID K +   +    +KGE +
Sbjct  65   PVCESLIIVQYIDEVWRDKAPLL-PSEPYQKAHSRFWADFIDKKLYDACSKIWSTKGEER  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LKQLE  LGDK YF GEKFGF D+A I F   F+ +E+ G F +E ECPK
Sbjct  124  EAAKKDFIEILKQLEGQLGDKQYFEGEKFGFLDIALITFYCWFHAFETCGNFSIEAECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRCM+R SVS+ L D  K+YEL
Sbjct  184  LIAWAKRCMQRESVSRSLADEKKVYEL  210



>gb|KHG29593.1| putative glutathione S-transferase [Gossypium arboreum]
Length=219

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 150/210 (71%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
             G + ++DFW + FGMR RIAL EKGI Y+Y+EEDL N  +S L+L+MNPV K +P+L+H
Sbjct  2    AGELVLLDFWPSPFGMRSRIALAEKGIPYEYREEDLRN--KSDLLLQMNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+SV  ++YID+ W D  PL+ P DPY+RA ARFW  F+D K +   +   K+KG
Sbjct  60   NGKPVCESVIQVQYIDEVWHDKAPLI-PSDPYQRAVARFWVDFVDKKIYDLGSKIWKTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E +  A+KE I  LK LE  LGDK+YFGGE  G+ DVA +PF + FY YE  G F +E E
Sbjct  119  EEQANAKKEFIECLKLLEGELGDKTYFGGESLGYVDVALVPFYTWFYAYEKCGDFSIEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPK++AWVKRCM++ SV+K LPD  K+YE 
Sbjct  179  CPKMIAWVKRCMQKESVAKSLPDQEKVYEF  208



>gb|AFK34240.1| unknown [Lotus japonicus]
Length=221

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 152/206 (74%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ FGMR+RIAL EKG+ Y+YKEE+L N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDVWASMFGMRVRIALAEKGVEYEYKEENLRN--KSDLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  P+L P DPYERA ARFW  +ID K + T      S+GE  
Sbjct  63   PICESAIIVQYIDEVWKDKAPIL-PSDPYERAQARFWVDYIDKKVYDTWRKMWLSEGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KELI+  K LE+ LGDKS++GG+ FGF D+  IPF + FY +E+ G FK+E ECPK
Sbjct  122  EAGKKELISIFKLLEETLGDKSFYGGDTFGFLDLGLIPFYTWFYTFETFGNFKMETECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ WVKRCM++ +VSK LPD  K+YE
Sbjct  182  LMDWVKRCMQKETVSKTLPDEKKVYE  207



>ref|XP_010060808.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW67681.1| hypothetical protein EUGRSUZ_F01424 [Eucalyptus grandis]
Length=219

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIAL EKG+ +  +EEDL+N  +S L+L+MNPV K +P+LVH G+
Sbjct  5    VILLDFWPSPFGMRARIALREKGVEFDMREEDLSN--KSPLLLKMNPVNKQIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ +++YID+TW    PLL P DPYERA ARFW  ++D K +P   T  +S+GEA+
Sbjct  63   PVCESLLMVQYIDETWVRQSPLL-PSDPYERARARFWADYVDKKIYPVGRTVWQSRGEAQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGDK+YFGGE+FG+ DV+ IPF S FYG E+   F + EECPK
Sbjct  122  EAAKKEYIECLKVLEGELGDKAYFGGERFGYVDVSLIPFYSWFYGLETMANFSIVEECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRCM+R SV+K LPD  K+Y+
Sbjct  182  LVAWAKRCMQRESVAKSLPDQHKLYD  207



>gb|AHI54570.1| glutathione S-transferase [Camellia japonica]
Length=220

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 153/221 (69%), Gaps = 5/221 (2%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
               + ++DFW + FGMR+RIAL EKGI Y+Y+EEDL N  +S L+L+MNPV K +P+L+H
Sbjct  2    ANQLVLLDFWPSMFGMRLRIALAEKGIDYEYREEDLRN--KSPLLLKMNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
              +PVC+S+  L+YID+ WKD  P LLP DPY+RA ARFW  ++D K +        SK 
Sbjct  60   NDKPVCESLIALQYIDEVWKDKSPPLLPSDPYQRAHARFWADYVDKKVYDGGRKVWTSKK  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+KE I  LK LE  LGDK YF GE FG+ D+A +PF S FY YE+ G F +E E
Sbjct  120  EEQEAAKKEFIECLKVLEGELGDKPYFAGETFGYIDIALVPFYSWFYAYETCGNFSVEAE  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIW---YGVE  105
            CPKL+AWVKRCM + SV+K LPD  K+YE  KI    YG+E
Sbjct  180  CPKLIAWVKRCMNKESVAKTLPDQHKVYEFVKIVRQKYGLE  220



>ref|XP_004147763.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004161561.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN53532.1| hypothetical protein Csa_4G064640 [Cucumis sativus]
Length=220

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 150/214 (70%), Gaps = 2/214 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW + FGMR+RIAL EKG++Y+Y E+DL N  +SHL+L+MNP+ K VP+ +H
Sbjct  2    GEEVKLLDFWGSMFGMRIRIALAEKGVSYEYVEQDLRN--KSHLLLQMNPIHKKVPVFIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S  IL+YID+ WKD  P LLP  PY+RA A+FW  FID K +         KG
Sbjct  60   NGKPICESYIILQYIDEVWKDKAPNLLPLHPYDRAQAKFWVDFIDKKLYDGAKKIWAGKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E +++ +KE+I  LKQLEQVLGDK+YFGGE  GF D+  I + + FY YE+ G F +E E
Sbjct  120  EEREKGKKEVIEILKQLEQVLGDKTYFGGESLGFVDIGLIGYYTWFYTYETIGNFSIESE  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            CPK++ WVKRCM+  SV+K LP+   +YE    W
Sbjct  180  CPKIMCWVKRCMQNESVAKSLPEPKNVYEFVVQW  213



>ref|XP_008775488.1| PREDICTED: probable glutathione S-transferase parA [Phoenix dactylifera]
Length=221

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 152/212 (72%), Gaps = 4/212 (2%)
 Frame = -2

Query  767  TTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPI  588
             T   GV ++DFW + FG R RIAL EKG+ Y+YKEE+L +  +S L+L+ NPV K +P+
Sbjct  2    ATAAKGVVLLDFWVSPFGQRCRIALAEKGVEYEYKEENLWD--KSPLLLKANPVHKKIPV  59

Query  587  LVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLK  408
            L+HEG P+C+S+ I++YID+ W +    LLP DPYERA ARFW  F+D K         K
Sbjct  60   LIHEGNPICESLVIVQYIDEVWSNN--PLLPSDPYERAQARFWADFVDKKVSECWTRLWK  117

Query  407  SKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKL  228
             KGEA++EA+K++I +LK LE  LGDK YFGGE FGF DVAF+P S+ FY +E+ G F +
Sbjct  118  VKGEAQEEARKDMIEDLKLLEGELGDKQYFGGETFGFVDVAFMPLSAWFYTFETCGNFSV  177

Query  227  EEECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            E+ECPKL+AW KRCMER SVSK L D  K+YE
Sbjct  178  EKECPKLVAWAKRCMERESVSKSLHDPHKVYE  209



>ref|XP_004243193.1| PREDICTED: probable glutathione S-transferase parA [Solanum lycopersicum]
Length=219

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 153/209 (73%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++D W + FGMR+RIAL+EKGI Y+ KEE+L+N  +S L+L+MNP+ K +P+L+H
Sbjct  2    GDEVVLLDLWVSPFGMRVRIALKEKGINYESKEENLSN--KSSLLLKMNPIHKQIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S+ I++YID+ WKD  PLL P DPYERA A+FW  ++D K + T      +KG
Sbjct  60   NGKPICESLIIVQYIDEVWKDKAPLL-PSDPYERAHAKFWADYVDKKIYSTGRLVWTTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            EA++ A+KELI+  K LE+ LGDK++FGG++FG  D+A IPF S FY  E+ G F +  E
Sbjct  119  EAQEAAKKELIHHFKLLEKELGDKTFFGGDQFGLVDIALIPFYSWFYALETCGNFSMIHE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+ W KRCMER SVS  LPD  K+Y+
Sbjct  179  CPKLVEWAKRCMERESVSTSLPDQYKVYD  207



>ref|XP_004251827.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=220

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 152/206 (74%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + +GMR RIALEEKG+ Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VILLDFWCSMYGMRARIALEEKGVKYEYKEEDLKN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+ I++YIDD WKD  PLL+P+DPY++A A FW+ ++DN           +KGE +
Sbjct  63   SICESLVIIQYIDDVWKDIGPLLIPKDPYDKAQAWFWSDYMDNTVHEYARKTWATKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A K+ +  LK LE VLGDK YFGGE FGF DV+ I + S F  YE+ GKF +E ECPK
Sbjct  123  EQAIKDFLGGLKLLEGVLGDKPYFGGENFGFLDVSLIGYYSWFLAYETFGKFNVELECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L++WVKRCMER SVSK LPDS K+ E
Sbjct  183  LISWVKRCMERESVSKALPDSKKVCE  208



>gb|EMT03167.1| hypothetical protein F775_14055 [Aegilops tauschii]
Length=215

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG R RIAL EKG+AY+Y E++L   Q+S L+L  NPV K +P+L+H GR
Sbjct  4    VMLLDFWASPFGQRCRIALAEKGVAYEYSEQNLE--QKSELLLRSNPVHKKIPVLLHGGR  61

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ IL YID+ W +  PLL P DPY RA ARFW ++IDNK    Q   L +KGEA+
Sbjct  62   PVCESLIILTYIDEAWPEMMPLL-PRDPYARAQARFWANYIDNKIVDCQTRLLTTKGEAQ  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A+K++I  LK L+  LGDK YFGG+ FGF DVAF+  +  FY YE +G F +EE CP+
Sbjct  121  EQAKKDMIGALKTLDSELGDKDYFGGQAFGFVDVAFVTLTPWFYTYEKYGDFSVEEHCPR  180

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIWYGV  108
            ++AW  RC ER SV+K L D  K+YE+ +  YG 
Sbjct  181  IVAWAARCRERESVAKALTDPEKVYEIVQEEYGA  214



>ref|XP_008775490.1| PREDICTED: probable glutathione S-transferase parA [Phoenix dactylifera]
Length=222

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 156/225 (69%), Gaps = 7/225 (3%)
 Frame = -2

Query  770  TTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVP  591
             T    GV ++D W + FG R RIAL EKG+ Y+YKEE+L +  +S L+L+ NPV K +P
Sbjct  2    ATAAEKGVVLLDVWVSPFGQRCRIALTEKGVEYEYKEENLWD--KSPLLLKANPVHKKIP  59

Query  590  ILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFL  411
            +L+HEG P+C+S+ I+ YID+ W +    LLP DPYERA ARFW  F+D K +       
Sbjct  60   VLIHEGNPICESLLIVRYIDEVWSNN--PLLPSDPYERAQARFWADFVDKKIYECGTRLW  117

Query  410  KSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFK  231
            K KGEA++EA+K++I  LK LE  LGDK YFGGE FGF DVAF+PFS+ FY YE+ G F 
Sbjct  118  KLKGEAQEEARKDMIEILKLLEGELGDKKYFGGETFGFVDVAFVPFSAWFYSYETCGNFS  177

Query  230  LEEECPKLLAWVKRCMERSSVSKILPDSVKMYEL---HKIWYGVE  105
            +E+ECPKL+AW KRCMER SVSK L D  K++E     K  YGVE
Sbjct  178  VEKECPKLVAWAKRCMERESVSKSLHDPHKVHEFVGHLKKMYGVE  222



>ref|XP_006442220.1| hypothetical protein CICLE_v10022164mg [Citrus clementina]
 gb|ESR55460.1| hypothetical protein CICLE_v10022164mg [Citrus clementina]
Length=219

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG+R+RIAL EKG+ Y+YKEEDL N  +S L+L+MNPV K +P+L+H GR
Sbjct  5    VVLLDFWPSMFGIRVRIALAEKGVKYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K + +      +KGE +
Sbjct  63   PVCESPIIVQYIDEVWKDKAPLL-PSDPYQRAQARFWVDFIDKKMYDSSRKTWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE    LK LE  LGDK +FGG+ FG+ D++ IPF   FY YE+ GKF +E ECPK
Sbjct  122  EAAKKEFFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCWFYTYETCGKFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AWVKRC++R +V+K LPD  K++E   +
Sbjct  182  FIAWVKRCLQRETVAKALPDGKKVFEFVSV  211



>dbj|BAB32446.2| glutathione S-transferase [Matricaria chamomilla]
Length=220

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 147/207 (71%), Gaps = 2/207 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
             V ++  WA+GFGMR++IAL EKGI Y+YKEEDL+N  +S L+LEMNPV K +P+L+H G
Sbjct  5    NVVLLTTWASGFGMRVQIALAEKGIEYEYKEEDLSN--KSSLLLEMNPVHKKIPVLIHNG  62

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            +P+C+S  I++YIDD W +  P LLP DPY +A ARFW  F+D K +        +KGE 
Sbjct  63   KPICESNIIVQYIDDAWSNKSPSLLPSDPYLKAQARFWADFVDKKIYDAARKIWTTKGEE  122

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            ++ A+KE I+ LK +E  LGDK Y  G+ FG+ D+A IPFS  FY  E+ G   +E+ECP
Sbjct  123  QETAKKEFIDWLKVMEGQLGDKPYLIGDSFGYADIALIPFSCWFYTLETIGNMSIEKECP  182

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYE  132
            KL+AWVKRCMER SVSK L D  KMYE
Sbjct  183  KLVAWVKRCMERESVSKSLADPHKMYE  209



>ref|XP_007212030.1| hypothetical protein PRUPE_ppa011202mg [Prunus persica]
 gb|EMJ13229.1| hypothetical protein PRUPE_ppa011202mg [Prunus persica]
Length=219

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 153/218 (70%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR R+AL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDFWASMFGMRARVALAEKGVKYEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++Y+D+ W+D  PLL P DPY RA +RFW  FID K +        +KGE +
Sbjct  63   PVCESLIIVQYVDEVWRDKAPLL-PSDPYLRARSRFWADFIDKKLYDAGRIIWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LKQLE  LG+K YF GE FGF D+A I F S FY +E+ G F  E ECPK
Sbjct  122  EAGKKEFIEVLKQLEGELGNKPYFEGESFGFLDIALITFYSWFYAFETCGNFSTEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL---HKIWYGVE  105
            L+AW KRCM++ SVSK LPD+ K+YE     K  +GVE
Sbjct  182  LIAWAKRCMQKESVSKTLPDNKKIYEFVLGMKKMFGVE  219



>ref|XP_010060812.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW67684.1| hypothetical protein EUGRSUZ_F01428 [Eucalyptus grandis]
Length=219

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 149/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR R+AL EKG+ Y+YKEEDL N  +S L+L MNPV K +P+LVH G+
Sbjct  5    VILLDFWPSMFGMRCRLALAEKGVKYEYKEEDLRN--KSDLLLRMNPVHKKIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ IL+YI++TW D  PLL P DPY+RA ARFW  ++D KF+        +KGE +
Sbjct  63   PVCESLIILQYIEETWPDRCPLL-PSDPYQRAQARFWADYVDKKFYDLGRKVWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI  +K LE  LGDK +FGGEK GF DVA +PFS+ FY YE  G F +E ECPK
Sbjct  122  EVAKKELIESMKVLEGELGDKPFFGGEKLGFVDVAIVPFSTWFYAYEMCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRC+E  +VSK L D  K+Y+
Sbjct  182  LIAWTKRCLEIETVSKSLVDPHKVYD  207



>ref|XP_009344316.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D+WA+ FGMR R+AL EKG+ Y+ +EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDYWASMFGMRARVALAEKGVKYENREEDLRNKIKSQLLLQMNPVHKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W+D  PLL P +PY++A +RFW  FID K +   +    +KGE +
Sbjct  65   PVCESLIIVQYIDEVWRDKAPLL-PSEPYQKAHSRFWADFIDKKLYDACSKIWSTKGEER  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LKQLE  LGD+ YF GEKFGF D+A I F   F+ +E+ G F +E ECPK
Sbjct  124  EAAKKDFIEILKQLEGQLGDEPYFEGEKFGFLDIALITFYCWFHAFETCGNFSIEAECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRCM+R SVS+ L D  K+YEL
Sbjct  184  LIAWAKRCMQRESVSRSLADEKKVYEL  210



>ref|XP_009759844.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=221

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 147/210 (70%), Gaps = 2/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK I Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYI++ WKD  P LLP DPY+RA ARFW  +ID K +        +KGE +
Sbjct  64   PICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGD+ YFGGE FGF D+A I F S FY YE+ G F  E ECPK
Sbjct  124  EAAKKDFIECLKVLEGALGDRPYFGGESFGFVDIALIGFYSWFYAYETFGNFSAEAECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AW KRCM+R SV+K LPD  K+ E  K+
Sbjct  184  FVAWAKRCMQRESVAKSLPDQPKVLEFVKV  213



>gb|EMS47855.1| putative glutathione S-transferase [Triticum urartu]
Length=215

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 148/214 (69%), Gaps = 3/214 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG R RIAL EKG+AY+Y E++L   Q+S L+L  NPV K +P+L+H GR
Sbjct  4    VVLLDFWASPFGQRCRIALAEKGVAYEYSEQNLE--QKSELLLRSNPVHKKIPVLLHGGR  61

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ IL YID+ W +  PLL P DPY RA ARFW  +IDNK    Q   L  KGEA 
Sbjct  62   PVCESLVILTYIDEAWPEVAPLL-PRDPYARAQARFWADYIDNKIVDCQTRLLTMKGEAL  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A+K++I  LK LE  LGDK YFGGE FGF DVAF+  +  FY YE +G F +EE CP+
Sbjct  121  EQAKKDMIGALKTLEADLGDKDYFGGEAFGFVDVAFVTLTPWFYTYEKYGDFSVEEHCPR  180

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIWYGV  108
            ++AW  RC ER SV+K L D  K+YE+ +  YG 
Sbjct  181  IVAWAARCRERESVAKALTDPEKVYEIVQEEYGA  214



>ref|XP_009616058.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
 sp|Q03666.1|GSTX4_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PCNT107 [Nicotiana tabacum]
 emb|CAA39707.1| auxin-induced protein [Nicotiana tabacum]
Length=221

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 147/210 (70%), Gaps = 2/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK I Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYI++ WKD  P LLP DPY+RA ARFW  +ID K +        +KGE +
Sbjct  64   PICESIIAVEYIEEVWKDKAPNLLPSDPYDRAQARFWADYIDKKLYDFGRKLWTTKGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGDK YFGGE FGF D+A I + S FY YE+ G F  E ECPK
Sbjct  124  EAAKKDFIECLKVLEGALGDKPYFGGESFGFVDIALIGYYSWFYAYETFGNFSTEAECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AW KRCM+R SV+K LPD  K+ E  K+
Sbjct  184  FVAWAKRCMQRESVAKSLPDQPKVLEFVKV  213



>ref|XP_011030768.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=219

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 152/210 (72%), Gaps = 3/210 (1%)
 Frame = -2

Query  761  CGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILV  582
             GG V ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+LV
Sbjct  2    AGGQVTLLDFWPSPFGMRVRLALAEKGVKYEYREEDLWN--KSALLLQMNPVNKQIPVLV  59

Query  581  HEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSK  402
            H+G+PVC+S+ I++YID+ WKD  PLL P DPY+RA ARFW  F+D K +         K
Sbjct  60   HDGKPVCESLIIVQYIDEVWKDSAPLL-PSDPYQRAQARFWADFVDKKIYDLGRKIWTKK  118

Query  401  GEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEE  222
            GE ++ A+K+ I+ LK +E  LGDK YFGGE  G+ D+A +PF S FY YE+ G F +E 
Sbjct  119  GEEQETAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEA  178

Query  221  ECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            ECPKL+A+ KRC+++ +VSK L D  K+Y+
Sbjct  179  ECPKLIAYCKRCLQKETVSKALEDPQKVYD  208



>ref|NP_001236486.1| glutathione S-transferase GST 9 [Glycine max]
 gb|AAG34799.1|AF243364_1 glutathione S-transferase GST 9 [Glycine max]
Length=200

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 146/201 (73%), Gaps = 3/201 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
              GV ++D WA+ FGMR+RIAL EKG+ Y+YKEE+L N  +S L+L+MNP+ K +P+L+H
Sbjct  2    ADGVVLLDTWASMFGMRVRIALAEKGVEYEYKEENLRN--KSPLLLQMNPIHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S  I++YID+ W D  P+L P DPYERA ARFW  +ID K + T      SKG
Sbjct  60   NGKPICESAIIVQYIDEVWNDKAPIL-PSDPYERAQARFWVDYIDKKVYDTWRKMWLSKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E  +  +KE I+  KQLE+ L DK+Y+G + FGF D+  IPF S FY +E++G FK+EEE
Sbjct  119  EEHEAGKKEFISIFKQLEETLSDKAYYGSDTFGFLDIGLIPFYSWFYTFETYGNFKMEEE  178

Query  218  CPKLLAWVKRCMERSSVSKIL  156
            CPKL+AW KRCM+R +VSK L
Sbjct  179  CPKLVAWAKRCMQREAVSKSL  199



>ref|XP_004147764.1| PREDICTED: probable glutathione S-transferase parC-like [Cucumis 
sativus]
 ref|XP_004166600.1| PREDICTED: probable glutathione S-transferase parC-like [Cucumis 
sativus]
 gb|KGN53533.1| Glutathione S-transferase [Cucumis sativus]
Length=220

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL +KG+AY+Y EEDL N  +S L+LEMNP+ K +P+L+H G+
Sbjct  6    VKLLDFWPSMFGMRVRIALAQKGVAYEYVEEDLRN--KSPLLLEMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I+EYID+ W D  PLL P  PY+RA ARFW  FID K +        +KGE  
Sbjct  64   PICESSIIVEYIDEFWNDKAPLL-PSHPYDRAQARFWVDFIDKKLYGPTRKIWATKGEEH  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LKQLEQVLG+K YFGGE  GF D+A I F S FY YE+ GKF +E ECPK
Sbjct  123  EAGKKEFIEILKQLEQVLGEKEYFGGESLGFIDIALIGFYSWFYTYETVGKFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            +++W KRC++  SV+K LPDS K+Y+ 
Sbjct  183  IISWGKRCLQNESVAKSLPDSKKIYDF  209



>ref|XP_008382602.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR R+AL EKGI Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWASMFGMRARVALAEKGIEYEYREEDLRN--KSQLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W D  PLL P +PY+RA +RFW  FID K +        +KGE +
Sbjct  63   PVCESLIIVQYIDEVWSDKAPLL-PSEPYQRACSRFWADFIDKKLYDAGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LKQLE  LG K YF GEKFGF D+A I F S F+ YE+ G F +E ECPK
Sbjct  122  EAAKKDFIEILKQLEGQLGGKPYFEGEKFGFLDIALITFYSWFHAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRC +R SVSK L D  K+YE 
Sbjct  182  LIAWAKRCKQRESVSKSLADEKKVYEF  208



>sp|P49332.1|GSTXC_TOBAC RecName: Full=Probable glutathione S-transferase parC; AltName: 
Full=Auxin-regulated protein parC [Nicotiana tabacum]
 emb|CAA45740.1| parC [Nicotiana tabacum]
Length=221

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 147/210 (70%), Gaps = 2/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK I Y+YK+EDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VILLDFWPSMFGMRLRIALAEKEIKYEYKQEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYI++ WKD  P LLP DPY+RA ARFW  +ID K +        +KGE +
Sbjct  64   PICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGD+ YFGGE FGF D+A I F S FY YE+ G F  E ECPK
Sbjct  124  EAAKKDFIECLKVLEGALGDRPYFGGESFGFVDIALIGFYSWFYAYETFGNFSTEAECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AW KRCM+R SV+K LPD  K+ E  K+
Sbjct  184  FVAWAKRCMQRESVAKSLPDQPKVLEFVKV  213



>ref|XP_010060816.1| PREDICTED: glutathione S-transferase U25-like [Eucalyptus grandis]
 gb|KCW67691.1| hypothetical protein EUGRSUZ_F01436 [Eucalyptus grandis]
Length=219

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG+R R+AL EKG+ Y+YKEEDL N  +  L+L+MNPVRK +P+L+H G+
Sbjct  5    VILLDFWPSMFGIRCRVALAEKGVVYEYKEEDLWN--KGELLLQMNPVRKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I+EY+D TW    PLL P DPYERA ARFW  FID KF+      L +KGE +
Sbjct  63   PVCESLVIVEYVDQTWSHKAPLL-PSDPYERARARFWADFIDKKFYGQGWKVLTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE  LG++ +FGG+KFGF D++FI F   FY YE  G F +E ECPK
Sbjct  122  EAAKKEFIHSLKLLESELGNEPFFGGKKFGFLDISFIGFYCRFYSYEMCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVSK LPD  K++
Sbjct  182  LIAWGKRCMEKESVSKSLPDPQKVH  206



>ref|XP_010062724.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW69857.1| hypothetical protein EUGRSUZ_F03196 [Eucalyptus grandis]
Length=278

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 153/219 (70%), Gaps = 8/219 (4%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGIAY YKEEDL N  +S L+L MNPV K +P+L+H G+
Sbjct  64   VILLDFWPSPFGMRVRIALAEKGIAYDYKEEDLKN--KSPLLLAMNPVHKKIPVLIHNGK  121

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++YID+ W D  PLL P DPYERA ARFW  ++D K +        +KGE +
Sbjct  122  PVCESLIAVQYIDEVWHDKSPLL-PSDPYERAQARFWADYVDKKIYDLGRKIWSTKGEEQ  180

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE +  LK LE  LGDK +FGG+ FGF DVA +PF S FY YE+ G F +E ECPK
Sbjct  181  EAAKKEFVESLKLLEGELGDKPFFGGQAFGFVDVALVPFYSWFYAYETCGGFSIEAECPK  240

Query  209  LLAWVKRCMERSSVSKILPDSVKMY----ELHKIWYGVE  105
            L+AW KRC+ R SVSK LPD  K++    EL K  YGVE
Sbjct  241  LVAWAKRCLLRESVSKSLPDPEKVHGFVLELKKK-YGVE  278



>ref|XP_006349999.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 152/206 (74%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + +GMR RIALEEKGI Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VILLDFWCSMYGMRARIALEEKGIKYEYKEEDLKN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+ I++YIDD WK   PLL+P+DPYE+A A FW+ ++DN           +KGE +
Sbjct  63   SICESLVIIQYIDDVWKGTGPLLVPKDPYEKAQAWFWSDYMDNTVHEYARKTWATKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +++ K+ ++ LK LE VLGDK YFGG+ FGF DV+ I + S F  YE+ GKF +E ECPK
Sbjct  123  EQSIKDFLDGLKLLEGVLGDKPYFGGDNFGFLDVSLIGYYSWFLAYETFGKFNVELECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L++WVKRC+ER SVSK LPDS K+ E
Sbjct  183  LISWVKRCLERDSVSKALPDSKKVCE  208



>ref|XP_004488707.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=219

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI ++Y+EEDL N  +S L+L+MNP+ K +P+LVH G+
Sbjct  5    VILLDFWPSPFGMRLRIALAEKGIEFEYREEDLRN--KSPLLLQMNPIHKKIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YID+ W    PLL P DPY+R+ ARFW  ++D K +         KGE +
Sbjct  63   PICESLIAVQYIDEVWNHKSPLL-PSDPYQRSQARFWADYVDKKIYDAGRNIWTKKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LEQ LGDK+YFGG+K GF DVA IPF + F GYE+ G F +E+ECPK
Sbjct  122  EAAKKEFIDALKLLEQELGDKTYFGGDKLGFVDVALIPFYTWFKGYETFGNFIVEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRCM+  SVSK LPD  K+YE 
Sbjct  182  FIAWAKRCMQIESVSKSLPDQEKVYEF  208



>ref|XP_008809358.1| PREDICTED: probable glutathione S-transferase parA [Phoenix dactylifera]
Length=221

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 153/216 (71%), Gaps = 6/216 (3%)
 Frame = -2

Query  776  MATTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKS  597
            MAT    G V ++D W + FG R RIAL EKG+ Y+Y+EE+L +  +S L+L+MNP+ K 
Sbjct  1    MATEK--GAVLLLDLWVSVFGQRCRIALAEKGVEYEYREENLGD--KSPLLLKMNPIHKK  56

Query  596  VPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQAT  417
            +P+L+H+G+PVC+S+ IL+Y+D+ W +    LLP DP+ERA ARFW  FID K +     
Sbjct  57   IPVLIHDGKPVCESLIILQYVDEVWTNN--PLLPSDPHERAKARFWADFIDQKIYECGTR  114

Query  416  FLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGK  237
              K KG+A  EA+K+++  LK LE  LGDK YFGGE FGF DVAF+PF++ FY YE+ G 
Sbjct  115  LWKFKGDAHDEAKKDMMEILKLLEGELGDKKYFGGETFGFVDVAFVPFTAWFYSYETLGN  174

Query  236  FKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            F  E ECPKL+AW KRCMER SV+K LP   K+YE+
Sbjct  175  FSTENECPKLVAWAKRCMERESVAKSLPHPYKVYEV  210



>ref|XP_007212042.1| hypothetical protein PRUPE_ppa011334mg [Prunus persica]
 gb|EMJ13241.1| hypothetical protein PRUPE_ppa011334mg [Prunus persica]
Length=215

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFWA+ F MR+R+AL EKG+ Y+ +EEDL N  +S L+L+MNPV K +P+L+H
Sbjct  2    GDEVVLLDFWASMFAMRVRVALAEKGVKYENREEDLWN--KSSLLLQMNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++Y+D+ W+D  PLL P DPY+RA +RFW  FID K +        +K 
Sbjct  60   NGKPVCESLIIVQYVDEVWRDKAPLL-PSDPYQRARSRFWADFIDKKLYVASRKIWGTKE  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++  +KE I  LKQLE  LGD+ YF GE FGF D+A IPF S F  YE+ G F  E E
Sbjct  119  EEQEAGKKEFIEALKQLEGELGDEPYFEGESFGFLDIALIPFYSWFNAYETCGNFSTEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGV  108
            CPKL+ W KRCM R SVSK L D  K+YE   IW G+
Sbjct  179  CPKLIEWAKRCMRRESVSKSLADPKKVYEFLTIWVGL  215



>dbj|BAC21261.1| glutathione S-transferase [Cucurbita maxima]
Length=218

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG+R+RIAL EKG+  +Y E+DL N  +S L+L+MNPV K +P+LVH GR
Sbjct  5    VKLLDFWPSMFGIRVRIALAEKGVRIEYMEQDLRN--KSPLLLQMNPVHKKIPVLVHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K +         KGE +
Sbjct  63   PICESSIIVQYIDEVWKDKAPLL-PSDPYQRAQARFWVDFIDKKLYDAGRKVWTGKGE-E  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
             EA KELI  LKQLE+VLG+K +FGGE+ GF D+A I F S FY YE+ GK  +E ECPK
Sbjct  121  VEAGKELIGVLKQLEEVLGEKGFFGGERLGFVDIALIGFHSWFYTYEAFGKLSIEAECPK  180

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            ++ W KRC+E+ SVSK LPDS K+Y+
Sbjct  181  IMGWAKRCLEKESVSKSLPDSKKVYD  206



>ref|XP_008226264.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=215

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFWA+ F  R+R+AL EKG+ Y+ +EEDL N  +S L+L+MNPV K +P+L+H
Sbjct  2    GDEVVLLDFWASMFATRVRVALAEKGVKYENREEDLWN--KSSLLLQMNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S+ I++Y+D+ W+D  PLL P DPY+RA +RFW  FID K +        +KG
Sbjct  60   NGKPICESLIIVQYVDEVWRDKAPLL-PSDPYQRARSRFWADFIDKKLYVASRKIWGTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++  +KE I  LKQLE  LGDK YF GE FGF D+A I F S FY YE+ G F  E E
Sbjct  119  EEQEAGKKEFIEALKQLEGELGDKPYFEGESFGFLDIALISFYSWFYAYETFGNFSTEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGV  108
            CPKL+ W KRCM+R SVSK L D  K+YE    W G+
Sbjct  179  CPKLIEWAKRCMQRESVSKSLADPKKVYESVTSWVGL  215



>ref|XP_010923803.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
Length=222

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 151/212 (71%), Gaps = 3/212 (1%)
 Frame = -2

Query  767  TTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPI  588
             T   GV ++D W + FG R RIAL EKG+ Y+++EE++    +S L+L+MNP+ K +P+
Sbjct  2    ATAEKGVVLLDLWVSMFGQRCRIALAEKGVEYEFREENIPE-HKSPLLLKMNPIHKKIPV  60

Query  587  LVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLK  408
            L+H+G+PVC+S+ I++YID+ W +    LLP DPYERA ARFW   +D K +   +   K
Sbjct  61   LIHDGKPVCESLIIVQYIDEVWTNN--PLLPSDPYERAEARFWADLVDKKIYDCGSRLWK  118

Query  407  SKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKL  228
             KGEA+QEA+KE+I  LK LE  LGDK YFGGE FGF DVA +PF++ FY YE+   F +
Sbjct  119  LKGEAQQEAKKEMIEVLKLLEDELGDKKYFGGEIFGFVDVALVPFTAWFYSYETCANFSI  178

Query  227  EEECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            EEECPKL+AW KRCMER SV+K L D  K+YE
Sbjct  179  EEECPKLVAWGKRCMERESVAKSLHDPHKVYE  210



>ref|XP_010694833.1| PREDICTED: probable glutathione S-transferase [Beta vulgaris 
subsp. vulgaris]
Length=215

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 153/217 (71%), Gaps = 3/217 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
               V ++DFW + FGMR+RIAL EK + Y+Y++E+L +  +S L+L+MNPV K +P+L+H
Sbjct  2    ANEVVLLDFWPSPFGMRVRIALAEKEVKYEYRDENLRD--KSELLLKMNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
              +PVC+S+ I+EYID+ W D +PLL P  PY+RA ARFW  F++ K + T      +KG
Sbjct  60   NNKPVCESLIIVEYIDEVWSDKYPLL-PSHPYQRAQARFWADFVEKKTYTTGRNIWSTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
              ++ A KE I+ LK LEQ LGDK YFGG+KFG+ D+ FIPF S FY YE+ G FK+EE 
Sbjct  119  TEQEAAIKEFIDHLKLLEQELGDKPYFGGDKFGYVDLIFIPFYSWFYAYETLGNFKIEES  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGV  108
            CPK++ W KRCMER SV+K LP+  K+Y   K  YG+
Sbjct  179  CPKIIEWAKRCMERESVAKTLPNHEKVYLEIKKVYGL  215



>ref|XP_006478015.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG+R+RIAL EKG+ Y+YKEEDL N  +S L+L+MNPV K +P+L+H GR
Sbjct  5    VVLLDFWPSMFGIRVRIALAEKGVKYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P C+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K + +      +KGE +
Sbjct  63   PFCESPIIVQYIDEVWKDKAPLL-PSDPYQRAQARFWVDFIDKKMYDSLRKTWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE    LK LE  LGDK +FGG+ FG+ D++ IPF   FY YE+ GKF +E ECPK
Sbjct  122  EAAKKEFFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCWFYTYETCGKFNVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AWVKRC++R +V+K LPD  K++E 
Sbjct  182  FIAWVKRCLQRETVAKALPDGKKVFEF  208



>ref|XP_008451810.1| PREDICTED: probable glutathione S-transferase parC [Cucumis melo]
Length=219

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL +KG+AY+Y EEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VKLLDFWPSMFGMRVRIALAQKGVAYEYIEEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ W D  PLL P  PY+RA ARFW  FID K +        +KGE  
Sbjct  63   PICESSIIVQYIDEVWNDKAPLL-PSHPYDRAQARFWVDFIDKKLYDPTRKIWATKGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE+I  LKQLEQVLG+K YFGGE  G  D+A I F S FY YE+ GKF +E ECPK
Sbjct  122  EAGKKEMIEILKQLEQVLGEKDYFGGESMGIIDIALIGFYSWFYTYETIGKFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            +++W KRC++  SV+K LPDS K+Y+
Sbjct  182  IISWGKRCLQNESVAKSLPDSRKIYD  207



>gb|ABG90381.2| glutathione S-transferase [Caragana korshinskii]
Length=219

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRLRIALAEKGIKYEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++YID+ W D  PLL P DPY+RA ARFW  ++D K +         KGE +
Sbjct  63   PVCESLIAVQYIDEVWSDRSPLL-PSDPYQRAQARFWADYVDKKIYEVGRNVWTKKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE+ LGDK+YFGGEK G+ D+A IPF + F  YE  G   +E+ECPK
Sbjct  122  EAAKKEFIDALKLLEEQLGDKTYFGGEKLGYVDIALIPFYTWFKAYEVFGNLNIEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRCM+  +VS+ LPD  K+YE 
Sbjct  182  FIAWAKRCMQIENVSRSLPDQHKVYEF  208



>ref|XP_002532823.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29553.1| glutathione s-transferase, putative [Ricinus communis]
Length=219

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RIAL EKG+ Y+Y+EE+L N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    VILLDFWASPFGMRVRIALAEKGVKYEYREENLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YID+ W D  PLL P D Y RA ARFW  F+D K +        +KGE +
Sbjct  63   PICESLIAVQYIDEVWHDESPLL-PSDSYPRAHARFWADFVDKKIYELGRKIWTTKGEDQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I+ +K LE  LGDK YFGGE FG+ DVA IPF S FY YE+ G F +E ECPK
Sbjct  122  EAGKKEFIDAIKLLEGELGDKPYFGGESFGYVDVALIPFYSWFYAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW+KRC+++ SVSK LPD  K+YE 
Sbjct  182  FMAWIKRCLQKESVSKALPDQQKVYEF  208



>ref|XP_010040784.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=221

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 151/206 (73%), Gaps = 4/206 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ FGMR RIAL EKG+ +  +EEDL+N  +S L+L+MNPV K +P+LVH G+
Sbjct  5    VILLDVWASPFGMRARIALREKGVEFDMREEDLSN--KSPLLLKMNPVNKQIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ +++YID+TW    PLL P DPYERA ARFW  ++D K FP   T  +S GEA+
Sbjct  63   PVCESLLLVQYIDETWVRESPLL-PSDPYERARARFWADYVD-KIFPVGRTVWQSMGEAQ  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGDK+YFGGE+FG+ DV+ IPF S FYG E+   F + EECP 
Sbjct  121  EAAKKEYIECLKVLEGELGDKAYFGGERFGYVDVSLIPFYSWFYGLETMANFSIVEECPT  180

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRCM+R SV+K LPD  K+Y+
Sbjct  181  LVAWAKRCMQRESVAKSLPDQHKVYD  206



>ref|XP_006442222.1| hypothetical protein CICLE_v10022154mg [Citrus clementina]
 gb|ESR55462.1| hypothetical protein CICLE_v10022154mg [Citrus clementina]
Length=219

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 150/210 (71%), Gaps = 3/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKG+ Y+YKE+DL N  +S L+L MNPV K +P+L+H G+
Sbjct  5    VILLDFWASMFGIRVRIALAEKGVKYEYKEQDLFN--KSPLLLRMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K + T      +KGE +
Sbjct  63   SVCESSIIVQYIDEVWKDKAPLL-PYDPYQRAQARFWVDFIDKKMYDTSRKTWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGDK +FGG+ FG+ D+  IP+   FY YE+ GKF +E ECPK
Sbjct  122  EAAKKEFIEVLKTLEGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AWVKRC++R +V+K LPD  K++E   +
Sbjct  182  FIAWVKRCLQRETVAKALPDEKKVFEFVSV  211



>ref|XP_010245128.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=219

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 151/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK I Y+Y++E+L +  +S ++LEMNPV K +P+L+H GR
Sbjct  5    VILLDFWPSSFGMRVRIALAEKEIQYEYRDENLQD--KSPMLLEMNPVHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+RA ARFW  ++D K +   +   ++KGE +
Sbjct  63   PICESLLIVQYIDEVWKDKSPLL-PSDPYQRAQARFWADYVDKKMYYCMSRIWRNKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A++ELI  LK L+  LG+K YFGGE FGF D++F+ F S FY  E+ G F +E ECPK
Sbjct  122  EAAKEELIESLKVLQGELGEKPYFGGETFGFVDLSFVSFYSWFYSTETCGNFSIESECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCMER SVSK LP   K+YE 
Sbjct  182  IVAWAKRCMERESVSKTLPHHHKIYEF  208



>ref|XP_010694823.1| PREDICTED: probable glutathione S-transferase [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
               V ++DFW + FGMR+RIAL EK + Y+Y++E+L +  +S L+L+MNPV K +P+LVH
Sbjct  2    ANEVVLLDFWPSPFGMRVRIALAEKEVKYEYRDENLRD--KSELLLKMNPVHKKIPVLVH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
              +PVC+S+ I+EYID+ W D +PLL P DPY+RA ARFW  F++ K + T  +   +KG
Sbjct  60   NNKPVCESLIIVEYIDEVWSDKYPLL-PSDPYQRAQARFWADFVEKKMYTTGRSVWSTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
              ++ A ++ I+ LK LEQ LG+K YFGG+ FG+ D+ FIP+ S F+ YE+ G FK+EE 
Sbjct  119  AEQEAAIRDFIDHLKLLEQELGNKPYFGGDNFGYVDLTFIPYYSWFHAYETLGNFKIEES  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPK++ W KRCMER +V+K LPD  K+YE 
Sbjct  179  CPKIIEWAKRCMERETVAKALPDQKKVYEF  208



>ref|XP_007149244.1| hypothetical protein PHAVU_005G053900g [Phaseolus vulgaris]
 gb|ESW21238.1| hypothetical protein PHAVU_005G053900g [Phaseolus vulgaris]
Length=219

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ FGMR+RIAL EK + Y+ KEE+L +  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDTWASMFGMRVRIALAEKSVKYELKEENLRD--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ W    P L+P DPYERA ARFW  +ID K + T      S GE  
Sbjct  63   PICESAIIVQYIDEVWNHN-PPLMPSDPYERAQARFWVDYIDKKVYDTWRKMWLSSGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KELI+  KQLE+ LGDK ++GGE FGF DV  IPF S FY +E++G FK+E ECPK
Sbjct  122  ETWKKELISIFKQLEETLGDKPFYGGETFGFADVGLIPFYSWFYTFETYGNFKMEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+ W KRCMER +VSK LPD  K+Y
Sbjct  182  LMVWAKRCMERETVSKTLPDEKKVY  206



>gb|KDP24710.1| hypothetical protein JCGZ_25701 [Jatropha curcas]
Length=219

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW + FGMR+RIAL EKG+ Y+Y+EEDL N  +S L+L+MNP+ K +P+L+H
Sbjct  2    GEEVILLDFWPSPFGMRVRIALAEKGVKYEYREEDLRN--KSPLLLQMNPIHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+  ++Y+D+ W D  PLL P DPY+RA ARFW  F+D K +        +KG
Sbjct  60   DGKPICESLIAVQYVDEVWSDKSPLL-PSDPYQRAQARFWADFVDKKIYDIGRKIWTTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I  LK LE  L DK YFGGE+ G+ DV+ +PF S FY YE  G F  E E
Sbjct  119  EEQEAAKKDFIECLKLLEAELEDKPYFGGERIGYVDVSLVPFYSWFYAYEQFGNFSTEVE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPKL+AWVKRC+E+ SVSK LPD  K+Y+ 
Sbjct  179  CPKLIAWVKRCLEKESVSKSLPDQQKVYDF  208



>ref|XP_010103478.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96020.1| putative glutathione S-transferase [Morus notabilis]
Length=241

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  27   VILLDFWVSMFGMRVRIALAEKGIKYEYKEEDLRN--KSVLLLQMNPIHKKIPVLIHNGK  84

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+ I++Y+D+ W +  PLL P DPY+RA ARFW  FID K +        +KGE +
Sbjct  85   PISESLIIVQYVDEVWNEKAPLL-PSDPYQRAQARFWADFIDKKMYDAGRNVWTTKGEEQ  143

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE +  LK LE  LG+K YFGG+ FGF D+A I FS  F+ YE+ G F +E ECPK
Sbjct  144  EAAKKEFLGNLKLLETELGNKPYFGGDSFGFVDIALIGFSCWFHAYETFGNFSIEAECPK  203

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRCME+ SVSK L D  K+YE 
Sbjct  204  LIAWAKRCMEKESVSKSLADEKKVYEF  230



>ref|XP_008226256.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=220

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ +EEDL+N  +S L+L+MNPV K +P+L+H+GR
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIDYEPREEDLSN--KSPLLLKMNPVHKQIPVLIHKGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W    PLL P DPY RA ARFW  ++D K + T      ++GE +
Sbjct  63   PVCESLIIVQYIDEVWSHKAPLL-PSDPYHRAHARFWADYVDKKIYSTGKLVWGTRGEIQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI   + LE  LGDK+YFGGE FG  DVA IPF S FY  E+ G   + +ECP+
Sbjct  122  EAAKKELIECFRLLENELGDKTYFGGETFGIVDVALIPFYSWFYALETCGNLCMVKECPR  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRCM+R SVSK LPD  KMY+
Sbjct  182  LVAWAKRCMQRESVSKSLPDQYKMYD  207



>ref|XP_008226266.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=215

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DF A+ F MR R+AL EKG+ Y+ KEEDL N  +S L+L+MNPV K +P+L+H
Sbjct  2    GDEVVLLDFCASMFAMRARVALAEKGVKYENKEEDLRN--KSSLLLQMNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++Y+D+ W+D  PLL P DPY+RA +RFW  FID K +        +K 
Sbjct  60   NGKPVCESLIIVQYVDEVWRDKAPLL-PSDPYQRARSRFWADFIDKKLYVASRKIWGTKE  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++  +KE I  LKQLE  LGD+ YF GE FGF D+A IPF S FY YE+ G F  E E
Sbjct  119  EEQEAGKKEFIEALKQLEGELGDEPYFEGESFGFLDIALIPFYSWFYAYETCGNFSTEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIWYGV  108
            CPKL+ W KRCM+R SVSK L D  K+YE    W G+
Sbjct  179  CPKLIEWAKRCMQRESVSKSLADPKKVYESLTSWVGL  215



>gb|KDP43662.1| hypothetical protein JCGZ_24120 [Jatropha curcas]
Length=221

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 154/219 (70%), Gaps = 8/219 (4%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI ++Y+EE+L N  +S L+L+MNPV K +P+L+H G+
Sbjct  7    VVLLDFWPSPFGMRVRIALAEKGIKHEYREENLRN--KSALLLQMNPVHKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PV +S   +EYID+ WKD  PLL P DPY+RA A+FW  F+D K +        +KGE +
Sbjct  65   PVVESRIAVEYIDEVWKDKTPLL-PSDPYQRAQAKFWADFVDKKIYDLGRKTWATKGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE +  LK LE  LGDK YFGGE FG+ DVAFIPF S FY YE  G F +E ECPK
Sbjct  124  EAAKKEFMESLKILEGELGDKPYFGGECFGYVDVAFIPFYSWFYAYEVSGNFSIEAECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMY----ELHKIWYGVE  105
            L+AWVKRC+E+ +VS  LPD  K+Y    EL K  YG++
Sbjct  184  LIAWVKRCLEKETVSNSLPDQKKIYGFVLELKKA-YGID  221



>ref|XP_007214172.1| hypothetical protein PRUPE_ppa019045mg [Prunus persica]
 gb|EMJ15371.1| hypothetical protein PRUPE_ppa019045mg [Prunus persica]
Length=220

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 147/206 (71%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKG+ Y+YKEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSMFGMRVRVALAEKGVKYEYKEEDLLN-NKSPLLLQMNPVHKKLPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  +ID   +        +KGE +
Sbjct  64   PVCESANIVQYIDEAWKDKAPLL-PSDPYQRALARFWVDYIDKNLYEAGKNIWATKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +EA+K+LI  LK LE  LGD SYFGGE FGF DVA + F   F+ YE+ G F +E ECPK
Sbjct  123  EEAKKKLIEILKLLEGQLGDNSYFGGEIFGFLDVALVTFYCWFFSYETCGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM++ SV++ L D  K+YE
Sbjct  183  LIEWAKRCMQKESVAQSLADPKKVYE  208



>ref|XP_010103480.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96022.1| putative glutathione S-transferase [Morus notabilis]
Length=219

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 149/211 (71%), Gaps = 3/211 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKGI Y+YKEE+L+N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VILLDFWPSMFGMRVRVALAEKGIKYEYKEENLSN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+ I++YID+ W D  PLL P DPY+RA ARFW  FID K +        +KGE K
Sbjct  63   PISESLTIVQYIDEVWNDKAPLL-PSDPYQRAQARFWADFIDKKVYDAAGKVWTTKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE +N LK LE  LG+K YFGG+ FGF D+A I FS  F+ YE+ G F ++ ECPK
Sbjct  122  EAAKKEFLNILKLLETELGNKPYFGGDSFGFVDIALIGFSCWFHAYETFGNFSIKAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            L+AW KRC E+ SVSK L D  K+YE    W
Sbjct  182  LIAWAKRCNEKESVSKSLADEKKVYEFVAEW  212



>ref|XP_007214499.1| hypothetical protein PRUPE_ppa018063mg [Prunus persica]
 gb|EMJ15698.1| hypothetical protein PRUPE_ppa018063mg [Prunus persica]
Length=220

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ +EEDL+N  +S L+L+MNPV K +P+L+H+GR
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIDYEPREEDLSN--KSPLLLKMNPVHKQIPVLIHKGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W    PLL P DPY RA ARFW  ++D K + T      ++GE +
Sbjct  63   PVCESLIIVQYIDEVWSHQAPLL-PSDPYHRAHARFWADYVDKKIYSTGKLVWGTRGEIQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI   K LE  LGDK+YFGGE FG  DVA IPF S FY  E+ G   + +ECP+
Sbjct  122  EAAKKELIECFKLLENELGDKTYFGGESFGIVDVALIPFYSWFYALETCGNLCMVKECPR  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM+R SVSK LPD  KMY+
Sbjct  182  LVTWAKRCMQRESVSKSLPDQYKMYD  207



>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max
 pdb|2VO4|B Chain B, Glutathione Transferase From Glycine Max
Length=219

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 146/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA  RFW  ++D K +        SKGE K
Sbjct  63   PICESLIAVQYIEEVWNDRNPLL-PSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A +PF + F  YE+ G   +E ECPK
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
             +AW KRC+++ SV+K LPD  K+YE
Sbjct  182  FIAWAKRCLQKESVAKSLPDQQKVYE  207



>gb|KHN27766.1| Glutathione S-transferase 3 [Glycine soja]
Length=217

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++  WA+ FGMR+RIAL EKG+ Y+YKEE+L N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VVLLGTWASMFGMRVRIALAEKGVKYEYKEENLRN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ W D  P+L P DPYERA ARFW  +ID K   T      S GE  
Sbjct  63   PICESAIIVQYIDEVWNDKAPIL-PSDPYERAQARFWVDYIDKKVNDTWRKMWLSTGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I+  KQLE+ LGDK ++GG+ FGF D+  IPF S FY +E++G FK+E ECPK
Sbjct  122  ETWKKEFISVFKQLEEALGDKPFYGGDTFGFVDLGLIPFYSWFYTFETYGNFKMEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRC++R +VSK LPD  K+Y+
Sbjct  182  LVAWAKRCLQRETVSKTLPDEKKVYD  207



>ref|XP_011030763.1| PREDICTED: probable glutathione S-transferase isoform X2 [Populus 
euphratica]
Length=219

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 146/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RIAL EKG+ Y+Y E+DL +  +S L+L+MNPV K +P+LVH G+
Sbjct  5    VTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRD--KSALLLQMNPVYKKIPVLVHRGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YIDD W+D  PLL P DPYERA + FW  FID K F        +KGE  
Sbjct  63   PVCESLIIVQYIDDVWRDKAPLL-PSDPYERAQSMFWADFIDKKVFEITKKIWTTKGEEL  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGD+ YFGGE  G+ DVAF+PF   FY YE+ G F +E ECPK
Sbjct  122  EGAKKDFIECLKLLEGELGDRPYFGGENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCM++ SVSK L    K+YE 
Sbjct  182  IIAWAKRCMQKESVSKSLEQPKKVYEF  208



>ref|XP_010923805.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=221

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 151/216 (70%), Gaps = 6/216 (3%)
 Frame = -2

Query  776  MATTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKS  597
            MAT    G V ++D W + FG R RIAL EKG+ Y+Y+EE L +  +S L+L+MNP+ K 
Sbjct  1    MATEK--GEVLLLDLWVSVFGQRCRIALAEKGVEYEYREESLLD--KSPLLLKMNPIHKK  56

Query  596  VPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQAT  417
            +P+L+H+G+PVC+S+ I++YID+ W +    LLP D YERA ARFW  F+D K +     
Sbjct  57   IPVLIHDGKPVCESLIIVQYIDEVWTNN--PLLPSDSYERAKARFWADFVDKKIYECGTK  114

Query  416  FLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGK  237
              + KGEA  EA+K++I  LK LE  LGDK YFGGE FGF D+AF+PF++ FY YE+ G 
Sbjct  115  LWRLKGEAHDEAKKDMIEILKLLEGELGDKKYFGGETFGFMDIAFVPFTAWFYSYETLGN  174

Query  236  FKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            F  E ECPKL+AW KRCMER SV+K LP   K+YE+
Sbjct  175  FSTENECPKLVAWAKRCMERESVTKSLPHPYKVYEV  210



>ref|XP_002300487.1| hypothetical protein POPTR_0001s42820g [Populus trichocarpa]
 gb|EEE85292.1| hypothetical protein POPTR_0001s42820g [Populus trichocarpa]
Length=220

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFWA+ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRN--KSALLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YIDD WKD  PLL P DPY+RA +RFW  F+D K +        +KG
Sbjct  61   DGKPICESLIIVQYIDDVWKDKAPLL-PSDPYQRAQSRFWADFVDKKLYDLGRKIWTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  G+ DVA +PF   FY YE+ G F +E  
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETVGNFNIEAV  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKM  138
            CPKL+A+ KRC+E+ SVSK L D  K+
Sbjct  180  CPKLIAYCKRCLEKESVSKSLEDPQKV  206



>ref|XP_002300483.2| hypothetical protein POPTR_0001s42760g [Populus trichocarpa]
 gb|ADB11311.1| tau class glutathione transferase GSTU2 [Populus trichocarpa]
 gb|EEE85288.2| hypothetical protein POPTR_0001s42760g [Populus trichocarpa]
Length=220

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRN--KSDLLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ WKD  PLL P DP+ERA +RFW  F+D K +        +KG
Sbjct  61   DGKPVCESLIIVQYIDEVWKDKAPLL-PSDPHERAQSRFWADFVDKKMYDFGRKIWTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  GF DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGETLGFVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPKL+A+ KRC+++ SVSK L D  K+Y+ 
Sbjct  180  CPKLIAYCKRCLQKESVSKSLKDPQKVYDF  209



>ref|NP_001237713.1| 2,4-D inducible glutathione S-transferase [Glycine max]
 pdb|4TOP|A Chain A, Glycine Max Glutathione Transferase
 pdb|4TOP|B Chain B, Glycine Max Glutathione Transferase
 gb|AAC18566.1| 2,4-D inducible glutathione S-transferase [Glycine max]
Length=219

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 146/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA  RFW  ++D K +        SKGE K
Sbjct  63   PICESLIAVQYIEEVWNDRNPLL-PSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A +PF + F  YE+ G   +E ECPK
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
             +AW KRC+++ SV+K LPD  K+YE
Sbjct  182  FIAWAKRCLQKESVAKSLPDQQKVYE  207



>gb|ADB11314.1| tau class glutathione transferase GSTU9 [Populus trichocarpa]
Length=220

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFWA+ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRN--KSALLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YIDD WKD  PLL P DPY+RA +RFW  F+D K +        +KG
Sbjct  61   DGKPICESLIIVQYIDDVWKDKAPLL-PSDPYQRAQSRFWADFVDKKLYDLGRKIWTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  G+ DVA +PF   FY YE+ G F +E  
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETVGNFNIEAV  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKM  138
            CPKL+A+ KRC+E+ SVSK L D  K+
Sbjct  180  CPKLIAYCKRCLEKESVSKSLEDPQKV  206



>gb|AFK35485.1| unknown [Lotus japonicus]
Length=219

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 149/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+ NPV K +P+L+H G+
Sbjct  5    VVLLDFWASPFGMRVRIALAEKGINYEYKEEDLRN--KSPLLLQSNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+  ++YID+ W D  PLL P DPY+RA ARFW  ++D K +      +  K E +
Sbjct  63   PIAESLIAVQYIDEVWNDASPLL-PSDPYQRAQARFWADYVDKKIYEIGRNIIWKKNEER  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE+ LGDK+YFGG+K G+ D+A +PF + F GYE+ G F +E ECPK
Sbjct  122  EAAKKEFIDCLKLLEEQLGDKTYFGGDKLGYVDIALVPFYTWFKGYETLGNFNIESECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRC+++ SVSK L D  K+YE
Sbjct  182  LIAWAKRCLQKESVSKSLHDQDKIYE  207



>ref|XP_002264437.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   237 bits (605),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+++AL EKG+ Y+++EEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVKVALAEKGLEYEFREEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+RA ARFW  +ID K F        +KGE +
Sbjct  63   PICESLIIVQYIDEVWKDKSPLL-PSDPYQRAQARFWADYIDKKIFELGRKIWTTKGEDQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGE FGF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  EAAKKEFIECLKLLEGELGEKPYFGGENFGFVDVALVTFSCWFYAYETFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCMER SVS  L D  K++
Sbjct  182  LIAWTKRCMERESVSSSLADPHKVH  206



>ref|XP_010911024.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
Length=223

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 150/216 (69%), Gaps = 4/216 (2%)
 Frame = -2

Query  776  MATTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKS  597
            MAT     GV ++D W + FG R RIAL EKG+ Y+YKEE+L++  +S L+L+MN + K 
Sbjct  1    MATAAEKEGVVLLDLWVSPFGQRCRIALAEKGVEYEYKEENLSD--KSPLLLKMNLIHKK  58

Query  596  VPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQAT  417
            +P+L+H G+P+C+S+  ++YID+ W +    LLP DPYERA ARFW  F+D K +     
Sbjct  59   IPVLIHHGKPICESLVTVQYIDEVWSNN--PLLPSDPYERAKARFWADFVDKKVYECGTR  116

Query  416  FLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGK  237
              K KGEA +EA+K++I  LK LE  LGDK YFGGE FGF DVA  PF++ FY YE+ GK
Sbjct  117  LWKLKGEAHEEARKDMIEILKLLEGELGDKKYFGGETFGFVDVAVAPFTAWFYTYETCGK  176

Query  236  FKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            F ++EECPKL AW KRC ER SVSK + D  K+YE 
Sbjct  177  FSVDEECPKLAAWAKRCKERESVSKSVHDPHKVYEF  212



>ref|XP_007212046.1| hypothetical protein PRUPE_ppa011371mg [Prunus persica]
 gb|EMJ13245.1| hypothetical protein PRUPE_ppa011371mg [Prunus persica]
Length=213

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 146/214 (68%), Gaps = 3/214 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DF A+ F MR R+AL EKG+ Y+ +EEDL N  +S L+L+MNPV K +P+L+H
Sbjct  2    GDEVVLLDFCASMFAMRARVALAEKGVKYENREEDLRN--KSSLLLQMNPVHKMIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S+ I++Y+D+ W+D  PLL P DPY+RA +RFW  FID K +        +KG
Sbjct  60   NGKPICESLIIVQYVDEVWRDKAPLL-PSDPYQRARSRFWADFIDKKLYVASRKIWGTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++  +KE I  LKQLE  LGD+ YF GE FGF D+A IPF S FY YE+ G F  E E
Sbjct  119  EEQEAGKKEFIEALKQLEGELGDRPYFEGESFGFLDIALIPFYSWFYAYETFGNFSTEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            CPKL+ W KRCM+R SVSK L D  K+YE    W
Sbjct  179  CPKLIEWAKRCMQRESVSKSLADPKKVYESLVNW  212



>gb|KHN26783.1| Glutathione S-transferase 3 [Glycine soja]
Length=221

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 149/206 (72%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D W + FGMR  IALEEKG+ Y++K EDLNN  +S L+++MNP+ K +P+L+H G+
Sbjct  6    VVLLDAWGSMFGMRAWIALEEKGVKYEHKMEDLNN--KSSLLMQMNPIYKQIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S  I++YI + W D    +LP DPYERA ARFW  +ID K +P       SKGE  
Sbjct  64   PISESAIIVQYIYEVWNDNKAPILPSDPYERAQARFWVDYIDKKVYPAWNKMWLSKGEEH  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KELI+  KQLE+ LGDK+++GG+ FGF D+A I F S FY +E++G F++E ECPK
Sbjct  124  EAGKKELISVFKQLEETLGDKTFYGGDTFGFVDIALITFYSWFYTFETYGNFEMEGECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRC++R +VSK+LPD  ++Y+
Sbjct  184  LVAWAKRCIQRETVSKVLPDEKELYD  209



>ref|XP_004294219.1| PREDICTED: probable glutathione S-transferase parC-like [Fragaria 
vesca subsp. vesca]
Length=220

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 145/207 (70%), Gaps = 2/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++ FW++ F MR R+AL EKG+ Y+Y+EEDL  P ++ L+LEMNP+ K VP+L+H G+
Sbjct  5    VVLLGFWSSMFAMRPRVALAEKGVEYEYREEDL--PNKTSLLLEMNPIHKKVPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+SV I++YID+ WKD  P LLP DPYERA ARFW  +ID K +    +   +KGE +
Sbjct  63   PVCESVNIVQYIDEAWKDKGPTLLPSDPYERAQARFWVDYIDKKLYEAGKSIWSTKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K  +  LK LE  LGDK+YFGG  FGF D+  + F   FY YE+ G F +E ECPK
Sbjct  123  EAAKKVFLEILKLLEGELGDKTYFGGVSFGFVDINLVTFYCWFYTYETIGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW ++CM + SVSK LPD  K+YE 
Sbjct  183  LIAWFEKCMLKESVSKTLPDPKKVYEF  209



>ref|XP_004243195.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=222

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 146/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFWA+ FGMR+RIAL EKGI Y+YKEE+     +S L+LEMNP+ K VP+L+H G+
Sbjct  6    LILLDFWASMFGMRLRIALAEKGIKYEYKEEEGLISNKSALLLEMNPIHKKVPVLIHNGK  65

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYI++ WKD  PLL P DPYERA ARFW  +ID K + +      +KGE +
Sbjct  66   PICESIIGVEYIEEVWKDKAPLL-PSDPYERAQARFWVDYIDKKLYVSARKIWGTKGEEQ  124

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +K+ I  LK LE  LG+K YFGG+ FGF D+A I F S FY YE++G F  E ECPK
Sbjct  125  EAGKKDFIEVLKVLEGELGEKPYFGGDNFGFVDIALIGFYSWFYAYETYGNFSAEAECPK  184

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRCM+R SV+K LPD  K+ E 
Sbjct  185  FVAWAKRCMQRDSVAKSLPDQHKVLEF  211



>ref|XP_007149247.1| hypothetical protein PHAVU_005G054100g [Phaseolus vulgaris]
 gb|ESW21241.1| hypothetical protein PHAVU_005G054100g [Phaseolus vulgaris]
Length=222

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 151/208 (73%), Gaps = 4/208 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H+G+
Sbjct  7    VVLLDFWPSPFGMRVRIALAEKGINYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHKGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPT-QATFLKSKGEA  393
            P+ +S+ +++YID+ W D  PLL P DPY+RA ARFW  ++D K +   +     SKGE 
Sbjct  65   PISESLIVVQYIDEVWHDRTPLL-PSDPYQRAQARFWADYVDKKIYDNGRKIVWTSKGEE  123

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            K+ A+KE I  LK LE+ LGDK+YFGG+  GF DVA +PF + F  YE+ G F LE ECP
Sbjct  124  KEVAKKEFIEGLKVLEEQLGDKTYFGGDNLGFVDVALVPFYTWFEAYETFGVFNLESECP  183

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            K +AW KRC+++ SV+K LPD  K++E+
Sbjct  184  KFIAWAKRCLQKESVAKSLPDQHKIHEI  211



>emb|CAA04391.1| glutathione transferase [Carica papaya]
Length=218

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEE+L N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRIRIALAEKGIHYEYKEENLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YID+ W D  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLIQIQYIDEVWSDKAPLL-PSDPYQRAQARFWADYVDKKMYEAGRRVWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGE FG+ D+ FIPF + F  YES GK  +E ECPK
Sbjct  122  EGAKKEFIEILKTLEGELGEKPYFGGESFGYVDLTFIPFYTWFSVYESFGKMSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L +WVKRC+E+ SVSK LPD  K+Y
Sbjct  182  LFSWVKRCLEKESVSKSLPDQDKVY  206



>ref|XP_011036235.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GEQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRN--KSDLLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ WK+  PLL P DPYERA +RFW  F+D K +        +KG
Sbjct  61   DGKPVCESLIIVQYIDEVWKEKAPLL-PSDPYERARSRFWADFVDKKMYDFGRKIWTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  GF DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEVAKKDFIDSLKLLEGELGDKPYFGGETLGFVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPKL+A+ KRC+++ SVSK L D  K+Y+ 
Sbjct  180  CPKLIAYCKRCLQKESVSKSLKDPRKVYDF  209



>ref|XP_002317608.1| glutathione transferase family protein [Populus trichocarpa]
 gb|EEE98220.1| glutathione transferase family protein [Populus trichocarpa]
 gb|ADB11322.1| tau class glutathione transferase GSTU30 [Populus trichocarpa]
Length=220

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKG+ Y+Y EEDL N  +S L+L+MNPV K +P+LVH G+
Sbjct  6    VTLLDFWPSPFGMRVRLALAEKGVKYEYSEEDLRN--KSALLLQMNPVNKQIPVLVHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ WKD  PLL P DPY+RA +RFW  F+D K +         KGE +
Sbjct  64   PVCESLIIVQYIDEVWKDSAPLL-PSDPYQRAQSRFWADFVDKKIYDLGRKIWTKKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I+ LK +E  LGDK YFGGE  G+ D+A +PF S FY YE+ G F +E ECPK
Sbjct  123  EAAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++A+ KRC+++ +VSK L D  K+Y+ 
Sbjct  183  MIAYCKRCLQKETVSKALEDPQKVYDF  209



>gb|EYU26249.1| hypothetical protein MIMGU_mgv1a013392mg [Erythranthe guttata]
Length=221

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            GV ++D   + FGMR RIAL EKGI Y+YKEE+L +  +S L+LEMNPV K +P+L+H G
Sbjct  4    GVVLLDSLCSMFGMRARIALAEKGIEYEYKEENLED--KSALLLEMNPVHKKIPVLIHNG  61

Query  572  RPVCDSVAILEYIDDTWKDG-FPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            +PVC+S+ I++YID+ WKD   P LLP DPY++A ARFW  F+D K +        +KG+
Sbjct  62   KPVCESLIIVQYIDEVWKDNNSPSLLPSDPYQKAQARFWADFVDKKVYDAGKRLWTTKGD  121

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
              + A+K+ I  LK +E  LG+K YFGGE FGF DVA I FSS FY YE+ G F +EE C
Sbjct  122  EIETAKKDFIKALKLMEAELGEKPYFGGENFGFVDVALITFSSWFYTYETCGNFSVEEHC  181

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMYE  132
            PKL+ WVKRCME+ SVSK L D  K+Y+
Sbjct  182  PKLMEWVKRCMEKESVSKSLADPKKLYD  209



>ref|XP_008226272.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=220

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 147/206 (71%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW++ FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWSSMFGMRVRVALAEKGVKYEYREEDLPN-NKSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  +ID   +        +KGE +
Sbjct  64   PVCESANIVQYIDEAWKDKAPLL-PSDPYQRAQARFWVDYIDKNLYEAGKNIWATKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+LI  LK LE  LGD +YFGGE FGF DVA + F   F+ YE+ G F +E ECPK
Sbjct  123  EAAKKKLIEILKLLEGQLGDDTYFGGEIFGFLDVALVTFYCWFFSYETCGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRC+++ SV+K L D  K+YE
Sbjct  183  LIEWAKRCLQKDSVAKSLADPKKVYE  208



>gb|AEF79856.1| glutathione-S-transferase tau 1 [Hevea brasiliensis]
Length=219

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDFWPSPFGMRVRIALAEKGVKYEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++Y+D+ WKD  P L P DPY+RA ARFW  FID K +        +KG+ +
Sbjct  63   PICESLIAVQYVDEVWKDKSPFL-PSDPYQRAQARFWADFIDKKIYDIGRKIWTTKGDEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGE  G+ DVA IPF S FY YE+ G F +E ECP 
Sbjct  122  EAAKKEFIEALKLLEGELGNKPYFGGESMGYVDVALIPFYSWFYAYETCGNFSIEPECPV  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRC+++ SVS+ +PD  K+YE 
Sbjct  182  LIAWAKRCLQKESVSESVPDPEKVYEF  208



>ref|XP_006477979.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKGI Y+YKE+DL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDFWASMFGIRVRIALAEKGIKYEYKEQDLFN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K + T      +KGE +
Sbjct  63   SVCESSIIVQYIDEVWKDKAPLL-PYDPYQRAQARFWADFIDKKMYDTSRKTWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK L   LGDK +FGG+ FG+ D+  IP+   FY YE+ GKF +E ECPK
Sbjct  122  EAAKKEFIEVLKTLGGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AWV RC++R +V+K LPD  K++E   +
Sbjct  182  FIAWVTRCLQRETVAKALPDEKKVFEFVSV  211



>gb|ACI42271.1| glutathione S-transferase Tau2 [Citrus sinensis]
 gb|ACO05907.1| glutathione transferase Tau2 [Citrus sinensis]
Length=216

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 146/206 (71%), Gaps = 6/206 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKG+ Y+YKEEDL N  +S L+L+MNPV K +P+L+H GR
Sbjct  5    VVLLDFWPSMFGMRVRIALAEKGVKYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K +        +KGE +
Sbjct  63   PVCESSIIVQYIDEVWKDKAPLL-PSDPYQRAQARFWVDFIDKKMYDASTKTWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE    LK LE  LGDK +FGG+ FG+ D++ IPF   +Y YE+ GK  +E ECPK
Sbjct  122  EAAKKEFFEALKTLEGQLGDKPFFGGDNFGYLDLSLIPF---YYTYETFGKSSVEAECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
              AWVKRC++R +++K LPD  K+ E
Sbjct  179  FKAWVKRCLQRETIAKALPDEKKVLE  204



>gb|AFK42157.1| unknown [Lotus japonicus]
Length=219

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 149/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+ NPV K +P+L+H G+
Sbjct  5    VVLLDFWASPFGMRVRIALAEKGINYEYKEEDLRN--KSPLLLQSNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+  ++YID+ W D  PLL P DPY+RA ARFW  ++D K +      +  K E +
Sbjct  63   PIAESLIAVQYIDEVWNDASPLL-PSDPYQRAQARFWADYVDKKIYEIGRNIIWKKNEER  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE+ LGDK+YFGG+K G+ D+A +PF + F GYE+ G F +E ECPK
Sbjct  122  EAAKKEFIDCLKLLEEQLGDKTYFGGDKLGYVDIALVPFYTWFKGYETLGNFNIESECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRC+++ SVSK L D  ++YE
Sbjct  182  LIAWAKRCLQKESVSKSLHDQGQIYE  207



>emb|CAI48072.1| glutathione S-transferase/peroxidase [Capsicum chinense]
Length=220

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 150/218 (69%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK + Y+ KEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  6    VILLDFWPSMFGMRLRIALAEKEVKYESKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYID+ WKD  PLL P DPYERA ARFW  +ID KFF +      +KGE +
Sbjct  64   PICESIIAVEYIDEVWKDKAPLL-PTDPYERAQARFWADYIDKKFFDSSRKIWTTKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LG+K +FGG+ FGF DVA I F S F+ YE+ G F  E ECPK
Sbjct  123  EAAKKDFIECLKVLEGALGEKPFFGGDNFGFVDVALIGFYSWFFAYETCGNFSTEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIW---YGVE  105
             + W KRCM+R SV+K LPD  K+ E  +     YG+E
Sbjct  183  FVTWAKRCMQRDSVAKSLPDQHKVLEFVQTLRKKYGIE  220



>ref|XP_002262767.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+YKEEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRLALSEKGLKYEYKEEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLLIVQYIDEVWHDKSPLL-PSDPYQRAQARFWADYVDKKLYELGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  F+ YES G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFHAYESFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_008226270.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=225

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (71%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSMFGMRVRVALAEKGVKYEYREEDLLN-NKSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  +ID   +        ++GE +
Sbjct  64   PVCESANIVQYIDEAWKDKAPLL-PSDPYQRAQARFWVDYIDKNLYEVGKNICATEGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+LI  LK LE  LGD +YFGGE FGF DVA + F   F+ YE+ G F +E ECPK
Sbjct  123  EAAKKKLIEILKLLEGQLGDNAYFGGEIFGFLDVALVTFYCRFFSYETCGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM++ SV+K L D  K+YE
Sbjct  183  LIEWAKRCMQKESVAKSLADPKKVYE  208



>ref|XP_002265110.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+YKEEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWHDKSPLL-PSDPYQRAQARFWVDYVDKKLYELGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  F+ YES G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFHAYESFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_002264825.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y++EDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRVALAEKGLKYEYRQEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWKDKSPLL-PSDPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LG+K YFGGEK GF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  ETGKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_009354827.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=220

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 146/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKG+ Y+ +EEDL+N  +S L+L+MNPV K +P+L+H+GR
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGVEYESREEDLSN--KSPLLLKMNPVHKQIPVLIHKGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W +  PLL P DPY RA ARFW  ++D K + T      + GE +
Sbjct  63   PICESLIIVQYIDEVWSNKAPLL-PSDPYPRAHARFWADYVDKKIYSTGKLVWVTTGEVQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI   K LE  LGDK+YFGGE FG  DVA  PF S FY  E+ G   + +ECP+
Sbjct  122  EAAKKELIECFKLLENELGDKTYFGGESFGLVDVALSPFYSWFYALETCGNLCMVKECPR  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM+R SVSK LPD  KMY+
Sbjct  182  LVGWAKRCMQRESVSKSLPDQYKMYD  207



>ref|XP_007212347.1| hypothetical protein PRUPE_ppa014555mg [Prunus persica]
 gb|EMJ13546.1| hypothetical protein PRUPE_ppa014555mg [Prunus persica]
Length=220

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+L+ NPV K +P+L+H G+
Sbjct  5    VVLLDFWPSMFGMRVRVALAEKGVKYEYREEDLLN-NKSPLLLQTNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  +ID   +        +KGE +
Sbjct  64   PVCESANIVQYIDEAWKDKAPLL-PSDPYQRALARFWVDYIDKNLYEAGKNIWATKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+ +LI  LK LE  LGD S+FGGE FGF DVA + F   F+ YE+ G F +E ECPK
Sbjct  123  EAAKNKLIEILKLLEGQLGDNSFFGGEIFGFLDVALVTFYCWFFSYETCGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCME+ SV+K L DS K+YE
Sbjct  183  LIEWAKRCMEKESVAKSLADSKKVYE  208



>ref|XP_003634749.1| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=219

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y+EED +N  +S L+LEMNP+ K +P+L+H G+
Sbjct  5    IILLDFWPSSFGMRVRVALAEKGLKYEYREEDTSN--KSPLLLEMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W +  PLL P DPY+RA ARFW  +ID K +        +KGE +
Sbjct  63   PICESMIIVQYIDEVWNEKSPLL-PSDPYQRAQARFWADYIDKKLYELGRRIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+ E I  LK LE  LG+K YFGGEKFGF DVA + FS++FY YES G F +E ECPK
Sbjct  122  ETAKNEFIEYLKILEGELGEKPYFGGEKFGFVDVALVTFSTLFYAYESFGNFSIEVECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRC E+ SVS  L D  K++
Sbjct  182  LIAWTKRCKEKESVSSSLKDPQKVH  206



>ref|XP_010245130.1| PREDICTED: probable glutathione S-transferase parC [Nelumbo nucifera]
Length=219

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIAL EKG+ Y+Y++EDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDFWPSPFGMRARIALAEKGVKYEYRDEDLQN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ IL+YID+ WKD  PL+ P DP++RA ARFW  F D K +        +KGE +
Sbjct  63   PICESLIILQYIDEVWKDKLPLM-PSDPHKRAQARFWADFTDKKIYDCGRRIWATKGEDQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGDK YFGG+   F DV  +PF S FY YE+ G F +E  CPK
Sbjct  122  EAAKKEFIECLKLLEGELGDKPYFGGDALDFVDVTLVPFYSWFYAYETCGNFSIEAHCPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRCM++ SVSK LPD  K+Y+ 
Sbjct  182  FVAWAKRCMQKESVSKSLPDQNKVYDF  208



>ref|XP_008226269.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=213

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 143/206 (69%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DF A+ F MR R+AL EKG+ Y+ +EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFCASMFAMRARVALAEKGVKYENREEDLRN--KSSLLLQMNPVHKMIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++Y+D+ W+D  PLL P DPY+RA +RFW  FID K +        +KGE +
Sbjct  63   PICESLIIVQYVDEVWRDKAPLL-PSDPYQRARSRFWADFIDKKLYVASRKIWGTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LKQLE  LGD+ YF GE FGF D+A IPF S FY YE+ G F  E ECPK
Sbjct  122  EAGKKEFIEALKQLEGELGDRPYFEGESFGFLDIALIPFYSWFYAYETFGNFSTEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM R SVSK L D  K+YE
Sbjct  182  LIEWAKRCMHRESVSKSLADPKKVYE  207



>ref|XP_007149246.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
 gb|ESW21240.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
Length=222

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 149/208 (72%), Gaps = 4/208 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H+G+
Sbjct  7    VVLLDFWPSPFGMRVRIALAEKGINYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHKGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFL-KSKGEA  393
            P+ +S+ +++YID+ W D  PLL P DPY+RA ARFW  F+D K +      L  SKGE 
Sbjct  65   PISESLIVVQYIDEVWHDRTPLL-PSDPYQRAQARFWADFVDKKMYDLGRKILWTSKGEE  123

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
             + A+KE I  LK LE+ LGD++YFGG+  GF DVA +PF + F  YE+ G   LE ECP
Sbjct  124  NEVAKKEFIETLKVLEEQLGDRTYFGGDNLGFMDVALVPFYTWFEAYETFGGLNLESECP  183

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            K +AW KRC+++ SV+K LPD  K++E+
Sbjct  184  KFIAWAKRCLQKESVAKSLPDQHKIHEI  211



>ref|XP_004294220.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D + + FGMR+R+AL EKGI Y+Y E+DL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDLYVSMFGMRVRVALAEKGIKYEYSEQDLRN--KSELLLKMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ WKD  PLL P DPY+RA ARFW  FID K +        +KGE +
Sbjct  63   PVCESLIIVQYIDEVWKDKAPLL-PSDPYQRAQARFWADFIDKKLYDAGRKIWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE  LGDK YF GE+FGF D+A I F S F+ YE+ G F +E ECPK
Sbjct  122  EAAKKEFIDILKVLEGELGDKPYFMGERFGFLDIALITFYSWFHAYETLGSFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L++W KRCM++ SVSK L D  K+ E
Sbjct  182  LISWAKRCMQKESVSKSLADPKKVCE  207



>ref|XP_011013656.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 150/209 (72%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GEQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRN--KSDLLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ WK+  PLL P DPYERA +RFW  F+D K +        +KG
Sbjct  61   DGKPVCESLIIVQYIDEVWKEKAPLL-PSDPYERARSRFWADFVDKKMYDFGRKIWTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  GF DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEVAKKDFIDSLKLLEGELGDKPYFGGETLGFVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+ + KRC+++ SVSK L D  K+Y+
Sbjct  180  CPKLITYCKRCLQKESVSKSLKDPHKVYD  208



>gb|KDO38596.1| hypothetical protein CISIN_1g027727mg [Citrus sinensis]
Length=219

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 148/210 (70%), Gaps = 3/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKG+ Y+YKE+DL N  +S L+L MNPV K +P+L+H G+
Sbjct  5    VILLDFWASMFGIRVRIALAEKGVKYEYKEQDLFN--KSPLLLRMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S  I++YID+ WKD  PLL P DPY+RA ARFW  FID K + T      +KGE +
Sbjct  63   SVCESSIIVQYIDEVWKDKAPLL-PYDPYQRAQARFWVDFIDKKMYDTSRKTWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK L   LGDK +FGG+ FG+ D+  IP+   FY YE+ GKF +E ECPK
Sbjct  122  EAAKKEFIEVLKTLGGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             +AWV RC++R +V+K LPD  K++E   +
Sbjct  182  FIAWVTRCLQRETVAKALPDEKKVFEFVSV  211



>ref|XP_003634747.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y++EDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRLALAEKGLKYEYRQEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWKDKSPLL-PSDPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LG+K YFGGEK GF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  ETGKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LVAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_010087162.1| putative glutathione S-transferase parC [Morus notabilis]
 gb|EXB27067.1| putative glutathione S-transferase parC [Morus notabilis]
Length=221

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW +  G+R+R+AL EKGI Y+++EEDL N  +S L+L+MNP+ K +P+L+H GR
Sbjct  5    VTLLDFWPSMLGIRVRVALAEKGIKYEHREEDLRN--KSPLLLQMNPIHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWK-DGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            P+ +S+ I+ YIDD W  D  PLLLP DP +R+ ARFW HF+D   F +      +KGE 
Sbjct  63   PISESLNIVHYIDDVWNHDRAPLLLPSDPDQRSQARFWAHFVDQNVFSSGRRVWATKGEE  122

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            ++ A+KE +  L+  E  LGDK YFGGE FG+ DV+ + F S FY YE+ G F +EEECP
Sbjct  123  QEAAKKEFMETLRLFEVELGDKPYFGGESFGYVDVSLVAFYSWFYAYETFGNFSIEEECP  182

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            +L+AW KRCME+ SV K LPD  K++E 
Sbjct  183  RLIAWAKRCMEKESVYKSLPDEKKIFEF  210



>emb|CAN66702.1| hypothetical protein VITISV_005451 [Vitis vinifera]
Length=219

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  + ++DFW + FGMR+R+AL EKG+ Y+YKEEDL N  +S L+LEMNPV K +P+L+H
Sbjct  2    GDEIMLLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRN--KSPLLLEMNPVHKQIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  ++D K +        +KG
Sbjct  60   NGKPICESLIIVQYIDEVWHDKSPLL-PSDPYQRAQARFWADYVDKKLYGLGRKVWSTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  FY YES G F +E E
Sbjct  119  EEQETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYESFGNFSIEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMY  135
            CPKL+AW KRC E+ SVS  L D  K++
Sbjct  179  CPKLIAWTKRCKEKESVSSSLEDPHKVH  206



>ref|XP_006364367.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 147/209 (70%), Gaps = 3/209 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK I Y+YK+EDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VILLDFWPSMFGMRLRIALAEKEIKYEYKDEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYID+ WKD  P L P DPYERA ARFW  ++D K F +      +KGE +
Sbjct  64   PICESIIGVEYIDEVWKDKAPFL-PSDPYERAQARFWADYVDKKLFDSGRKLWTTKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LG+K YFGG+ FGF D+A I F S F+ YE++G F  E ECPK
Sbjct  123  EAAKKDFIECLKVLEGALGEKPYFGGDNFGFVDIALIGFYSWFHSYETYGNFSTEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHK  123
             +AW KRCM+R SV+K LPD  K+ +  K
Sbjct  183  FVAWAKRCMQRDSVAKSLPDQHKVLDFVK  211



>emb|CAN83043.1| hypothetical protein VITISV_027913 [Vitis vinifera]
Length=219

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+YKEEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWHDKSPLL-PSDPYQRAQARFWADYVDKKLYELGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  F  YES G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFQAYESFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>gb|KHF99304.1| putative glutathione S-transferase [Gossypium arboreum]
Length=220

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 153/218 (70%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK I Y+YKEEDL N  +S L+L+MNPV K +P+L++ G+
Sbjct  6    VVLLDFWPSPFGMRVRIALAEKEIKYEYKEEDLRN--KSDLLLKMNPVHKKIPVLIYNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++YID+ W    PLL P DPY+RA ARFW  F+DNK +        +KGE +
Sbjct  64   PVCESLIQVQYIDEIWPHKSPLL-PTDPYQRAIARFWGDFVDNKIYDLGRKLWTTKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K+YFGGE  G+ DV  +PF S FY YE  G F +E ECPK
Sbjct  123  EAAKKEFIECLKLLEGELGNKAYFGGENLGYVDVVLVPFYSWFYAYEKCGNFSIETECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE--LH-KIWYGVE  105
            L+AW KRCME+ +VSK LPD  K+Y+  LH K  +G+E
Sbjct  183  LIAWAKRCMEKDTVSKSLPDQDKIYDFVLHLKKVFGIE  220



>ref|XP_007213037.1| hypothetical protein PRUPE_ppa020220mg [Prunus persica]
 gb|EMJ14236.1| hypothetical protein PRUPE_ppa020220mg [Prunus persica]
Length=220

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSMFGMRVRVALAEKGVKYEYREEDLLN-NKSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  +ID   +        +KGE +
Sbjct  64   PVCESANIVQYIDEAWKDKAPLL-PSDPYQRAQARFWVDYIDKNLYEVGRNIWATKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
             EA+K+LI  LK LE  LGD S+FGGE FGF DVA +     F+ YE+ G F +E ECPK
Sbjct  123  DEAKKKLIEILKLLEGQLGDNSFFGGEIFGFLDVALVTVYCWFFSYETCGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM++ SV+K L D  K+YE
Sbjct  183  LIEWAKRCMQKESVAKSLADPKKVYE  208



>ref|XP_009776045.1| PREDICTED: probable glutathione S-transferase parA [Nicotiana 
sylvestris]
Length=220

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 144/209 (69%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
               V ++DFW + FGMR+RIAL  KGI Y+ KEE+L++  +S L+LEMNPV K +PIL+H
Sbjct  3    SNNVVLLDFWPSSFGMRIRIALALKGIKYEAKEENLSD--KSPLLLEMNPVHKKIPILIH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
              +P+C+S+ ILEYID+ W D  PLL P DPY R+ ARFW  +ID K + T       KG
Sbjct  61   NSKPICESLNILEYIDEVWHDNCPLL-PSDPYGRSQARFWADYIDKKIYSTGRRVWSGKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            + ++EA+KE I   K LE  LG+K+YFGG+  GF DVA +PF+S FY YE+   F +E E
Sbjct  120  QDQEEAKKEFIEIFKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEAE  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+ W KRCME  SVSK LP   K+Y+
Sbjct  180  CPKLVVWAKRCMENESVSKSLPHPHKIYD  208



>ref|XP_003634746.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRVALAEKGLKYEYREEDLWN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  +ID K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWCDKSPLL-PSDPYQRAQARFWADYIDKKLYELGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSMEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|NP_001236181.1| glutathione S-transferase 3 [Glycine max]
 sp|P46417.1|GSTX3_SOYBN RecName: Full=Glutathione S-transferase 3 [Glycine max]
 emb|CAA48717.1| lactoylglutathione lyase [Glycine max]
 gb|KHN27764.1| Glutathione S-transferase 3 [Glycine soja]
Length=219

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 152/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ +GMR RIAL EKG+ Y+YKEE+L N  RS L+L+MNP+ K +P+L+H G+
Sbjct  5    VVLLDTWASMYGMRARIALAEKGVRYEYKEENLMN--RSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ W D  PL+ P DPY+R+ ARFW  +ID K + T      SKGE  
Sbjct  63   PICESAIIVQYIDEVWNDKSPLM-PSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E +KELI+  KQLE+ L DK ++G + FGF D+  I FSS FY YE++G FK+EEECPK
Sbjct  122  EEGKKELISIFKQLEETLTDKPFYGDDTFGFVDLCLITFSSWFYTYETYGNFKMEEECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AWVKRCMER +VS  LPD+ K+Y L
Sbjct  182  LMAWVKRCMERETVSNTLPDAKKVYGL  208



>ref|XP_003634751.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRVALAEKGLKYEYREEDLWN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  +ID K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWCDKSPLL-PSDPYQRAQARFWADYIDKKLYELGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_002298935.2| hypothetical protein POPTR_0001s42770g [Populus trichocarpa]
 gb|EEE83740.2| hypothetical protein POPTR_0001s42770g [Populus trichocarpa]
Length=271

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 156/224 (70%), Gaps = 4/224 (2%)
 Frame = -2

Query  800  QNLNIYIYMATTTCGGG-VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLV  624
            +++ I I+  T+   G  V ++D WA+ FGMR+RIAL EK + Y+Y E+DL N  +  L+
Sbjct  39   RSVAISIFFFTSRMAGDQVTLLDLWASPFGMRVRIALAEKAVKYEYSEQDLWN--KGALL  96

Query  623  LEMNPVRKSVPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFID  444
            L+MNPV K +P+LVH+G+P+C+S+ I++YID+ WKD  PLL P DPYERA +RFW  F+D
Sbjct  97   LQMNPVHKRIPVLVHDGKPICESLIIVQYIDEVWKDKAPLL-PSDPYERAQSRFWADFVD  155

Query  443  NKFFPTQATFLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSM  264
             K +        +KGE ++ A+K+ I+ LK LE  LGDK YFGG+  G+ DVA +PF   
Sbjct  156  KKLYELGKKIYTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGGKTLGYVDVALLPFYCW  215

Query  263  FYGYESHGKFKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            FY YE+ G F +E +CPKL+A+ KRC+E+ SVSK L D  K+Y+
Sbjct  216  FYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSLEDPQKVYD  259



>gb|ADB11324.1| tau class glutathione transferase GSTU33 [Populus trichocarpa]
Length=219

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKG+ Y+Y E++L +  +S L+L+MNPV K +P L+H GR
Sbjct  5    VTLLDFWASPFGIRVRIALAEKGVKYEYSEQNLRD--KSALLLQMNPVYKKIPTLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S+ I++Y+DD WK   PLL P DPY+RA +RFW  FID K F        +KGE  
Sbjct  63   SVCESLIIVQYVDDAWKGKAPLL-PSDPYQRAQSRFWADFIDKKVFEITKKIWTTKGEEL  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGDK YFGGE  G+ DVAF+PF   FY YE+ G F +E ECPK
Sbjct  122  EGAKKDFIECLKLLEGELGDKPYFGGENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCM++ SVSK L D  K+YE 
Sbjct  182  IIAWAKRCMQKESVSKSLEDPKKVYEF  208



>ref|XP_004500374.1| PREDICTED: probable glutathione S-transferase parA-like [Cicer 
arietinum]
Length=219

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 150/210 (71%), Gaps = 3/210 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
             V ++DFW + +GMR++IALEEKGI Y+ ++ED     +S L+LEMNP+ K +P+L+H G
Sbjct  4    NVVLLDFWPSSYGMRVKIALEEKGITYECRQEDFQ--AKSSLLLEMNPIHKLIPVLIHNG  61

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            +PVC+S+ ++EYID+ W +  P LLP DPY+R+ ARFW  +ID   +  +      KG+ 
Sbjct  62   KPVCESLNVIEYIDEVW-NYKPSLLPSDPYKRSQARFWGDYIDKNVYSIRRKVWIGKGKE  120

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            ++E++K+ I  LK LEQ LGDK YFGGE+FG+ DVA IPF+S FY YE +GK  +EEECP
Sbjct  121  QEESKKKFIECLKTLEQELGDKPYFGGEEFGYVDVALIPFTSWFYTYEIYGKLNIEEECP  180

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYELHK  123
            KL+ W KRCME+ SV+K LP   K+Y   K
Sbjct  181  KLVTWAKRCMEKESVAKSLPHPHKIYGFAK  210



>ref|XP_002263395.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y+EED  N  ++ L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSPFGMRVRVALAEKGLKYEYREEDPRN--KNPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W    PLL P DPY+RA ARFW  +ID K +        +KGE +
Sbjct  63   PICESMIIVQYIDEVWNKKSPLL-PSDPYQRAQARFWADYIDKKLYELGRRIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+ E I  LK LE  LG+K YFGGEKFGF DVA + FS++FY YES G F +E ECPK
Sbjct  122  ETAKNEFIEYLKILEGELGEKPYFGGEKFGFVDVALVTFSTLFYAYESFGNFSIEVECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLKDPQKVH  206



>ref|XP_011098133.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=225

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  + ++DFW++ F  R+RIAL EKG+ ++  EEDL    +S L+LEMNPV K VP+L+H
Sbjct  2    GEELILLDFWSSPFTTRVRIALREKGVEFKSVEEDLLG-TKSQLLLEMNPVHKQVPVLIH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S  IL+YID+ W+D    L+P DPYERA ARFW  +ID K + T      S G
Sbjct  61   NGKPVCESTIILQYIDEVWRDKATPLMPSDPYERANARFWADYIDRKIYSTAKLVWTSTG  120

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K +I   K LE  LG+K +FGG  FG  DV+ IPFSS FY  E+ G F + +E
Sbjct  121  EVQETAKKNIIECFKLLESELGEKPFFGGNSFGLVDVSLIPFSSRFYTLETCGNFSMSDE  180

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL++W KRCMER SVSK LPD  K+Y+
Sbjct  181  CPKLVSWAKRCMERESVSKSLPDPYKVYD  209



>gb|ACJ85907.1| unknown [Medicago truncatula]
Length=219

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D+W + FGMR+RIAL EKGI ++Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDYWVSPFGMRVRIALAEKGIKHEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+  ++YID+ W +  PLL P DPY+R+ ARFW  ++D K +         KGE +
Sbjct  63   SICESLIAVQYIDEVWNEKSPLL-PSDPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LEQ LGDK+YFGG+K GF DVA IPF + F GYE+ G   +E+ECPK
Sbjct  122  EAAKKEFIEALKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
             +AW KRCM+  S+SK LPD  K+Y
Sbjct  182  FIAWAKRCMQVESISKSLPDQDKVY  206



>gb|AFK49533.1| unknown [Medicago truncatula]
Length=219

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D+W + FGMR+RIAL EKGI ++Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDYWVSPFGMRVRIALAEKGIKHEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+  ++YID+ W +  PLL P DPY+R+ ARFW  ++D K +         KGE +
Sbjct  63   SICESLIAVQYIDEVWNEKSPLL-PSDPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LEQ LGDK+YFGG+K GF DVA IPF + F GYE+ G   +E+ECPK
Sbjct  122  EAAKKEFIEALKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
             +AW KRCM+  S+SK LPD  K+Y
Sbjct  182  FIAWAKRCMQVESISKSLPDQDKVY  206



>ref|XP_003634752.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y++EDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRVALAEKGLKYEYRQEDLRN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+RA ARFW  ++D K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWKDKSPLL-PSDPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE    LK LE  LG+K YFGGEK GF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  ETGKKEFTECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LVAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_009612277.1| PREDICTED: probable glutathione S-transferase parA [Nicotiana 
tomentosiformis]
 sp|P25317.1|GSTXA_TOBAC RecName: Full=Probable glutathione S-transferase parA; AltName: 
Full=Auxin-regulated protein parA; AltName: Full=STR246C 
protein [Nicotiana tabacum]
 gb|AAA67894.1| par peptide [Nicotiana tabacum]
 emb|CAA56790.1| STR246C [Nicotiana tabacum]
Length=220

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
               V ++DFW + FGMR+RIAL  KGI Y+ KEE+L++  +S L+LEMNPV K +PIL+H
Sbjct  3    SNNVVLLDFWPSSFGMRLRIALALKGIKYEAKEENLSD--KSPLLLEMNPVHKKIPILIH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
              + +C+S+ ILEYID+ W D  PLL P DPYER+ ARFW  +ID K + T       KG
Sbjct  61   NSKAICESLNILEYIDEVWHDKCPLL-PSDPYERSQARFWADYIDKKIYSTGRRVWSGKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++EA+KE I  LK LE  LG+K+YFGG+  GF DVA +PF+S FY YE+   F +E E
Sbjct  120  EDQEEAKKEFIEILKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEAE  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMY  135
            CPKL+ W K CME  SVSK LP   K+Y
Sbjct  180  CPKLVVWAKTCMESESVSKSLPHPHKIY  207



>ref|XP_003634776.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DF ++ FGMR+R+AL EKG+ Y+YK EDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFSSSMFGMRVRVALAEKGLKYEYKGEDLWN--KSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+RA ARFW  ++D K          +KGE +
Sbjct  63   PICESLIIVQYIDEVWKDKSPLL-PSDPYQRAQARFWADYVDKKLAELGKKICSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA +PFS  FY YES G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVPFSCWFYAYESFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_008775487.1| PREDICTED: glutathione S-transferase 3-like [Phoenix dactylifera]
Length=219

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++  W + FG+R++IAL EK + Y+++EE+L +  +S L+LE+NPV K +P+L+H G+
Sbjct  5    VILLSSWVSAFGLRVQIALAEKEVEYEFREENLFD--KSPLLLELNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ W +G P LLP+DP +RA ARFW  F+D   +   +   K+KG+A+
Sbjct  63   PVCESSVIIQYIDEVWTNG-PSLLPQDPLQRANARFWADFVDKMIYQCGSRIWKNKGDAQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
              A+KELI  LKQLE  LG+K ++GGE  G+ D+  +PFSS FY YE+ G F +E+ECPK
Sbjct  122  AAAKKELIGILKQLEGELGEKPFYGGETLGYVDIVLVPFSSWFYTYETFGGFNIEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            LLAWV+RC ER SVSK+LPD  K+YE
Sbjct  182  LLAWVRRCNERESVSKVLPDRHKVYE  207



>ref|XP_010103479.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96021.1| putative glutathione S-transferase [Morus notabilis]
Length=218

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  4    VILLDFWASMFGMRVRIALAEKGIKYEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  61

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+ I++Y+D+ W +  PLL P DPY+RA ARFW  FID K +        +KGE K
Sbjct  62   PISESLIIVQYVDEVWNEKAPLL-PSDPYQRAQARFWADFIDKKVYDAAGKVWTAKGEEK  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE  LGDK YFGG+ FGF D+A + F   FY  E+ G F +E ECPK
Sbjct  121  EAAKKEFIDILKLLETELGDKPYFGGDSFGFLDIALVGFYPWFYALETFGNFSVEAECPK  180

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W K C E+ SVSK L D  K+YE 
Sbjct  181  LIEWAKSCKEKESVSKSLADEKKLYEF  207



>gb|ADB11312.1| tau class glutathione transferase GSTU3 [Populus trichocarpa]
Length=220

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++D WA+ FGMR+RIAL EK + Y+Y E+DL N  +  L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDLWASPFGMRVRIALAEKAVKYEYSEQDLWN--KGALLLQMNPVHKRIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YID+ WKD  PLL P DPYERA +RFW  F+D K +        +KG
Sbjct  61   DGKPICESLIIVQYIDEVWKDKAPLL-PSDPYERAQSRFWADFVDKKLYELGKKIYTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGG+  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGKTLGYVDVALLPFYCWFYAYETIGNFNIESD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+A+ KRC+E+ SVSK L D  K+Y+
Sbjct  180  CPKLIAYCKRCLEKESVSKSLEDPQKVYD  208



>ref|XP_002298937.1| hypothetical protein POPTR_0001s42780g [Populus trichocarpa]
 gb|EEE83742.1| hypothetical protein POPTR_0001s42780g [Populus trichocarpa]
Length=220

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +  L L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLWN--KGALYLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YID+ WKD  PLL P DPYERA +RFW  F+D K +        +KG
Sbjct  61   DGKPICESLIIVQYIDEVWKDKAPLL-PSDPYERAQSRFWADFVDKKVYELGKKICTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK  FGGE  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPCFGGETLGYVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+A+ KRC+E+ SVSK L D  K+Y+
Sbjct  180  CPKLIAYCKRCLEKESVSKSLKDPQKVYD  208



>ref|XP_011012342.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++ FWA+ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLVFWASPFGMRVRIALAEKGVKYEYSEQDLRN--KSALLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ WKD  PLL P DPY+RA +RFW  F+D K +      L +KG
Sbjct  61   DGKPVCESLIIVQYIDEVWKDKAPLL-PSDPYQRAQSRFWADFVDKKLYYLGRKILTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YF GE FG+ DVA IPF   FY YE+ G   +E  
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKRYFVGETFGYVDVALIPFYCWFYAYETVGNINIEAV  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKM  138
            CPKL+A+ +RC+E+ SVSK L D  K+
Sbjct  180  CPKLIAYCRRCLEKESVSKSLDDPQKV  206



>ref|XP_010644726.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=219

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL   ++S L+LEMNPV K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMRVRLALAEKGLKYEYREEDLW--KKSPLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  +ID K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWCDKSPLL-PSDPYQRAQARFWADYIDKKLYELGRRIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+ E I  LK LE  LG+K YFGGEKFGF DVA + FS++FY YES G F +E ECPK
Sbjct  122  ETAKNEFIEYLKILEGELGEKPYFGGEKFGFVDVALVTFSTLFYAYESFGNFSIEVECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRC E+ SVS  L D  K++
Sbjct  182  LIAWTKRCKEKESVSSSLKDPQKVH  206



>emb|CDP06112.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 149/211 (71%), Gaps = 5/211 (2%)
 Frame = -2

Query  761  CGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILV  582
             G  V ++D   + FGMR+RIAL EKGI ++YKEE+L +  +S L+LEMNPV K +P+L+
Sbjct  2    AGDKVVLLDTHVSAFGMRVRIALAEKGIEHEYKEENLAD--KSPLLLEMNPVHKKIPVLI  59

Query  581  HEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSK  402
            H G+PVC+S+ I++YID+ W D  PLL P DP++RA ARFW  F+D K +        +K
Sbjct  60   HNGKPVCESLIIVQYIDEVWHDKNPLL-PSDPHQRAQARFWADFVDKKLYDAGWRLWATK  118

Query  401  GEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEE  222
            GE ++ A+KELI  +K LE  LGDK+YFGGE FG+ DVA IPF + FY YE+ G FK+  
Sbjct  119  GEEQEAAKKELIGTVKTLEAELGDKTYFGGEDFGYVDVALIPFYNWFYTYETCGNFKI--  176

Query  221  ECPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            ECPKL+ W KRCM+R +VSK L D  K+YE 
Sbjct  177  ECPKLVEWAKRCMQRETVSKSLADPHKIYEF  207



>ref|XP_010941008.1| PREDICTED: glutathione S-transferase 3-like [Elaeis guineensis]
Length=219

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 150/206 (73%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++  WA+ FG+R++IAL EKG+ Y+++EEDL +  +S L+LE NPV K VP+L+H G+
Sbjct  5    VVLLSSWASVFGLRVQIALAEKGVDYEFREEDLFD--KSPLLLESNPVHKKVPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ W  G P LLP+DP +RA ARFW  FI+   +P  +   ++KG+ +
Sbjct  63   PICESSIIIQYIDEVWTKG-PSLLPKDPLQRANARFWADFINQTIYPCSSRIWRNKGDVQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
              A+KELI  LKQLE  LG++ +FGGE  G+ D+  +PFS  FY YE+ G F +E+ECPK
Sbjct  122  SAAKKELIGILKQLEGELGERPFFGGETLGYVDIVLVPFSRWFYTYETFGGFSIEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AWV+RC E+ SVSK+LPD  K+YE
Sbjct  182  LMAWVRRCNEKESVSKVLPDPHKVYE  207



>gb|EMS47857.1| putative glutathione S-transferase [Triticum urartu]
Length=273

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 140/194 (72%), Gaps = 5/194 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFWAN FGMR+RIAL E G+A++Y EEDL   +RS LV  MNPV + VPIL+H+GR
Sbjct  11   VTCVDFWANEFGMRVRIALRELGVAFEYVEEDLRVRERSDLVRRMNPVLRMVPILIHQGR  70

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC SV I+EYID+ W +    LLP +P +RA ARFW  F+D+K F  Q  FL+SKGE K
Sbjct  71   PVCGSVNIVEYIDEVWGEE-TRLLPANPVDRADARFWADFVDHKVFGAQVRFLESKGEEK  129

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
                 EL+ +LK+LE+VLGDK +F G +FGF D+  IPFSSMF+GYE  G+F L+ ECPK
Sbjct  130  D----ELVEQLKRLEEVLGDKGFFSGHEFGFLDIVTIPFSSMFHGYEQLGRFHLDVECPK  185

Query  209  LLAWVKRCMERSSV  168
            L  W KRC +R SV
Sbjct  186  LTQWAKRCKQRESV  199



>ref|NP_001236312.1| glutathione transferase [Glycine max]
 emb|CAA71784.1| glutathione transferase [Glycine max]
Length=216

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ KEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA ARFW  F+DNK F        SKGE K
Sbjct  63   PICESLVAVQYIEEVWNDRNPLL-PSDPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A IPF + F   ++ G   +E ECPK
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWF---KTFGSLNIESECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRCM++ SV++ LPD  K+YE 
Sbjct  179  FVAWAKRCMQKDSVARSLPDQHKVYEF  205



>gb|ADB11352.1| tau class glutathione transferase GSTU15 [Populus trichocarpa]
Length=219

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW++ + +R+++AL EKGI Y+ +E++L +  +S L+LEMNPV K++P+L+H G+
Sbjct  5    VTLLDFWSSSWAVRVKVALAEKGIEYESREQNLID--KSSLLLEMNPVHKTIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  PLL P DPY+R+ ARFW  +ID K +       K KGE +
Sbjct  63   PICESHNIVQYIDEVWKDKSPLL-PSDPYQRSQARFWADYIDKKIYNNAKKLWKEKGEKQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E ++E I  LK LE  LGDK YFGGE FGF DV  +P +S FY  E  GKF +E ECPK
Sbjct  122  EEVKREFIEGLKTLEGELGDKLYFGGESFGFVDVVLVPVTSWFYSLEICGKFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            + AW+KRCME+ SVS  LPD  K+Y+
Sbjct  182  ITAWIKRCMEKESVSSSLPDPHKIYD  207



>ref|XP_010923799.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
 ref|XP_010923800.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
 ref|XP_010923801.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
Length=221

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  767  TTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPI  588
             T   GV ++D W + FG R RIAL EK + Y+Y E++L +  +S L+L++NP+ K +P+
Sbjct  2    ATAEKGVVLLDAWVSPFGQRCRIALAEKAVEYEYSEQNLAD--KSPLLLKVNPIHKKIPV  59

Query  587  LVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLK  408
            L+H+G+PVC+S+ I++YID+ W      LLP DPYERA ARFW  F+D K +       K
Sbjct  60   LIHDGKPVCESLIIVQYIDEVWTKN--PLLPSDPYERAKARFWADFVDKKVYECGTKLWK  117

Query  407  SKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKL  228
             KGEA+QEA+KE+I  LK LE  LGDK YFGGE FGF DVA +PF++ FY YE+   F +
Sbjct  118  LKGEAQQEAKKEMIEILKLLEGELGDKKYFGGEIFGFVDVALVPFTAWFYAYETCANFSV  177

Query  227  EEECPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            E ECPKL+AW K CMER SV+K L D  K+YE 
Sbjct  178  EAECPKLVAWSKGCMERESVAKSLHDPHKVYEF  210



>gb|ADC95628.1| glutathione S-transferase [Bruguiera gymnorhiza]
Length=219

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RI LEEKG+ ++Y+E+DL N  +S L+L+MNPV K +P+LVH G+
Sbjct  5    VILLDFWASPFGMRVRITLEEKGVKFEYREQDLMN--KSPLLLQMNPVHKKIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++Y+D+TWKD  PLL P DPY+RA ARFW  F+D K +       ++KGE +
Sbjct  63   PVCESLIAVQYVDETWKDKAPLL-PSDPYQRAQARFWADFVDKKIYDLGRKTWQTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI   K LE+ LGDK YFGGE FG+ DV  +PF S F  YE  G F +E ECPK
Sbjct  122  EGAKKELIECFKLLEKELGDKPYFGGETFGYVDVTLVPFYSWFDVYERSGNFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+ W  RC+++ SVSK L D  K+Y
Sbjct  182  LMEWANRCLQKESVSKSLVDREKVY  206



>ref|XP_010044072.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 ref|XP_010044073.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW86075.1| hypothetical protein EUGRSUZ_B02778 [Eucalyptus grandis]
Length=220

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 146/206 (71%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D W++ FG R RIAL EKG+ +  +EEDL +  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDLWSSPFGTRARIALREKGVHFDLREEDLPS-NKSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+TW    PLL P DP+ERA ARFW  ++D K FP   T  +S GEA+
Sbjct  64   PVCESHIIVQYIDETWGPESPLL-PSDPHERARARFWADYVDKKIFPAGRTAYRSTGEAQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK +E  LGDK+YFGGE+FGF DV+ IPF S FY  E+      EEECPK
Sbjct  123  EAAKKEYIEGLKAVEGELGDKAYFGGERFGFLDVSLIPFYSWFYAVETFTGCSFEEECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM+R SV++ LPD  K+Y+
Sbjct  183  LVRWAKRCMQRESVARSLPDQHKVYD  208



>gb|ABK94892.1| unknown [Populus trichocarpa]
Length=219

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKG+ Y+Y E++L +  +S L+L+MNPV K +P L+H GR
Sbjct  5    VTLLDFWASPFGIRVRIALAEKGVKYEYSEQNLRD--KSALLLQMNPVYKKIPTLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S+ I++Y+DD WK   PLL P DPY+RA +RFW  FID K F        +KGE  
Sbjct  63   SVCESLIIVQYVDDAWKGKAPLL-PSDPYQRAQSRFWADFIDKKVFEITKKIWTTKGEEL  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+ + I  LK LE  LGDK YFGGE  G+ DVAF+PF   FY YE+ G F +E ECPK
Sbjct  122  EGAKTDFIECLKLLEGELGDKPYFGGENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCM++ SVSK L D  K+YE 
Sbjct  182  IIAWAKRCMQKESVSKSLEDPKKVYEF  208



>ref|XP_007149248.1| hypothetical protein PHAVU_005G054200g [Phaseolus vulgaris]
 gb|ESW21242.1| hypothetical protein PHAVU_005G054200g [Phaseolus vulgaris]
Length=222

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 148/208 (71%), Gaps = 4/208 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L MNPV K +P+L+H+G+
Sbjct  7    VVLLDFWPSPFGMRVRIALAEKGINYEYKEEDLKN--KSPLLLHMNPVHKKIPVLIHKGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPT-QATFLKSKGEA  393
            P+ +S+  ++YID+ W D  PLL P DPY+RA ARFW  ++D K +   +     SKGE 
Sbjct  65   PISESLIAVQYIDEVWHDRTPLL-PSDPYQRAQARFWVDYVDKKMYDLGRKIVWTSKGEE  123

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            K+ A+KE I  LK LE+ LGDK+YFGG+  GF DVA +PF + F  YE+ G   LE ECP
Sbjct  124  KEVAKKEFIEVLKVLEEQLGDKTYFGGDNLGFVDVALVPFYTWFEAYETFGGLNLESECP  183

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            K +AW KRC+++ SV+K LPD  K++E+
Sbjct  184  KFIAWAKRCLQKESVAKSLPDQHKIHEI  211



>gb|AFK35601.1| unknown [Medicago truncatula]
 gb|KEH34501.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=224

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -2

Query  776  MATTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKS  597
            M+     G V ++DFW + +GMR++IALEEKG++Y+ ++ED  +  +S L+LEMNPV K 
Sbjct  1    MSHCKAEGNVILLDFWPSSYGMRVKIALEEKGVSYECRQEDFQD--KSSLLLEMNPVYKM  58

Query  596  VPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQAT  417
            +P+LVH G+P+C+S+ I+EYID+ W    P LLP DPY+R+ A+FW  +ID   +     
Sbjct  59   IPVLVHNGKPICESLNIVEYIDEAWNQK-PSLLPSDPYKRSQAKFWGDYIDKHVYNIGKK  117

Query  416  FLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGK  237
                KGE ++E +K+ I  LK LE  LGDK YFGG++FG+ DVA IPF+  FY YE++GK
Sbjct  118  VWTGKGEEQEEGKKKFIECLKTLEDELGDKPYFGGDEFGYVDVALIPFTGWFYTYETYGK  177

Query  236  FKLEEECPKLLAWVKRCMERSSVSKILPDSVKMY  135
              +E+ECPKL+AW KRCM++ SV+K LP   K+Y
Sbjct  178  LSIEKECPKLVAWAKRCMKKESVAKSLPHPHKIY  211



>gb|AAO61854.1| glutathione S-transferase U1 [Malva pusilla]
Length=219

 Score =   232 bits (591),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 149/221 (67%), Gaps = 8/221 (4%)
 Frame = -2

Query  755  GGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHE  576
            G V ++DFW + FGMR RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H 
Sbjct  3    GEVVLLDFWPSPFGMRSRIALAEKGINYEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHN  60

Query  575  GRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            G+P+C+S+  ++YID+ W D  PLL P DP++RA ARFW  F+D K +   +   K+KGE
Sbjct  61   GKPICESLIQVQYIDEVWHDKSPLL-PSDPHQRAVARFWADFVDKKMYEQGSRVWKTKGE  119

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             +  A+KE I  LK LE  LG    FGGE  G+ D   +PF S  Y YE  G F +E EC
Sbjct  120  EQATAKKEFIESLKLLEGELGASLTFGGENLGYVDGVLVPFYSWVYAYEKCGNFNIEPEC  179

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMY----ELHKIWYGVE  105
            PKL+AW KRCME+ SV+K LPD  K+Y    +L KI YG+E
Sbjct  180  PKLIAWAKRCMEKESVAKSLPDQEKVYDFVLQLKKI-YGIE  219



>gb|ACJ84004.1| unknown [Medicago truncatula]
 gb|AFK47909.1| unknown [Medicago truncatula]
 gb|KEH38378.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=219

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D W + FGMR+RIAL EKG+ Y+YKEE+L +  +S ++L+MNP+ K +P+L+H G+
Sbjct  5    VVLLDTWVSMFGMRVRIALAEKGVQYEYKEENLRD--KSPILLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ W D  P + P DPYERA ARFW  +ID K + T      SKGE  
Sbjct  63   PVCESAIIVQYIDEVWNDKAPFM-PSDPYERAQARFWVDYIDKKVYDTWRKMWLSKGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E +KELI+  K LE+ LGDK ++GG  FGF D+  IPF S FY YE++G FK+E ECPK
Sbjct  122  EEGKKELISIFKTLEETLGDKPFYGGATFGFLDIGLIPFYSWFYAYETYGNFKMEVECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRC+E+ SVSK LPD +K+Y+ 
Sbjct  182  LMAWAKRCLEKESVSKTLPDQMKVYDF  208



>ref|XP_009418988.1| PREDICTED: probable glutathione S-transferase parA [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 151/219 (69%), Gaps = 6/219 (3%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            GV ++DFW + FG R RIAL EKG+ Y+++EE+L +  +S L+L+ NPV K +P+L+H+G
Sbjct  8    GVVLLDFWVSPFGQRCRIALAEKGVEYEFREENLGD--KSPLLLKSNPVHKKIPVLIHDG  65

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            +PVC+S+ I++YID+ W D  PLL P DPY RA ARFW  FID K +       K KGE 
Sbjct  66   KPVCESLIIVQYIDEAWPDCAPLL-PADPYARAQARFWADFIDKKIYECGTRLWKLKGEG  124

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            +  A++ELI  LK LE  LGDK YFGG+ FGF D+A +PF S FY YE+   F +EE  P
Sbjct  125  QAAAKEELIGILKLLEGELGDKKYFGGDAFGFVDIALVPFVSWFYTYETCAGFSIEEAAP  184

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYE---LHKIWYGVE  105
            KL+AW KRCMER SV+K L D  K+YE   L K  +GVE
Sbjct  185  KLVAWGKRCMERESVAKTLSDPHKVYEFVGLLKKRFGVE  223



>gb|ACL80571.1| glutathione S-transferase [Glycine max]
Length=216

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ KEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA ARFW  F+DNK F        SKGE K
Sbjct  63   PICESLVAVQYIEEVWNDRNPLL-PSDPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A IPF + F   ++ G   +E ECPK
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWF---KTFGSLNIESECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRC+++ SV+K LPD  K+YE 
Sbjct  179  FVAWAKRCLQKDSVAKSLPDQHKVYEF  205



>gb|ABL84692.1| glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+R+AL EKG+ Y+Y+EEDL N  +S L+LEMNPV K +P L+H G+
Sbjct  5    IILLDFWPSMFGMRVRLALAEKGLKYEYREEDLWN--KSPLLLEMNPVHKKIPALIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ W D  PLL P DPY+RA ARFW  +ID K +        +KGE +
Sbjct  63   PICESLIIVQYIDEVWCDKSPLL-PSDPYQRAQARFWADYIDKKLYELGRKIWSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGEK GF DVA + FS  FY YE+ G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVS  L D  K++
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVH  206



>ref|XP_007022199.1| Glutathione S-transferase TAU 19 [Theobroma cacao]
 gb|EOY13724.1| Glutathione S-transferase TAU 19 [Theobroma cacao]
Length=219

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 151/219 (69%), Gaps = 8/219 (4%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGMR+RIAL EKGI ++Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    LVLLDFWPSPFGMRVRIALAEKGIKHEYREEDLRN--KSALLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++YID+ W D  PLL P DPY+RA ARFW  F+D K +        +KGE +
Sbjct  63   PVCESLIQVQYIDEVWHDQAPLL-PSDPYQRAIARFWADFVDKKIYELGRKIWTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK YFGGE  G+ DV  +PF S F  YE  G F +E ECPK
Sbjct  122  ETGKKEFIECLKLLEGELGDKPYFGGENLGYVDVVLVPFYSWFLAYEKCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY----ELHKIWYGVE  105
            L+AW +RC+++ SVSK LPD  K+Y    +L KI +G+E
Sbjct  182  LIAWAQRCLQKESVSKSLPDQEKVYGFVLQLKKI-FGIE  219



>ref|XP_011082829.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=219

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = -2

Query  743  VIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGRPV  564
            ++D   + FGMR+R+AL EKGI Y+Y+EE+L N  +S L+LEMNPV K +P+L+H G+P+
Sbjct  7    LLDVHVSMFGMRVRVALAEKGIEYEYREENLAN--KSPLLLEMNPVHKKIPVLIHNGKPI  64

Query  563  CDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAKQE  384
             +S+ I++YID+ WKD FPLL P DPY+RA ARFW  F+D K F         KGE ++ 
Sbjct  65   SESLIIVQYIDEVWKDKFPLL-PSDPYQRAQARFWADFVDKKIFDAGRRIWTRKGEEQEA  123

Query  383  AQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPKLL  204
            A+KE I+ LK LE  LG+K+YFGG+KFGF DVA I F S F  YE+ G F +EE CPKL+
Sbjct  124  AKKEFIDALKLLEGELGEKAYFGGDKFGFVDVALITFYSWFDTYETCGNFSVEEHCPKLV  183

Query  203  AWVKRCMERSSVSKILPDSVKMYE  132
            AW KRCME+ SVSK L D   +YE
Sbjct  184  AWAKRCMEKESVSKSLADPKMVYE  207



>ref|XP_006836372.1| hypothetical protein AMTR_s00092p00118580 [Amborella trichopoda]
 gb|ERM99225.1| hypothetical protein AMTR_s00092p00118580 [Amborella trichopoda]
Length=218

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 149/221 (67%), Gaps = 7/221 (3%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            GG V ++DFWA+ FGMR RIAL EKG+ Y+Y+EE+L N  +  L+L+ NPV K +P+L+H
Sbjct  2    GGEVVLLDFWASPFGMRARIALAEKGVKYEYREENLAN--KGELLLKSNPVYKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+ + +S+ I++YID+ WK+  P LLPED YERA ARFW  F D K + +     KSKG
Sbjct  60   DGKSLSESLIIVQYIDEVWKN--PPLLPEDAYERAVARFWADFADKKLYDSGTKIWKSKG  117

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            EA+  A KE I  LK LE  LGD+ +FGGEK GF DV  +PF   F+ YE HG F +  E
Sbjct  118  EAQASAVKEFIENLKILEGALGDEPFFGGEKLGFVDVMVVPFVCWFHAYEVHGGFSVAAE  177

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE---LHKIWYGVE  105
            CPK+ AW KRCMER SVSK L D  K+ E     K  YGVE
Sbjct  178  CPKIDAWAKRCMERESVSKALQDPEKILEFVGFLKKKYGVE  218



>ref|XP_009757657.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=215

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D W + +GMR RIAL EKG+ Y+YKEEDLNN  +S L+LEMNP+ K VP+L+H G+
Sbjct  5    VILLDCWCSMYGMRARIALAEKGVKYEYKEEDLNN--KSPLLLEMNPIHKKVPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+ I++YID+ WK   PL+ P DPYE+A A FW+ ++ N           +KGE +
Sbjct  63   SICESLVIVQYIDEVWKGNGPLI-PSDPYEKAQAWFWSDYMGNTVHEYAVKIWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A K+ +  LK +E VLGDK YFGGE FGF D++ I F S F  YE+ GKF +E+ECPK
Sbjct  122  EQAVKDYLGGLKLIEGVLGDKPYFGGENFGFLDISLIGFYSWFLAYETFGKFSVEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ WVKRC+ER SVSK LPDS K+ E 
Sbjct  182  LILWVKRCLERDSVSKTLPDSEKVCEF  208



>gb|KEH38377.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=219

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 142/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ FGMR RIAL EK + Y+YKEEDL N  +S L+L+MNP+   +P+L+H G+
Sbjct  5    VILLDTWASMFGMRARIALAEKSVKYEYKEEDLRN--KSPLLLQMNPIHNKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S  I++YID+ W D    + P DPYERA ARFW  + D K + T      SKGE  
Sbjct  63   SICESAIIVQYIDEVWNDKASFM-PSDPYERAQARFWVDYSDKKVYDTWKKMWLSKGEEY  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E + ELI+  K LE  L DK ++GG+ FGF D+  IPF S FY +E++G FK+E ECPK
Sbjct  122  EEGKMELISIFKTLEGALSDKLFYGGDTFGFLDIGLIPFYSWFYAFETYGNFKMETECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRCME+ SVSK LPD  K+Y+ 
Sbjct  182  LMAWTKRCMEKDSVSKSLPDQKKVYDF  208



>gb|AFK45916.1| unknown [Medicago truncatula]
 gb|KEH38381.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=219

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++++W + FGMR++I L EKGI ++Y+EEDL+N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLNYWPSPFGMRLKIVLAEKGIKHEYREEDLSN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++YID+ W D  P L P DPY++A ARFW  +ID K +         KGE +
Sbjct  63   PVCESLIAVQYIDEVWNDKSPFL-PSDPYQKAQARFWADYIDKKIYEVAGNLWTKKGEVQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LEQ LGDK++FGG+K GF DVAFIP  + F GYE+ GK  +++ECPK
Sbjct  122  ETAKKEFIEALKLLEQELGDKNFFGGDKLGFVDVAFIPLYNWFRGYEAFGKISVDKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
              AW  RCME  SVSK LPD  ++++L
Sbjct  182  FFAWANRCMEIESVSKSLPDQDQIHDL  208



>gb|AEB77867.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=219

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RI LEEKG+ ++Y+E+DL N  +S L+L+MNPV K +P+LVH G+
Sbjct  5    VILLDFWASPFGMRVRITLEEKGVKFEYREQDLMN--KSPLLLQMNPVHKKIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  ++Y+D+TWKD  PLL P DPY RA ARFW  F+D K +       ++KGE +
Sbjct  63   PVCESLIAVQYVDETWKDKAPLL-PSDPYRRAQARFWADFVDKKIYDLGRKTWQTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI   K LE+ LGDK YFGGE FG+ DV  +PF S F  YE  G F +E ECPK
Sbjct  122  EGAKKELIECFKLLEKELGDKPYFGGETFGYVDVTLVPFYSWFDVYERSGNFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+ W  RC+++ SVSK L D  K+Y
Sbjct  182  LMEWANRCLQKESVSKSLVDREKVY  206



>gb|KEH38383.1| glutathione S-transferase, amino-terminal domain protein, partial 
[Medicago truncatula]
Length=204

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 144/203 (71%), Gaps = 3/203 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D+W + FGMR+RIAL EKGI ++Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDYWVSPFGMRVRIALAEKGIKHEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+  ++YID+ W +  PLL P DPY+R+ ARFW  ++D K +         KGE +
Sbjct  63   SICESLIAVQYIDEVWNEKSPLL-PSDPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LEQ LGDK+YFGG+K GF DVA IPF + F GYE+ G   +E+ECPK
Sbjct  122  EAAKKEFIEALKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVK  141
             +AW KRCM+  S+SK LPD  K
Sbjct  182  FIAWAKRCMQVESISKSLPDQDK  204



>ref|XP_011098132.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=224

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 142/207 (69%), Gaps = 1/207 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW++ F  R+RIAL EKG+ ++  EEDL    +S L+LEMNPV K VP+L+H G+
Sbjct  5    LILLDFWSSPFATRVRIALREKGVEFKSVEEDLLG-TKSQLLLEMNPVHKQVPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  IL+YID+ W+D    L+P DPYERA ARFW  +ID K + T        GE +
Sbjct  64   PVCESTIILQYIDEVWRDEAAPLMPSDPYERANARFWADYIDRKIYSTSRLVWMGTGEVQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K++I   K LE  LG+K +FGG  FGF DV+ IP SS FY  E  G F L +ECPK
Sbjct  124  ETAKKDIIECFKLLESELGEKPFFGGNVFGFVDVSLIPISSRFYTLEKLGNFSLADECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L++W KRCMER SVSK +PD  K+Y+L
Sbjct  184  LVSWAKRCMERESVSKSMPDQYKVYDL  210



>ref|XP_009757658.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 150/209 (72%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
             G V ++D + + FGMR RIAL EKGI Y+YKE+DL+N  +S L+L++NP+ K +P+L+H
Sbjct  2    AGEVVLLDAYVSMFGMRARIALAEKGIQYEYKEQDLSN--KSSLLLQLNPIHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++YID+ WKD  PL+ P DPY+RA ARFW  FID K + +      +KG
Sbjct  60   NGKPVCESLIIVQYIDEVWKDKSPLM-PTDPYKRAQARFWADFIDKKVYDSGRRIWTTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+KE I  LK LE  LGDK YFGGE FGF DVA IP+ S F  YE  G F +E +
Sbjct  119  EDQETAKKEFIECLKLLEGELGDKPYFGGEIFGFLDVALIPYYSWFPTYEKCGNFSIEAK  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+AW K+C+++ SV+K L +S K+Y+
Sbjct  179  CPKLVAWTKKCVQKESVAKSLAESDKVYD  207



>gb|AAR26529.1| glutathione S-transferase 2 [Glycine max]
Length=216

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ KEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA ARFW  F+DNK F        SKGE K
Sbjct  63   PICESLVAVQYIEEVWNDRNPLL-PSDPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A IPF + F   ++ G   +E ECPK
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWF---KTFGSLNIESECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRC+++ SV++ LPD  K+YE 
Sbjct  179  FVAWAKRCLQKDSVARSLPDQHKVYEF  205



>gb|KHN27773.1| Putative glutathione S-transferase [Glycine soja]
Length=216

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ KEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA ARFW  F+DNK F        SKGE K
Sbjct  63   PICESLVAVQYIEEVWNDRNPLL-PSDPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A IPF + F   ++ G   +E ECPK
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWF---KTFGNLNIESECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRC+++ SV++ LPD  K+YE 
Sbjct  179  FVAWAKRCLQKDSVARSLPDQHKVYEF  205



>ref|XP_008794506.1| PREDICTED: probable glutathione S-transferase parA [Phoenix dactylifera]
Length=222

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
             V ++D   + FG R+RIAL EKG+ ++Y+EEDL N  +S L+L+ NPV K +P+L+H+G
Sbjct  6    AVVLLDERVSPFGQRVRIALAEKGVEHEYQEEDLAN--KSPLLLKSNPVYKKIPVLIHDG  63

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            +P+C+S+ I++YID+ W  G PLL P +PYERA ARFW  F+D K + + A  LK  G+A
Sbjct  64   KPICESLIIVQYIDEVWVRGSPLL-PSNPYERANARFWADFVDKKIYDSGARMLKYTGQA  122

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
             +EA++E I  LK LE  L D++YFGGE FG  D+AF+PF++ FY +E +G F +E+ECP
Sbjct  123  HEEAKEEFIESLKLLEGELRDETYFGGENFGLVDIAFVPFTTWFYTFEVYGNFSIEKECP  182

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            KL+AW KRCMER SVSK L D   +YEL
Sbjct  183  KLVAWGKRCMERESVSKSLQDPHVVYEL  210



>ref|XP_010923806.1| PREDICTED: glutathione S-transferase U19-like [Elaeis guineensis]
Length=222

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
             V ++D   + FG R+RIAL EKG+ ++Y+EEDL N  +S L+L+ NPV K +P+L+H G
Sbjct  6    AVVLLDERVSPFGQRVRIALAEKGVEHEYREEDLTN--KSPLLLKSNPVYKKIPVLIHNG  63

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            +P+C+S+ I+++ID+ W  G PLL P DPYERA ARFW  F+D K + + A  L+  GEA
Sbjct  64   KPICESLIIVQHIDEVWVHGSPLL-PADPYERANARFWADFVDKKIYDSGARMLRYTGEA  122

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
             +EA++E +  LK LE  L DK+YFGGE FG  D+AF+PF++ FY +E +G F +EEE P
Sbjct  123  HEEAKEEFLENLKLLEGELQDKTYFGGENFGLVDIAFVPFTTWFYTFEFYGNFSIEEEFP  182

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            KL+AW KRCMER SVSK L D +++YEL
Sbjct  183  KLVAWGKRCMERESVSKSLQDPLEVYEL  210



>ref|XP_008226263.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=216

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V V+ FW + +G R  IAL+EKG+ Y+Y+EEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  6    VVVLGFWPSMYGTRATIALDEKGVKYEYREEDLRN--KSSLLLEMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W+   PLL P DPY+RA AR W  FID K    +     +KGE  
Sbjct  64   PVCESLIIVQYIDEVWEGKAPLL-PSDPYQRARARVWADFIDKKVPDARKKLWSTKGEEL  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +EA+KE I+ LKQLE  LGDK YFGGE FGF D+A I   + FY +E+ G F  E ECPK
Sbjct  123  EEAKKEFIDILKQLEGELGDKPYFGGESFGFLDIALITSYNWFYAFETLGNFSTEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            L+ W KRCM+R SVSK L D  K+YE    W
Sbjct  183  LIEWAKRCMQRESVSKSLADPKKVYEFLLGW  213



>ref|NP_001275790.1| glutathione S-transferase [Citrus sinensis]
 gb|ABQ95990.2| glutathione S-transferase [Citrus sinensis]
 gb|ACO05906.1| glutathione transferase Tau1 [Citrus sinensis]
Length=216

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 145/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKG+ Y+YKEEDL N  +S L+L+MNPV K +P+L+H GR
Sbjct  5    VVLLDFWPSMFGMRVRIALAEKGVKYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P D Y+RA ARFW  FID K +        ++GE +
Sbjct  63   PVCESSIIVQYIDEVWKDKAPLL-PSDRYQRAQARFWVDFIDKKMYDASTKTWTTEGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE    LK LE  LGDK +FGG+ FG+ D++ IPF   +Y YE+ GK  +E ECPK
Sbjct  122  EAAKKEFFEALKTLEGQLGDKPFFGGDNFGYLDLSLIPF---YYTYETFGKSSIEAECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
              AWVKRC++R +++K LPD  K+ E
Sbjct  179  FKAWVKRCLQRETIAKALPDEKKVLE  204



>emb|CDP11579.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 144/210 (69%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V V+  + + F MR+++AL EKGI Y+ KEEDL N  +S L+LEMNPV K +P+L+H
Sbjct  3    GDKVVVLGTYVSMFSMRVQVALAEKGIEYENKEEDLAN--KSPLLLEMNPVHKKIPVLIH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++YID+ W D  PLL P DPY+RA ARFW  FID K +        +KG
Sbjct  61   NGKPVCESLIIVQYIDEVWHDKNPLL-PSDPYQRAQARFWADFIDKKVYDCGRRIWATKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E K+ A+KE I  +K LE  LG+K YFGGE FG+ DVA IPF   F+ YE+ G FK E E
Sbjct  120  EEKEAAKKEFIGIMKTLEGELGNKPYFGGEDFGYVDVALIPFYCWFHAYENFGNFKTETE  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPKL+ W KRCM+R SVSK L D  K+YE 
Sbjct  180  CPKLVEWAKRCMQRESVSKSLADPHKIYEF  209



>gb|EYU26250.1| hypothetical protein MIMGU_mgv1a022085mg [Erythranthe guttata]
Length=221

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D + + FGMR R+AL EKGI Y+YKEE+L +  +S ++LEMNPV K +P+L+H G+
Sbjct  5    VVLLDTFFSMFGMRARLALAEKGIEYEYKEENLGD--KSPVLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDG-FPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            PVC+S+ I++YID+ WKD   P LLP DPY++A ARFW  F+D K +        +KG+ 
Sbjct  63   PVCESLIIVQYIDEVWKDNNSPSLLPSDPYQKAQARFWADFVDKKLYDAGRRLCTTKGDE  122

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
             + A+K+ I  LK LE  LG+KSYFGGE FGF DVA I +S+ FY YE+ G F +EE CP
Sbjct  123  LETAKKDFIEVLKLLEAELGEKSYFGGENFGFGDVALITYSNWFYSYETCGNFSVEEHCP  182

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYE  132
            KL+ WVKRCME+ SVSK L D  K+Y+
Sbjct  183  KLMEWVKRCMEKESVSKSLADPKKIYD  209



>ref|NP_001238712.1| uncharacterized protein LOC100500477 [Glycine max]
 gb|ACU15566.1| unknown [Glycine max]
Length=214

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 146/201 (73%), Gaps = 3/201 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D W + FGMR  IALEEKG+ Y++K EDLNN  +S L+++MNP+ K +P+L+H G+
Sbjct  6    VVLLDAWGSMFGMRAWIALEEKGVKYEHKMEDLNN--KSSLLMQMNPIYKQIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S  I++YI + W D    +LP DPYERA ARFW  +ID K +P       SKGE +
Sbjct  64   PISESAIIVQYIYEVWNDNKAPILPSDPYERAQARFWVDYIDKKVYPAWNKMWLSKGEEE  123

Query  389  QEA-QKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
             EA +KELI+  KQLE+ LGDK+++GG+ FGF D+A I F S FY +E++G F++E ECP
Sbjct  124  HEAGKKELISVFKQLEETLGDKTFYGGDTFGFVDIALITFYSWFYIFETYGNFEMEGECP  183

Query  212  KLLAWVKRCMERSSVSKILPD  150
            KL+ W KRC++R +VSK+LPD
Sbjct  184  KLVVWAKRCIQRETVSKVLPD  204



>ref|XP_002262644.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFWA+ FGMR+R+AL EKG+ Y+ +EEDL N  +S L+LE+NPV K +P+L+H G+
Sbjct  5    IILLDFWASIFGMRVRVALAEKGLKYEKREEDLWN--KSPLLLEVNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ +++YID+ W    PLL P DPY+RA ARFW  +ID K +      L +KGE +
Sbjct  63   PICESMILVQYIDEVWNHKSPLL-PTDPYQRAQARFWADYIDKKLYDLGKKILLTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGE FG  DVA + FSS FY YES G F +E ECPK
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGENFGLVDVALVTFSSRFYAYESIGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCM++ SVS  L D  K++
Sbjct  182  LIAWTKRCMQKESVSSSLADPHKVH  206



>ref|XP_009614585.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=221

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 150/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEE-DLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            V ++DFW + +GMR RIAL EKG+ Y++KEE DL N  +S L+LEMNP+ K +P+L+H G
Sbjct  5    VILLDFWCSMYGMRARIALAEKGVKYEHKEEEDLKN--KSPLLLEMNPIHKKIPVLIHNG  62

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            + VC+S+ I++YID+ WK   PL+ P DPYE+A A FW+ ++DN           +KGE 
Sbjct  63   KSVCESLVIVQYIDEVWKGNGPLI-PSDPYEKAQAWFWSDYMDNTVHGYAEKIWTTKGEE  121

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            +++A K+ +  LK +E +LGDK YFGGE FGF DV+ I F S F+ YE+ GKF +E ECP
Sbjct  122  QEQAVKDFLGGLKLIEGILGDKPYFGGENFGFLDVSLIGFYSWFFAYETFGKFSVEAECP  181

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            KL++WVKRC+ER SVSK LPDS K+ E    W
Sbjct  182  KLISWVKRCLERDSVSKTLPDSEKVCEFAVEW  213



>ref|NP_001234157.1| glutathione S-transferase-like protein [Solanum lycopersicum]
 gb|AAL92873.1| glutathione S-transferase-like protein [Solanum lycopersicum]
Length=220

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 146/210 (70%), Gaps = 3/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V  +DFW + +GMR+RIAL EK I Y+Y++EDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VIQLDFWPSMYGMRLRIALAEKEIKYEYRDEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYID+ WKD  PLL P DPYERA ARFW  +ID K + T +    + G+ +
Sbjct  64   PICESIIGVEYIDEVWKDKAPLL-PSDPYERAQARFWADYIDKKLYATGSKIYTATGDEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +K+ +  LK LE  LG+K Y+GG+ FGF D+A I F   F+ YE +G F +E ECP 
Sbjct  123  EAGKKDFVEILKVLEGALGEKPYYGGDNFGFGDIALIGFYCWFHAYEVYGNFSIEAECPN  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
            L+AW KRCM+R SV+K LPD  K+ E  KI
Sbjct  183  LVAWAKRCMQRDSVAKTLPDQHKIIEFVKI  212



>ref|XP_006442221.1| hypothetical protein CICLE_v10022193mg [Citrus clementina]
 gb|ESR55461.1| hypothetical protein CICLE_v10022193mg [Citrus clementina]
Length=216

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 145/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKG+ Y+YKEEDL N  +S L+L+MNPV K +P+L+H GR
Sbjct  5    VILLDFWPSMFGMRVRIALAEKGVKYEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P D Y+RA ARFW  FID K +        ++GE +
Sbjct  63   PVCESSIIVQYIDEVWKDKAPLL-PSDRYQRAQARFWVDFIDKKMYDASTKTWTTEGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE    LK LE  LGDK +FGG+ FG+ D++ IPF   +Y YE+ GK  +E ECPK
Sbjct  122  EAAKKEFFEALKTLEGQLGDKPFFGGDNFGYLDLSLIPF---YYTYETFGKSSIEAECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
              AWVKRC++R +++K LPD  K+ E
Sbjct  179  FKAWVKRCLQRETIAKALPDEKKVLE  204



>emb|CAC24549.1| glutathione S-transferase [Cichorium intybus x Cichorium endivia]
Length=219

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = -2

Query  761  CGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILV  582
             G  V ++D W + FGMR+RIAL EK + Y+ +EEDL N  +S L+L+MNPV K VP+L+
Sbjct  2    AGSEVVLLDTWVSLFGMRVRIALAEKDVHYERREEDLTN--KSSLLLQMNPVHKKVPVLI  59

Query  581  HEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSK  402
            H+G+P+C+S  I++YID+ W++  P LLP DPY +A ARFW  FID K +       + K
Sbjct  60   HDGKPICESNIIVQYIDEAWQNNSPPLLPSDPYLKAQARFWADFIDKKIYDAGTRIWRRK  119

Query  401  GEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEE  222
            GE ++ A+KE I+ +K LE  LG+ SY  G+ FG+ D+A +PF   FY  E  G   +E+
Sbjct  120  GEEQEIAKKEFIDWMKVLEGQLGENSYLMGKSFGYVDIAMVPFYCWFYALEKIGNISIEK  179

Query  221  ECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            ECPKL+AW KRCMER SVSK LPD  K+YE
Sbjct  180  ECPKLVAWAKRCMERESVSKTLPDPHKVYE  209



>gb|ADB11349.1| tau class glutathione transferase GSTU8 [Populus trichocarpa]
Length=220

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRN--KSDLLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ WKD  PLL P DP++RA +RFW  F+D K +        + G
Sbjct  61   DGKPVCESLIIVQYIDEVWKDKAPLL-PSDPHKRAQSRFWADFVDKKIYDFGRKIWTTNG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+A  KRC+++ SVSK L D   +Y+
Sbjct  180  CPKLIACCKRCLQKESVSKSLKDPQILYD  208



>ref|NP_001238691.1| glutathione S-transferase [Glycine max]
 pdb|4CHS|A Chain A, Crystal Structure Of A Tau Class Glutathione Transferase 
10 From Glycine Max
 pdb|4CHS|B Chain B, Crystal Structure Of A Tau Class Glutathione Transferase 
10 From Glycine Max
 gb|AAG34800.1|AF243365_1 glutathione S-transferase GST 10 [Glycine max]
 gb|AAR26528.1| glutathione S-transferase [Glycine max]
 gb|KHN26781.1| Putative glutathione S-transferase [Glycine soja]
Length=219

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 145/206 (70%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIEYEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+  ++YI++ W D  PLL P DPY+RA ARFW  ++D K          SKGE K
Sbjct  63   PISESLIAVQYIEEVWNDRNPLL-PSDPYQRAQARFWADYVDIKIHDLGKKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE+ LGDK+YFGG+  GF D+A +PF + F  YE+ G   +E ECP+
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDNIGFVDIALVPFYTWFKVYETFGSLNIENECPR  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
             +AW KRC+++ SV+K LPD  K+YE
Sbjct  182  FVAWAKRCLQKESVAKSLPDQHKVYE  207



>gb|EYU26251.1| hypothetical protein MIMGU_mgv1a013400mg [Erythranthe guttata]
Length=221

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 146/209 (70%), Gaps = 3/209 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            GV ++D + + FGMR R+AL EKGI Y+YKEE+L +  +S ++LEMNPV K +P+L+H G
Sbjct  4    GVVLLDTYFSMFGMRARLALAEKGIEYEYKEENLGD--KSPILLEMNPVHKKIPVLIHNG  61

Query  572  RPVCDSVAILEYIDDTWKDG-FPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            +PVC+S+ I++YID+ WKD   P LLP DPY++A ARFW  F+D K +        +KG+
Sbjct  62   KPVCESLIIVQYIDEVWKDNNSPSLLPSDPYQKAQARFWADFVDKKVYDAGRRLWTTKGD  121

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
              + A+K+ I  LK LE  LG K YFGGE FGF DVA + +SS FY YE+ G F + E C
Sbjct  122  ELETAKKDFIEALKLLEAELGKKPYFGGENFGFVDVALVTYSSWFYAYETCGNFSVAEHC  181

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            PKL+ WVKRCME+ SVSK L D  K+Y+ 
Sbjct  182  PKLMEWVKRCMEKESVSKSLADPKKVYDF  210



>gb|KHG06513.1| putative glutathione S-transferase [Gossypium arboreum]
Length=232

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 143/205 (70%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R AL  KGI Y+YKEEDL+N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VVLLDFWPSPFGMRVRTALAVKGIKYEYKEEDLSN--KSDLLLKMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YID+ W    PLL P DPY+RA A+FW  F++ K +        +KGE +
Sbjct  64   PICESLIQVQYIDEIWPHKSPLL-PTDPYQRAIAKFWADFVEKKIYDLGKKVWTTKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LG+K YFGGE  G+ DV  +PF S FY YE  G F +E ECPK
Sbjct  123  EAAKKEFIACLKLLEGELGNKDYFGGENLGYVDVVLVPFYSWFYAYEKCGNFSIERECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
            L+AW KRCME+ SVSK LPD  K+Y
Sbjct  183  LIAWAKRCMEKDSVSKSLPDQQKIY  207



>gb|AFK44154.1| unknown [Lotus japonicus]
Length=221

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++D W + FGMR RIAL EK I Y+YKEEDL N  +S L+LEMNP+ K +P+L+H G+
Sbjct  6    LILLDEWLSMFGMRARIALAEKEIRYEYKEEDLTN--KSQLLLEMNPIHKKIPVLIHHGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I+EYID+ WK+  PLL P +PY+RA ARFW  F++ K           K +  
Sbjct  64   PICESIIIVEYIDEVWKEKAPLL-PSEPYQRAQARFWADFVNKKVGDVGGRIWAGKRDGI  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +EA+KELI  LK+LE+VLG K YFGG+ FGF D+A IPF + FY YE+  KFK+E ECPK
Sbjct  123  EEAKKELIEGLKELEKVLGVKPYFGGDTFGFVDIALIPFYTWFYTYEALCKFKVEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+AW KRC +R SVSK + D  ++Y+
Sbjct  183  LIAWAKRCKQRESVSKSVADEKEVYD  208



>ref|XP_004981530.1| PREDICTED: probable glutathione S-transferase GSTU1-like [Setaria 
italica]
Length=223

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 147/208 (71%), Gaps = 2/208 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            G+ ++DFW + FG R RIAL EKG+ Y+Y E+DL+N  +S L+L  NP+ K +P+L+H+G
Sbjct  7    GLQLLDFWVSPFGQRCRIALAEKGLPYEYLEQDLSN--KSELLLRSNPIHKKIPVLLHDG  64

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            RPVC+S+ I++YID+ +      LLP DPY RA ARFW  ++D K +   +   K KGEA
Sbjct  65   RPVCESLIIVQYIDEAFPGQGAPLLPADPYARAQARFWADYVDKKVYDCGSRLWKLKGEA  124

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            +Q+A+KE++  LK LE  LGD  +FGGE FGF DVAF+PF++ F  YE +G+F +EEECP
Sbjct  125  QQQARKEMVEILKTLEGALGDGKFFGGEAFGFLDVAFVPFTAWFLTYERYGEFSVEEECP  184

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            +L AW KRC ER SV+K L    K+YE 
Sbjct  185  RLAAWAKRCAERESVAKNLYPPEKVYEF  212



>ref|XP_011030762.1| PREDICTED: probable glutathione S-transferase isoform X1 [Populus 
euphratica]
Length=219

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKG+ Y+Y E++L +  +S L+L+MNPV K +P L+H GR
Sbjct  5    VTLLDFWASPFGIRVRIALAEKGVKYEYSEQNLRD--KSALLLKMNPVYKRIPTLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S+ I++Y+DD WK   PLL P DPY+RA +RFW  FID K F        +KGE  
Sbjct  63   SVCESLIIVQYVDDVWKGKAPLL-PSDPYQRAQSRFWADFIDKKVFEITKKIWTTKGEEL  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGD+ YFGGE  G+ DVAF+PF   FY YE+ G F +E ECPK
Sbjct  122  EGAKKDFIECLKLLEGELGDRPYFGGENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCM++ SVSK L    K+YE 
Sbjct  182  IIAWAKRCMQKESVSKSLEQPKKVYEF  208



>gb|ACU15760.1| unknown [Glycine max]
Length=226

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ +GMR RIAL EKG+ Y+YKEE+L N  RS L+L+MNP+ K +P+L+H G+
Sbjct  5    VVLLDTWASMYGMRARIALAEKGVRYEYKEENLMN--RSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ W D  PL+ P DPY+R+ ARFW  +ID K + T      SKGE  
Sbjct  63   PICESAIIVQYIDEVWNDKSPLM-PSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E +KELI+  KQLE+ L DK ++G + FGF D+  I FSS FY YE++G FK+EEECPK
Sbjct  122  EEGKKELISIFKQLEETLTDKPFYGDDTFGFVDLCLITFSSWFYTYETYGNFKMEEECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AWVKRCMER +VS  LPD+ K   L
Sbjct  182  LMAWVKRCMERETVSNTLPDAKKCMAL  208



>ref|XP_004488706.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=221

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 150/218 (69%), Gaps = 5/218 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEE L++  +S  +L++NPV+K +P+L+H G+
Sbjct  6    VILLDFWPSPFGMRVRIALAEKGINYEYKEEPLSSLSKSTFLLQINPVQKKIPVLIHNGK  65

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+  ++YID+ W    PLL P DPY R+ ARFW  ++D K +P        KGE +
Sbjct  66   SICESLIAVQYIDEVWNHKSPLL-PSDPYLRSQARFWADYVD-KLYPIGRDIYSKKGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE IN LK LEQ LG+KSYFGG+K G  D++ IPF S F  YE+ G F  E ECPK
Sbjct  124  EVAKKEFINTLKLLEQQLGEKSYFGGDKIGLVDISLIPFYSRFKAYETFGNFNTENECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL---HKIWYGVE  105
             +AW KRCM+  SVSK LPD  K+Y+    ++  YG+E
Sbjct  184  FIAWAKRCMKIESVSKSLPDQDKIYDFIVDYRKIYGIE  221



>gb|ACU15945.1| unknown [Glycine max]
Length=216

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 144/207 (70%), Gaps = 6/207 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+ KEEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YI++ W D  PLL P DPY+RA ARFW  F+DNK F        SKGE K
Sbjct  63   PICESLVAVQYIEEVWNDRNPLL-PSDPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A KE I  LK LE+ LGDK+YF G+  GF D+A IPF + F   ++ G   +E ECPK
Sbjct  122  EAANKEFIEALKLLEEQLGDKTYFAGDDLGFVDIALIPFDTWF---KTFGSLNIESECPK  178

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW KRC+++ SV+K LPD  K+YE 
Sbjct  179  FVAWAKRCLQKDSVAKSLPDQHKVYEF  205



>gb|KDP43660.1| hypothetical protein JCGZ_24118 [Jatropha curcas]
Length=224

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 154/222 (69%), Gaps = 11/222 (5%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI ++Y+EE+L N  +S L+L+MNPV K +P+L+H G+
Sbjct  7    VVLLDFWPSPFGMRVRIALAEKGIKHEYREENLRN--KSALLLQMNPVHKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PV +S   +EYID+ WKD  PLL P DPY+RA A+FW  F+D K +        +KGE +
Sbjct  65   PVVESRIAVEYIDEVWKDKTPLL-PSDPYQRAQAKFWADFVDKKIYDLGRKTWATKGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGY---ESHGKFKLEEE  219
            + A+KE +  LK LE  LGDK YFGGE FG+ DVAFIPF S FY +   E  G F +E E
Sbjct  124  EAAKKEFMESLKILEGELGDKPYFGGECFGYVDVAFIPFYSWFYWFYANEVSGNFSVEAE  183

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMY----ELHKIWYGVE  105
            CPKL+AWVKRC+E+ +VS  LPD  K+Y    EL K  YG++
Sbjct  184  CPKLIAWVKRCLEKETVSNSLPDQKKIYGFVLELKKA-YGID  224



>gb|EYU26253.1| hypothetical protein MIMGU_mgv1a013454mg [Erythranthe guttata]
Length=220

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 146/207 (71%), Gaps = 2/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D + + +GMR+RIAL EKG+ Y++K E+L +  +S L+LEMNP  K VP+L+H G+
Sbjct  5    VVLVDAYISMYGMRVRIALAEKGVEYEFKNENLFD--KSALLLEMNPAHKKVPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I+EYID+ WKD  P LLP  PY+RA ARFW  F+D K          +KG+ +
Sbjct  63   PICESLIIVEYIDEVWKDNSPPLLPRHPYQRAQARFWADFVDKKVSVPGRRIWFTKGDEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A+KE I  L  LE+ LG+K+YFGGE FGF D+A IPF S FY YE+ G F +EE CP+
Sbjct  123  EKAKKEFIEALNSLEEELGEKTYFGGESFGFVDLALIPFYSWFYAYETCGNFSIEEHCPR  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W KRCME+ SVSK L D  K+Y+ 
Sbjct  183  LIVWAKRCMEKESVSKSLADPKKVYDF  209



>ref|XP_002263638.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  + ++DFW + FGMR+R+AL EKG+ Y+YKEEDL N  +S L+LEMNPV K +P+L+H
Sbjct  2    GDEIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRN--KSPLLLEMNPVHKQIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+P+C+S+ I++YID+ W D  PLL   DPY+RA ARFW  ++D K +        +KG
Sbjct  60   NGKPICESLIIVQYIDEVWHDKSPLL-RSDPYQRAQARFWADYVDKKLYGLGRKVWSTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+KE I  L+ LE  LG+K YFGGEK GF DVA + FS  FY YES G F +E E
Sbjct  119  EEQETAKKEFIECLQLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYESFGNFSIEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMY  135
            CPKL+AW KRC E+ SVS  L D  K++
Sbjct  179  CPKLIAWTKRCKEKESVSSSLEDPHKVH  206



>ref|XP_004295706.1| PREDICTED: probable glutathione S-transferase parC-like [Fragaria 
vesca subsp. vesca]
Length=220

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 146/218 (67%), Gaps = 7/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V V+  W++   MR R+AL EKG+ Y+Y+EEDL N  ++ L+LEMNP+ K +P+L+H G+
Sbjct  5    VVVLGLWSSMIAMRTRVALAEKGVEYEYREEDLRN--KTSLLLEMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  P LLP DPYERA ARFW  +ID   +        +KGE +
Sbjct  63   PVCESANIVQYIDEAWKDKGPALLPSDPYERAQARFWVDYIDKNLYEAGKNIWSTKGEEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K  +  LK LE  LGDK+YFGGE FGF D+  + F   F+ YE+ G F +E  CP 
Sbjct  123  EAAKKIFLEILKLLEGELGDKTYFGGESFGFVDINLVTFHCWFFTYETIGNFSIEAVCPT  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE----LHKIWYGV  108
            L+AW KRCM++  VS+ILPD  K+Y+    L K +YGV
Sbjct  183  LIAWCKRCMQKERVSRILPDPRKVYDKCLFLQK-YYGV  219



>gb|ACJ84159.1| unknown [Medicago truncatula]
Length=219

 Score =   229 bits (584),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 145/203 (71%), Gaps = 3/203 (1%)
 Frame = -2

Query  743  VIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGRPV  564
            ++D+WA+ FGMR+RIAL EKGI ++YKEEDL N  +S L+L+MNPV K +P+L+H G+ +
Sbjct  7    LLDYWASPFGMRVRIALAEKGIKHEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKSI  64

Query  563  CDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAKQE  384
            C+S+  ++YID+ W +  PLLL  DPY+R+ ARFW  ++D K +         KGE ++ 
Sbjct  65   CESLIAVQYIDEVWNEKSPLLLS-DPYQRSQARFWADYVDKKIYEVGKNLWTKKGEEQEA  123

Query  383  AQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPKLL  204
            A+KE +   K LEQ LGDK+YFGG+K GF DVA IPF + F GYE+ G   +E+ECPK +
Sbjct  124  AKKEFVEAHKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEKECPKFI  183

Query  203  AWVKRCMERSSVSKILPDSVKMY  135
            AW KRCM+  S+SK +PD  K+Y
Sbjct  184  AWAKRCMQVESISKSVPDQDKVY  206



>ref|XP_002300485.1| hypothetical protein POPTR_0001s42800g [Populus trichocarpa]
 gb|EEE85290.1| hypothetical protein POPTR_0001s42800g [Populus trichocarpa]
Length=220

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +S L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWSSPFGMRVRIALAEKGVKYEYCEQDLRN--KSDLLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ WKD  PLL P DP++RA +RFW  F+D K +        + G
Sbjct  61   DGKPVCESLIIVQYIDEVWKDKAPLL-PSDPHKRAQSRFWADFVDKKIYDFGRKIWTTNG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+A  KRC+++ SVSK L D   +Y+
Sbjct  180  CPKLIACCKRCLQKESVSKSLKDPQILYD  208



>ref|XP_002266007.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 148/218 (68%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGM++RIAL EKG+ Y+Y++EDL N  +  L+LEMNP+ K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMKVRIALAEKGLKYEYRDEDLFN--KGPLLLEMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  PLL P DPY RA ARFW  +ID K     A   ++KGE +
Sbjct  63   PICESQIIVQYIDEVWKDKSPLL-PSDPYHRAQARFWADYIDKKLHLLGARLWRTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK YFGGE FGF DV  +P+ S  Y +E    F +E ECPK
Sbjct  122  EANKKEYIECLKLLEGELGDKPYFGGENFGFVDVNLMPYFSWLYVFEIAANFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELH---KIWYGVE  105
            L+ W KRCME+ SVS  LPD  K+Y+     K W+G+E
Sbjct  182  LITWAKRCMEKESVSTSLPDHQKLYDFFLQLKKWHGIE  219



>ref|XP_010044074.1| PREDICTED: probable glutathione S-transferase parC [Eucalyptus 
grandis]
 gb|KCW86077.1| hypothetical protein EUGRSUZ_B02780 [Eucalyptus grandis]
Length=220

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 146/207 (71%), Gaps = 2/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR +IAL EKG+ +  +EE+L +  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDFWPSPFGMRAKIALREKGVHFDLREEELLS-NKSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+TW    PLL P +P+ERA ARFW  ++D K FP   T  +S GEA+
Sbjct  64   PVCESHIIVQYIDETWGPESPLL-PSEPHERARARFWADYVDKKIFPAGRTAWRSTGEAQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGD +YFGGE+FGF DV+ IPF S FY  E+      EEECPK
Sbjct  123  EAAKKEYIEGLKMLEGELGDTAYFGGERFGFLDVSLIPFYSWFYAVETLTGCSFEEECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W KRCM+R SV++ LPD  K+Y+ 
Sbjct  183  LVGWAKRCMQRESVARSLPDQHKVYDF  209



>gb|ADB11347.1| tau class glutathione transferase GSTU5 [Populus trichocarpa]
Length=220

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 147/210 (70%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EKG+ Y+Y E+DL N  +  L L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLWN--KGALYLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YID+ WKD  PLL P DPYERA +RFW  F+D K          +KG
Sbjct  61   DGKPICESLIIVQYIDEVWKDKAPLL-PSDPYERAQSRFWADFVDKKVNYFGKKICTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK  FGGE  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPCFGGETLGYVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPKL+A+ KRC+E+ SVSK L D  K+Y+ 
Sbjct  180  CPKLIAYCKRCLEKESVSKSLKDPQKVYDF  209



>gb|KEH38387.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=221

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 144/206 (70%), Gaps = 1/206 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG+R+RIAL EKGI Y+Y EE+L + ++S L+LEMNPV+K +P+L+H G+
Sbjct  5    VILLDFWPSPFGIRVRIALAEKGIKYKYIEEELMSLKKSPLLLEMNPVQKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  ++YID+ W +  PLL P DPY+R+ A FW  +ID K +          GE +
Sbjct  65   PICESLIAVQYIDEVWNEKSPLL-PSDPYQRSQALFWADYIDKKIYSIGKNIYTKTGEEQ  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I+ LK LE  LG+ SYFGG+KFGF D++ IPF S    YE+ G   LE ECPK
Sbjct  124  EVAKKEFIDTLKLLEDQLGESSYFGGDKFGFVDISLIPFYSRLKVYETFGNLNLENECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
             +AW KRCM+  SVSK LPD  K+YE
Sbjct  184  FIAWAKRCMQIESVSKSLPDQDKIYE  209



>ref|XP_004500375.1| PREDICTED: probable glutathione S-transferase parA-like [Cicer 
arietinum]
Length=220

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 147/211 (70%), Gaps = 3/211 (1%)
 Frame = -2

Query  755  GGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHE  576
              V ++DFW + +GMR++IAL EKGI+Y+ K+ED     +S L+LE NP+ K +P+L+H 
Sbjct  4    NNVVLLDFWPSSYGMRVKIALGEKGISYECKQEDFQ--AKSSLLLETNPIYKMIPVLIHN  61

Query  575  GRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            G+PVC+S+ I+EYID+ W    P LL  DPY+R+ ARFW  +ID   +         KG+
Sbjct  62   GKPVCESLNIIEYIDEAWNHK-PSLLLSDPYKRSQARFWGDYIDKNVYSIGKKVWIGKGK  120

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             ++E +K+ I  LK LEQ LGDK YFGGE+FG+ DVA IPF+S FY YE++GK  +EEEC
Sbjct  121  EQEEGKKKFIECLKTLEQELGDKPYFGGEEFGYVDVALIPFTSWFYTYETYGKLNIEEEC  180

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMYELHK  123
            PKL+ W KRCME+ SV+K LP   K+Y+  K
Sbjct  181  PKLVTWAKRCMEKESVAKSLPHPHKIYDFAK  211



>ref|XP_011041780.1| PREDICTED: probable glutathione S-transferase parA [Populus euphratica]
 ref|XP_011041781.1| PREDICTED: probable glutathione S-transferase parA [Populus euphratica]
 ref|XP_011041782.1| PREDICTED: probable glutathione S-transferase parA [Populus euphratica]
 ref|XP_011041783.1| PREDICTED: probable glutathione S-transferase parA [Populus euphratica]
Length=219

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 144/206 (70%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW++ + MR+++AL EKGI Y+ +E++L +  +S L+LEMNPV K +P+L+H GR
Sbjct  5    VTLLDFWSSSWAMRVKVALAEKGIEYESREQNLID--KSPLLLEMNPVHKMIPVLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I+ YID+ WKD  PLL P DPY R+ ARFW  +ID K +       K K E +
Sbjct  63   PICESLNIVLYIDELWKDKSPLL-PSDPYRRSQARFWADYIDKKIYNNAKKLWKEKAEKQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E ++E I  L+ LE  LGDK YFGGE FGF DV  +P +S FY  E  GKF +E +CPK
Sbjct  122  EEVKREFIEGLRTLEGELGDKLYFGGESFGFVDVVLVPVTSWFYSLEICGKFSIEADCPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            + AW+KRCMER SVS  LPD  K+Y+
Sbjct  182  ITAWIKRCMERESVSSSLPDPHKIYD  207



>ref|XP_007214387.1| hypothetical protein PRUPE_ppb009345mg [Prunus persica]
 gb|EMJ15586.1| hypothetical protein PRUPE_ppb009345mg [Prunus persica]
Length=220

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 141/207 (68%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKGI Y+YKEEDL+N  +S L+L+ NPV K +P+L+H G+
Sbjct  5    VLLLDFWPSPFGMRVRVALAEKGIQYEYKEEDLSN--KSALLLQSNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PV +S+  LEYID+ WKD  PLL P DPY RA ARFW  F+D K +        +KGE +
Sbjct  63   PVSESLVALEYIDEVWKDKTPLL-PSDPYLRAQARFWADFVDKKVYEIGKVLRSTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE +  +  LE+ LGDK YFGGE  GF DVA IPF S FY YE  G F +E E PK
Sbjct  122  EAAKKEFLECIGLLEEKLGDKPYFGGETLGFVDVALIPFYSWFYAYEKLGNFSIEAEQPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
              AW KRCM++ SVSK L D   +Y+ 
Sbjct  182  FYAWAKRCMQKESVSKSLADQKAIYDF  208



>ref|XP_010087160.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB27065.1| putative glutathione S-transferase [Morus notabilis]
Length=220

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKGI Y+YKEEDL N  +S L++EMNP+ K +P+L+H G+
Sbjct  6    VILLDFWGSMFGMRVRIALAEKGIKYEYKEEDLWN--KSTLLVEMNPIHKRIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+ I++Y+D+ W    PLL P DPY+RA ARFW   +D+K +        +KGE +
Sbjct  64   SICESLIIVQYVDEVWHGKAPLL-PSDPYQRAHARFWADVVDDKMYDAGKNVWATKGEDQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A K   + LK LE  LGDK YFGG+ FGF DVA IP+ S F+ YE+ G F +E ECPK
Sbjct  123  EAANKVFFDTLKLLEAELGDKPYFGGDSFGFVDVALIPYYSWFHAYETFGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRC E+ SVSK L D  K+ E 
Sbjct  183  LIAWAKRCTEKESVSKSLADENKICEF  209



>gb|AFK39936.1| unknown [Medicago truncatula]
 gb|KEH34502.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=224

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -2

Query  776  MATTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKS  597
            M+       V ++DFW + +GMR++IALEEKG++Y+ ++ED  +  +S ++LEMNPV K 
Sbjct  1    MSQYMDKDSVVLLDFWPSVYGMRVKIALEEKGVSYECRQEDFQD--KSSMLLEMNPVYKM  58

Query  596  VPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQAT  417
            +P+LVH G+P+C+S+ I+EYID+ W    P LLP DPY+R+ A+FW  +ID   +  +  
Sbjct  59   IPVLVHNGKPICESLNIVEYIDEAWNHK-PSLLPLDPYKRSQAKFWGDYIDKHVYSIRRK  117

Query  416  FLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGK  237
              K K E ++E +K+ I  LK LE  LGDK YFGG++FG+ DVA IPF+S FY YE +GK
Sbjct  118  LWKGKVEEQEEGKKKFIEGLKTLEDELGDKPYFGGDEFGYVDVALIPFTSWFYTYEIYGK  177

Query  236  FKLEEECPKLLAWVKRCMERSSVSKILPDSVKMY  135
              +E+ECPKL+AW KRCME+ SV+K LP   K+Y
Sbjct  178  LSIEKECPKLVAWAKRCMEKESVAKSLPHPHKIY  211



>ref|XP_007212678.1| hypothetical protein PRUPE_ppa018428mg [Prunus persica]
 gb|EMJ13877.1| hypothetical protein PRUPE_ppa018428mg [Prunus persica]
Length=216

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V V+ FW + +G R  IAL+EKG+ Y+Y+E+DL N  +S L+L+MNPV K +P+L+H G+
Sbjct  6    VVVLGFWPSMYGTRATIALDEKGVKYEYREQDLRN--KSSLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID+ W+   PLL P DPY+RA AR W  FID K    +     +KGE  
Sbjct  64   PVCESLIIVQYIDEVWEGKAPLL-PSDPYQRARARVWADFIDKKVPDARKKLWSTKGEEL  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +EA+KE I+ LKQLE  LGDK YFGGE FGF D+A I   + FY +E+ G F  E ECPK
Sbjct  123  EEAKKEFIDILKQLEGELGDKPYFGGESFGFLDIALITSYNWFYAFETLGNFSTEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            L+ W KRCM+R SVSK L D  K+YE    W
Sbjct  183  LIEWAKRCMQRESVSKSLADPKKVYEFLLGW  213



>ref|XP_006387538.1| hypothetical protein POPTR_0878s00210g [Populus trichocarpa]
 gb|ERP46452.1| hypothetical protein POPTR_0878s00210g [Populus trichocarpa]
Length=219

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FG+R+RIAL EKG+ Y+Y E++L +  +S L+L+MNPV K +P L+H GR
Sbjct  5    VTLLDFWASPFGIRVRIALAEKGVKYEYSEQNLRD--KSALLLQMNPVYKKIPTLIHNGR  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             VC+S+ I++Y+DD WK   PLL P  PY+RA +R W  FID K F        +KGE  
Sbjct  63   SVCESLIIVQYVDDAWKGKAPLL-PSVPYQRAQSRLWADFIDKKVFEITKKIWTTKGEEL  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+ I  LK LE  LGDK YFGGE  G+ DVAF+PF   FY YE+ G F +E ECPK
Sbjct  122  EGAKKDFIECLKLLEGELGDKPYFGGENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCM++ SVSK L D  K+YE 
Sbjct  182  IIAWAKRCMQKESVSKSLEDPKKVYEF  208



>gb|AFK35203.1| unknown [Medicago truncatula]
Length=209

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 139/203 (68%), Gaps = 3/203 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D WA+ FGMR RIAL EK + Y+YKEEDL N  +S L+L+MNP+   +P+L+H G+
Sbjct  5    VILLDTWASMFGMRARIALAEKSVKYEYKEEDLRN--KSPLLLQMNPIHNKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S  I++YID+ W D    + P DPYERA ARFW  + D K + T      SKGE  
Sbjct  63   SICESAIIVQYIDEVWNDKASFM-PSDPYERAQARFWVDYSDKKVYDTWKKMWLSKGEEY  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E + ELI+  K LE  L DK ++GG+ FGF D+  IPF S FY +E++G FK+E ECPK
Sbjct  122  EEGKMELISIFKTLEGALSDKLFYGGDTFGFLDIGLIPFYSWFYAFETYGNFKMETECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVK  141
            L+AW KRCME+ SVSK LPD  K
Sbjct  182  LMAWTKRCMEKDSVSKSLPDQKK  204



>ref|XP_006829366.1| hypothetical protein AMTR_s00384p00012000 [Amborella trichopoda]
 gb|ERM96782.1| hypothetical protein AMTR_s00384p00012000 [Amborella trichopoda]
Length=218

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 152/221 (69%), Gaps = 7/221 (3%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            GG V ++D WA+ FGMR+RIAL EKG+ Y+Y+EEDL+N  +S L+L+ NPV K +P+L+H
Sbjct  2    GGEVILLDVWASPFGMRVRIALAEKGVKYEYREEDLDN--KSELLLKSNPVHKKIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
              + V +S+ I+EY+D+ WK+    LLP+DPYERA ARFW  F+D K + +     K KG
Sbjct  60   GDKCVSESLIIVEYVDEVWKNS--PLLPKDPYERAVARFWADFVDKKVYESGTRIWKHKG  117

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            EA+ EA K+ I  LK LE  LGD+ +FGGEK GF D+A +PF   F+ YE HG F +  E
Sbjct  118  EARAEAVKDFIESLKVLESGLGDEPFFGGEKLGFMDIALVPFVCWFHAYEVHGGFSVAAE  177

Query  218  CPKLLAWVKRCMERSSVSKILPDSVK---MYELHKIWYGVE  105
            CPK+ AW KRCME+ SVSK L D  K   + E+ K  +GVE
Sbjct  178  CPKIDAWGKRCMEKESVSKALQDPEKILVLLEVIKKKFGVE  218



>ref|XP_006366776.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 144/210 (69%), Gaps = 3/210 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EK + Y+YKEEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  6    VILLDFWPSMFGMRLRIALAEKEVKYEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  +EYID+ WKD  PLL P DPY RA ARFW  +ID K + T      + G+  
Sbjct  64   PICESLIGVEYIDEVWKDKSPLL-PSDPYVRAQARFWGDYIDKKLYDTARKIYSATGDEH  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +K+ I  LK LE  LG+K Y+GG+ FGF D+A I F   F  YE +G F +E ECPK
Sbjct  123  EAGKKDFIEILKVLEGALGEKPYYGGDNFGFGDIALIGFYCWFPAYEIYGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKI  120
            L+AW KRCM+R SV+K LPD  K+ E  KI
Sbjct  183  LVAWAKRCMKRDSVAKTLPDQHKILEFAKI  212



>ref|XP_009591607.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=222

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 152/212 (72%), Gaps = 3/212 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            GV ++DFWA+  GMR+RIAL EK I Y+YKEEDL +  +S L+L+MNP+ K +P+L+H G
Sbjct  5    GVILLDFWASMLGMRVRIALAEKEIKYEYKEEDLLS-TKSSLLLKMNPIHKKIPVLIHNG  63

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            +PVC+S+  +EYID+ WKD  PLLLP DPYERA ARFW  +ID K +        +KGE 
Sbjct  64   KPVCESIIAVEYIDEVWKDKAPLLLPSDPYERAQARFWCDYID-KMYDFGRKIWTTKGEE  122

Query  392  KQEAQKELINELKQLE-QVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             +E +K+ I+ LK LE + LGDK YFGGE FGF D+A I F S FY Y++ G F +E EC
Sbjct  123  HEEGKKKFIDSLKLLELEALGDKPYFGGENFGFVDIALIGFYSWFYAYDTFGNFSIEAEC  182

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMYELHKI  120
            PKL+AW KRCM+R SVS  L D  K+YE+ ++
Sbjct  183  PKLVAWGKRCMQRESVSTSLADPHKIYEMLQV  214



>ref|XP_010041120.1| PREDICTED: glutathione S-transferase U25-like [Eucalyptus grandis]
 gb|KCW44635.1| hypothetical protein EUGRSUZ_L01850 [Eucalyptus grandis]
Length=215

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 145/204 (71%), Gaps = 7/204 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+RIAL EKG+ +  +EEDL+N  +S L+L+MNPV K +PILVH G+
Sbjct  5    VILLDFWPSLFGMRVRIALREKGVEFDMREEDLSN--KSPLLLKMNPVHKKIPILVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ I++YID++W    PLL P DPYERA A FW  ++D K +P   T   S GEA+
Sbjct  63   PVCESLLIVQYIDESWVRESPLL-PSDPYERARAGFWADYVDKKLYPAMRTMWLSTGEAQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK+YFGGE FG+ DV+ IPF S FY  +    F + EECPK
Sbjct  122  EAGKKEFIEFLKVLEGELGDKAYFGGETFGYVDVSLIPFYSWFYALD----FSIVEECPK  177

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L+AW KRCM+R SV+K LPD  K+
Sbjct  178  LVAWAKRCMQRESVAKSLPDQHKL  201



>gb|EYU26247.1| hypothetical protein MIMGU_mgv1a013356mg [Erythranthe guttata]
Length=223

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D   + +GMR+R+AL EKG+ Y++K+E+L +  +S L+LEMNP+ K +P+L+H G+
Sbjct  7    VVLLDSMFSMYGMRVRVALAEKGVEYEFKDENLLD--KSTLLLEMNPIHKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWK-DGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            PVC+S+ I+EY+D+ WK D  PLLLP DPY+R  ARFW  FID K   +Q      KG+ 
Sbjct  65   PVCESMMIVEYVDNVWKNDDSPLLLPCDPYKRFQARFWADFIDKKVNDSQKKVWTMKGKE  124

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            +++ ++E I  LK LE  LGDK YFGG+ FGF D+A +PF S FY YE+ G F +EE CP
Sbjct  125  QEKGKEEFIEALKLLEGELGDKPYFGGDNFGFLDIALVPFYSWFYAYETLGNFSIEEHCP  184

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYE  132
            KL+ W++RCM++ SVSK LPD  K+YE
Sbjct  185  KLIEWIERCMQKESVSKSLPDPKKVYE  211



>ref|XP_010245129.1| PREDICTED: probable glutathione S-transferase parA [Nelumbo nucifera]
Length=219

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 145/211 (69%), Gaps = 3/211 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIAL EKGI Y+Y++EDL N  +S  +L++NPV K +P+L+  G+
Sbjct  5    VILLDFWPSPFGMRARIALAEKGIKYEYRDEDLEN--KSRFLLQVNPVHKKIPVLIDNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD   LL+P DPY+RA ARFW  F+DNK +        SK E K
Sbjct  63   PICESLIIVQYIDEVWKDKC-LLMPSDPYKRAQARFWADFVDNKLYHCGRRVWFSKAEDK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +EA KELI  LK LE  LG+K YFGGE  GF DVA +PF+S F  YE+   F +E  CPK
Sbjct  122  EEACKELIECLKLLEGELGNKPYFGGETLGFIDVALVPFNSWFCSYETCENFSIEPHCPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELHKIW  117
            ++AW KRCME+ SVSK  PD   + +L   W
Sbjct  182  IVAWAKRCMEKESVSKSFPDHQMVCDLALQW  212



>ref|XP_008794561.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=221

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V V+DFW + F MR++IALEEKGI ++ +EEDL    +S L+L+ NP+ K VP+L+H G+
Sbjct  7    VVVLDFWVSPFAMRVKIALEEKGIKFEAREEDLLG-NKSELLLQSNPIYKKVPVLLHNGK  65

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ IL Y+D+TW    P LLP +PYER+ A+FW  F+D K F   +   KSKGEA 
Sbjct  66   PLCESLVILNYVDETWPS--PPLLPTNPYERSVAKFWADFVDKKIFEGGSKIWKSKGEAL  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE    LK LE  LG+K YF G  FGF D+  IP  S FYGYE  G FK+EE+CPK
Sbjct  124  EVAKKEFEECLKLLEGALGEKEYFAGNGFGFMDIVLIPHISWFYGYEQFGGFKVEEQCPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L AW+KRC+ R SV+K+LPD  K++E
Sbjct  184  LGAWMKRCLGRESVAKVLPDPAKVHE  209



>ref|NP_001236587.1| uncharacterized protein LOC100527221 [Glycine max]
 gb|ACU16274.1| unknown [Glycine max]
Length=221

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 144/207 (70%), Gaps = 2/207 (1%)
 Frame = -2

Query  755  GGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHE  576
              V ++DFW + +GMR++IAL EKGI+Y+ K+EDL    RS L+LEMNPV K +P+L+H 
Sbjct  4    ANVVLLDFWPSSYGMRVKIALAEKGISYECKQEDLE--ARSSLLLEMNPVHKMIPVLIHN  61

Query  575  GRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            G+P+C+S+ I++YID+TW      LLP DPY+R+ ARFW  +ID   +         KG+
Sbjct  62   GKPICESLNIVQYIDETWNHKPSSLLPSDPYKRSQARFWGDYIDKNVYNAVKRVWTGKGK  121

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             ++E +K+ I  LK LE  LGDK YFGGE FG+ DVA +PF+S FY  E+ GK  +E+EC
Sbjct  122  EQEEFKKQFIQCLKTLEYELGDKPYFGGEDFGYVDVALVPFTSWFYTVETCGKLSIEKEC  181

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMY  135
            PKL+AW KRCME+ SV+  LP   ++Y
Sbjct  182  PKLMAWAKRCMEKESVATPLPHPHQIY  208



>ref|XP_004243196.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=241

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 150/229 (66%), Gaps = 6/229 (3%)
 Frame = -2

Query  806  YIQNLNIYIYMATTTCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHL  627
            +I  L I+I   +      V ++DFW + FG+R+RIAL EK + Y+Y+EEDL  P +S L
Sbjct  11   FISFLFIHI---SKMANNEVILLDFWPSMFGLRLRIALAEKEVKYEYREEDL--PNKSPL  65

Query  626  VLEMNPVRKSVPILVHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFI  447
            +L+MNP+ K +P+L+H G+P+C+S+  +EYID+ WKD  PLL P DPYERA ARFW  +I
Sbjct  66   LLQMNPIHKKIPVLIHNGKPICESIIGVEYIDEVWKDKAPLL-PSDPYERAQARFWADYI  124

Query  446  DNKFFPTQATFLKSKGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSS  267
            D KF+        +KGE    A++E I  LK LE  LGDK YFGG+ FGF D+A I F  
Sbjct  125  DKKFYWASRKLWTTKGEELDAAKEEFIVCLKVLEGALGDKPYFGGDNFGFVDIALIGFYC  184

Query  266  MFYGYESHGKFKLEEECPKLLAWVKRCMERSSVSKILPDSVKMYELHKI  120
             F  YE++G F  E E PK +AW KRCM+R SV+K  PD  K+ E  K+
Sbjct  185  WFSAYETYGNFSTEAESPKFVAWAKRCMQRDSVAKSSPDQHKVLEFVKV  233



>ref|XP_010644811.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 147/218 (67%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGM++RIAL EKG+ Y+Y++EDL N  +  L+LEMNP+ K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMKVRIALAEKGLKYEYRDEDLFN--KGPLLLEMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  PLL P DPY RA ARFW  +ID K         ++KGE +
Sbjct  63   PICESQIIVQYIDEVWKDKSPLL-PSDPYHRAQARFWADYIDKKLHLLGKRLWRTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK YFGGE FGF DV  +P+ S  Y +E    F +E ECPK
Sbjct  122  EANKKEYIECLKLLEGELGDKPYFGGENFGFVDVNLMPYFSWLYVFEIAANFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELH---KIWYGVE  105
            L+ W KRCME+ SVS  LPD  K+Y+     K W+G+E
Sbjct  182  LITWAKRCMEKESVSTSLPDRQKLYDFFLQLKKWHGIE  219



>ref|XP_009781253.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D   + FGMR+R AL EKGI Y+YKE+DL N  ++ L+L+MNP+ K +P+L+H G+
Sbjct  5    VVLLDTNVSMFGMRVRFALAEKGIQYEYKEQDLLN--KTPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PL+ P DPYERA ARFW  ++D K + T      SK E +
Sbjct  63   PICESLVIVQYIDEVWKDNSPLM-PSDPYERAHARFWADYVDKKIYDTGRKIWTSKKEDQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A KE I  LK LE  LGDK YFGGE FGF DVA IP+ + F  YE  G F +E ECPK
Sbjct  122  EAANKEFIECLKLLEGELGDKPYFGGESFGFVDVALIPYYTWFPTYEKFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW KRCM++ SVSK L D  K+Y+ 
Sbjct  182  IVAWAKRCMQKESVSKSLADPDKVYDF  208



>ref|XP_010476861.1| PREDICTED: glutathione S-transferase U24-like [Camelina sativa]
Length=221

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 143/204 (70%), Gaps = 3/204 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR RIAL EKG+ Y Y+E+DL N  +S L+L+MNPV K +P+L+H G+
Sbjct  7    VILLDFWASMFGMRTRIALAEKGVEYDYREQDLWN--KSSLLLQMNPVHKKIPVLIHNGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  L+YID+TW D    LLP DPY+RA A+FW  FID K          +KGE +
Sbjct  65   PVCESLFQLQYIDETWPDNKCSLLPSDPYKRALAKFWADFIDKKVNVAARRIWATKGE-E  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            QEA KELI  LK LE  LGDK YFG E FG+ D+A I F S F  Y+ +G   +E ECPK
Sbjct  124  QEASKELIEILKTLESELGDKDYFGDETFGYVDIALIGFYSWFGVYDKYGNINIESECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L++W KRC++R SV+K LP+S K+
Sbjct  184  LISWAKRCLQRESVAKALPESEKV  207



>emb|CDP20885.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 143/210 (68%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V V+  + + F MR+++AL EKGI Y+ KEEDL N  +S L+LE+NPV K +P+L+H
Sbjct  3    GDKVVVLGTYGSMFSMRVQVALAEKGIEYENKEEDLAN--KSPLLLEVNPVHKKIPVLIH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++YID+ W D  PLL P DPY+RA ARFW  F+D K +        +KG
Sbjct  61   NGKPVCESLIIVQYIDEVWHDKNPLL-PSDPYQRAQARFWADFVDKKVYDCGRRIWATKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E K+ A+KE I  +K LE  LG+K YFGGE FG+ DVA IPF   F+ YE  G FK E E
Sbjct  120  EEKEAAKKEFIGIMKTLEGELGNKPYFGGEDFGYVDVALIPFYCWFHAYEKFGNFKTETE  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPKL+ W KRCM+R SVSK L D  K+YE 
Sbjct  180  CPKLVEWAKRCMQRESVSKSLADPHKIYEF  209



>ref|XP_006305593.1| hypothetical protein CARUB_v10010257mg [Capsella rubella]
 gb|EOA38491.1| hypothetical protein CARUB_v10010257mg [Capsella rubella]
Length=219

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIALEEK + + Y+E+DL N  +S ++LEMNPV K +P+L+H G+
Sbjct  5    VILLDFWPSMFGMRTRIALEEKNVKFDYREQDLWN--KSPILLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  +EYID+ W    PLL P DPY+RA A+FW  FID K + +      +KGE +
Sbjct  63   PVCESLIQVEYIDEVWPSKNPLL-PSDPYQRAQAKFWGDFIDKKVYASARLIWGAKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK YFGGE FG+ D+A I F S F  Y+  G F +E ECPK
Sbjct  122  EAGKKEFIEILKTLESELGDKIYFGGETFGYVDIALIGFYSWFEAYDKFGNFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRC+ER SV+K LPDS K+ E 
Sbjct  182  LIAWAKRCVERESVAKSLPDSNKIVEF  208



>ref|XP_011013655.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 146/209 (70%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW++ FGMR+RIAL EK + Y+Y E+DL N  +  L L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWSSPFGMRVRIALAEKAVEYEYSEQDLWN--KGALFLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YID+ WKD  PLL   DP ERA +RFW  F+D K +        +KG
Sbjct  61   DGKPLCESLIIVQYIDEVWKDKAPLL-SSDPCERAQSRFWADFVDKKLYELGKKICTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGGE  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+A+ KRC+E+ SVSK L D  K+Y+
Sbjct  180  CPKLIAYCKRCLEKESVSKSLKDPQKVYD  208



>gb|ADB11329.1| tau class glutathione transferase GSTU54 [Populus trichocarpa]
Length=220

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 147/209 (70%), Gaps = 3/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++D WA+ FGMR+RIAL EKG+ Y+Y E+DL N  +  L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDLWASPFGMRVRIALAEKGVKYEYSEQDLWN--KGALLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+P+C+S+ I++YID+  KD  PLL   DPYERA +RFW  F+D K +        +KG
Sbjct  61   DGKPICESLIIVQYIDEVSKDKAPLL-SSDPYERAQSRFWADFVDKKLYELGKKIYTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE  LGDK YFGG+  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQEAAKKDFIDSLKLLEGELGDKPYFGGDTLGYVDVALLPFYCWFYAYETIGNFNIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            CPKL+A+ KRC+E+ SVSK L D  K+Y+
Sbjct  180  CPKLIAYCKRCLEKESVSKSLEDPQKVYD  208



>ref|XP_007133435.1| hypothetical protein PHAVU_011G178400g [Phaseolus vulgaris]
 gb|ESW05429.1| hypothetical protein PHAVU_011G178400g [Phaseolus vulgaris]
Length=219

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 144/205 (70%), Gaps = 3/205 (1%)
 Frame = -2

Query  743  VIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGRPV  564
            ++D W + FGMR RIAL EK I Y+Y+EEDLNN  +S L+L+MNPV K +P+L+H G+P+
Sbjct  7    LLDDWLSMFGMRARIALAEKEIEYEYREEDLNN--KSQLLLQMNPVHKKIPVLIHNGKPI  64

Query  563  CDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAKQE  384
             +S+ I+EYID+ WK+    L P +PY+RA ARFW  F++ K           K E  + 
Sbjct  65   SESIIIVEYIDEVWKNKASFL-PSEPYQRAQARFWADFVNKKIGDVGGRIWAGKREEIEA  123

Query  383  AQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPKLL  204
            A+KEL+  LK+LE+ LG+K YFGG+ FGF D+A IPFS+ FY YE+ G FK+E ECPK++
Sbjct  124  AKKELVEGLKELEKNLGEKPYFGGDTFGFVDIALIPFSTWFYSYEALGNFKVEAECPKII  183

Query  203  AWVKRCMERSSVSKILPDSVKMYEL  129
            AW KRC ER SVSK + D  K+YE 
Sbjct  184  AWAKRCNERESVSKSVADEKKVYEF  208



>gb|ABG73420.1| glutathione S-transferase isoform 2 [Castanea crenata]
Length=219

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 145/210 (69%), Gaps = 3/210 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
             G V ++DFW + F MR+RIAL EKGI Y+ KEEDL+N  +S L+LEMNP+ K +P+L+H
Sbjct  2    AGEVVLLDFWPSMFAMRVRIALAEKGIRYESKEEDLSN--KSPLLLEMNPINKQIPVLIH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
            +G+PVC+S+ I++YID+ W D  PLL P DPY++ +++ W  F+D K          +KG
Sbjct  60   KGKPVCESLIIVQYIDEVWNDKSPLL-PSDPYQKRSSQVWADFVDKKVSGAAKKVWSTKG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++  +KE +  LK +E  LGDK YFGGE FG+ D++FI F S F+ YE  G F +E E
Sbjct  119  EEQEAGKKEFLEALKTMEGELGDKPYFGGETFGYVDLSFITFYSWFHAYEVLGNFNIEAE  178

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKMYEL  129
            CPK++ W KRCM++ +V+  LPD  K+YE 
Sbjct  179  CPKIITWAKRCMQKEAVANTLPDQKKVYEF  208



>ref|XP_009420693.1| PREDICTED: probable glutathione S-transferase parA [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 150/220 (68%), Gaps = 8/220 (4%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            G+ ++DFW + FG R RIAL EKG+ Y+Y+EE+L +  +S L+L+ NPV K +P+L+  G
Sbjct  8    GLVLLDFWVSPFGQRCRIALAEKGVEYEYREENLRD--KSPLLLKSNPVHKKIPVLIDHG  65

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
             PVC+S+ I++YID+ W D  PLL P DPY RA ARFW   ++ K + +     K KGEA
Sbjct  66   MPVCESLNIVQYIDEKWPDRAPLL-PADPYARAQARFWADLVEKKMYESGTKLWKLKGEA  124

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            ++EA+KE I  LK LE  LGDK YFGGE FG  D+A +PF++ FY YE+      E+E P
Sbjct  125  QEEAKKEFIEILKLLEGELGDKKYFGGETFGLVDIALVPFTAWFYSYEACANLSTEKETP  184

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYE----LHKIWYGVE  105
            KL+ W KRC ER SVSK LPD +K+YE    L K+ YG+E
Sbjct  185  KLVPWAKRCRERESVSKSLPDPLKVYEFVCFLKKV-YGIE  223



>ref|XP_010428964.1| PREDICTED: glutathione S-transferase U19-like [Camelina sativa]
Length=219

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 145/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIAL EKG+ ++Y+EEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VVLLDFWPSMFGMRTRIALREKGVEFEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PV +S+  ++YID+ W    P+L P DPY+RA ARFW  FID K +  Q     +KGE +
Sbjct  63   PVNESIIQVQYIDEVWSHKNPIL-PSDPYQRAQARFWADFIDKKMYEAQRKVWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +K+ I  LK LE  LGDK YFGG++FG  D+A I FS+ F  YE  G F +E+ECPK
Sbjct  122  ETGKKDFIEILKTLESELGDKPYFGGDEFGLVDIALIGFSTWFPSYEKFGNFSIEQECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AWVK+C++R +V+K LPD  K+ E 
Sbjct  182  LIAWVKKCLQRETVAKSLPDPEKVTEF  208



>ref|XP_010087165.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB27070.1| putative glutathione S-transferase [Morus notabilis]
Length=219

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 142/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKGI Y+YKEE+L+N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VILLDFWLSMFGMRVRVALAEKGIKYEYKEENLSN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+ +S+ I++YID+ W D  PLL P DPY+RA ARFW  FID K +        +KGE K
Sbjct  63   PISESLTIVQYIDEVWNDKAPLL-PSDPYQRAQARFWADFIDKKVYDAWRKVWTTKGEEK  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE ++ LK LE  LGDK YFGG+  GF D+A + F   FY  E+ G F +E ECPK
Sbjct  122  EAGKKEFLDALKLLETELGDKPYFGGDSLGFLDIALVGFYPWFYALETFGNFSVEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W K C E+ SVSK L D  K+YE 
Sbjct  182  LIEWAKSCKEKESVSKSLADEKKVYEF  208



>gb|ADB11350.1| putative tau class glutathione transferase GSTU10 [Populus trichocarpa]
Length=220

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 146/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFWA+ FGMR+RIAL EKG+ Y+Y E+DL N  ++ L+L+MNPV K +P+LVH
Sbjct  3    GDQVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRN--KTALLLQMNPVHKKIPVLVH  60

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++ ID+ WKD  PLL P DPY+   +RFW  F+D K +        +KG
Sbjct  61   NGKPVCESLIIVQNIDEAWKDKAPLL-PSDPYQGVQSRFWADFVDKKIYALGRKIWTTKG  119

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            E ++ A+K+ I+ LK LE+ LG+K YFGGE  G+ DVA +PF   FY YE+ G F +E +
Sbjct  120  EDQESAKKDFIDSLKLLERELGEKPYFGGETLGYVDVALLPFLCWFYAYETIGNFSIEAD  179

Query  218  CPKLLAWVKRCMERSSVSKILPDSVKM  138
            CPKL+A+ KRC+++ SVSK L D  K+
Sbjct  180  CPKLIAYCKRCLQKESVSKSLEDPQKV  206



>ref|XP_010923804.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
Length=222

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  752  GVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEG  573
            GV ++DFW + FG R RIAL EKG+ Y+Y+EE++ +  +S L+LE+NP+ K +P+L+H+G
Sbjct  7    GVVLLDFWVSMFGQRCRIALAEKGVEYEYREENVVD-HKSPLLLEINPIYKKIPVLIHDG  65

Query  572  RPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEA  393
            + VC+S+ I++YID+ W +    LLP D YERA ARFW  FID K         K KGEA
Sbjct  66   KSVCESLIIVQYIDEVWTNN--PLLPSDHYERAKARFWADFIDKKVHECGTRLWKLKGEA  123

Query  392  KQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECP  213
            +  A+KE+I  LK LE  LGDK YFGGE FGF D+A +P ++ FY YE+   F +EEECP
Sbjct  124  QGAAKKEMIEVLKLLEGELGDKKYFGGETFGFVDIALVPVTAWFYSYETCANFSIEEECP  183

Query  212  KLLAWVKRCMERSSVSKILPDSVKMYEL  129
            KL+AW KRC ER SV+K L D  K+YE 
Sbjct  184  KLVAWGKRCRERESVAKSLNDPHKVYEF  211



>emb|CDP06114.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 152/220 (69%), Gaps = 6/220 (3%)
 Frame = -2

Query  755  GGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHE  576
            G V ++D +A+ FGMR+RIAL EKG+ Y+Y+EE+L  P++S  + +MNP+ K VP+L+H 
Sbjct  3    GEVILLDAYASMFGMRLRIALAEKGVKYEYREENL--PKKSPFLFQMNPIHKKVPVLIHN  60

Query  575  GRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            G+P+C+S+  L+YID+ W D  PLL P DPY+RA AR W  F+D K          +KGE
Sbjct  61   GKPICESLIALQYIDEVWHDKNPLL-PSDPYKRAQARLWADFVDQKVHILGRKIWSAKGE  119

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             ++ A+KE I  LK LE  LG+K YFGGE+FG+ DVA IPF S F+ YE+ G FK+  +C
Sbjct  120  EQEAAKKEFIEALKVLEGELGEKPYFGGEEFGYVDVALIPFYSWFHAYETCGNFKIGTQC  179

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMYE---LHKIWYGVE  105
            PK +AW KRCM+R SVSK L D  K+Y+   + K  +GVE
Sbjct  180  PKFVAWAKRCMQRESVSKSLADPEKVYDFVLILKKHFGVE  219



>ref|XP_010060804.1| PREDICTED: glutathione S-transferase U25-like [Eucalyptus grandis]
Length=215

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 149/216 (69%), Gaps = 11/216 (5%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW + FGMR+RIAL EKG+ +  +EEDL+N  +S L+L+MNPV K +PILVH
Sbjct  2    GEEVILLDFWPSLFGMRVRIALREKGVEFDMREEDLSN--KSPLLLKMNPVHKKIPILVH  59

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             G+PVC+S+ I++YID++W    PLL P DPYERA A FW  ++D K +P   T   S G
Sbjct  60   NGKPVCESLLIVQYIDESWVRESPLL-PSDPYERARAGFWADYVDKKLYPAMRTMWLSTG  118

Query  398  EAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEE  219
            EA++  +KE I  LK LE  LGDK+YFGGE FG+ DV+ IPF S FY  +    F + +E
Sbjct  119  EAQEAGKKEFIEFLKVLEGELGDKAYFGGETFGYVDVSLIPFYSWFYALD----FSIVKE  174

Query  218  CPKLLAWVKRCMERSSVSKILPDSVK----MYELHK  123
            CPKL AW KRCM+R SV+K LPD  K    + ELHK
Sbjct  175  CPKLGAWAKRCMQRESVAKSLPDQHKLRDFLLELHK  210



>ref|NP_173161.1| glutathione S-transferase TAU 25 [Arabidopsis thaliana]
 sp|Q9SHH7.1|GSTUP_ARATH RecName: Full=Glutathione S-transferase U25; Short=AtGSTU25; 
AltName: Full=GST class-tau member 25 [Arabidopsis thaliana]
 gb|AAD50015.1|AC007651_10 Putative glutathione transferase [Arabidopsis thaliana]
 dbj|BAC43490.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AAO64063.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AEE29555.1| glutathione S-transferase TAU 25 [Arabidopsis thaliana]
Length=221

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 141/204 (69%), Gaps = 3/204 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIALEEK + + Y+E+DL N  +S ++LEMNPV K +P+L+H G 
Sbjct  5    VILLDFWPSMFGMRTRIALEEKNVKFDYREQDLWN--KSPILLEMNPVHKKIPVLIHNGN  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  +EYID+ W    PLL P DPY+RA A+FW  FID K + +      +KGE  
Sbjct  63   PVCESLIQIEYIDEVWPSKTPLL-PSDPYQRAQAKFWGDFIDKKVYASARLIWGAKGEEH  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK+YFGGE FG+ D+A I F S F  YE  G F +E ECPK
Sbjct  122  EAGKKEFIEILKTLESELGDKTYFGGETFGYVDIALIGFYSWFEAYEKFGSFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L+AW KRC+ER SV+K LPDS K+
Sbjct  182  LIAWGKRCVERESVAKSLPDSEKI  205



>ref|XP_008226262.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=220

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 140/207 (68%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKGI Y+YKEEDL+N  +S L+L+ NPV K +P+L+H G+
Sbjct  5    VLLLDFWPSPFGMRLRVALAEKGIQYEYKEEDLSN--KSALLLQSNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PV +S+  LEYID+ WKD  PLL P DPY RA ARFW  F+D K +        +KGE +
Sbjct  63   PVSESLVALEYIDEVWKDKTPLL-PSDPYLRAQARFWADFVDKKVYEIGKVLRSAKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE +  +  LE+ LGDK YFGGE  GF DVA IPF S FY YE  G F +E E PK
Sbjct  122  EAAKKEFLECIGLLEEKLGDKPYFGGETLGFVDVALIPFYSWFYVYEKFGNFSIEAEQPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
               W KRCM++ SVSK L D   +Y+ 
Sbjct  182  FYGWAKRCMQKESVSKSLADQKAIYDF  208



>gb|ACG33497.1| glutathione S-transferase [Zea mays]
Length=222

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 141/204 (69%), Gaps = 2/204 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG R RIAL EKG+AY+Y+E+DL N  +  L+L  NP+ K +P+L+H GR
Sbjct  7    VVLLDFWVSPFGQRCRIALAEKGVAYEYREQDLLN--KGELLLRSNPIHKKIPVLLHAGR  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ IL+YID+ W D  PLL  +DPY RA ARFW  +ID K + +Q    K +GEA+
Sbjct  65   PVCESLVILQYIDEAWPDVAPLLPKDDPYARAQARFWADYIDKKIYDSQTRLWKFEGEAR  124

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A+K+L+  L+ LE  L DK +FGG   GF DVA +PF+S F  YE  G F ++E CP+
Sbjct  125  EQAKKDLVEVLETLEGELADKPFFGGGALGFVDVALVPFTSWFLAYEKLGGFSIQEHCPR  184

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            ++AW  RC ER SV+K L D  K+
Sbjct  185  IVAWAARCRERESVAKALSDPAKV  208



>ref|XP_004955467.1| PREDICTED: probable glutathione S-transferase-like [Setaria italica]
Length=224

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FG R RIAL EKG+ Y+Y+E+DL    +S L+L  NPV K +P+L+H GR
Sbjct  7    VVLLDFWVSPFGQRCRIALAEKGVPYKYREQDLLL-SKSELLLRSNPVHKKIPVLLHAGR  65

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+AI+EYID+ W    PLL  +DPY RA ARFW  +ID K +  Q+   K KGEA+
Sbjct  66   PVCESLAIVEYIDEVWPQAAPLLPRDDPYGRAQARFWADYIDKKIYGCQSRLWKLKGEAQ  125

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            ++A+K+LI  LK LE  L DK YFGGE FGF D+A +PF+  F  YE  G F +EE CPK
Sbjct  126  EQARKDLIEALKTLEFELDDKPYFGGENFGFVDIALVPFTCRFLAYEKLGSFSIEEHCPK  185

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            ++AW K C ER SV+K+LPD  K++E 
Sbjct  186  IVAWAKLCKERESVAKVLPDPDKVFEF  212



>ref|NP_001146786.1| GST6 protein [Zea mays]
 gb|ACL54749.1| unknown [Zea mays]
 tpg|DAA59559.1| TPA: GST6 protein [Zea mays]
Length=222

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 142/211 (67%), Gaps = 2/211 (1%)
 Frame = -2

Query  764  TCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPIL  585
                 V ++DFW + FG R RIAL EKG+AY+Y+E+DL +  +  L+L  NP+ K +P+L
Sbjct  2    AAAAEVVLLDFWVSPFGQRCRIALAEKGVAYEYREQDLLD--KGELLLRSNPIHKKIPVL  59

Query  584  VHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKS  405
            +H GRPVC+S+ IL+YID+ W D  PLL  +DPY RA ARFW  +ID K + +Q    K 
Sbjct  60   LHAGRPVCESLVILQYIDEAWPDVAPLLPKDDPYARAQARFWADYIDKKIYDSQTRLWKF  119

Query  404  KGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLE  225
            +GEA+++A+K+L+  L+ LE  L DK +FGG   GF DVA +PF+S F  YE  G F ++
Sbjct  120  EGEAREQAKKDLVEVLETLEGELADKPFFGGGALGFVDVALVPFTSWFLAYEKLGGFSIQ  179

Query  224  EECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            E CP+++AW  RC ER SV+K L D  K+ E
Sbjct  180  EHCPRIVAWAARCRERESVAKALSDPAKVLE  210



>ref|NP_173160.1| glutathione S-transferase TAU 24 [Arabidopsis thaliana]
 sp|Q9SHH6.1|GSTUO_ARATH RecName: Full=Glutathione S-transferase U24; Short=AtGSTU24; 
AltName: Full=GST class-tau member 24 [Arabidopsis thaliana]
 gb|AAD50016.1|AC007651_11 Putative glutathione transferase [Arabidopsis thaliana]
 gb|AAS76278.1| At1g17170 [Arabidopsis thaliana]
 gb|AEE29554.1| glutathione S-transferase TAU 24 [Arabidopsis thaliana]
Length=218

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR RIAL EK + Y ++EEDL N  +S L+LEMNPV K +P+L+H G+
Sbjct  5    VILLDFWASMFGMRTRIALAEKRVKYDHREEDLWN--KSSLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  +EYID+TW D  PLL P DPY+RA A+FW  FID K   T       KGE +
Sbjct  63   PVCESLIQIEYIDETWPDNNPLL-PSDPYKRAHAKFWADFIDKKVNVTARRIWAVKGE-E  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            QEA KELI  LK LE  LGDK YFG E FG+ D+A I F S F  YE  G   +E EC K
Sbjct  121  QEAAKELIEILKTLESELGDKKYFGDETFGYVDIALIGFHSWFAVYEKFGNVSIESECSK  180

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L+AW KRC+ER SV+K LP+S K+
Sbjct  181  LVAWAKRCLERESVAKALPESEKV  204



>gb|ADB11318.1| tau class glutathione transferase GSTU16 [Populus trichocarpa]
Length=219

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 144/206 (70%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + +  R+++AL EKGI Y+ +E++L +  +S L+LEMNPV K++P+L+H G+
Sbjct  5    VTLLDFWPSPWATRVKVALAEKGIEYESREQNLID--KSPLLLEMNPVHKTIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  PLL P DPY+R+ ARFW  +ID K +       K KGE +
Sbjct  63   PICESHNIVQYIDEVWKDKSPLL-PSDPYQRSQARFWADYIDKKIYNNAKKLWKEKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E ++E I  LK LE  LGDK YFGGE FGF DV  +P +S FY  E  GKF +E ECP+
Sbjct  122  EEVKREFIEGLKTLEGELGDKLYFGGESFGFVDVVLVPVTSWFYSLEICGKFSIEAECPR  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
              AW+KRCME+ SVS  LPD  K+Y+
Sbjct  182  FTAWIKRCMEKESVSSSLPDPHKVYD  207



>ref|XP_002270159.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 147/218 (67%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++DFW + FGM++RIAL EKG+ Y+Y++EDL N  +  L+LEMNP+ K +P+L+H G+
Sbjct  5    IILLDFWPSMFGMKVRIALAEKGLKYEYRDEDLFN--KGPLLLEMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+ WKD  PLL P D Y RA ARFW  +ID K     A   ++KGE +
Sbjct  63   PICESQIIVQYIDEVWKDKSPLL-PSDQYHRAQARFWADYIDKKLHLLGARLWRTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  +KE I  LK LE  LGDK YFGGE FGF DV  +P+ S  Y +E    F +E ECPK
Sbjct  122  EANKKEYIECLKLLEGELGDKPYFGGENFGFVDVNLMPYFSWLYVFEIAANFSIEAECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYELH---KIWYGVE  105
            L+ W KRCME+ SVS  LPD  K+Y+     K W+G+E
Sbjct  182  LITWAKRCMEKESVSTSLPDRQKLYDFFLQLKKWHGIE  219



>gb|ACH63238.1| glutathione-S-transferase 2 [Rheum australe]
Length=221

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 143/209 (68%), Gaps = 2/209 (1%)
 Frame = -2

Query  758  GGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVH  579
            G  V ++DFW + FG+R RIAL EKG+ Y Y+EEDL + Q+S L+LEMNPV K +P+L+H
Sbjct  2    GKEVVLLDFWPSMFGIRARIALAEKGVDYDYQEEDLLHGQKSELLLEMNPVHKKIPVLIH  61

Query  578  EGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKG  399
             GRPVC+S+ ILEYID+ W D    L+P DPY RA ARFW  +IDNK         K+KG
Sbjct  62   NGRPVCESLVILEYIDEVWADR-AQLMPSDPYRRAQARFWADYIDNKVINGGVMIGKTKG  120

Query  398  EAKQEAQKELINELKQL-EQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEE  222
            E K++A+ E I  LK L EQ LGD  +FGG++FGF DV  + +   F+  E  G FK+EE
Sbjct  121  EEKEKAKAEFIGALKVLEEQALGDAPFFGGDEFGFLDVVLVAYYCWFHAIEVEGNFKVEE  180

Query  221  ECPKLLAWVKRCMERSSVSKILPDSVKMY  135
             CPK+ AW + CM+R +V+K LPD  +++
Sbjct  181  SCPKICAWGRPCMQRDNVAKSLPDPQRIH  209



>gb|AAB38965.1| auxin-induced protein [Eucalyptus globulus]
Length=220

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 144/206 (70%), Gaps = 2/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR +IAL EKG+ +  +EE+L +  +S L+L+MNPV K +P+L+H G+
Sbjct  5    VILLDFWPSPFGMRAKIALREKGVHFDLREEELLS-NKSPLLLQMNPVHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+TW    PLL P +P+ERA ARFW  ++D K FP      +S GEA+
Sbjct  64   PVCESHIIVQYIDETWGPESPLL-PSEPHERARARFWADYVDKKIFPAGRAAWRSTGEAQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGD  YFGGE+FGF DV+ IPF S FY  E+      EEECPK
Sbjct  123  EAAKKEYIEGLKMLEGELGDTPYFGGERFGFLDVSLIPFYSWFYAVETLTGCSFEEECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRCM+R SV++ LPD  K+Y+
Sbjct  183  LVGWAKRCMQRESVARSLPDQHKVYD  208



>emb|CDX81807.1| BnaC08g37940D [Brassica napus]
Length=218

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 143/207 (69%), Gaps = 4/207 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ +GMR RIALEEK + Y Y+E+DL N  +S L+LEMNPV K +P+LVH G+
Sbjct  5    VVLLDFWASVYGMRTRIALEEKKVKYDYREQDLLN--KSALLLEMNPVHKKIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  +EYID+TW    PLL P DPYERA A+FW  FID K   T      +K E +
Sbjct  63   PVCESLIQIEYIDETWPGENPLL-PSDPYERAQAKFWADFIDKKMSVTAKRVWATKSE-E  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            QEA KELI  LK LE  LG+K YFGG+ FGF D+A I F S F  YE +G   +E EC K
Sbjct  121  QEASKELIEILKTLESELGEKHYFGGKTFGFVDIALIGFYSWFGVYEKYGNVSIESECSK  180

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+AW KRC++R SV+K LP+  K+  L
Sbjct  181  LIAWAKRCLQRDSVTKTLPELEKLIAL  207



>ref|XP_010060810.1| PREDICTED: probable glutathione S-transferase isoform X1 [Eucalyptus 
grandis]
 gb|KCW67683.1| hypothetical protein EUGRSUZ_F01427 [Eucalyptus grandis]
Length=219

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V + DFW++ FGMR RIAL EKG+ Y+YKEEDL   ++S L+L+MNP+ K +P+LVH G+
Sbjct  5    VILQDFWSSMFGMRCRIALAEKGVKYEYKEEDLR--KKSDLLLQMNPIHKKIPVLVHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+ IL+YID+TW D   LL P DPY+RA ARFW  +   KF         +KGE +
Sbjct  63   PVCESLIILQYIDETWPDKCSLL-PSDPYQRAQARFWADYFYKKFSDLGRKICTTKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KELI+ LK LE  LGDK +FGGEK G  D+A +PF + F  YE+ G F +E ECP 
Sbjct  122  EVAKKELIDSLKLLEGELGDKPFFGGEKLGLVDLAIVPFYTYFLAYETCGNFSIEVECPN  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMY  135
             +AW KRC+E  SVSK L D  K+Y
Sbjct  182  FIAWTKRCLEIESVSKSLADPQKVY  206



>ref|XP_004251828.1| PREDICTED: probable glutathione S-transferase parC [Solanum lycopersicum]
Length=219

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++  + + FGMR+RIAL EKGI Y+YKEEDL+N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VVLLSAYVSMFGMRVRIALHEKGIQYEYKEEDLSN--KSELLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I+EYID+ WKD  PL+ P +PY+RA ARFW  FID K + +      +KGE +
Sbjct  63   PICESLIIVEYIDEVWKDKSPLM-PFNPYKRAQARFWADFIDKKVYDSGKRIWATKGEDQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I  LK LE  LGDK+YF GE FGF D+A IPF S F  +E  G F +E+ECPK
Sbjct  122  EAAKKEFIEYLKLLEGELGDKTYFNGENFGFVDLALIPFYSWFPTFEKFGNFNIEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
             +AW  +C+ + SVSK L +S K+YE
Sbjct  182  FVAWANKCIYKDSVSKSLAESNKVYE  207



>ref|XP_010044071.1| PREDICTED: glutathione S-transferase U19-like [Eucalyptus grandis]
 gb|KCW86074.1| hypothetical protein EUGRSUZ_B02777 [Eucalyptus grandis]
Length=220

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 144/207 (70%), Gaps = 2/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIAL EKG+ +  +EE+L +  +S L+L+MNPV K +PIL+H G+
Sbjct  5    VILLDFWPSPFGMRTRIALREKGVHFDQREEELLS-NKSPLLLQMNPVHKKIPILIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S  I++YID+TW    PLL P DP+ERA ARFW  ++DNK FP       S GEA+
Sbjct  64   PICESHIIVQYIDETWGPESPLL-PSDPHERARARFWADYVDNKIFPAGLMVWWSTGEAQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +  + + I  LK LE  LGDK+YFGGE+FGF DV+ +PF   FY  E+     +E+ECPK
Sbjct  123  EAGKNDFIEGLKLLEGELGDKAYFGGERFGFVDVSLMPFYCWFYAVETFTSCSIEDECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W KRCM+R SV+K LPD  K+Y+ 
Sbjct  183  LVGWAKRCMQRESVAKSLPDQHKVYDF  209



>ref|XP_006389991.1| hypothetical protein EUTSA_v10019118mg [Eutrema salsugineum]
 gb|ESQ27277.1| hypothetical protein EUTSA_v10019118mg [Eutrema salsugineum]
Length=219

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR RIAL EKG+ ++Y+EEDL N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VILLDFWPSMFGMRTRIALREKGVEFEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S   ++YID+ W    P+L P DPY+RA ARFW  FID K +  Q     +KGE +
Sbjct  63   PVCESSIQVQYIDEVWSHKNPIL-PSDPYQRAQARFWVDFIDKKMYDAQRKVWATKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + ++KE I  LK LE  LGDK YFGG+ FG+ D+  I F + F  YE  G F +E ECPK
Sbjct  122  EASKKEFIELLKTLESELGDKPYFGGDDFGYVDIGLIGFYTWFGAYEKFGNFSIESECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W KRC++R SV+K LP+S K+ E 
Sbjct  182  LIGWAKRCLQRESVAKSLPESEKVTEF  208



>ref|XP_004510706.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=219

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            + ++D W + FGMR RIAL EK I Y+YKEEDL N  +S ++L+MNP+ K +P+L+H+G+
Sbjct  5    LILLDEWLSMFGMRARIALAEKEINYEYKEEDLMN--KSQMLLQMNPIHKKIPVLIHKGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I+EYID+ WKD  PLL P DPY++A ARFW  F++ K           K +  
Sbjct  63   PICESIIIVEYIDEVWKDRVPLL-PSDPYQKAQARFWADFVNKKVGDVGGRIWSKKRDEI  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+ ELI  LK+LE VLGDK YFGG+ FGF D+A IPF + FY YE  G FK+E EC K
Sbjct  122  EGAKNELIEGLKELENVLGDKPYFGGDTFGFVDIALIPFYNWFYTYEKLGNFKVEAECAK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            L+ W KRC+ R SVSK + D   +YE
Sbjct  182  LIVWAKRCIHRESVSKSVADEKDIYE  207



>gb|KHN22772.1| Putative glutathione S-transferase parA [Glycine soja]
Length=221

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 143/207 (69%), Gaps = 2/207 (1%)
 Frame = -2

Query  755  GGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHE  576
              V ++DFW + +GMR++IAL EKGI+Y+ K+EDL    RS L+LEMNPV K +P+L+H 
Sbjct  4    ANVVLLDFWPSSYGMRVKIALAEKGISYECKQEDLE--ARSSLLLEMNPVHKMIPVLIHN  61

Query  575  GRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGE  396
            G+P+C+S+ I++YID+TW      LLP DPY+R+ ARFW  +ID   +         KG+
Sbjct  62   GKPICESLNIVQYIDETWNHKPSSLLPSDPYKRSQARFWGDYIDKNVYNAVKRVWTGKGK  121

Query  395  AKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEEC  216
             ++E +K+ I  LK LE  LGDK YFGGE FG+ DV  +PF+S FY  E+ GK  +E+EC
Sbjct  122  EQEEFKKQFIQCLKTLEYELGDKPYFGGEDFGYVDVDLVPFTSWFYTVETCGKLSIEKEC  181

Query  215  PKLLAWVKRCMERSSVSKILPDSVKMY  135
            PKL+AW KRCME+ SV+  LP   ++Y
Sbjct  182  PKLMAWAKRCMEKESVATSLPHPHQIY  208



>ref|XP_007213483.1| hypothetical protein PRUPE_ppa023395mg [Prunus persica]
 gb|EMJ14682.1| hypothetical protein PRUPE_ppa023395mg [Prunus persica]
Length=220

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 144/207 (70%), Gaps = 2/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW + FGMR+R+AL EKG+ Y+ +EEDL    +S L+L+MNP  K +P+L+H G+
Sbjct  5    VVLLDFWPSMFGMRVRVALAEKGVKYESREEDLLY-NKSPLLLQMNPFHKKIPVLIHNGK  63

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S  I++YID+ WKD  PLL P DPY+RA ARFW  +ID   +        +KG+ +
Sbjct  64   PVCESANIVQYIDEAWKDKAPLL-PSDPYQRAQARFWVSYIDKNLYEAGKNIWATKGKEQ  122

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+K+LI  LK LE  LGD +YFGGE FGF DVA + F S F+ YE+ G F +E ECPK
Sbjct  123  EAAKKKLIEILKLLEGQLGDNTYFGGEIFGFLDVALVTFYSWFFSYETCGNFSIEAECPK  182

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
            L+ W KRCM++ SV+K + +  K+YE 
Sbjct  183  LIEWAKRCMQKESVAKSVAEPKKVYEF  209



>gb|KEH38385.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=217

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 145/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++D+W + FGMR+RIAL EKGI Y+Y+EEDL+N  +S L+L+MNP+ K +P+L+H G+
Sbjct  5    VILLDYWVSPFGMRVRIALAEKGIKYEYREEDLSN--KSPLLLQMNPIHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
             +C+S+  ++YID+ W +   LL P DPY+R+ ARFW  ++D K F         KGE +
Sbjct  63   SICESLMAVQYIDEVWNEKSSLL-PSDPYQRSQARFWADYVDKKIFDVGRNLWAKKGEEQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            + A+KE I   K LE  LGDK+YFGG+K GF DVA IP+ + F  YE+ G   LE+ECPK
Sbjct  122  EAAKKEFIEVHKLLELELGDKTYFGGDKLGFVDVALIPYYTWFKSYETFGNISLEKECPK  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYEL  129
             +AW K+CM+  SVSK LPD  K+++L
Sbjct  182  FIAWAKKCMQIESVSKSLPDQDKVHDL  208



>ref|NP_001105112.1| glutathione transferase6 [Zea mays]
 emb|CAB38120.1| GST6 protein [Zea mays]
Length=222

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 142/211 (67%), Gaps = 2/211 (1%)
 Frame = -2

Query  764  TCGGGVAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPIL  585
                 V ++DFW + FG R RIAL EKG+AY+Y+E+DL +  +  L+L  NP+ K +P+L
Sbjct  2    AAAAEVVLLDFWVSPFGQRCRIALAEKGVAYEYREQDLLD--KGELLLRSNPIHKKIPVL  59

Query  584  VHEGRPVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKS  405
            +H GRPVC+S+ IL+YID+ W D  PLL  +DPY RA ARFW  +ID K + +Q    K 
Sbjct  60   LHAGRPVCESLVILQYIDEAWPDVAPLLPKDDPYARAQARFWADYIDKKIYDSQTRLWKF  119

Query  404  KGEAKQEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLE  225
            +GEA+++A+K+L+  L+ LE  L DK +FGG   GF DVA +PF+S F  YE  G F ++
Sbjct  120  EGEAREQAKKDLVEVLETLEGELADKPFFGGGALGFVDVALVPFTSWFLAYEKLGGFSVQ  179

Query  224  EECPKLLAWVKRCMERSSVSKILPDSVKMYE  132
            E CP+++AW  RC ER SV+K + D  K+ E
Sbjct  180  EHCPRIVAWAARCRERESVAKAMSDPAKVLE  210



>ref|XP_010498063.1| PREDICTED: glutathione S-transferase U24-like [Camelina sativa]
Length=221

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR RIAL EKG+ Y Y+E+DL N  +S L+L+MNPV K +P+L+H G+
Sbjct  7    VILLDFWASMFGMRTRIALAEKGVKYDYREQDLWN--KSSLLLQMNPVHKKIPVLIHHGK  64

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  L+YID+TW      LLP DPY+RA A+FW  FID K          +KGEA 
Sbjct  65   PVCESLFQLQYIDETWPGNKYSLLPSDPYKRALAKFWADFIDKKVNVAARRIWATKGEA-  123

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            QEA KEL+  LK LE  LGDK YFG + FG+ D+A I F S F  Y+ +G   +E ECPK
Sbjct  124  QEASKELLEILKTLESELGDKDYFGDQTFGYVDIALIGFYSWFGVYDKYGNINIESECPK  183

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L+AW KRC++R SV+K LP+S K+
Sbjct  184  LIAWAKRCLQRESVAKALPESEKV  207



>gb|ADB11353.1| tau class glutathione transferase GSTU17 [Populus trichocarpa]
Length=219

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 145/206 (70%), Gaps = 3/206 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFW++ + +R+++AL EKGI Y+ +E++L +  +S L+LEMNPV K +P+L+H G+
Sbjct  5    VTLLDFWSSSWAVRVKVALAEKGIEYESREQNLID--KSSLLLEMNPVHKMIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+ I++YID+ WKD  PLL P DPY+R+ ARFW  +ID K +       K KGE +
Sbjct  63   PICESLNIVQYIDEVWKDKSPLL-PSDPYQRSQARFWADYIDKKIYNNAKKLWKEKGEKQ  121

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +E ++E I  LK LE  LGDK YFGGE FGF DV  +P +S FY  E  GKF +E E P 
Sbjct  122  EEVKREFIEGLKTLEGELGDKLYFGGESFGFVDVVLVPVTSWFYSLEICGKFSIEAEFPM  181

Query  209  LLAWVKRCMERSSVSKILPDSVKMYE  132
            + AW+KRCME+ SVS  LPD  K+Y+
Sbjct  182  IAAWIKRCMEKESVSSSLPDPHKIYD  207



>ref|XP_002890207.1| hypothetical protein ARALYDRAFT_471920 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66466.1| hypothetical protein ARALYDRAFT_471920 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ FGMR+RIAL EK + Y Y+EEDL +  +S L+LEMNPV K +P+L+H G+
Sbjct  5    VILLDFWASMFGMRIRIALSEKRVKYDYREEDLWD--KSSLLLEMNPVHKKIPVLIHNGK  62

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            PVC+S+  +EYID+TW D  PLL P DPY+RA A+FW  FID K   T      +KGE +
Sbjct  63   PVCESLIQIEYIDETWPDKNPLL-PSDPYKRAHAKFWADFIDKKVNVTARRIWAAKGE-E  120

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            QEA KE I  LK LE  LGDK YFG E FG+ D+A I F S F  YE  G   +E EC K
Sbjct  121  QEAAKEFIEILKTLESELGDKKYFGDETFGYVDIALIGFYSWFGVYEKFGNISIESECSK  180

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L+AW KRC+ER SV+K LP+S K+
Sbjct  181  LIAWAKRCLERESVAKALPESEKV  204



>ref|XP_006303293.1| hypothetical protein CARUB_v10010098mg [Capsella rubella]
 gb|EOA36191.1| hypothetical protein CARUB_v10010098mg [Capsella rubella]
Length=251

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = -2

Query  749  VAVIDFWANGFGMRMRIALEEKGIAYQYKEEDLNNPQRSHLVLEMNPVRKSVPILVHEGR  570
            V ++DFWA+ +GMR RIAL EK + Y Y+EEDL N  +S L+L+MNPV K +P+L+H G+
Sbjct  37   VILLDFWASMYGMRTRIALAEKRVKYHYREEDLWN--KSSLLLQMNPVHKKIPVLIHNGK  94

Query  569  PVCDSVAILEYIDDTWKDGFPLLLPEDPYERATARFWTHFIDNKFFPTQATFLKSKGEAK  390
            P+C+S+  LEYID+TW +  PLL P DPY+RA A+FW   ID K          +KGE K
Sbjct  95   PLCESLFQLEYIDETWPEENPLL-PSDPYKRARAKFWADIIDKKVNVAGRRIWTTKGEEK  153

Query  389  QEAQKELINELKQLEQVLGDKSYFGGEKFGFFDVAFIPFSSMFYGYESHGKFKLEEECPK  210
            +EA KELI  LK LE  LGDK YFG E FG+ D+A I F S F  Y+ +G   +E ECPK
Sbjct  154  EEASKELIEILKTLESELGDKDYFGEETFGYVDIALIGFYSWFGVYDKYGNINIESECPK  213

Query  209  LLAWVKRCMERSSVSKILPDSVKM  138
            L+AW KRC++R SV+K LP+S K+
Sbjct  214  LIAWAKRCLQRESVAKALPESEKI  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1749734148162