BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86912_g1_i1 len=1614 path=[1592:0-1613]

Length=1614
                                                                      Score     E

ref|XP_006348710.1|  PREDICTED: uncharacterized protein LOC102602723    282   4e-84   
emb|CDP00414.1|  unnamed protein product                                281   2e-83   
ref|XP_009775816.1|  PREDICTED: zinc finger protein ZAT4-like           270   1e-79   
ref|XP_009598345.1|  PREDICTED: uncharacterized protein LOC104094174    269   3e-79   
ref|XP_004239066.2|  PREDICTED: uncharacterized protein LOC101247524    268   8e-79   
ref|XP_004237053.1|  PREDICTED: uncharacterized protein LOC101251273    260   2e-75   
dbj|BAA19926.1|  PEThy; ZPT4-2                                          256   5e-74   Petunia x hybrida [garden petunia]
ref|XP_009631793.1|  PREDICTED: uncharacterized protein LOC104121...    255   1e-73   
ref|XP_006344247.1|  PREDICTED: uncharacterized protein LOC102585908    256   1e-73   
ref|XP_009631802.1|  PREDICTED: uncharacterized protein LOC104121...    253   5e-73   
ref|XP_011070953.1|  PREDICTED: zinc finger protein 91-like             253   8e-73   
ref|XP_009791314.1|  PREDICTED: uncharacterized protein LOC104238609    251   7e-72   
ref|XP_011075585.1|  PREDICTED: uncharacterized protein LOC105160026    249   2e-71   
ref|XP_009590895.1|  PREDICTED: uncharacterized protein LOC104087998    246   2e-70   
dbj|BAA20137.1|  ZPT4-3                                                 243   3e-69   Petunia x hybrida [garden petunia]
ref|XP_009761680.1|  PREDICTED: zinc finger protein 655-like            239   7e-68   
ref|XP_004228405.1|  PREDICTED: zinc finger protein 91-like             240   7e-68   
ref|XP_006365137.1|  PREDICTED: uncharacterized protein LOC102597521    228   2e-63   
gb|EYU28846.1|  hypothetical protein MIMGU_mgv1a024011mg                187   8e-49   
ref|XP_007227675.1|  hypothetical protein PRUPE_ppa025764mg             182   8e-47   
ref|XP_008221523.1|  PREDICTED: uncharacterized protein LOC103321496    182   1e-46   
ref|XP_008389420.1|  PREDICTED: uncharacterized protein LOC103451771    176   2e-44   
ref|XP_009356378.1|  PREDICTED: uncharacterized protein LOC103947235    176   2e-44   
ref|XP_007045914.1|  C2H2-like zinc finger protein, putative            175   3e-44   
gb|EYU22378.1|  hypothetical protein MIMGU_mgv1a018487mg                169   1e-42   
ref|XP_002274495.1|  PREDICTED: uncharacterized protein LOC100245765    169   2e-42   Vitis vinifera
emb|CAN60166.1|  hypothetical protein VITISV_040088                     167   1e-41   Vitis vinifera
ref|XP_004298386.1|  PREDICTED: uncharacterized protein LOC101291428    167   2e-41   
ref|XP_010259244.1|  PREDICTED: uncharacterized protein LOC104598750    162   1e-39   
ref|XP_010258119.1|  PREDICTED: uncharacterized protein LOC104597985    159   1e-38   
ref|XP_008339829.1|  PREDICTED: uncharacterized protein LOC103402838    156   8e-38   
ref|XP_010109363.1|  Zinc finger protein ZAT4                           152   1e-36   
ref|XP_002316093.2|  hypothetical protein POPTR_0010s16710g             150   6e-36   Populus trichocarpa [western balsam poplar]
ref|XP_006483052.1|  PREDICTED: uncharacterized protein DDB_G0271...    150   7e-36   
gb|KDO83101.1|  hypothetical protein CISIN_1g041528mg                   150   7e-36   
ref|XP_006438809.1|  hypothetical protein CICLE_v10031223mg             150   8e-36   
ref|XP_011018421.1|  PREDICTED: uncharacterized protein LOC105121467    147   7e-35   
ref|XP_002311333.2|  zinc finger family protein                         145   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002512106.1|  hypothetical protein RCOM_1621120                  145   3e-34   Ricinus communis
ref|XP_011012172.1|  PREDICTED: uncharacterized protein LOC105116480    143   9e-34   
ref|XP_002514689.1|  hypothetical protein RCOM_1470470                  142   4e-33   Ricinus communis
ref|XP_007037499.1|  C2H2-like zinc finger protein, putative            138   7e-32   
ref|XP_002281438.2|  PREDICTED: zinc finger protein ZAT4-like           137   2e-31   Vitis vinifera
gb|KDP41283.1|  hypothetical protein JCGZ_15690                         136   2e-31   
ref|XP_010680727.1|  PREDICTED: probable serine/threonine-protein...    130   4e-29   
ref|XP_010106656.1|  Zinc finger protein ZAT4                           128   1e-28   
ref|XP_010532588.1|  PREDICTED: uncharacterized protein LOC104808577    120   5e-26   
gb|KDP31317.1|  hypothetical protein JCGZ_11693                         120   1e-25   
ref|XP_007210777.1|  hypothetical protein PRUPE_ppa019308mg             117   8e-25   
ref|XP_002893392.1|  zinc finger family protein                         116   8e-25   
ref|XP_010527736.1|  PREDICTED: uncharacterized protein LOC104805...    111   2e-23   
ref|XP_010552554.1|  PREDICTED: zinc finger protein ZAT4-like iso...    110   3e-23   
ref|NP_173983.1|  C2H2-like zinc finger protein                         111   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527735.1|  PREDICTED: uncharacterized protein LOC104805...    110   9e-23   
ref|XP_010552553.1|  PREDICTED: zinc finger protein ZAT4-like iso...    109   2e-22   
ref|XP_010499021.1|  PREDICTED: uncharacterized protein LOC104776622    105   8e-21   
ref|XP_010477841.1|  PREDICTED: uncharacterized protein LOC104756882    104   1e-20   
gb|KGN64038.1|  hypothetical protein Csa_1G039050                       104   2e-20   
ref|XP_010904961.1|  PREDICTED: zinc finger protein ZAT9-like           104   2e-20   
emb|CDP18404.1|  unnamed protein product                                103   3e-20   
ref|XP_010936336.1|  PREDICTED: zinc finger protein ZAT1-like           102   8e-20   
ref|XP_006306284.1|  hypothetical protein CARUB_v10012148mg             102   8e-20   
gb|EPS71098.1|  hypothetical protein M569_03665                         100   2e-19   
ref|XP_007155253.1|  hypothetical protein PHAVU_003G186100g             101   3e-19   
ref|XP_008805104.1|  PREDICTED: zinc finger protein ZAT1-like           100   4e-19   
ref|XP_010462889.1|  PREDICTED: uncharacterized protein LOC104743517    100   6e-19   
ref|XP_006440700.1|  hypothetical protein CICLE_v10019977mg           99.4    7e-19   
gb|EPS61299.1|  hypothetical protein M569_13499                       92.8    2e-18   
ref|XP_006600569.1|  PREDICTED: zinc finger protein ZAT4-like iso...  97.8    4e-18   
gb|KDO54593.1|  hypothetical protein CISIN_1g038961mg                 97.1    4e-18   
ref|XP_008356637.1|  PREDICTED: uncharacterized protein LOC103420355  97.1    5e-18   
ref|XP_006477628.1|  PREDICTED: zinc finger protein ZAT4-like         96.7    5e-18   
ref|XP_004490147.1|  PREDICTED: UPF0396 protein-like                  96.3    1e-17   
ref|XP_004508691.1|  PREDICTED: uncharacterized protein LOC101491614  95.5    2e-17   
ref|XP_009339147.1|  PREDICTED: zinc finger protein ZAT4-like         95.1    2e-17   
ref|XP_006579519.1|  PREDICTED: uncharacterized protein LOC102669916  95.5    2e-17   
ref|XP_009338601.1|  PREDICTED: zinc finger protein ZAT9-like         93.6    8e-17   
ref|XP_007157592.1|  hypothetical protein PHAVU_002G082200g           93.6    8e-17   
ref|XP_009801846.1|  PREDICTED: zinc finger protein ZAT9-like         92.4    1e-16   
ref|XP_009623743.1|  PREDICTED: zinc finger protein ZAT9-like         92.4    2e-16   
gb|AHN52235.1|  C2H2-type zinc finger protein 4                       92.8    2e-16   
gb|KHN48727.1|  Zinc finger protein ZAT4                              92.4    2e-16   
ref|XP_011090203.1|  PREDICTED: zinc finger protein ZAT4-like         90.9    2e-16   
dbj|BAA21919.1|  ZPT2-10                                              89.0    3e-16   Petunia x hybrida [garden petunia]
ref|XP_008239874.1|  PREDICTED: zinc finger protein ZAT4-like         92.0    3e-16   
dbj|BAA21928.1|  ZPT4-4                                               91.3    3e-16   Petunia x hybrida [garden petunia]
ref|XP_010030507.1|  PREDICTED: zinc finger protein ZAT9-like         90.9    5e-16   
ref|XP_008786152.1|  PREDICTED: uncharacterized protein LOC103704576  90.9    6e-16   
ref|XP_006415937.1|  hypothetical protein EUTSA_v10009600mg           90.1    6e-16   
ref|XP_008393205.1|  PREDICTED: uncharacterized protein LOC103455400  89.7    1e-15   
emb|CAN68959.1|  hypothetical protein VITISV_019273                   90.5    1e-15   Vitis vinifera
ref|XP_010661128.1|  PREDICTED: zinc finger protein 845-like          89.7    1e-15   
ref|XP_004236489.1|  PREDICTED: zinc finger protein ZAT1-like         89.4    1e-15   
ref|XP_009395200.1|  PREDICTED: zinc finger protein ZAT4-like         89.0    2e-15   
emb|CBI27269.3|  unnamed protein product                              89.4    2e-15   
ref|XP_009595361.1|  PREDICTED: zinc finger protein ZAT4-like         88.2    3e-15   
ref|XP_006345158.1|  PREDICTED: zinc finger protein ZAT9-like         87.8    4e-15   
gb|KEH31995.1|  C2H2-type zinc finger protein                         87.8    5e-15   
ref|XP_009400680.1|  PREDICTED: zinc finger protein ZAT9-like         85.9    7e-15   
ref|XP_011093296.1|  PREDICTED: uncharacterized protein LOC105173302  87.0    8e-15   
ref|XP_008775635.1|  PREDICTED: uncharacterized protein LOC103695954  87.8    8e-15   
ref|XP_008344613.1|  PREDICTED: zinc finger protein ZAT1-like         86.7    1e-14   
gb|KHN03635.1|  Zinc finger protein ZAT9                              86.3    1e-14   
ref|XP_010939263.1|  PREDICTED: zinc finger protein ZAT1-like         86.3    2e-14   
ref|XP_010919569.1|  PREDICTED: zinc finger protein ZAT9-like         86.3    2e-14   
ref|XP_009350429.1|  PREDICTED: uncharacterized protein LOC103941954  85.9    2e-14   
ref|XP_004231156.1|  PREDICTED: zinc finger protein ZAT4-like         85.9    2e-14   
ref|XP_006582555.1|  PREDICTED: probable cyclin-dependent serine/...  85.9    2e-14   
ref|XP_006348001.1|  PREDICTED: zinc finger protein ZAT4-like         85.9    2e-14   
gb|KDP28801.1|  hypothetical protein JCGZ_14572                       84.3    2e-14   
ref|XP_003517826.2|  PREDICTED: uncharacterized protein LOC100805520  85.9    2e-14   
ref|XP_010923648.1|  PREDICTED: zinc finger protein ZAT4              85.5    3e-14   
ref|XP_009350427.1|  PREDICTED: zinc finger protein ZAT1-like         85.1    3e-14   
ref|XP_008232569.1|  PREDICTED: zinc finger protein ZAT9-like         85.1    3e-14   
emb|CDP09474.1|  unnamed protein product                              85.1    4e-14   
ref|XP_007219076.1|  hypothetical protein PRUPE_ppa014890mg           84.7    4e-14   
ref|XP_004301124.1|  PREDICTED: uncharacterized protein LOC101302461  84.7    4e-14   
ref|XP_009761173.1|  PREDICTED: zinc finger protein ZAT1-like         84.3    5e-14   
ref|XP_009785654.1|  PREDICTED: zinc finger protein ZAT4-like         84.3    5e-14   
ref|XP_008375807.1|  PREDICTED: zinc finger protein ZAT9-like         84.3    5e-14   
ref|XP_011072829.1|  PREDICTED: zinc finger protein ZAT4-like         84.3    6e-14   
ref|XP_008796146.1|  PREDICTED: zinc finger protein ZAT4-like         84.3    6e-14   
ref|XP_011033858.1|  PREDICTED: zinc finger protein ZAT9-like         84.0    7e-14   
gb|KDP28802.1|  hypothetical protein JCGZ_14573                       84.0    8e-14   
ref|XP_002301264.1|  zinc finger family protein                       82.4    8e-14   Populus trichocarpa [western balsam poplar]
gb|EYU31947.1|  hypothetical protein MIMGU_mgv1a021269mg              81.6    1e-13   
ref|XP_001780762.1|  predicted protein                                84.3    1e-13   
ref|XP_011017453.1|  PREDICTED: zinc finger protein ZAT4-like         83.6    1e-13   
ref|XP_010934138.1|  PREDICTED: zinc finger protein ZAT4-like         83.6    1e-13   
ref|XP_007219458.1|  hypothetical protein PRUPE_ppa021208mg           82.8    1e-13   
ref|XP_007134733.1|  hypothetical protein PHAVU_010G071300g           81.6    1e-13   
emb|CDY41155.1|  BnaA09g38600D                                        80.9    1e-13   
ref|XP_010919568.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  82.4    1e-13   
ref|XP_002540465.1|  conserved hypothetical protein                   80.1    2e-13   Ricinus communis
ref|XP_009594478.1|  PREDICTED: zinc finger protein ZAT4-like         82.8    2e-13   
ref|XP_010258927.1|  PREDICTED: zinc finger protein ZAT1-like         81.3    2e-13   
ref|XP_004308477.1|  PREDICTED: uncharacterized protein LOC101307639  82.8    2e-13   
ref|XP_010264307.1|  PREDICTED: zinc finger protein ZAT4-like         82.4    2e-13   
ref|XP_008448369.1|  PREDICTED: zinc finger protein ZAT9-like         82.4    2e-13   
ref|XP_007157656.1|  hypothetical protein PHAVU_002G087500g           82.4    3e-13   
ref|XP_004133770.1|  PREDICTED: zinc finger protein ZAT9-like         80.1    4e-13   
ref|XP_010089243.1|  Zinc finger protein ZAT3                         82.0    4e-13   
ref|XP_006837069.1|  hypothetical protein AMTR_s00110p00085760        82.4    4e-13   
ref|XP_003520110.2|  PREDICTED: uncharacterized protein DDB_G0286...  82.0    4e-13   
ref|XP_009405969.1|  PREDICTED: zinc finger protein ZAT4-like         80.1    4e-13   
ref|XP_011017454.1|  PREDICTED: zinc finger protein ZAT4-like         80.9    4e-13   
ref|XP_007134731.1|  hypothetical protein PHAVU_010G071100g           81.6    4e-13   
ref|XP_008375818.1|  PREDICTED: zinc finger protein ZAT9-like         80.9    4e-13   
gb|KHN30002.1|  Zinc finger protein ZAT1                              81.6    4e-13   
ref|XP_002511650.1|  conserved hypothetical protein                   81.6    5e-13   Ricinus communis
gb|KEH16508.1|  C2H2-type zinc finger protein, putative               80.5    5e-13   
ref|XP_008787063.1|  PREDICTED: zinc finger protein ZAT9-like         80.5    5e-13   
ref|XP_008437783.1|  PREDICTED: zinc finger protein ZAT9              80.5    5e-13   
gb|KGN56354.1|  hypothetical protein Csa_3G117400                     80.5    6e-13   
ref|XP_011090189.1|  PREDICTED: uncharacterized protein LOC105170939  81.3    6e-13   
ref|XP_011090067.1|  PREDICTED: zinc finger protein ZAT4-like         81.3    6e-13   
ref|XP_006445329.1|  hypothetical protein CICLE_v10024047mg           80.9    7e-13   
ref|XP_008796144.1|  PREDICTED: zinc finger protein ZAT4-like         80.1    7e-13   
ref|XP_009804983.1|  PREDICTED: zinc finger protein ZAT9-like         79.3    9e-13   
ref|XP_006345608.1|  PREDICTED: zinc finger protein ZAT4-like         80.5    9e-13   
ref|XP_002301263.1|  zinc finger family protein                       80.5    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009385228.1|  PREDICTED: zinc finger protein ZAT1-like         80.5    1e-12   
ref|XP_004240265.1|  PREDICTED: zinc finger protein ZAT4-like         80.5    1e-12   
ref|XP_010678415.1|  PREDICTED: uncharacterized protein LOC104893969  80.5    1e-12   
ref|XP_004986893.1|  PREDICTED: zinc finger protein ZAT4-like         79.7    1e-12   
emb|CBI16587.3|  unnamed protein product                              79.3    1e-12   
gb|AAY40249.1|  Cys2/His2 zinc-finger transcription factor            78.2    2e-12   Silene latifolia
ref|XP_004306958.1|  PREDICTED: zinc finger protein ZAT9-like         79.3    2e-12   
ref|XP_003559736.2|  PREDICTED: zinc finger protein ZAT5-like         79.0    2e-12   
ref|XP_010264306.1|  PREDICTED: zinc finger protein ZAT1-like         78.6    2e-12   
ref|XP_004504528.1|  PREDICTED: zinc finger protein ZAT4-like         79.7    2e-12   
ref|XP_008344330.1|  PREDICTED: zinc finger protein ZAT9-like         79.0    2e-12   
ref|XP_007052173.1|  C2H2-like zinc finger protein, putative          79.7    2e-12   
ref|XP_009116736.1|  PREDICTED: zinc finger protein ZAT9-like         77.8    2e-12   
ref|XP_006578555.1|  PREDICTED: probable cyclin-dependent serine/...  79.3    3e-12   
gb|KDO85696.1|  hypothetical protein CISIN_1g044606mg                 78.6    3e-12   
gb|KCW78319.1|  hypothetical protein EUGRSUZ_D02498                   79.3    3e-12   
ref|XP_009624701.1|  PREDICTED: zinc finger protein ZAT9-like         77.8    3e-12   
ref|XP_009416826.1|  PREDICTED: zinc finger protein ZAT3-like         78.6    3e-12   
ref|XP_006445328.1|  hypothetical protein CICLE_v10020499mg           78.6    3e-12   
ref|XP_009412857.1|  PREDICTED: zinc finger protein ZAT4-like         79.0    3e-12   
gb|KHN24637.1|  Zinc finger protein ZAT4                              76.3    3e-12   
ref|XP_011033847.1|  PREDICTED: zinc finger protein ZAT9-like iso...  78.2    4e-12   
ref|XP_006291511.1|  hypothetical protein CARUB_v10017660mg           77.0    4e-12   
ref|XP_010053941.1|  PREDICTED: zinc finger protein ZAT9              78.2    4e-12   
ref|XP_010053943.1|  PREDICTED: zinc finger protein ZAT4-like         78.6    4e-12   
ref|XP_003605324.1|  Zinc finger protein                              78.6    4e-12   
ref|XP_011033839.1|  PREDICTED: zinc finger protein ZAT9-like iso...  78.2    4e-12   
gb|AES87521.2|  Cys2/His2 zinc-finger transcription factor            78.6    5e-12   
ref|XP_010258926.1|  PREDICTED: zinc finger protein ZAT9-like         78.6    5e-12   
emb|CDX71799.1|  BnaC08g30750D                                        76.3    5e-12   
gb|KCW78318.1|  hypothetical protein EUGRSUZ_D02497                   77.8    5e-12   
ref|XP_004506485.1|  PREDICTED: zinc finger protein ZAT9-like         77.0    5e-12   
ref|XP_009402052.1|  PREDICTED: zinc finger protein ZAT1-like         78.2    5e-12   
emb|CDP02295.1|  unnamed protein product                              79.0    5e-12   
gb|KHN23998.1|  Zinc finger protein ZAT4                              78.2    6e-12   
gb|EPS74461.1|  hypothetical protein M569_00297                       75.1    6e-12   
ref|XP_006347910.1|  PREDICTED: zinc finger protein ZAT9-like         76.6    7e-12   
ref|XP_009345136.1|  PREDICTED: zinc finger protein ZAT9-like         77.0    7e-12   
ref|XP_002320706.2|  zinc finger family protein                       76.3    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006652617.1|  PREDICTED: uncharacterized protein LOC102714091  77.8    8e-12   
ref|XP_010512387.1|  PREDICTED: zinc finger protein ZAT9-like         76.3    8e-12   
ref|XP_002278612.1|  PREDICTED: zinc finger protein ZAT9              77.4    8e-12   Vitis vinifera
ref|XP_001779240.1|  predicted protein                                74.3    9e-12   
ref|XP_002320707.1|  zinc finger family protein                       77.0    1e-11   Populus trichocarpa [western balsam poplar]
gb|KEH29190.1|  Cys2/His2 zinc-finger transcription factor            76.6    1e-11   
gb|KHM99417.1|  Zinc finger protein ZAT3                              77.0    1e-11   
ref|XP_004494014.1|  PREDICTED: zinc finger protein ZAT4-like         76.3    1e-11   
gb|KGN56355.1|  hypothetical protein Csa_3G117410                     77.0    1e-11   
ref|XP_004134285.1|  PREDICTED: uncharacterized protein LOC101222211  77.0    2e-11   
ref|XP_010934955.1|  PREDICTED: zinc finger protein ZAT1-like         75.5    2e-11   
ref|XP_008437784.1|  PREDICTED: uncharacterized protein LOC103483116  76.6    2e-11   
ref|XP_008669045.1|  PREDICTED: zinc finger protein ZAT1-like         74.7    2e-11   
ref|XP_009385850.1|  PREDICTED: zinc finger protein ZAT1-like         75.1    2e-11   
ref|XP_010942825.1|  PREDICTED: zinc finger protein ZAT10-like        73.9    2e-11   
ref|XP_008453249.1|  PREDICTED: zinc finger protein ZAT1-like         76.3    2e-11   
ref|XP_002880157.1|  hypothetical protein ARALYDRAFT_483645           75.1    2e-11   
gb|KHM99419.1|  Zinc finger protein ZAT9                              75.5    2e-11   
ref|XP_002465113.1|  hypothetical protein SORBIDRAFT_01g032230        75.9    2e-11   Sorghum bicolor [broomcorn]
emb|CDP09473.1|  unnamed protein product                              75.1    2e-11   
ref|XP_003517016.1|  PREDICTED: zinc finger protein ZAT9-like         75.5    3e-11   
ref|XP_009140851.1|  PREDICTED: zinc finger protein ZAT5-like         74.3    3e-11   
gb|AFF57513.1|  Cys2/His2-type zinc finger protein                    73.6    3e-11   
ref|NP_001239999.1|  uncharacterized protein LOC100780611             75.5    3e-11   
gb|EYU25508.1|  hypothetical protein MIMGU_mgv1a012456mg              73.6    3e-11   
ref|XP_008787061.1|  PREDICTED: zinc finger protein ZAT9-like         75.9    3e-11   
dbj|BAM66957.1|  Zinc finger protein                                  73.6    3e-11   
ref|XP_007200542.1|  hypothetical protein PRUPE_ppa011687mg           72.8    3e-11   
ref|XP_003516436.1|  PREDICTED: zinc finger protein ZAT4-like         75.5    3e-11   
ref|XP_008232572.1|  PREDICTED: zinc finger protein ZAT9-like         75.1    4e-11   
ref|XP_006402568.1|  hypothetical protein EUTSA_v10006508mg           74.3    4e-11   
ref|XP_010044422.1|  PREDICTED: uncharacterized protein LOC104433394  75.5    4e-11   
gb|KCW86511.1|  hypothetical protein EUGRSUZ_B03164                   75.5    4e-11   
ref|XP_010325535.1|  PREDICTED: zinc finger protein ZAT9-like         74.7    4e-11   
ref|NP_001050407.1|  Os03g0425900                                     75.1    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010112022.1|  Zinc finger protein ZAT9                         75.1    4e-11   
ref|XP_008660066.1|  PREDICTED: zinc finger protein ZAT4-like         74.7    4e-11   
ref|XP_010933668.1|  PREDICTED: zinc finger protein ZAT9-like         74.7    4e-11   
ref|XP_010692450.1|  PREDICTED: uncharacterized protein LOC104905560  75.9    5e-11   
ref|XP_007140808.1|  hypothetical protein PHAVU_008G143900g           74.7    5e-11   
ref|XP_002324101.2|  hypothetical protein POPTR_0017s12740g           75.1    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009360635.1|  PREDICTED: zinc finger protein 90-like           75.1    5e-11   
ref|XP_011035855.1|  PREDICTED: uncharacterized protein LOC105133516  75.1    6e-11   
ref|XP_002511651.1|  zinc finger protein, putative                    72.8    6e-11   Ricinus communis
emb|CDY36493.1|  BnaC03g48520D                                        72.4    6e-11   
gb|EAZ27392.1|  hypothetical protein OsJ_11341                        74.3    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009110025.1|  PREDICTED: zinc finger protein ZAT9-like         74.7    6e-11   
ref|XP_009407610.1|  PREDICTED: zinc finger protein ZAT4-like         74.7    6e-11   
ref|XP_007052174.1|  C2H2-type zinc finger family protein             74.7    7e-11   
ref|XP_002526088.1|  zinc finger protein, putative                    75.1    7e-11   Ricinus communis
ref|XP_004976448.1|  PREDICTED: zinc finger protein ZAT1-like         73.6    7e-11   
ref|XP_001773376.1|  predicted protein                                71.6    8e-11   
gb|ACR36405.1|  unknown                                               71.6    8e-11   Zea mays [maize]
ref|XP_010469165.1|  PREDICTED: zinc finger protein ZAT9-like         73.2    9e-11   
gb|KFK39287.1|  hypothetical protein AALP_AA3G225100                  72.4    9e-11   
gb|EYU33552.1|  hypothetical protein MIMGU_mgv1a008943mg              73.6    1e-10   
emb|CDY11255.1|  BnaA03g00910D                                        72.0    1e-10   
ref|XP_010524399.1|  PREDICTED: zinc finger protein ZAT4-like iso...  73.2    1e-10   
ref|NP_188592.1|  zinc-finger protein 2                               72.0    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413542.1|  PREDICTED: zinc finger protein ZAT9-like         72.8    1e-10   
ref|XP_010053481.1|  PREDICTED: zinc finger protein ZAT4-like         73.2    1e-10   
ref|XP_002970126.1|  EPF-type Cis2-His2 zinc finger transcription...  73.9    2e-10   
emb|CAN59833.1|  hypothetical protein VITISV_017619                   72.0    2e-10   Vitis vinifera
dbj|BAA19114.1|  PEThy;ZPT4-1                                         73.6    2e-10   Petunia x hybrida [garden petunia]
ref|XP_010037208.1|  PREDICTED: uncharacterized protein LOC104425995  73.6    2e-10   
gb|ADD09568.1|  kruppel-like zinc finger protein                      71.2    2e-10   Trifolium repens [creeping white clover]
ref|XP_002274374.1|  PREDICTED: zinc finger protein ZAT5              71.6    2e-10   Vitis vinifera
ref|NP_001152162.1|  cys2/His2 zinc-finger transcription factor       72.4    2e-10   Zea mays [maize]
gb|EAY90527.1|  hypothetical protein OsI_12129                        73.2    2e-10   Oryza sativa Indica Group [Indian rice]
gb|EPS57985.1|  cys2/his2-type zinc finger transcription factor       70.9    2e-10   
ref|XP_010487903.1|  PREDICTED: zinc finger protein AZF2              71.6    2e-10   
ref|XP_004501530.1|  PREDICTED: zinc finger protein ZAT10-like        70.9    2e-10   
ref|XP_010508210.1|  PREDICTED: zinc finger protein ZAT4-like         72.0    2e-10   
emb|CDY08718.1|  BnaA06g25060D                                        70.9    2e-10   
gb|ACO54857.1|  zinc finger protein ZF1                               70.9    2e-10   
ref|NP_182037.1|  C2H2-like zinc finger protein                       72.0    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838175.1|  hypothetical protein AMTR_s00106p00120810        73.2    2e-10   
ref|XP_010242904.1|  PREDICTED: zinc finger protein ZAT3-like         71.6    2e-10   
ref|NP_001053505.1|  Os04g0552700                                     71.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009150704.1|  PREDICTED: zinc finger protein AZF1-like         70.9    2e-10   
ref|XP_007216232.1|  hypothetical protein PRUPE_ppa016813mg           73.2    2e-10   
emb|CAH67411.1|  OSIGBa0143N19.5                                      71.6    2e-10   
emb|CDY04886.1|  BnaAnng00680D                                        70.9    3e-10   
ref|XP_008341644.1|  PREDICTED: zinc finger protein 43-like           72.8    3e-10   
ref|XP_009397260.1|  PREDICTED: zinc finger protein ZAT4-like         72.8    3e-10   
ref|XP_009125507.1|  PREDICTED: zinc finger protein ZAT5-like         70.9    3e-10   
gb|ADD09582.1|  kruppel-like zinc finger protein                      70.5    3e-10   
emb|CBI16586.3|  unnamed protein product                              70.5    3e-10   
ref|XP_010045301.1|  PREDICTED: zinc finger protein ZAT5              70.9    3e-10   
gb|ADZ99348.1|  C2H2 zinc finger protein                              70.9    3e-10   
ref|XP_003525928.1|  PREDICTED: zinc finger protein ZAT10             70.1    3e-10   
ref|XP_008452639.1|  PREDICTED: zinc finger protein ZAT10-like        70.5    3e-10   
ref|XP_003517971.1|  PREDICTED: zinc finger protein ZAT9-like         72.0    3e-10   
ref|XP_010423704.1|  PREDICTED: zinc finger protein ZAT5-like         70.9    4e-10   
gb|KFK42574.1|  hypothetical protein AALP_AA1G013300                  70.1    4e-10   
ref|XP_010518124.1|  PREDICTED: zinc finger protein ZAT4-like         71.2    5e-10   
ref|XP_009631995.1|  PREDICTED: zinc finger protein ZAT3-like         71.6    5e-10   
ref|XP_007136747.1|  hypothetical protein PHAVU_009G070800g           69.7    5e-10   
emb|CDX80870.1|  BnaC03g01240D                                        69.7    5e-10   
ref|XP_010452231.1|  PREDICTED: zinc finger protein ZAT5-like         70.5    5e-10   
ref|XP_002985202.1|  EPF-type Cis2-His2 zinc finger transcription...  72.4    5e-10   
ref|XP_010645909.1|  PREDICTED: zinc finger protein ZAT3              70.9    5e-10   
ref|XP_002278670.1|  PREDICTED: zinc finger protein ZAT4-like         71.2    6e-10   
emb|CAN59897.1|  hypothetical protein VITISV_002884                   72.0    6e-10   
ref|XP_006401365.1|  hypothetical protein EUTSA_v10015446mg           71.6    6e-10   
ref|XP_004290960.1|  PREDICTED: zinc finger protein ZAT10-like        69.7    6e-10   
ref|XP_010277065.1|  PREDICTED: zinc finger protein ZAT10             69.3    6e-10   
ref|XP_009630807.1|  PREDICTED: zinc finger protein ZAT10-like        69.3    6e-10   
gb|KCW87459.1|  hypothetical protein EUGRSUZ_B03929                   70.5    7e-10   
ref|XP_006280373.1|  hypothetical protein CARUB_v10026299mg           71.6    7e-10   
ref|NP_195971.1|  C2H2-type zinc finger protein                       70.1    7e-10   
dbj|BAG15864.1|  zinc-finger protein                                  69.3    7e-10   
ref|XP_010424795.1|  PREDICTED: zinc finger protein ZAT5-like         70.1    8e-10   
ref|XP_010476288.1|  PREDICTED: zinc finger protein 1-like            69.7    8e-10   
ref|XP_010507810.1|  PREDICTED: zinc finger protein AZF2-like         69.7    8e-10   
ref|XP_006397693.1|  hypothetical protein EUTSA_v10001538mg           70.5    8e-10   
emb|CAN61394.1|  hypothetical protein VITISV_013327                   68.9    8e-10   
ref|XP_008236445.1|  PREDICTED: zinc finger protein ZAT10-like        68.9    8e-10   
ref|XP_010490834.1|  PREDICTED: zinc finger protein ZAT5              69.7    8e-10   
ref|XP_002285260.1|  PREDICTED: zinc finger protein ZAT10-like        68.9    8e-10   
ref|XP_006298327.1|  hypothetical protein CARUB_v10014391mg           69.3    9e-10   
ref|XP_006398801.1|  hypothetical protein EUTSA_v10014348mg           69.3    1e-09   
ref|XP_009354104.1|  PREDICTED: zinc finger protein ZAT10             69.3    1e-09   
ref|XP_004141285.1|  PREDICTED: zinc finger protein ZAT10-like        68.9    1e-09   
ref|XP_009396187.1|  PREDICTED: zinc finger protein ZAT1-like         70.1    1e-09   
gb|AFH57271.1|  ZFP                                                   68.6    1e-09   
ref|XP_011074364.1|  PREDICTED: zinc finger protein ZAT10-like        68.9    1e-09   
ref|XP_010525977.1|  PREDICTED: zinc finger protein ZAT4-like         70.9    1e-09   
ref|XP_004514533.1|  PREDICTED: uncharacterized protein LOC101511854  70.9    1e-09   
ref|XP_008348887.1|  PREDICTED: zinc finger protein ZAT10-like        68.6    1e-09   
ref|XP_010545300.1|  PREDICTED: zinc finger protein ZAT9-like         70.5    1e-09   
ref|XP_009112214.1|  PREDICTED: zinc finger protein AZF1-like         68.6    1e-09   
emb|CDY10376.1|  BnaCnng02770D                                        68.9    1e-09   
emb|CDY40256.1|  BnaA07g09440D                                        70.5    1e-09   
ref|XP_006288382.1|  hypothetical protein CARUB_v10001633mg           68.9    1e-09   
ref|XP_010506448.1|  PREDICTED: zinc finger protein ZAT4-like         69.7    1e-09   
ref|XP_002885316.1|  hypothetical protein ARALYDRAFT_479472           68.6    1e-09   
ref|XP_009411362.1|  PREDICTED: zinc finger protein ZAT5-like         68.9    1e-09   
ref|XP_009335384.1|  PREDICTED: zinc finger protein ZAT10-like        68.6    1e-09   
ref|XP_002264302.1|  PREDICTED: zinc finger protein ZAT10             68.2    1e-09   
ref|XP_010099609.1|  Zinc finger protein ZAT10                        68.6    2e-09   
ref|XP_009784656.1|  PREDICTED: zinc finger protein ZAT6-like iso...  68.6    2e-09   
ref|XP_002533000.1|  zinc finger protein, putative                    67.8    2e-09   
gb|ADB82925.1|  Cys2/His2-type zinc finger protein                    67.8    2e-09   
emb|CDY44371.1|  BnaC02g03060D                                        68.6    2e-09   
ref|XP_009784655.1|  PREDICTED: zinc finger protein ZAT10-like is...  68.9    2e-09   
dbj|BAA05078.1|  zinc-finger DNA binding protein                      68.2    2e-09   
ref|XP_006294533.1|  hypothetical protein CARUB_v10023569mg           69.3    2e-09   
gb|EYU37579.1|  hypothetical protein MIMGU_mgv1a024189mg              68.6    2e-09   
emb|CDY16170.1|  BnaA09g29040D                                        69.7    2e-09   
emb|CDY18661.1|  BnaA09g07340D                                        67.4    2e-09   
ref|XP_011094585.1|  PREDICTED: zinc finger protein ZAT5-like         68.2    2e-09   
ref|XP_009780218.1|  PREDICTED: zinc finger protein ZAT9              69.7    2e-09   
ref|XP_010557519.1|  PREDICTED: zinc finger protein AZF2-like         68.2    2e-09   
ref|XP_003572064.1|  PREDICTED: zinc finger protein ZAT1-like         69.3    2e-09   
ref|XP_008364438.1|  PREDICTED: zinc finger protein ZAT10-like        67.8    2e-09   
ref|XP_009133702.1|  PREDICTED: zinc finger protein ZAT4              67.4    2e-09   
ref|XP_010484494.1|  PREDICTED: zinc finger protein AZF1-like         67.8    2e-09   
ref|XP_009103097.1|  PREDICTED: zinc finger protein ZAT4-like         69.7    2e-09   
ref|XP_002306061.1|  hypothetical protein POPTR_0004s11730g           70.1    2e-09   
ref|XP_002446910.1|  hypothetical protein SORBIDRAFT_06g024690        68.9    2e-09   
ref|XP_011017126.1|  PREDICTED: zinc finger protein ZAT10             67.8    2e-09   
ref|NP_201546.1|  zinc-finger protein 1                               67.8    2e-09   
ref|XP_006652618.1|  PREDICTED: zinc finger protein ZAT1-like         68.6    2e-09   
emb|CDP01373.1|  unnamed protein product                              69.3    3e-09   
gb|KFK42573.1|  hypothetical protein AALP_AA1G013200                  67.8    3e-09   
ref|XP_006368233.1|  hypothetical protein POPTR_0001s00800g           67.8    3e-09   
ref|XP_010489335.1|  PREDICTED: zinc finger protein ZAT2-like         67.8    3e-09   
gb|EPS61223.1|  hypothetical protein M569_13576                       65.9    3e-09   
ref|XP_008347606.1|  PREDICTED: zinc finger protein ZAT10-like        67.8    3e-09   
gb|ADL36637.1|  C2H2L domain class transcription factor               67.8    3e-09   
ref|XP_009385229.1|  PREDICTED: zinc finger protein ZAT9-like         68.9    3e-09   
ref|XP_002301152.2|  hypothetical protein POPTR_0002s12010g           67.8    3e-09   
ref|XP_006418481.1|  hypothetical protein EUTSA_v10008559mg           67.8    3e-09   
ref|XP_009347118.1|  PREDICTED: zinc finger protein ZAT10-like        67.4    3e-09   
ref|XP_008357375.1|  PREDICTED: zinc finger protein ZAT10-like        67.8    3e-09   
ref|XP_009130761.1|  PREDICTED: zinc finger protein ZAT5              67.8    3e-09   
ref|XP_007160903.1|  hypothetical protein PHAVU_001G026700g           67.0    3e-09   
ref|XP_002527502.1|  zinc finger protein, putative                    67.4    3e-09   
ref|XP_006406484.1|  hypothetical protein EUTSA_v10021307mg           67.8    3e-09   
ref|XP_010552999.1|  PREDICTED: zinc finger protein ZAT5              67.8    3e-09   
gb|ABQ53549.1|  zinc finger protein                                   67.4    3e-09   
ref|XP_008230999.1|  PREDICTED: uncharacterized protein LOC103330234  69.7    3e-09   
emb|CAF74935.1|  zinc finger DNA-binding protein                      67.4    3e-09   
emb|CAN61204.1|  hypothetical protein VITISV_013668                   68.6    3e-09   
gb|AAO16037.1|AF525022_1  zinc finger protein                         67.4    3e-09   
gb|KFK28431.1|  hypothetical protein AALP_AA8G513800                  67.0    4e-09   
ref|XP_009415446.1|  PREDICTED: zinc finger protein ZAT1-like         68.2    4e-09   
emb|CDX90072.1|  BnaA10g00100D                                        69.3    4e-09   
ref|XP_009136525.1|  PREDICTED: zinc finger protein AZF1 isoform X1   66.6    4e-09   
emb|CDM84884.1|  unnamed protein product                              66.6    4e-09   
ref|XP_002889340.1|  hypothetical protein ARALYDRAFT_333453           67.0    4e-09   
emb|CDX82290.1|  BnaA03g35310D                                        67.4    4e-09   
ref|XP_009776555.1|  PREDICTED: zinc finger protein ZAT5-like         67.8    4e-09   
ref|XP_010933179.1|  PREDICTED: zinc finger protein ZAT5-like         67.4    4e-09   
ref|XP_008235978.1|  PREDICTED: zinc finger protein ZAT3              68.2    5e-09   
ref|XP_002313585.1|  zinc finger family protein                       67.4    5e-09   
ref|XP_009365959.1|  PREDICTED: zinc finger protein 43-like           68.9    5e-09   
ref|XP_010107170.1|  Zinc finger protein ZAT9                         67.0    5e-09   
ref|XP_006305993.1|  hypothetical protein CARUB_v10011272mg           68.6    5e-09   
ref|XP_002510108.1|  zinc finger protein, putative                    67.0    5e-09   
ref|XP_007042625.1|  Zinc-finger DNA binding protein, putative        67.0    5e-09   
ref|XP_004242283.1|  PREDICTED: zinc finger protein ZAT4              67.4    5e-09   
ref|XP_006279684.1|  hypothetical protein CARUB_v10026997mg           66.6    5e-09   
ref|XP_009103654.1|  PREDICTED: zinc finger protein ZAT5              67.4    5e-09   
ref|XP_006294403.1|  hypothetical protein CARUB_v10023420mg           68.2    6e-09   
ref|XP_010536792.1|  PREDICTED: zinc finger protein ZAT9              68.6    6e-09   
gb|EYU23573.1|  hypothetical protein MIMGU_mgv1a007726mg              68.2    6e-09   
emb|CDX99202.1|  BnaC05g33170D                                        67.0    6e-09   
ref|NP_171705.1|  C2H2-like zinc finger protein                       67.0    6e-09   
ref|XP_010523093.1|  PREDICTED: zinc finger protein ZAT2              66.2    6e-09   
ref|XP_009132329.1|  PREDICTED: zinc finger protein ZAT1-like         68.2    6e-09   
gb|EPS57971.1|  hypothetical protein M569_16846                       65.1    6e-09   
ref|XP_006398890.1|  hypothetical protein EUTSA_v10014546mg           66.2    6e-09   
ref|XP_004306095.1|  PREDICTED: uncharacterized protein LOC101305788  68.6    7e-09   
ref|XP_011018344.1|  PREDICTED: zinc finger protein ZAT9-like         67.4    7e-09   
ref|XP_002871040.1|  zinc finger family protein                       67.0    7e-09   
gb|KFK27201.1|  hypothetical protein AALP_AA8G348500                  68.6    7e-09   
ref|XP_010515478.1|  PREDICTED: zinc finger protein ZAT2-like         66.6    7e-09   
emb|CDP09972.1|  unnamed protein product                              67.8    7e-09   
ref|XP_010510676.1|  PREDICTED: zinc finger protein ZAT5              67.0    7e-09   
ref|XP_011028801.1|  PREDICTED: zinc finger protein ZAT10-like        66.2    8e-09   
gb|KHN09048.1|  Zinc finger protein ZAT4                              65.5    8e-09   
gb|KDP32063.1|  hypothetical protein JCGZ_12524                       65.5    8e-09   
gb|KHN04447.1|  Zinc finger protein ZAT10                             65.9    8e-09   
ref|XP_009591197.1|  PREDICTED: zinc finger protein ZAT1-like         67.0    8e-09   
emb|CDY65161.1|  BnaC03g73930D                                        66.2    8e-09   
gb|EPS65753.1|  hypothetical protein M569_09025                       65.9    8e-09   
ref|XP_010467471.1|  PREDICTED: zinc finger protein ZAT2-like         66.6    8e-09   
ref|XP_006299883.1|  hypothetical protein CARUB_v10016090mg           66.6    9e-09   
emb|CDP01211.1|  unnamed protein product                              66.2    9e-09   
gb|ABI74691.1|  C2H2 zinc finger protein                              65.9    9e-09   
gb|KDP22438.1|  hypothetical protein JCGZ_26269                       67.0    9e-09   
ref|XP_002460947.1|  hypothetical protein SORBIDRAFT_02g038000        65.9    1e-08   
gb|AFK50424.1|  C2H2-type zinc finger protein                         65.9    1e-08   
gb|EYU31946.1|  hypothetical protein MIMGU_mgv1a017686mg              68.2    1e-08   
ref|NP_001265993.1|  zinc finger protein ZAT10-like                   66.2    1e-08   
ref|XP_009109781.1|  PREDICTED: zinc finger protein ZAT10-like        65.5    1e-08   
ref|XP_009386511.1|  PREDICTED: zinc finger protein ZAT6-like         66.2    1e-08   
ref|XP_011092508.1|  PREDICTED: zinc finger protein AZF2-like         65.5    1e-08   
ref|XP_009373429.1|  PREDICTED: zinc finger protein ZAT3-like         67.4    1e-08   
ref|XP_002862505.1|  hypothetical protein ARALYDRAFT_920621           65.5    1e-08   
ref|XP_003614031.1|  PEThy ZPT4-2                                     67.8    1e-08   
ref|XP_003536582.1|  PREDICTED: zinc finger protein AZF1-like         65.9    1e-08   
ref|XP_006472288.1|  PREDICTED: zinc finger protein ZAT10-like        65.5    1e-08   
ref|XP_002300263.2|  hypothetical protein POPTR_0001s30260g           66.2    1e-08   
ref|XP_010272343.1|  PREDICTED: zinc finger protein ZAT10             65.5    1e-08   
ref|XP_009135641.1|  PREDICTED: zinc finger protein AZF2-like         65.9    1e-08   
ref|XP_006291812.1|  hypothetical protein CARUB_v10017988mg           65.1    1e-08   
ref|XP_011081399.1|  PREDICTED: zinc finger protein ZAT1-like         67.4    1e-08   
gb|AGY36840.1|  Cys2/His2-type zinc finger protein                    64.7    1e-08   
gb|KDP29659.1|  hypothetical protein JCGZ_18821                       66.6    1e-08   
ref|XP_003562286.1|  PREDICTED: zinc finger protein 1-like            65.1    1e-08   
ref|NP_200431.1|  C2H2 type zinc finger transcription factor-like...  67.4    1e-08   
ref|XP_006486925.1|  PREDICTED: zinc finger protein ZAT10-like        65.9    1e-08   
ref|XP_003555988.1|  PREDICTED: zinc finger protein ZAT10-like        65.5    1e-08   
ref|NP_001130769.1|  uncharacterized protein LOC100191873             66.6    1e-08   
dbj|BAA05076.1|  zinc-finger DNA binding protein                      65.9    1e-08   
gb|KDP29189.1|  hypothetical protein JCGZ_16578                       65.9    1e-08   
gb|KDP41634.1|  hypothetical protein JCGZ_16041                       65.5    1e-08   
emb|CDX93340.1|  BnaC04g45560D                                        67.8    1e-08   
ref|XP_010414581.1|  PREDICTED: zinc finger protein ZAT5-like         65.9    1e-08   
ref|XP_002525261.1|  zinc finger protein, putative                    64.7    2e-08   
ref|XP_006415734.1|  hypothetical protein EUTSA_v10010032mg           65.1    2e-08   
ref|XP_006422839.1|  hypothetical protein CICLE_v10029065mg           65.5    2e-08   
emb|CDY43576.1|  BnaC02g16730D                                        64.7    2e-08   
gb|AAQ10954.1|  zinc finger protein                                   65.5    2e-08   
ref|XP_010426524.1|  PREDICTED: zinc finger protein AZF1-like         64.7    2e-08   
gb|ACG47274.1|  cys2/His2 zinc-finger transcription factor            66.6    2e-08   
emb|CDY38042.1|  BnaCnng09030D                                        65.5    2e-08   
ref|XP_010463335.1|  PREDICTED: uncharacterized protein LOC104744002  67.8    2e-08   
emb|CDY22361.1|  BnaA06g36830D                                        64.3    2e-08   
emb|CDX83402.1|  BnaA03g21040D                                        65.9    2e-08   
ref|XP_010466108.1|  PREDICTED: zinc finger protein AZF2-like         65.9    2e-08   
ref|XP_008779116.1|  PREDICTED: zinc finger protein ZAT5-like         65.9    2e-08   
ref|XP_010314999.1|  PREDICTED: zinc finger protein AZF1-like         64.7    2e-08   
ref|XP_002465091.1|  hypothetical protein SORBIDRAFT_01g031920        64.3    2e-08   
ref|XP_009759748.1|  PREDICTED: zinc finger protein ZAT1-like         65.9    2e-08   
ref|NP_171706.1|  C2H2-type zinc finger protein                       66.2    2e-08   
ref|XP_010662329.1|  PREDICTED: zinc finger protein ZAT1-like         64.3    2e-08   
emb|CDY30794.1|  BnaC07g16940D                                        64.3    2e-08   
gb|AFK36438.1|  unknown                                               64.7    2e-08   
gb|KFK37304.1|  hypothetical protein AALP_AA4G239800                  65.1    2e-08   
ref|XP_009397727.1|  PREDICTED: zinc finger protein 1-like            64.3    2e-08   
gb|ACJ84409.1|  unknown                                               64.7    2e-08   
emb|CDY51312.1|  BnaCnng20570D                                        64.3    2e-08   
ref|XP_006591588.1|  PREDICTED: uncharacterized protein LOC100796376  66.2    2e-08   
ref|XP_008805550.1|  PREDICTED: zinc finger protein ZAT9-like         66.6    2e-08   
ref|XP_006486840.1|  PREDICTED: zinc finger protein ZAT3-like         65.5    2e-08   
ref|XP_006381377.1|  hypothetical protein POPTR_0006s12340g           65.5    2e-08   
ref|XP_002894223.1|  hypothetical protein ARALYDRAFT_314403           67.4    2e-08   
ref|XP_010450774.1|  PREDICTED: zinc finger protein ZAT4-like         66.6    2e-08   
gb|AGQ03803.1|  Cys2/His2-type zinc finger protein                    64.7    2e-08   
ref|XP_006433625.1|  hypothetical protein CICLE_v10002297mg           64.7    2e-08   
ref|XP_009145772.1|  PREDICTED: zinc finger protein AZF2-like iso...  65.1    3e-08   
gb|EYU37578.1|  hypothetical protein MIMGU_mgv1a022434mg              64.7    3e-08   
ref|XP_011008618.1|  PREDICTED: uncharacterized protein LOC105113944  66.6    3e-08   
ref|XP_009599610.1|  PREDICTED: zinc finger protein ZAT10-like        64.7    3e-08   
gb|KDO72957.1|  hypothetical protein CISIN_1g031430mg                 63.5    3e-08   
ref|XP_010065906.1|  PREDICTED: zinc finger protein ZAT10-like        64.3    3e-08   



>ref|XP_006348710.1| PREDICTED: uncharacterized protein LOC102602723 [Solanum tuberosum]
Length=529

 Score =   282 bits (722),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 226/379 (60%), Gaps = 76/379 (20%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNS----IGSSSVSEIDEQEQEEV-AKCLMMLSKDSGNWYG--  296
             KRYK+LVVKS +  L NNN+     GSSSVSEIDE +QEEV AKCLMMLS+D+GNW G  
Sbjct  147   KRYKRLVVKSSNYCLVNNNNSVVNYGSSSVSEIDELDQEEVVAKCLMMLSRDTGNWNGVN  206

Query  297   SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGD  476
             SVVE SDNNSVVLETKSSS DMK  RK+                   N+ + P TKK+  
Sbjct  207   SVVESSDNNSVVLETKSSSTDMKFGRKDRLKCVY-------------NQNETPGTKKL--  251

Query  477   NRKVMKSSIVHTEMAESQSSDSGYFLGENK-VESDVSVNGF-------------------  596
                    S +  + AES+SSDSGYFL +N  VESD+SV+GF                   
Sbjct  252   -------SGLDVDQAESESSDSGYFLDDNTIVESDISVDGFHRNGNSKWSTSQMSHAVWC  304

Query  597   ----LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEME  755
                 + K K LNR K Y    R  +  E E YDD+ +AS   K   +KR  D+SY PE+ 
Sbjct  305   DESGVDKGKGLNRTKKYPTESRKDLTVECE-YDDYAIASYMEKCEPRKRMKDSSYHPELG  363

Query  756   TGSYKKTKVVAASSPGTNA-NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGT  932
               S KK K+   SS G N   KKKYECLNCKKSFNSYQALGGHRPCHKK N  +ES  GT
Sbjct  364   NKSVKKIKISPKSSEGCNTIQKKKYECLNCKKSFNSYQALGGHRPCHKKANAYLESINGT  423

Query  933   GENSLDADETYNHGNGGKIRDCFGSKKAGAT--------EKKVRPKKGKGHECPFCHRMF  1088
             GE+S+D           K R+ F S+   +T        EK ++PKK + HECPFC R+F
Sbjct  424   GESSVD----------DKNRETFSSRTPASTAKDLSYNPEKTIKPKKSQRHECPFCDRVF  473

Query  1089  KSGQALGGHKRSHFIGGAQ  1145
             KSGQALGGHKRSHFI G +
Sbjct  474   KSGQALGGHKRSHFIVGTE  492



>emb|CDP00414.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 255/415 (61%), Gaps = 63/415 (15%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEF  311
             KRYK++++KS S SL N    GSSSVSEIDEQEQEEVA CLMMLS+DSGNW G  SVVE 
Sbjct  166   KRYKRIIIKSSSFSLAN----GSSSVSEIDEQEQEEVAMCLMMLSRDSGNWGGVNSVVES  221

Query  312   SDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVM  491
             SDNNSVVLETKSSSIDM+  R  G    +              E   P TK     R + 
Sbjct  222   SDNNSVVLETKSSSIDMRIGRMEGLKFVHSP------------EDDTPQTKP----RSLK  265

Query  492   KSSIVHTEMA-ESQSSDSGYFLGEN-KVESDVSVNGFLAKC-------------------  608
             KSS +  E+  E ++SDSGYFL E  K+ESD SV+GF  KC                   
Sbjct  266   KSSGLDAELVFEQENSDSGYFLEEVVKLESDASVDGFHRKCGFFKSSKPKASVGARCEET  325

Query  609   -----KVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEMETGS  764
                  +  +++K Y    R  + +E E+  D GV S  GK   + ++ D+S + E+   S
Sbjct  326   LAEIKRGFSKIKSYKAELRKEMSRENEH--DSGVISKMGKYEARNKSKDSSDNLELVNES  383

Query  765   YKKTKVVAASSPGT-NANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE  938
             ++K +  ++ +  + NA K+ KYECLNCKK+F SYQALGGHRPCHK++N  +ES Y TGE
Sbjct  384   HRKARHGSSDADQSKNAYKRSKYECLNCKKTFKSYQALGGHRPCHKRSNAYLESRYETGE  443

Query  939   NSLDADETYNHGNGGKIRDCFGSKKAGA------TEKKVRPKKGKGHECPFCHRMFKSGQ  1100
             NSLD D+T       K+R+   ++ A A       EK V+ KK KG ECPFCHR+FK+GQ
Sbjct  444   NSLDGDDTPTDIPSTKLRESSSNRNASAKNLYHNAEKNVKSKKTKGLECPFCHRIFKNGQ  503

Query  1101  ALGGHKRSHFI-GGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDEQLMAW  1262
             ALGGHKRSHFI GG+ V+  S QT    K +  +LLDLNLPAP+EDE+D Q ++W
Sbjct  504   ALGGHKRSHFIGGGSAVVERSTQT-PTFKTDGPELLDLNLPAPLEDENDGQFISW  557



>ref|XP_009775816.1| PREDICTED: zinc finger protein ZAT4-like [Nicotiana sylvestris]
Length=508

 Score =   270 bits (690),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 254/407 (62%), Gaps = 80/407 (20%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSI--GSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYGSVVE  308
             KRY+++VVKS S+ L N+N+I  GSS VSEID EQ+QEEVAKCLMMLSKDS N   S VE
Sbjct  150   KRYRRIVVKS-SVCLVNDNTINNGSSCVSEIDNEQDQEEVAKCLMMLSKDSWNCVTSFVE  208

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVVLETKSSS DMK +RK+G                D N+ + P TKK  D+   
Sbjct  209   SSDNNSVVLETKSSSTDMKFARKDGLRC-------------DYNQEEMPRTKKKEDSN--  253

Query  489   MKSSIVHTEMAESQSSDSGYFLGENK-VESDVSVNG-----------------------F  596
             +K S++  E+ ES++SDS YFL EN  VESDVS +G                       +
Sbjct  254   LKLSVLDVEV-ESENSDSAYFLDENTIVESDVSFDGLHRNGNSKWSTSKMSDTVWCDESW  312

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEMETGSY  767
             + K K LNR K Y  P   G E     YDD+ +AS   K   +KRT ++SY  E+E  S+
Sbjct  313   IDKEKGLNRTKRY--PTESGSE-----YDDYRIASYFDKCESRKRTKNSSYRLELENESF  365

Query  768   KKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSL  947
             KK                KYEC+NCKK+F+SYQALGGHRPCHKKTN  +ES  GTGENS+
Sbjct  366   KK----------------KYECMNCKKTFSSYQALGGHRPCHKKTNAYIESINGTGENSV  409

Query  948   DADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSH  1127
             DA +        K R+ F S+K  + EKK++PKK KGHECPFC R+FKSGQALGGHKRSH
Sbjct  410   DAAD-----RDDKHRETFSSRKPASAEKKIKPKKFKGHECPFCDRIFKSGQALGGHKRSH  464

Query  1128  FIGGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDE--QLMAW  1262
             FI G       HQ+ +  K++  DLLDLNLPAPVEDEDDE   L++W
Sbjct  465   FIVGTS--QNMHQS-SPVKKDVDDLLDLNLPAPVEDEDDEHAHLVSW  508



>ref|XP_009598345.1| PREDICTED: uncharacterized protein LOC104094174 [Nicotiana tomentosiformis]
Length=501

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 196/406 (48%), Positives = 247/406 (61%), Gaps = 78/406 (19%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSI--GSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYGSVVE  308
             KRYK++VVKS S+ L N+N+I  GSS VSEID EQ+QEE+AKCLMMLS+DS N   S +E
Sbjct  143   KRYKRIVVKS-SVCLVNDNTINNGSSCVSEIDNEQDQEEIAKCLMMLSRDSWNCVTSFIE  201

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVVLETKSSS DM+ +RK+G                  N+ + P TK+  D  + 
Sbjct  202   SSDNNSVVLETKSSSTDMRFARKDGLKCVY-------------NQDETPRTKEKVD--RD  246

Query  489   MKSSIVHTEMAESQSSDSGYFLGENK-VESDVSVNGF-----------------------  596
             +K S+++ E AES++SDS YFL EN  VESDVS +GF                       
Sbjct  247   LKLSVLNAE-AESENSDSAYFLDENTTVESDVSFDGFHRNGNSKWSTSKMSDTVWCDESG  305

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEMETGSY  767
               K K LNR K Y    R         YD + +ASNS K   +KR  ++SY+PE+E  S+
Sbjct  306   TDKGKGLNRTKRYPTASRS-------EYDYYRIASNSDKCESRKRAKNSSYNPEIENESF  358

Query  768   KKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSL  947
             KK                KYECLNCKK+F+SYQALGGHRPCHKKTN  +ES  GTGENS+
Sbjct  359   KK----------------KYECLNCKKNFSSYQALGGHRPCHKKTNACIESTNGTGENSV  402

Query  948   DADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSH  1127
             DA    +H N  K R+   S+K+ + EKK++PKK KGHECPFC R+FKSGQALGGHKRSH
Sbjct  403   DA---ADHDN--KHRETLSSRKSASAEKKIKPKKFKGHECPFCDRIFKSGQALGGHKRSH  457

Query  1128  FI-GGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDEQLMAW  1262
             FI   AQ +N S  +P     +    L+L  P  VED++   L++W
Sbjct  458   FIVSTAQNMNQS--SPVKKDVDDLLDLNLPAPVEVEDDEHAHLVSW  501



>ref|XP_004239066.2| PREDICTED: uncharacterized protein LOC101247524 [Solanum lycopersicum]
Length=531

 Score =   268 bits (686),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 222/379 (59%), Gaps = 76/379 (20%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNS--------IGSSSVSEIDEQEQEEV-AKCLMMLSKDSGNW  290
             KRYK+LV K  +  L NNNS         GSSSVSEIDE +QEEV AKCLMMLS+D+GNW
Sbjct  149   KRYKRLVAKPSNYCLVNNNSNNNNGVVNYGSSSVSEIDELDQEEVVAKCLMMLSRDTGNW  208

Query  291   YG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTK  464
              G  SVVE SDNNSVVLETKSSS DMK  RK+                   N+ + P TK
Sbjct  209   NGVNSVVESSDNNSVVLETKSSSTDMKFGRKDRLKCVY-------------NQNETPGTK  255

Query  465   KMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENK-VESDVSVNGF---------------  596
             K+         S +  + AES+SSDSGYFL +N  VESD+SV+GF               
Sbjct  256   KL---------SGLDVDQAESESSDSGYFLDDNTIVESDISVDGFNRNGNSKWSTSQMSH  306

Query  597   ----LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEME  755
                 + K K LNR K Y    R  +  E + YD + +AS   K   +KR  D+SY  E+ 
Sbjct  307   AESGVDKGKGLNRTKKYPIESRKDLTAECD-YDYYAIASYIDKCEPRKRMKDSSYHSELG  365

Query  756   TGSYKKTKVVAASSPGTNA-NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGT  932
                 KK K+   SS G NA  KKKYECLNCKKSFNSYQALGGHRPCHKK N  +ES  GT
Sbjct  366   NKFVKKIKLGPKSSEGCNAIQKKKYECLNCKKSFNSYQALGGHRPCHKKANAYLESINGT  425

Query  933   GENSLDADETYNHGNGGKIRDCFGSKKAGAT--------EKKVRPKKGKGHECPFCHRMF  1088
             GE+S+D           K R+ F S+   +T        EK ++PKK + HECPFC R+F
Sbjct  426   GESSVD----------DKNRETFSSRTPASTAKDQSYNPEKTIKPKKSQRHECPFCDRVF  475

Query  1089  KSGQALGGHKRSHFIGGAQ  1145
             KSGQALGGHKRSHF+ G +
Sbjct  476   KSGQALGGHKRSHFVVGTE  494



>ref|XP_004237053.1| PREDICTED: uncharacterized protein LOC101251273 [Solanum lycopersicum]
Length=559

 Score =   260 bits (664),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 184/384 (48%), Positives = 231/384 (60%), Gaps = 59/384 (15%)
 Frame = +3

Query  120   QSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG-  296
             +S  + KRY +LV KS S  L NN S+ SS VSEIDEQ+QEEVAKCLMMLS DSG W G 
Sbjct  155   KSRSNTKRYNRLVAKSSSFCLVNNRSV-SSPVSEIDEQDQEEVAKCLMMLSMDSGIWNGV  213

Query  297   -SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMG  473
              SVVE SDNNSV+LETKSSS+DMK +RK                  +N +  +   KK  
Sbjct  214   NSVVESSDNNSVILETKSSSVDMKVARKGCLKPA------------ENVDETHRRCKKEA  261

Query  474   DNRKVMKSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGF---------------LAK  605
             D  + +K + ++ E AES++SDSGYFLGE  KVESD SV+ F                  
Sbjct  262   D--RNLKLNALNAE-AESENSDSGYFLGEYMKVESDASVDEFHRNVNYQWNTSNKSLRVW  318

Query  606   C--------KVLNRVKG-YVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPE  749
             C        K  NR    Y+   R G  K+Y+ Y+ +G+ASN  K   +KR  D SY+PE
Sbjct  319   CDETRRDVEKGFNRTTTKYITEMRNGSTKDYK-YESYGMASNLAKSESRKRIKDISYEPE  377

Query  750   M-ETGSYKKTKVVAASSPGT--NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMES  920
             + +  S++K KV      G+     KKKYEC NCKK+F+SYQALGGHRPC+KK N   ES
Sbjct  378   LGKESSFRKIKVGFKGPEGSKHTRKKKKYECFNCKKAFSSYQALGGHRPCNKKANAYFES  437

Query  921   GYGTGENSLDADETYNHGNGGKIRDCFGSKKAGA---------TEKKVRPKKGKGHECPF  1073
              Y T EN   A+   ++ + GK R+ F ++K             EKK++PKK KGHECPF
Sbjct  438   TYETDENGRGAENGPSYIDKGKHRETFNNRKPTVHDGQDVNYNPEKKMKPKKFKGHECPF  497

Query  1074  CHRMFKSGQALGGHKRSHFIGGAQ  1145
             C+RMFKSGQALGGHKRSHF+ G+Q
Sbjct  498   CNRMFKSGQALGGHKRSHFLVGSQ  521



>dbj|BAA19926.1| PEThy; ZPT4-2 [Petunia x hybrida]
Length=554

 Score =   256 bits (655),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 182/370 (49%), Positives = 223/370 (60%), Gaps = 56/370 (15%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGSVVEF  311
             KRY +L+ KS S    NN S  SSSVSEID+QEQEEVAKCLMMLS D+   N   S+VE 
Sbjct  163   KRYNRLIAKSSSFCFVNNKS-VSSSVSEIDDQEQEEVAKCLMMLSMDTWICNGVNSIVES  221

Query  312   SDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVM  491
             SDNNSVVLETKSSS+DMK  RK+                  NN  + P +KK  D  + +
Sbjct  222   SDNNSVVLETKSSSVDMKIERKDSPKCV-------------NNLDETPRSKKKAD--RNL  266

Query  492   KSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGF-----------------------L  599
             K  +++ E A+S++SDS YFLGE  KVESD SV+ F                        
Sbjct  267   KLDLLNAE-AQSENSDSEYFLGEYKKVESDASVDEFHRNGNYQWNTSNTSLGCWFDESGP  325

Query  600   AKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQ---KRTNDTSYDPEMETGSYK  770
             A+ K L R+K YV   R  + K+Y+ YD +G+ S+  K+   KR  D+SY P +   ++K
Sbjct  326   AEKKELTRMKNYVTDSRKDLSKDYK-YDSYGMVSHLDKRESRKRIKDSSYPPNLSNETFK  384

Query  771   KTKVVAASSPGT--NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS  944
               K    S  G+     KKKYECLNCKK+F+SYQALGGHRPC+K TN   ES Y TGENS
Sbjct  385   NVKPSFKSPEGSKHTQKKKKYECLNCKKTFSSYQALGGHRPCNKNTNAYFESTYETGENS  444

Query  945   LDADETYNHGNGGKIRDCFGSKKAGAT-------EKKVRPKKGKGHECPFCHRMFKSGQA  1103
              DAD   N+ N GK R+   +K A  +       EKK++PKK KGH CPFC RMFKSGQA
Sbjct  445   RDADNGPNYINKGKHRETLSNKPAAHSHDYSSNPEKKMKPKKFKGHACPFCPRMFKSGQA  504

Query  1104  LGGHKRSHFI  1133
             LGGHKRSHFI
Sbjct  505   LGGHKRSHFI  514



>ref|XP_009631793.1| PREDICTED: uncharacterized protein LOC104121485 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631797.1| PREDICTED: uncharacterized protein LOC104121485 isoform X1 [Nicotiana 
tomentosiformis]
Length=537

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 204/414 (49%), Positives = 244/414 (59%), Gaps = 76/414 (18%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYGS--VVE  308
             KRYKK++VKS S+   NNN   SSSVSEID EQEQEEVAKCLMMLS+DSG W G   VVE
Sbjct  161   KRYKKIIVKS-SICKVNNNYNCSSSVSEIDHEQEQEEVAKCLMMLSRDSGIWNGVNIVVE  219

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVVLETKSSS DM+ +R N                R  N+ + P TKK  D  + 
Sbjct  220   SSDNNSVVLETKSSSNDMRNARNNTLK-------------RAYNQDEKPQTKKKED--RD  264

Query  489   MKSSIVHTEMAESQSSDSGYFLGEN-KVESDVSVNGFLAK--CKV---------------  614
             +K  I+  E  +S++SDS YFLGEN KV+SD SV  F     CK                
Sbjct  265   LKRDILEAE-TQSENSDSDYFLGENGKVDSDGSVERFRGNGNCKWSSSKMSLGAWLDERR  323

Query  615   ------LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKT  776
                   LNR+K Y+   R  + K+YE +D +G+ASN  K +    T       T  YK  
Sbjct  324   HDEKKSLNRIKRYLTESRKDLSKKYE-HDGYGLASNFDKCESRKGT-------TDRYKNI  375

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD  956
                          K+KYECLNCKK+F+SYQALGGHRPCHKK N   ES Y TGENSL AD
Sbjct  376   H-----------KKRKYECLNCKKTFSSYQALGGHRPCHKKINDYSESTYETGENSLGAD  424

Query  957   ETYNHGNGGKIRDCFGSKKAGATEKKV--------RPKKGKGHECPFCHRMFKSGQALGG  1112
                 + N GK ++ F +KK   + + V        +PKK KGH+CPFC R+FKSGQALGG
Sbjct  425   NDPKYINIGKHKETFSNKKPAVSTQDVPYEPEKKVKPKKSKGHKCPFCPRIFKSGQALGG  484

Query  1113  HKRSHFIGGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDE----QLMAW  1262
             HKRSHFI  A V   +    +A K E ADLLDLNLPAPV+DEDDE    + M+W
Sbjct  485   HKRSHFI-HASVNEENLNQSSAVKREVADLLDLNLPAPVDDEDDEHEHARFMSW  537



>ref|XP_006344247.1| PREDICTED: uncharacterized protein LOC102585908 [Solanum tuberosum]
Length=562

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 191/387 (49%), Positives = 235/387 (61%), Gaps = 62/387 (16%)
 Frame = +3

Query  120   QSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG-  296
             +S  + KRY +LV KS S  L NN S+ SSSVSEIDEQ+QEEVAKCLMMLS DSG W G 
Sbjct  155   KSRSNTKRYNRLVAKSSSFCLVNNRSV-SSSVSEIDEQDQEEVAKCLMMLSMDSGIWNGV  213

Query  297   -SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMG  473
              SVVE SDNNSV+LETKSSS+DMK +RK+                 DN +  +  +KK  
Sbjct  214   NSVVESSDNNSVILETKSSSVDMKVARKDCLKPA------------DNLDETHRRSKKEA  261

Query  474   DNRKVMKSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGFL---------------AK  605
             D  + +K + ++ E AES++SDSGYFLGE  KVESD SV+ F                  
Sbjct  262   D--RNLKLNDLNAE-AESENSDSGYFLGEYMKVESDASVDEFHRNGNYQWNTSNKSLGVW  318

Query  606   C--------KVLNR----VKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSY  740
             C        K LNR     K   E R  G  KEY+ YD +G+ASN  K   +KRT D SY
Sbjct  319   CDETRKDVEKDLNRTTTTTKYITEMRINGSTKEYK-YDSYGMASNLAKSESRKRTKDISY  377

Query  741   DPEM-ETGSYKKTKVVAASSPGT--NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPD  911
             +PE+    S++K KV      G+     KKKYEC NCKK+F+SYQALGGHRPC+KK N  
Sbjct  378   EPELGNESSFRKIKVGFKGPEGSKHTQKKKKYECFNCKKAFSSYQALGGHRPCNKKANAY  437

Query  912   MESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGA---------TEKKVRPKKGKGHE  1064
              ES Y T EN   A+   ++ + GK R+ F ++K             EKK++PKK KGHE
Sbjct  438   FESTYETDENGRGAENGPSYIDKGKHRETFNNRKPAVHDGQDVNYNPEKKMKPKKFKGHE  497

Query  1065  CPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             CPFC+RMFKSGQALGGHKRSHF+ G+Q
Sbjct  498   CPFCNRMFKSGQALGGHKRSHFLVGSQ  524



>ref|XP_009631802.1| PREDICTED: uncharacterized protein LOC104121485 isoform X2 [Nicotiana 
tomentosiformis]
Length=536

 Score =   253 bits (646),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 215/367 (59%), Gaps = 71/367 (19%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYGS--VVE  308
             KRYKK++VKS S+   NNN   SSSVSEID EQEQEEVAKCLMMLS+DSG W G   VVE
Sbjct  161   KRYKKIIVKS-SICKVNNNYNCSSSVSEIDHEQEQEEVAKCLMMLSRDSGIWNGVNIVVE  219

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVVLETKSSS DM+ +R N                R  N+ + P TKK  D  + 
Sbjct  220   SSDNNSVVLETKSSSNDMRNARNNTLK-------------RAYNQDEKPQTKKKED--RD  264

Query  489   MKSSIVHTEMAESQSSDSGYFLGEN-KVESDVSVNGFLAK--CKV---------------  614
             +K  I+  E  +S++SDS YFLGEN KV+SD SV  F     CK                
Sbjct  265   LKRDILEAE-TQSENSDSDYFLGENGKVDSDGSVERFRGNGNCKWSSSKMSLGAWLDERR  323

Query  615   ------LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKT  776
                   LNR+K Y+   R  + K+YE +D +G+ASN  K +    T       T  YK  
Sbjct  324   HDEKKSLNRIKRYLTESRKDLSKKYE-HDGYGLASNFDKCESRKGT-------TDRYKNI  375

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD  956
                          K+KYECLNCKK+F+SYQALGGHRPCHKK N   ES Y TGENSL AD
Sbjct  376   H-----------KKRKYECLNCKKTFSSYQALGGHRPCHKKINDYSESTYETGENSLGAD  424

Query  957   ETYNHGNGGKIRDCFGSKKAGATEKKV--------RPKKGKGHECPFCHRMFKSGQALGG  1112
                 + N GK ++ F +KK   + + V        +PKK KGH+CPFC R+FKSGQALGG
Sbjct  425   NDPKYINIGKHKETFSNKKPAVSTQDVPYEPEKKVKPKKSKGHKCPFCPRIFKSGQALGG  484

Query  1113  HKRSHFI  1133
             HKRSHFI
Sbjct  485   HKRSHFI  491



>ref|XP_011070953.1| PREDICTED: zinc finger protein 91-like [Sesamum indicum]
Length=543

 Score =   253 bits (646),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 223/376 (59%), Gaps = 63/376 (17%)
 Frame = +3

Query  117   SQSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG  296
             ++S+   KRYKK+VVKS S SL NN   GSSSVSEID +EQEEVA CLM+LS+DSGN  G
Sbjct  159   TRSSKSNKRYKKIVVKSPSFSLANN---GSSSVSEIDGEEQEEVAMCLMLLSRDSGNKGG  215

Query  297   --SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKM  470
               SVVE SDNNSV+LETKSSSIDM+T R+                       + P  KK+
Sbjct  216   VNSVVESSDNNSVILETKSSSIDMRTKRREAPKEV----------------DEIPQMKKI  259

Query  471   GDNRKVMKSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGFLAKCKV-----------  614
             GD  K +K S++  E+A++ +SDSGYFL E  K ESDVSV+GF                 
Sbjct  260   GDMMK-LKDSVL--EVAQADNSDSGYFLDECAKAESDVSVDGFRRNGAFGEYSKSLMNGS  316

Query  615   -----------LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK--QKRTNDTSYDPEM-  752
                        LNR K Y    R  +++E    +D+  ASNS +   +R    S +PE+ 
Sbjct  317   YEEYGAEFGHSLNRSKSY----RAELKRELVKENDYNTASNSARIESRRRRYISENPELC  372

Query  753   -ETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYG  929
              E G   + +   A +   +  K KYEC NCKK+F SYQALGGHRPCHK+ N   ES Y 
Sbjct  373   NEYGRITRNEPPNAEACNISQKKSKYECFNCKKAFKSYQALGGHRPCHKRNNAFYESRYE  432

Query  930   TGENSLDADETYNHGNGGKIRDCFGSKKAGA------TEKKVRPKKGKGHECPFCHRMFK  1091
             +GENSL  D++      GK+ +   ++++ A       EKK++ KK KGH CPFC+R+FK
Sbjct  433   SGENSL--DDSTEFVTTGKLVESASNRRSSAKNSSHYVEKKIKAKKNKGHVCPFCNRVFK  490

Query  1092  SGQALGGHKRSHFIGG  1139
             +GQALGGHKRSHFIGG
Sbjct  491   NGQALGGHKRSHFIGG  506



>ref|XP_009791314.1| PREDICTED: uncharacterized protein LOC104238609 [Nicotiana sylvestris]
Length=548

 Score =   251 bits (640),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 224/377 (59%), Gaps = 72/377 (19%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG---SVVE  308
             KRY K   KS S  L NN S  SSSVSEIDEQ+QEEVAKCLMMLS DSGNW G   SVVE
Sbjct  165   KRYNK--SKSSSFCLVNNRSF-SSSVSEIDEQDQEEVAKCLMMLSMDSGNWNGVINSVVE  221

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVV E+KSSS+DMK +RK+     +                  P +KK  D  + 
Sbjct  222   SSDNNSVVFESKSSSVDMKIARKDSLKYADSLDGT-------------PRSKKKAD--RN  266

Query  489   MKSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGFLAKC-------------------  608
             +K ++++ E+ +S++SDSGYFL E   VESD SV+ F  K                    
Sbjct  267   LKLNVLNGEV-QSENSDSGYFLDEYMNVESDASVDEFHRKYNYQRNTSNKSLGVWYDESR  325

Query  609   ----KVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEMETGSY  767
                 K LNR+K ++   R G  K+Y+ Y+ +G+ASN  K   +KR  D+SY  E+   S+
Sbjct  326   IDEEKGLNRMKKHITDIRNGSTKDYK-YNCYGMASNLVKCESRKRNKDSSYHSELGNESF  384

Query  768   -KKTKVVAASSPGT--NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE  938
              KK K+    + G+     KKKYEC NCKK+F+SYQALGGHRPC KK N  +ES Y T E
Sbjct  385   NKKIKLGFKGAEGSKHTQKKKKYECFNCKKTFSSYQALGGHRPCTKKINTYIESKYETNE  444

Query  939   NSLDADETYNHGNGGKIRDCFGSKKAGA--------TEKKVRPKKGKGHECPFCHRMFKS  1094
             NS DAD           R+ F +KK  A         EKK++ KK KGHECPFC+RMFKS
Sbjct  445   NSRDAD-----------RETFSNKKPAAHTQDISYNPEKKMKAKKFKGHECPFCNRMFKS  493

Query  1095  GQALGGHKRSHFIGGAQ  1145
             GQALGGHKRSHF+ G+Q
Sbjct  494   GQALGGHKRSHFLTGSQ  510



>ref|XP_011075585.1| PREDICTED: uncharacterized protein LOC105160026 [Sesamum indicum]
Length=553

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 212/365 (58%), Gaps = 49/365 (13%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEF  311
             KRYKK+V KS   SL NN   GSSSVSEID QEQEE+A CLM+LS+DSGN  G  SVVE 
Sbjct  167   KRYKKIVDKSPCFSLANN---GSSSVSEIDGQEQEEIAMCLMLLSRDSGNKGGVNSVVES  223

Query  312   SDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVM  491
             SDNNSVVLETKSSSI+M+T +K      +            N +   P   K G+  K +
Sbjct  224   SDNNSVVLETKSSSIEMRTGKKESLDCIH------------NLDEVIPAATKFGN--KKL  269

Query  492   KSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGF-----LAKCK-----VLNRVKGYV  638
             K S +  E+A+ ++SDSGYFL E  K ESDVSV+GF      ++CK     V  R + Y 
Sbjct  270   KDSTIDAEIAQMENSDSGYFLDECAKAESDVSVDGFRRYGGFSECKKPAMSVEERDEEYG  329

Query  639   EPRRGGVE----------KEYENYDDFGVASN----SGKQKRTNDTSYDPEMETGSYKKT  776
                R  ++          KE E YDD G+ASN      ++++ +  + +P  E+    K 
Sbjct  330   AGFRKSLKVIKTELSKSSKENE-YDDDGMASNFAGIESRKRKYSSQNPEPWNESAKIMKK  388

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD  956
                 A     +  + KYEC NCKK+F SYQALGGHRPCHK+TN   ES Y +GENSLD  
Sbjct  389   STPNAELCNNSPKRSKYECFNCKKTFKSYQALGGHRPCHKRTNTFYESRYESGENSLDDS  448

Query  957   ETYNHGN----GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRS  1124
               Y   N        R       +   EK  +PKK KGH CPFC+R+FK+GQALGGHKRS
Sbjct  449   TDYRTTNKIVESSTNRKSSSKNSSRYAEKMPKPKKNKGHVCPFCNRVFKNGQALGGHKRS  508

Query  1125  HFIGG  1139
             HFIGG
Sbjct  509   HFIGG  513



>ref|XP_009590895.1| PREDICTED: uncharacterized protein LOC104087998 [Nicotiana tomentosiformis]
Length=545

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 213/377 (56%), Gaps = 72/377 (19%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG---SVVE  308
             KRY K   KS S  L NN S  SSSVSEIDEQ+QEEVAKCLMMLS DSG W G   SVVE
Sbjct  165   KRYNK--SKSSSFCLVNNRSF-SSSVSEIDEQDQEEVAKCLMMLSMDSGKWNGVINSVVE  221

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVV E+KSSS+DM+ SRK+                  +N    P +KK  D    
Sbjct  222   SSDNNSVVFESKSSSVDMRISRKDSLKCA-------------DNVDGTPRSKKKADRNLT  268

Query  489   MKSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGFLAK---------------C----  608
             +    V +   +S++SDSGYFL +   VESD SV+ F  K               C    
Sbjct  269   LN---VLSAEVQSENSDSGYFLDDYMNVESDASVDEFHRKHNYQRNTSNKSHGVWCDESR  325

Query  609   ----KVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEMETGSY  767
                 K LNR+K  +   R    K+Y+ YD +G+ SN  K   +KR  D+SY  E+   S+
Sbjct  326   IDEGKDLNRMKKCITELRNASSKDYK-YDSYGMTSNLVKCESRKRNKDSSYHSELGNESF  384

Query  768   KKTKV---VAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE  938
                K+   +  +    +  KKKYEC NCKK+F+SYQALGGHRPC KKTN  +ES Y T E
Sbjct  385   NNKKINLGLKGAEGIKHTQKKKYECFNCKKTFSSYQALGGHRPCTKKTNAYIESKYETNE  444

Query  939   NSLDADETYNHGNGGKIRDCFGSKK--AGATEKKVRPK------KGKGHECPFCHRMFKS  1094
             N+ DAD           R+ F +KK  A A +    P+      K KGHECPFC+RMFKS
Sbjct  445   NNRDAD-----------RETFSNKKPVAHARDLSYNPEKKMKAKKFKGHECPFCNRMFKS  493

Query  1095  GQALGGHKRSHFIGGAQ  1145
             GQALGGHKRSHFI G+Q
Sbjct  494   GQALGGHKRSHFITGSQ  510



>dbj|BAA20137.1| ZPT4-3 [Petunia x hybrida]
Length=554

 Score =   243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 187/370 (51%), Positives = 222/370 (60%), Gaps = 61/370 (16%)
 Frame = +3

Query  138   KRYKKLVVK--SYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNW--YGSVV  305
             KRYK +VVK  S+ L  ++  +  SSSVSEIDEQEQEEVAK LM LS+DS  W    SV 
Sbjct  172   KRYKTIVVKPSSFCLVNSSTVNNSSSSVSEIDEQEQEEVAKSLMKLSRDSRIWNCVTSVD  231

Query  306   EFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRK  485
             E SDNNSVVLETKSSS DM+  RK+                R  N+ + PPTK   D  +
Sbjct  232   ESSDNNSVVLETKSSSTDMRFGRKDSLK-------------RVYNQDETPPTKNKED--R  276

Query  486   VMKSSIVHTEMAESQSSDSGYFLGENK-VESDVSVNGF---------------LAKC---  608
              +K S+   E A+S+SSDS YFL EN  VESDVSV+GF                A C   
Sbjct  277   NLKLSVSDAE-AQSESSDSAYFLEENAIVESDVSVDGFGINGNSKWITSKMSNAAWCDES  335

Query  609   -----KVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGK---QKRTNDTSYDPEMETGS  764
                  K LNR K         + +E E+ DD+ ++S   K   +KR  D+SY PE+   S
Sbjct  336   RTHKEKGLNRNKRNTIDSSKDITEECED-DDYWLSSYEDKCEPRKRLRDSSYHPELGNES  394

Query  765   YKKTKVVAASSPGTNA--NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE  938
             YKK K+    S G     NKKKYECLNCKK F SYQALGGHRPCHKK N  +ES  GTGE
Sbjct  395   YKKMKLSHKGSEGCKKIHNKKKYECLNCKKIFGSYQALGGHRPCHKKANSYVESINGTGE  454

Query  939   NSLDADETYNHGNGGKIRDCFGSKKAGA--TEKKVRPKKGKGHECPFCHRMFKSGQALGG  1112
             NSLDAD      + GK    F + K  +   EKK++PKK KGHECP+C R+FKSGQALGG
Sbjct  455   NSLDAD------HDGKP---FSAVKEPSYNPEKKIKPKKVKGHECPYCDRVFKSGQALGG  505

Query  1113  HKRSHFIGGA  1142
             HKRSHFIGG+
Sbjct  506   HKRSHFIGGS  515



>ref|XP_009761680.1| PREDICTED: zinc finger protein 655-like [Nicotiana sylvestris]
Length=529

 Score =   239 bits (611),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 196/412 (48%), Positives = 241/412 (58%), Gaps = 74/412 (18%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYG--SVVE  308
             KRYKK++VKS S+   NNN   SSSVSEID EQEQEEVAKCLMMLS+DSG W G  SVVE
Sbjct  155   KRYKKIIVKS-SICKVNNNYNCSSSVSEIDHEQEQEEVAKCLMMLSRDSGIWNGVNSVVE  213

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNS+VLETKSSS DM+ +R N                   N+ + P TKK  D  + 
Sbjct  214   SSDNNSIVLETKSSSNDMRNARNNSLKCVY-------------NQGEQPRTKKKED--RN  258

Query  489   MKSSIVHTEMAESQSSDSGYFLGEN-KVESDVSVNGFLAK--CKV---------------  614
             +K  ++ TE  +S++SDS YFLGEN KV+SD SV  F     CK                
Sbjct  259   LKCDMLDTE-TQSENSDSDYFLGENGKVDSDGSVERFRGNGNCKWSTSKVSLGAWLDERR  317

Query  615   ------LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKT  776
                   LNR+K Y+   R  + K+YE +  +G ASN  K +                  +
Sbjct  318   NDEKKSLNRIKRYLTESRKDLSKKYE-HGGYGSASNFDKCE------------------S  358

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD  956
             +            K+KYECLNCKK+F+SYQALGGHRPCH+KTN   ES Y TGENSL AD
Sbjct  359   RKGITDRHKKIHKKRKYECLNCKKNFSSYQALGGHRPCHRKTNDYPESRYETGENSLGAD  418

Query  957   ETYNHGNGGKIRDCFGSKKAGATEKKV--------RPKKGKGHECPFCHRMFKSGQALGG  1112
                   N  K ++ + +KK   + + V        +PKK KGH+CPFC R+FKSGQALGG
Sbjct  419   NDTKCINISKHKETYSNKKPAVSTQDVPYEPEKKVKPKKSKGHKCPFCPRIFKSGQALGG  478

Query  1113  HKRSHFIGGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDE--QLMAW  1262
             HKRSHFI  A+V   +    +A K E ADLLDLNLPAPV+DEDDE  + M+W
Sbjct  479   HKRSHFI-HARVSEENFNQSSAVKREVADLLDLNLPAPVDDEDDEHARFMSW  529



>ref|XP_004228405.1| PREDICTED: zinc finger protein 91-like [Solanum lycopersicum]
Length=577

 Score =   240 bits (613),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 243/423 (57%), Gaps = 77/423 (18%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDE-QEQEEVAKCLMMLSKDSGNWYG--SVVE  308
             KRY K+VVKS       NN   SSSVSEID+ QEQEE+AKCL+MLS+DS +W G  S+VE
Sbjct  184   KRYNKIVVKS-------NNYNCSSSVSEIDQVQEQEELAKCLIMLSRDSRSWNGVDSLVE  236

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNS +LETK SS DM+ +                   R  N+ + P  KK GD   +
Sbjct  237   TSDNNSAILETKPSSSDMRNN------------ARKNGVKRVYNQDEKPRMKKEGDT--I  282

Query  489   MKSSIVHTEMAESQSSDSGYFLGEN-KVESDVSVNGFLAKCKV-----------------  614
              K  ++  E  +S++SDS Y+LGEN  +ESD SV  +L   K                  
Sbjct  283   TKIDMLEGE-TQSENSDSDYYLGENGNIESDGSVERYLGNGKGKWNTSKMSFAAWLNENL  341

Query  615   ------LNRVKGYVEPRRGGVEKEYENYDDFGVASNS---GKQKRTNDTSYDPEMETGSY  767
                   +NR+K Y+   R  + K+ E  D +G+ASNS     +KR  D   D E+   S 
Sbjct  342   SDEKNGINRIKQYITESRKNLGKKCER-DGYGLASNSYICESKKRAMDPYNDLEIRNDS-  399

Query  768   KKTKVVAASSPGTNAN---KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE  938
             KK K+   S  G   +    +KYECLNCKK F+SYQALGGHRPCHKK +   ES Y TGE
Sbjct  400   KKMKLCVKSPEGYKNDIHKTRKYECLNCKKVFSSYQALGGHRPCHKKVHDYSESTYETGE  459

Query  939   NSLDADETYNHGNG-----GKIRDCFGSKKAGA--------TEKKVRPKKGKGHECPFCH  1079
             NSL AD    H +      GK RD F +KK            E KV+ KK KGH+CPFC+
Sbjct  460   NSLGAD----HNDPKCTKLGKHRDVFRNKKQVVPSQDLPYEPEIKVKTKKSKGHKCPFCY  515

Query  1080  RMFKSGQALGGHKRSHFIGGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDE--QL  1253
             RMFKSGQALGGHKRSHFI G+   N + Q+ +A K E  DLLDLNLPAPV++ED+E  + 
Sbjct  516   RMFKSGQALGGHKRSHFINGSDQENLNQQS-SAVKREVVDLLDLNLPAPVDEEDEEHARY  574

Query  1254  MAW  1262
             M+W
Sbjct  575   MSW  577



>ref|XP_006365137.1| PREDICTED: uncharacterized protein LOC102597521 [Solanum tuberosum]
Length=574

 Score =   228 bits (582),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 192/419 (46%), Positives = 241/419 (58%), Gaps = 69/419 (16%)
 Frame = +3

Query  138   KRYKKLVVKSYSLSLTNNNSIGSSSVSEIDE-QEQEEVAKCLMMLSKDSGNWYG--SVVE  308
             KRY K+VVKS       NN   SSSVSEID+ QEQEE+AKCL+MLS+DS +W G  S+VE
Sbjct  181   KRYNKIVVKS-------NNYNCSSSVSEIDQVQEQEELAKCLIMLSRDSRSWNGVNSLVE  233

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNS +LETK SS DM+ +                   R  N+ +    KK GD  ++
Sbjct  234   TSDNNSAILETKPSSSDMRNN------------ARKNGVKRVYNQDEKLRMKKEGD--RI  279

Query  489   MKSSIVHTEMAESQSSDSGYFLGEN-KVESDVSVNGFLA---------------------  602
              K  ++  E  +S++SDS Y+LGEN  VESD SV  F+                      
Sbjct  280   TKIDMLEAE-TQSENSDSDYYLGENGNVESDGSVERFVGNGKGKWSTSKMSFQAWLDEHR  338

Query  603   --KCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNS---GKQKRTNDTSYDPEMETGSY  767
               + K ++R+K Y+      + K++E  D +G+ASNS     +KRT D   D E+    Y
Sbjct  339   MDEKKGISRIKQYITESSKDLGKKFER-DGYGLASNSYICESKKRTTDRYNDLEIRN-DY  396

Query  768   KKTKVVAASSPGTNAN---KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE  938
             KK K    S  G   +    +KYECLNCKK F+SYQALGGHRPCHKK N   ES Y TGE
Sbjct  397   KKMKFGVKSPEGYKNDIHKTRKYECLNCKKVFSSYQALGGHRPCHKKVNDYSESTYETGE  456

Query  939   NSLDADETYNHGNG-GKIRDCFGSKKAGATEKKV--------RPKKGKGHECPFCHRMFK  1091
             NSL AD         GK RD F +KK     + +        +PKK KGH+CPFC RMFK
Sbjct  457   NSLGADHNDPKCTKIGKHRDVFRNKKQVVPSQNLPYEPEKKVKPKKSKGHKCPFCDRMFK  516

Query  1092  SGQALGGHKRSHFIGGAQVINGSHQTpaaakeeaadlldlnlpapVEDEDDE--QLMAW  1262
             SGQALGGHKRSHFI G    N + Q+ +A K E ADLLDLNLPAPV++ED+E  + M+W
Sbjct  517   SGQALGGHKRSHFINGGDQENFNQQS-SAVKREVADLLDLNLPAPVDEEDEEHARFMSW  574



>gb|EYU28846.1| hypothetical protein MIMGU_mgv1a024011mg [Erythranthe guttata]
Length=513

 Score =   187 bits (475),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 191/355 (54%), Gaps = 67/355 (19%)
 Frame = +3

Query  141   RYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG-------NWYGS  299
             RYKKLV  S S +L NNN  GSSSV+EID  +QEEVA CLMMLSKDSG           S
Sbjct  161   RYKKLVDNS-SFNLGNNN--GSSSVTEIDGVDQEEVAMCLMMLSKDSGCNKGGGGGGVNS  217

Query  300   VVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDN  479
             VVE SDNNSVVLETKSSSI+M   RK     G             +N+ +    KK+   
Sbjct  218   VVESSDNNSVVLETKSSSIEMIIGRKESVSYG-------------HNQNEASQIKKLN--  262

Query  480   RKVMKSSIVHTEMAESQSSDSGYFLGE-NKVESDVSVNGFLAKCKVLNRVKGYVEPRRGG  656
                  ++    E+ ++++SDSGYFL E  K ESDVSV+GF        R  G+ E ++  
Sbjct  263   -----ATSFGEEIEKTENSDSGYFLDECAKAESDVSVDGF-------RRYGGFGEFKKSS  310

Query  657   --VEKEYENYDDFG-----VASN----SGKQKRTNDTSYDPEMETGSYKKTKVVAASSPG  803
               ++ EY + DD+      +ASN    + + ++    S +PE   GS KK+K        
Sbjct  311   KLIKNEYADGDDYDDDNGVMASNLVARTDQSRKRKYGSENPEPRNGSPKKSK--------  362

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGG  983
                    YEC NCKK F SYQALGGHRPCHK+ N   ES Y +  NS +    Y      
Sbjct  363   -------YECFNCKKVFKSYQALGGHRPCHKRVNEFQESRYESVRNSQEDSTNYKKLVEP  415

Query  984   KIRDCFGSKKAGATEKKVRPKKGK---GHECPFCHRMFKSGQALGGHKRSHFIGG  1139
                    +KK   +    +  K K   GH CPFC R+FK+GQALGGHKRSHFIGG
Sbjct  416   SSSKKPSAKKLATSHNAEKKNKAKKSKGHVCPFCDRVFKNGQALGGHKRSHFIGG  470



>ref|XP_007227675.1| hypothetical protein PRUPE_ppa025764mg [Prunus persica]
 gb|EMJ28874.1| hypothetical protein PRUPE_ppa025764mg [Prunus persica]
Length=547

 Score =   182 bits (462),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 199/364 (55%), Gaps = 62/364 (17%)
 Frame = +3

Query  159   VKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVV  332
             +K  +L + ++ + GSSS S + EQEQ+EVA  LMMLS+DSG+  G  S  E SDNNSVV
Sbjct  170   MKYQNLDVHSSMANGSSSGSGV-EQEQQEVAISLMMLSRDSGHKGGLNSFAESSDNNSVV  228

Query  333   LETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNR---KVMKSSI  503
             LETKSSSIDM+ S + G    +    +                  MG  R   K +KS  
Sbjct  229   LETKSSSIDMRISAEQGLNCASKVNDI------------------MGMKRARDKKLKSE-  269

Query  504   VHTEMAESQSSDSGYFLGE-NKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENY  680
                E+  S +SDSGYF  E  KVESDVSV+GF+   +  ++V+     +  G    YE+Y
Sbjct  270   ---EITVSDNSDSGYFRHEPKKVESDVSVDGFIRNGE-FHKVRAEFGSKFEG----YESY  321

Query  681   D-----DFGVASNSGKQKRTNDTSYDPEMETG-----SYKKTKVVAASSPGTNAN-----  815
             D      F + S  GK   + + ++  ++  G     + +KT       P TN +     
Sbjct  322   DVKLRRGFHMKSEMGKDHLSREEAHPDQVHRGGSLKYALRKTTKNGFHRPFTNGSTNVEV  381

Query  816   ------KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN  977
                     KYECL CKK+F+S++ALGGHR  H KTN   ES Y +GENS+D D +     
Sbjct  382   CRNARKSSKYECLTCKKTFHSHRALGGHRASHTKTNGYSESMYESGENSIDTDVSPVPTP  441

Query  978   GGKIRD-CFGSKK------AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
               K+ + C G +       +G+ ++    KK KGHECPFC ++F+SGQALGGHKRSHF+G
Sbjct  442   ESKLVEPCSGKRPIDENVLSGSAKRNSGSKKSKGHECPFCFKVFRSGQALGGHKRSHFVG  501

Query  1137  GAQV  1148
             G +V
Sbjct  502   GCEV  505



>ref|XP_008221523.1| PREDICTED: uncharacterized protein LOC103321496 [Prunus mume]
Length=548

 Score =   182 bits (461),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 142/367 (39%), Positives = 198/367 (54%), Gaps = 69/367 (19%)
 Frame = +3

Query  159   VKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVV  332
             +K  +L + ++ + GSSS S + EQEQ+EVA  LMMLS+DSG+  G  S  E SDNNSVV
Sbjct  172   MKYQNLDVYSSMANGSSSGSGV-EQEQQEVAISLMMLSRDSGHKGGLNSFAESSDNNSVV  230

Query  333   LETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHT  512
             LETKSSSIDM+ S + G    +    +                  MG  R   +   + +
Sbjct  231   LETKSSSIDMRISTEQGLNCASKVNDI------------------MGMKR--ARDEKLKS  270

Query  513   EMAESQSSDSGYFLGE-NKVESDVSVNGFL-------AKCKVLNRVKGY----VEPRRGG  656
             E+  S +SDSGYF  E  KVESDVSV+GF+        + +  ++ +GY    V+ RRG 
Sbjct  271   EITVSDNSDSGYFRREPKKVESDVSVDGFIRNGEFHKVRAEFGSKFEGYESNDVKLRRG-  329

Query  657   VEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETG-----SYKKTKVVAASSPGTNAN--  815
                       F + S  GK   + + ++  ++  G     + +KT       P TN +  
Sbjct  330   ----------FHMKSEMGKDLLSREEAHPDQVHRGGSLKYALRKTTKNGFHRPFTNGSTN  379

Query  816   ---------KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYN  968
                        KYECL CKK+F+S++ALGGHR  H KTN   ES Y +GENS+D D +  
Sbjct  380   VEVCRNARKSSKYECLTCKKTFHSHRALGGHRASHTKTNGYSESMYESGENSIDTDVSPV  439

Query  969   HGNGGKIRD-CFGSKK------AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSH  1127
                  K+ + C G +       +G+ ++    KK KGHECPFC ++F+SGQALGGHKRSH
Sbjct  440   PTPESKLVEPCSGKRPIDENVLSGSAKRNSGSKKSKGHECPFCFKVFRSGQALGGHKRSH  499

Query  1128  FIGGAQV  1148
             F+GG +V
Sbjct  500   FVGGCEV  506



>ref|XP_008389420.1| PREDICTED: uncharacterized protein LOC103451771 [Malus domestica]
Length=567

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 181/346 (52%), Gaps = 66/346 (19%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngng  401
             EQEQ+EVA  LMMLS+DSG   G  S  E SDNNSV+LE KSSSIDM+ +          
Sbjct  204   EQEQQEVALSLMMLSRDSGGKGGLNSFAESSDNNSVILEAKSSSIDMRIN----------  253

Query  402   kgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGEN--KVES  575
                      ++        +  MG  R V +  +   E+  S +SDSGYF  E   KV+S
Sbjct  254   --------TKEGLNCAYKVSDVMGMKR-VREKKLKSEEIEVSDNSDSGYFRHEQPKKVDS  304

Query  576   DVSVNGFL-------AKCKVLNRVKGY----VEPRRG-GVEKEY-------------ENY  680
             DVSV+GF         + +  +R++GY    V+ R+G  VE E              + +
Sbjct  305   DVSVDGFFRNGEFHKGRAEFGSRIEGYESYDVKLRKGFRVESELGKDVSNAEARSPDQVH  364

Query  681   DDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKK-KYECLNCKKSFN  857
              D G    + ++   N T + P ++  S           P  NA K  KYECL C K+F+
Sbjct  365   RDRGTLKYALRKTTKNTTFHRPIVDDSS--------NVEPCRNARKSGKYECLTCNKTFH  416

Query  858   SYQALGGHRPCHKKTNPDMESGYGTGENSLDADET-YNHGNGGKIRD--CFGSKK-----  1013
             S++ALGGHR  H KTN   ES Y +GENS+D D +        K+ D  C G K      
Sbjct  417   SHRALGGHRASHTKTNAYSESIYESGENSVDTDPSPVLTPESSKLADQHCSGKKPMNDQD  476

Query  1014  -AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
              +G+ ++    KK KGHECPFC ++FKSGQALGGHKRSHF+GG +V
Sbjct  477   FSGSAKRSSETKKSKGHECPFCFKVFKSGQALGGHKRSHFVGGCEV  522



>ref|XP_009356378.1| PREDICTED: uncharacterized protein LOC103947235 [Pyrus x bretschneideri]
Length=566

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 142/353 (40%), Positives = 184/353 (52%), Gaps = 80/353 (23%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngng  401
             EQEQ+EVA  LMMLS+DSG   G  S  E SDNNSV+LE KSSSIDM             
Sbjct  203   EQEQQEVALSLMMLSRDSGGKGGLNSFAESSDNNSVILEAKSSSIDM-------------  249

Query  402   kgvvykvcnRDNNETQNPPTKKMGD---NRKVMKSSIVHTEMAESQSSDSGYFLGEN--K  566
                      R N +     T K+ D    ++V +  +   E+  S +SDSGYF  E   K
Sbjct  250   ---------RINTKEGLNCTYKVSDVMGMKRVREKKLKSEEIEVSDNSDSGYFRHEQPKK  300

Query  567   VESDVSVNGFL-------AKCKVLNRVKGY----VEPRRGGVEKEYENYDDFGVASNSGK  713
             V+SDVSV+GF         + +  +R+ GY    V+ R+G           F V S  GK
Sbjct  301   VDSDVSVDGFFRNGEFHKGRAEFGSRIVGYESYDVKLRKG-----------FRVESELGK  349

Query  714   QKRTNDTSYDPEM---ETGSYKKT------------KVVAASS---PGTNANKK-KYECL  836
             +  +N  +  P+    + G+ K T             +V  SS   P  NA K  KYECL
Sbjct  350   EV-SNAEARSPDQVHRDRGTMKYTLRKTTKNATFHRPIVDDSSNVEPCRNARKSGKYECL  408

Query  837   NCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADET-YNHGNGGKIRD--CFGS  1007
              C K+F+S++ALGGHR  H KTN   ES Y +GENS+D D +        K+ D  C G 
Sbjct  409   TCNKTFHSHRALGGHRASHTKTNAYSESMYESGENSIDTDPSPVPTPESSKLADQHCSGK  468

Query  1008  KK------AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
             K       +G+ ++    KK KGHECPFC ++FKSGQALGGHKRSHF+GG +V
Sbjct  469   KPMNDQDFSGSAKRSSGTKKSKGHECPFCFKVFKSGQALGGHKRSHFVGGCEV  521



>ref|XP_007045914.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
 gb|EOY01746.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
Length=534

 Score =   175 bits (443),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 152/371 (41%), Positives = 197/371 (53%), Gaps = 78/371 (21%)
 Frame = +3

Query  144   YKKL-VVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFS  314
             YK + V  + S+SL N    GSSS SEI EQEQEEVA CLMMLS+D+G   G  SV + S
Sbjct  167   YKTIGVYSNNSVSLAN----GSSSASEI-EQEQEEVAMCLMMLSRDAGCKKGLNSVADSS  221

Query  315   DNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMK  494
             DNNSVVLE KSSSID+K + K                    N+T+       GD  K+  
Sbjct  222   DNNSVVLEAKSSSIDLKITIK--------------------NDTK--CVSNGGDFLKMKM  259

Query  495   SSIVHTEMAES----QSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGV  659
                   + A+S    ++SDSGYF  G  KVESDVSV+GFL     L ++K  VE   G  
Sbjct  260   PRDCKLKSAKSGPSSENSDSGYFTNGPKKVESDVSVDGFLRNVG-LKKLK--VESGSG--  314

Query  660   EKEYENYD-DFGVASNSGK-----------------QKRTNDTSYDPEMETG-SYKKTKV  782
                +E++D   G +S++ K                 Q     T YD        Y   + 
Sbjct  315   ---FEDFDAKIGKSSSNFKCMKAEFPKDLVSEVGDNQADRALTKYDLRKSAKKDYYSPEF  371

Query  783   VAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSL-----  947
             +  +SP  N    KYECL C K+F+S++ALGGHR  H K N   ES + +GE+SL     
Sbjct  372   LCNNSPKGN----KYECLTCNKTFDSHRALGGHRASHTKVNDCSESIHESGEDSLANDSF  427

Query  948   -----DADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGG  1112
                  D+  T +  +   +    GS  +G  EK++  KK KGHECPFC R+FKSGQALGG
Sbjct  428   PVPMTDSKVTKSSHHNKSLSTPRGS--SGNAEKRLGSKKNKGHECPFCFRVFKSGQALGG  485

Query  1113  HKRSHFIGGAQ  1145
             HKRSHF+GG++
Sbjct  486   HKRSHFVGGSE  496



>gb|EYU22378.1| hypothetical protein MIMGU_mgv1a018487mg, partial [Erythranthe 
guttata]
Length=467

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 164/312 (53%), Gaps = 75/312 (24%)
 Frame = +3

Query  219   EIDEQEQEEVAKCLMMLSKDSGN----WYGSVVEFSDNNSVVLETKSSSIDMKTSRkngn  386
             EID +E EEVA CLMMLS+DSGN       SVVE SDNNSV+LETKSSSID+K       
Sbjct  201   EIDGEENEEVAMCLMMLSRDSGNNNKGGVNSVVESSDNNSVILETKSSSIDIK-------  253

Query  387   gngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGE-N  563
                       K+ N +NN  Q   TKK+ +         VH +      SDSGYFL E +
Sbjct  254   ----------KIHNNNNNSNQENKTKKIDE---------VHND------SDSGYFLDECS  288

Query  564   KVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYD  743
             K ESD SV+GF         +  Y E            YD+       G  + +    Y 
Sbjct  289   KYESDASVDGFRRN------IPSYFE------------YDNKPSMKTRGGDESSRKRRYI  330

Query  744   PEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESG  923
             PE     Y +              + KYEC NCKK+F SYQALGGHRPCHK++    E+ 
Sbjct  331   PENIPEEYTE-------------KRSKYECFNCKKTFKSYQALGGHRPCHKRSTAFYETR  377

Query  924   YGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQA  1103
             Y +GENSL+    +   N         ++K  + EKK++ KK K H CPFC R+FK+GQA
Sbjct  378   YESGENSLEGSTEFVANNNS-----LSNRK--SIEKKMKGKKNKPHVCPFCDRVFKNGQA  430

Query  1104  LGGHKRSHFIGG  1139
             LGGHKRSHFIGG
Sbjct  431   LGGHKRSHFIGG  442



>ref|XP_002274495.1| PREDICTED: uncharacterized protein LOC100245765 [Vitis vinifera]
Length=522

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 183/352 (52%), Gaps = 72/352 (20%)
 Frame = +3

Query  204   SSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRk  377
             S SVS+  EQEQ+E+A CLMMLS+DSG+W G  S+V  SDNNSVVLE KSSSIDM+  R 
Sbjct  158   SPSVSDT-EQEQQELAICLMMLSRDSGHWGGLNSLVYSSDNNSVVLEAKSSSIDMRICRG  216

Query  378   ngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-  554
                   +           D +E     TKK+GD +   KS+++ +E    ++SDSGYF+ 
Sbjct  217   EDMNCVS-----------DGDEIVE--TKKLGDGKS--KSAVLDSEAGPFENSDSGYFMN  261

Query  555   GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYEN---YDDFGVASNSG-KQKR  722
             G  +VESDVSV+G     + L              E + E+   +D FG  S  G K+ +
Sbjct  262   GAQRVESDVSVDGVFRNVESL--------------ELKLEDGSGFDVFGAESGKGLKRLK  307

Query  723   TNDTSYDPEMETGSYKKTKV------------VAASSPGTNANKK---------------  821
                     +++     KT++            V  +S   + +K+               
Sbjct  308   CMKAGLGKDLKRPKCVKTELGKGLLKQEGYDRVNRASVEYDLSKRAKNDSYSEENVRKRS  367

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY+CL C K+F+S+QALGGHR  HK+      S Y + ENS++ D         K+   F
Sbjct  368   KYQCLTCNKTFHSHQALGGHRANHKRVEGCNSSNYESIENSIETDTCPGPTPHKKLAR-F  426

Query  1002  GSKK-------AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
             GS K       +G  EKK+  +K  GH CP C ++F+SGQALGGHK+SHF+G
Sbjct  427   GSGKTPIAQDLSGKAEKKIGSRKSNGHMCPICFKVFRSGQALGGHKKSHFVG  478



>emb|CAN60166.1| hypothetical protein VITISV_040088 [Vitis vinifera]
Length=509

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 130/352 (37%), Positives = 182/352 (52%), Gaps = 72/352 (20%)
 Frame = +3

Query  204   SSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRk  377
             S SVS+   QEQ+E+A CLMMLS+DSG+W G  S+V  SDNNSVVLE KSSSIDM+  R 
Sbjct  145   SPSVSDT-XQEQQELAICLMMLSRDSGHWGGLNSLVYSSDNNSVVLEAKSSSIDMRICRG  203

Query  378   ngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-  554
                   +           D +E     TKK+GD +   KS+++ +E    ++SDSGYF+ 
Sbjct  204   EDMNCVS-----------DGDEIVE--TKKLGDGKS--KSAVLDSEAGPFENSDSGYFMN  248

Query  555   GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYEN---YDDFGVASNSG-KQKR  722
             G  +VESDVSV+G     + L              E + E+   +D FG  S  G K+ +
Sbjct  249   GAQRVESDVSVDGVFRNVESL--------------ELKLEDGSGFDVFGAESGKGLKRLK  294

Query  723   TNDTSYDPEMETGSYKKTKV------------VAASSPGTNANKK---------------  821
                     +++     KT++            V  +S   + +K+               
Sbjct  295   CMKAGLGKDLKRPKCVKTELGKGLLKQEGYDRVNRASVEYDLSKRAKNDSYSEENVRKRS  354

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY+CL C K+F+S+QALGGHR  HK+      S Y + ENS++ D         K+   F
Sbjct  355   KYQCLTCNKTFHSHQALGGHRANHKRVEGCNSSNYESIENSIETDTCPGPTPHKKLAR-F  413

Query  1002  GSKK-------AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
             GS K       +G  EKK+  +K  GH CP C ++F+SGQALGGHK+SHF+G
Sbjct  414   GSGKTPIAQDLSGKAEKKIGSRKSNGHMCPICFKVFRSGQALGGHKKSHFVG  465



>ref|XP_004298386.1| PREDICTED: uncharacterized protein LOC101291428 [Fragaria vesca 
subsp. vesca]
Length=564

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 133/342 (39%), Positives = 178/342 (52%), Gaps = 65/342 (19%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngng  401
             EQEQ+EVA  LMMLS+DSG   G  S  E SDNNSV+LE KSSSIDM+ S K G      
Sbjct  190   EQEQQEVAISLMMLSRDSGYKGGLNSFGESSDNNSVILEGKSSSIDMRISTKRGL-----  244

Query  402   kgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENK-VESD  578
                           +       + D ++V +  + + E+  S +SDSGY + E K VESD
Sbjct  245   --------------SYGAKVSDVMDLKRVREKKLKYEEVTVSDNSDSGYHIHEPKRVESD  290

Query  579   VSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYD-----DFGVASNSGKQKRTNDTSYD  743
             VSV+GF+ K +   + +       GG    YE YD      FG+ S   K+    + +Y+
Sbjct  291   VSVDGFVRKGE-FKKYRAEFGSGFGG----YETYDVKSRRGFGIKSEMVKELAKEEETYE  345

Query  744   PEMETGS-----------YKKTKVVAASSPGTNANKKKY---ECLNCKKSFNSYQALGGH  881
                 + S           + +     +SS     N KK    ECL C K+F+S++ALGGH
Sbjct  346   LVDRSSSKYALRKSIKNGFHRPFTSGSSSVEVYKNVKKSSKCECLTCNKTFHSHRALGGH  405

Query  882   RPCHKKTNPDMESGYGTGENSLDADETY-----------NHGNGGK--IRDCFGSKKAGA  1022
             R  H K+N   ES Y +GENS+D+DE+            N    GK  I    G+K+   
Sbjct  406   RASHTKSNGYYESMYESGENSIDSDESPIPTPQSKHVEDNKPYKGKTPINQDLGAKRNSG  465

Query  1023  TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
             +      K+ KGHECPFC ++FKSGQALGGHKRSHF+GG +V
Sbjct  466   S------KRSKGHECPFCFKVFKSGQALGGHKRSHFVGGCEV  501



>ref|XP_010259244.1| PREDICTED: uncharacterized protein LOC104598750 [Nelumbo nucifera]
Length=582

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 178/359 (50%), Gaps = 61/359 (17%)
 Frame = +3

Query  213   VSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngn  386
             VS+I EQEQEEVA CLMMLS+D G+W G  SV E+SDNNSVVLE +SS    + +RK G 
Sbjct  181   VSDI-EQEQEEVAMCLMMLSRDVGHWGGLNSVAEYSDNNSVVLEARSSGFHKQVTRKGGT  239

Query  387   gngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GEN  563
                +           +  + + P  +++       +++ V    +E  +S+SG    G  
Sbjct  240   DFTSYGD--------ETMKMKKPRERRLESGASDPENAHVQKGRSECGASNSGVLRSGIK  291

Query  564   KVESDVSVNGFLA----KCKVLNRVKGY----------------VEPRRGGVEKEYENYD  683
             KVES+VS+ GF      K   ++++ G+                + P++G ++     Y 
Sbjct  292   KVESEVSLVGFPMDDEFKKPKMDKIAGFELSDMELRKDSCNKNKLSPKKGKLK-----YS  346

Query  684   DFGVASNSGKQ----------------KRTNDTSYDPEMETGSYKKTKVVAASSP--GTN  809
             +  +   S K+                KRT   +Y PE+     KK K  A  S   G +
Sbjct  347   EAELGKRSTKETGRNRTNWEYKKYNSSKRTRTDAYIPELGGDFCKKKKYDALDSEACGDS  406

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK-  986
               K ++EC  C K F+SYQALGGHR  HKK      S   + +NS++ D +       K 
Sbjct  407   QKKSRFECTTCNKIFHSYQALGGHRASHKKVKGCFASKVDSSDNSIETDASPEPTADSKL  466

Query  987   IRDC-----FGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
             +R C          AG+ E    PKK KGHECP C ++F SGQALGGHKRSH IGG++ 
Sbjct  467   VRSCSNENIIDRDVAGSVEASSGPKKSKGHECPICFKVFSSGQALGGHKRSHLIGGSEA  525



>ref|XP_010258119.1| PREDICTED: uncharacterized protein LOC104597985 [Nelumbo nucifera]
Length=581

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 131/355 (37%), Positives = 176/355 (50%), Gaps = 54/355 (15%)
 Frame = +3

Query  213   VSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngn  386
             VSEI EQEQEEVA CLMMLS+D G+W G  SV E SDNNSVVLE +SS ID + +R+ G 
Sbjct  181   VSEI-EQEQEEVAMCLMMLSRDVGHWGGLNSVGESSDNNSVVLEARSSGIDKRITRRGGK  239

Query  387   gngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQS--SDSGYFL-G  557
                +           +  + Q P  +++  +  V     VH +   S+   SDSG    G
Sbjct  240   VFTSNVY--------ETVKMQKPRNRRL--DSVVSDPENVHVDKGRSECGVSDSGVLRKG  289

Query  558   ENKVESDVSVNGFLA----KCKVLNRVKGY----VEPRRGGVEKEYE------NYDDFGV  695
               K ES+VSV+GFL     K   L+   G+    +E  R   +K +       +Y +  +
Sbjct  290   IKKGESEVSVDGFLTDDEFKKPKLDDETGFELSDMELMRKDNKKRFNCKKSTVDYSEVEL  349

Query  696   ASNSGKQ----------------KRTNDTSYDPEMETGSYKKTKVVAASSP--GTNANKK  821
               +  K+                KRT   +YDPE+     KK +     S   G    K 
Sbjct  350   GKDFVKETGKDRSDSEFKKFSFSKRTRTDAYDPELGGDFSKKIRYDDLDSEIYGETQKKS  409

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK-IRDC  998
             +YEC  C K F+SYQALGGHR  HKK      S   + ENS++ D + +     K ++ C
Sbjct  410   RYECTTCNKIFHSYQALGGHRASHKKVKGCFASKVESSENSIETDVSPDPTADSKLVKSC  469

Query  999   -----FGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                       A + E     KK KGHECP C ++F SGQALGGHKRSH +GG++ 
Sbjct  470   SNENLVDRDGAVSLEASSVSKKSKGHECPICFKVFTSGQALGGHKRSHMVGGSEA  524



>ref|XP_008339829.1| PREDICTED: uncharacterized protein LOC103402838 [Malus domestica]
Length=567

 Score =   156 bits (394),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 179/343 (52%), Gaps = 59/343 (17%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngng  401
             EQEQ+EVA CLMMLS+DSG+  G  S  E SDN SVVLE KSSSID++ S K G      
Sbjct  203   EQEQQEVAICLMMLSRDSGSKGGLNSFAESSDNTSVVLEAKSSSIDVRISTKKGMNCAY-  261

Query  402   kgvvykvcnRDNNETQNPPTKKMGD---NRKVMKSSIVHTEMAESQSSDSGYFLGEN--K  566
                                  K+ D    ++  +      EM  S +SDSGYF  E   K
Sbjct  262   ---------------------KVSDVIGMKRAREKKFNCEEMGVSDNSDSGYFRHERPKK  300

Query  567   VESDVSVNGFL-------AKCKVLNRVKGY----VEPRRG-----GVEKEYENYDDFGVA  698
             V+S+VS +GF         + +  +R++GY    V+ R+G      + K+  N +D    
Sbjct  301   VDSEVSEDGFFRNGEFHKGRAEFGSRIEGYESYDVKLRKGFRVESELGKDVXNAEDRSPD  360

Query  699   SNSGKQKRTNDTSYDPEMETGSYKKTKVVAASS--PGTNANKK-KYEC-LNCKKSFNSYQ  866
                G  +RT   +     + G++ +     +S+  P  N  K  KYEC L C K+F+S++
Sbjct  361   QVHG-DRRTLKYALRNTTKNGTFHRPIADDSSNVEPCRNTRKSGKYECLLTCNKTFHSHR  419

Query  867   ALGGHRPCHKKTNPDMESGYGTGENSLDADET-YNHGNGGKIRD--CFGSKK------AG  1019
             ALG HR  H KT    ES Y +GENS+D D +        K+ +  C G K       +G
Sbjct  420   ALGAHRASHTKTTAYSESIYESGENSMDTDPSPILTPASSKLAEQPCSGKKPMDDQDFSG  479

Query  1020  ATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
             + ++    KK KGHECPFC ++F+SGQALGGHKRSHF+GG +V
Sbjct  480   SAKRCSGSKKSKGHECPFCFKVFRSGQALGGHKRSHFVGGCEV  522



>ref|XP_010109363.1| Zinc finger protein ZAT4 [Morus notabilis]
 gb|EXC22068.1| Zinc finger protein ZAT4 [Morus notabilis]
Length=490

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 172/342 (50%), Gaps = 76/342 (22%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSGNWYG------SVVEFSDNNSVVLETKSSSIDMKTSRkngng  389
             EQEQ+EVA  LM+LS+DSG   G      S+ + SDNNSVVLE KSSSIDM         
Sbjct  149   EQEQQEVAISLMLLSRDSGYKGGLDLNLNSLADSSDNNSVVLEAKSSSIDMNM-------  201

Query  390   ngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENK  566
                             N+  N   +K       +KS +     + S++SDSGYF  G  K
Sbjct  202   ----------------NKVANFDEEK-------LKSGV---GASVSENSDSGYFRNGPKK  235

Query  567   VESDVSVNGFLA------------------KCKVLNRVKGYVEPRRGGVEKEYENYDDFG  692
             +ESDVSV+GFL                   K  + +   G +  +R  V++E ++ ++  
Sbjct  236   IESDVSVDGFLKNGEFRKLEVESGSGIGANKLGISDEKSGQL-GKRILVDEEEKDEENCR  294

Query  693   VASNSGKQKRTNDTSYDPEMETGSYK-KTKVVAASSPGTNANKK-KYECLNCKKSFNSYQ  866
              +S    +KRT +  Y  E    S K ++     S    N  K+ KYECL C K+F S++
Sbjct  295   GSSKYELRKRTKNGLYRGEALMESCKDESNYAFKSEICRNFEKRSKYECLTCNKTFKSHR  354

Query  867   ALGGHRPCHKKTNPDMESGYGTGENSLDADETY--------NHGNGGKIRDCFGSKKAGA  1022
             ALGGHR  H K N   E    +GEN+++ D +         N      IR+ F  +K+G+
Sbjct  355   ALGGHRANHSKINGCCEPICESGENNIENDNSTPEEAKIIENGAGKTPIREDFIERKSGS  414

Query  1023  TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                    KK +GHECP C RMFKSGQALGGHKRSHF+GG + 
Sbjct  415   -------KKSRGHECPICFRMFKSGQALGGHKRSHFVGGREA  449



>ref|XP_002316093.2| hypothetical protein POPTR_0010s16710g [Populus trichocarpa]
 gb|EEF02264.2| hypothetical protein POPTR_0010s16710g [Populus trichocarpa]
Length=499

 Score =   150 bits (378),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 130/352 (37%), Positives = 179/352 (51%), Gaps = 56/352 (16%)
 Frame = +3

Query  135   PKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGSVVE  308
             P+R K++  K+  +  T+      SS S+I EQEQEEVAKCLMMLSKDSG    + S+ +
Sbjct  150   PRRSKRMRYKTIDVFTTS-----LSSTSDI-EQEQEEVAKCLMMLSKDSGFKGCFSSLAD  203

Query  309   FSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSVVLE KSSS   + +  N     +                         + +K 
Sbjct  204   SSDNNSVVLEGKSSSTKTRINVNNAVNFVSSGIESL-------------------EVKKS  244

Query  489   MKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEK  665
             M+  ++ TE  +S++SDSGYF  G  KVESDVSV+GF       + +K Y        + 
Sbjct  245   MQRGVISTENDQSENSDSGYFRKGPKKVESDVSVHGFARN----DEIKKY--------KV  292

Query  666   EY-ENYDDFGVASNSGKQ----KRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYE  830
             E+  +YDD  + + SGK+    +R         +E   Y +    +  S     N+  YE
Sbjct  293   EFGSSYDD-AIDAESGKRLSRFRRVRTQLGKDFIEEDVYDQADRASMDSQKRCKNES-YE  350

Query  831   CLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH-GNGGKIRDCFGS  1007
              L+ ++       LGG R  H KTN   +S Y +GENS+D D   N   N  ++      
Sbjct  351   FLSSRR--GKCVPLGGRRASHNKTNGCSDSIYESGENSVDTDYVPNPIPNSSRMIQSRSG  408

Query  1008  K------KAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             K       +G  EK +  KKGK HECPFC ++F+SGQALGGHKRSHF G A+
Sbjct  409   KTPIEQNSSGNAEKNLGLKKGKLHECPFCPKVFRSGQALGGHKRSHFAGAAR  460



>ref|XP_006483052.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=527

 Score =   150 bits (378),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 133/368 (36%), Positives = 177/368 (48%), Gaps = 70/368 (19%)
 Frame = +3

Query  135   PKRYKK---LVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNW---YG  296
             P+R K    + + +YS S+   N  GSSSVSE+ EQEQEEVA CLMMLS+DS        
Sbjct  161   PRRSKGTGYMTMGAYSSSVDVAN--GSSSVSEL-EQEQEEVAICLMMLSRDSSGCKKGLN  217

Query  297   SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGD  476
             S  + SDNNSVVLE KSSSIDMK S  N                        P   +  +
Sbjct  218   SFADSSDNNSVVLEAKSSSIDMKISGANCV----------------------PNGNEFVE  255

Query  477   NRKVMKSSIVHTEMAE-SQSSDSGYFL-GENKVESDVSVNGFL--AKCKV--LNRVKGYV  638
               K   S     E+ + S +SDSGYF  G  K ES+ S +GF+   KCK   +    G+ 
Sbjct  256   MNKSNDSKFKSAEIDDVSDNSDSGYFRNGPKKAESNASFDGFIRTGKCKKSGVEYGPGFE  315

Query  639   E---------PRRGGVEKEYENYDDFGVASNS----GKQKRTNDTSYDPEMETGSYKKTK  779
             E          +R    K     +DF +   +    G +KR  + S  P++   + +K  
Sbjct  316   EFDAKFEKSSNKRTEFGKHLTKEEDFALVDRASTKHGSRKRAKNDSSSPQIFRNNAQK--  373

Query  780   VVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE  959
                         + +++CL C K F+S ++L GH   H K N   ES   + ENS + D 
Sbjct  374   ------------RSQFKCLTCNKVFHSPRSLWGHTASHSKINGCCESINESSENSRETDS  421

Query  960   TYNHGNGGKIRDCFGSKKAGA------TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKR  1121
                     K       K   A       +K++  KK KGHECPFC R+FKSGQALGGHKR
Sbjct  422   FPVPMPNSKFCKSVNGKTPIAQNLSTNVDKRLGSKKSKGHECPFCFRVFKSGQALGGHKR  481

Query  1122  SHFIGGAQ  1145
             SHF+GG++
Sbjct  482   SHFVGGSE  489



>gb|KDO83101.1| hypothetical protein CISIN_1g041528mg [Citrus sinensis]
Length=527

 Score =   150 bits (378),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 133/368 (36%), Positives = 177/368 (48%), Gaps = 70/368 (19%)
 Frame = +3

Query  135   PKRYKK---LVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNW---YG  296
             P+R K    + + +YS S+   N  GSSSVSE+ EQEQEEVA CLMMLS+DS        
Sbjct  161   PRRSKGTGYMTMGAYSSSVDVAN--GSSSVSEL-EQEQEEVAICLMMLSRDSSGCKKGLN  217

Query  297   SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGD  476
             S  + SDNNSVVLE KSSSIDMK S  N                        P   +  +
Sbjct  218   SFADSSDNNSVVLEAKSSSIDMKISGANCV----------------------PNGNEFVE  255

Query  477   NRKVMKSSIVHTEMAE-SQSSDSGYFL-GENKVESDVSVNGFL--AKCKV--LNRVKGYV  638
               K   S     E+ + S +SDSGYF  G  K ES+ S +GF+   KCK   +    G+ 
Sbjct  256   MNKSNDSKFKSAEIDDVSDNSDSGYFRNGPKKAESNASFDGFIRTGKCKKSGVEYGPGFE  315

Query  639   E---------PRRGGVEKEYENYDDFGVASNS----GKQKRTNDTSYDPEMETGSYKKTK  779
             E          +R    K     +DF +   +    G +KR  + S  P++   + +K  
Sbjct  316   EFDAKFEKSSNKRTEFGKHLTKEEDFALVDRASTKHGSRKRAKNDSSSPQIFRNNAQK--  373

Query  780   VVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE  959
                         + +++CL C K F+S ++L GH   H K N   ES   + ENS + D 
Sbjct  374   ------------RSQFKCLTCNKVFHSPRSLWGHTASHSKINGCCESINESSENSRETDS  421

Query  960   TYNHGNGGKIRDCFGSKKAGA------TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKR  1121
                     K       K   A       +K++  KK KGHECPFC R+FKSGQALGGHKR
Sbjct  422   FPVPMPNSKFCKSVNGKTPIAQNLSTNVDKRLGSKKSKGHECPFCFRVFKSGQALGGHKR  481

Query  1122  SHFIGGAQ  1145
             SHF+GG++
Sbjct  482   SHFVGGSE  489



>ref|XP_006438809.1| hypothetical protein CICLE_v10031223mg [Citrus clementina]
 gb|ESR52049.1| hypothetical protein CICLE_v10031223mg [Citrus clementina]
Length=527

 Score =   150 bits (378),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 133/374 (36%), Positives = 178/374 (48%), Gaps = 73/374 (20%)
 Frame = +3

Query  126   THHPKRYKK------LVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGN  287
             T  P R ++      + + +YS S+   N  GSSSVSE+ EQEQEEVA CLMMLS+DS  
Sbjct  155   TSAPSRRRRSKGTGYMTMGAYSSSVDVAN--GSSSVSEL-EQEQEEVAICLMMLSRDSSG  211

Query  288   W---YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPP  458
                   S  + SDNNSVVLE KSSSIDMK S  N                        P 
Sbjct  212   CKKGLNSFADSSDNNSVVLEAKSSSIDMKISGANCV----------------------PN  249

Query  459   TKKMGDNRKVMKSSIVHTEMAE-SQSSDSGYFL-GENKVESDVSVNGFL--AKCKV--LN  620
               +  +  K   S     E+ + S +SDSGYF  G  K ES+ S +GF+   KCK   + 
Sbjct  250   GNEFVEMNKSNDSKFKSAEIDDVSDNSDSGYFRNGPKKAESNASFDGFIRTGKCKKSGVE  309

Query  621   RVKGYVE---------PRRGGVEKEYENYDDFGVASNS----GKQKRTNDTSYDPEMETG  761
                G+ E          +R    K     +DF +   +    G +KR  + S  P++   
Sbjct  310   YGPGFEEFDAKFEKSSNKRTEFGKHLTKEEDFALVDRASTKHGSRKRAKNDSSSPQIFRN  369

Query  762   SYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGEN  941
             + +K              + +++CL C K F+S ++L GH   H K N   ES   + EN
Sbjct  370   NAQK--------------RSQFKCLTCNKVFHSPRSLWGHTASHSKINGCCESINESSEN  415

Query  942   SLDADETYNHGNGGKIRDCFGSKKAGA------TEKKVRPKKGKGHECPFCHRMFKSGQA  1103
             S + D         K       K   A       +K++  KK KGHECPFC R+FKSGQA
Sbjct  416   SRETDSFPVPMPNSKFCKSVNGKTPIAQNLSTNVDKRLGSKKSKGHECPFCFRVFKSGQA  475

Query  1104  LGGHKRSHFIGGAQ  1145
             LGGHKRSHF+GG++
Sbjct  476   LGGHKRSHFVGGSE  489



>ref|XP_011018421.1| PREDICTED: uncharacterized protein LOC105121467 [Populus euphratica]
Length=509

 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 136/359 (38%), Positives = 182/359 (51%), Gaps = 65/359 (18%)
 Frame = +3

Query  141   RYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGSVVEFS  314
             RYK + V + SLSLTN  S+  SS S+I EQEQEEVAK LMMLSKDSG    + SV + S
Sbjct  157   RYKAIDVYTSSLSLTNTASL--SSTSDI-EQEQEEVAKSLMMLSKDSGFKGCFSSVADSS  213

Query  315   DNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMK  494
             DNNSVVLE KSSS+ M+ +  +G                 N  +    + +M   +K  +
Sbjct  214   DNNSVVLEGKSSSMKMRINVNDGI----------------NFVSSGIESLEM---KKATQ  254

Query  495   SSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEY  671
               +  +E  +S++SDSGYF  G  KV SDVSV+GF                R G  +K+ 
Sbjct  255   RGVNSSENDQSENSDSGYFRNGPKKVGSDVSVHGF---------------ARNGEFKKQE  299

Query  672   EN----YDDFGVASNSGKQK------RTN---DTSYDPEMETGSYKKTKVVAASSPGTNA  812
              +    YDD  + + SGK+       RT    D   D     G     + +  S  G   
Sbjct  300   VDSVFSYDD-ELDAESGKRLSMSRHIRTQLGKDFIVDDVYNQGD----RALMDSQKGCKN  354

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH-GNGGKI  989
                +Y+  + +   +   +LGG R  H + N   +S Y +GENS+D D   N   N  K+
Sbjct  355   ESCEYKSSSVRNRGSKCVSLGGRRTIHNRINGCSDSIYESGENSVDTDYVPNPIANSSKM  414

Query  990   RDCFGSK------KAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                   K       +G  EKK+  K  K HECPFC ++F+SGQALGGHKRSHFIG A+V
Sbjct  415   IQSRSGKTPIEKSSSGKAEKKLGLKIEKVHECPFCPKVFRSGQALGGHKRSHFIGAARV  473



>ref|XP_002311333.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE88700.2| zinc finger family protein [Populus trichocarpa]
Length=509

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 136/359 (38%), Positives = 180/359 (50%), Gaps = 65/359 (18%)
 Frame = +3

Query  141   RYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGSVVEFS  314
             RYK + V + SLSLTN  S+  SS S+I EQEQEEVAK LMMLSKDSG    + SV + S
Sbjct  157   RYKAIDVYTSSLSLTNTASL--SSTSDI-EQEQEEVAKSLMMLSKDSGFKGCFSSVADSS  213

Query  315   DNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMK  494
             DNNSVVLE KSS + M+ +  +G                 N  +    + +M   +K  +
Sbjct  214   DNNSVVLEGKSSYMKMRINVNDGI----------------NFVSSGIESLEM---KKATQ  254

Query  495   SSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEY  671
               +   E  +S++SDSGYF  G  KVESDVSV+GF                R G  +K+ 
Sbjct  255   RGVNSAENDQSENSDSGYFRNGPKKVESDVSVHGF---------------ARNGEFKKQE  299

Query  672   EN----YDDFGVASNSGKQK------RTN---DTSYDPEMETGSYKKTKVVAASSPGTNA  812
              +    YDD  + + SGK+       RT    D   D     G     + +  S  G   
Sbjct  300   VDSMFSYDD-ELDAESGKRLSMSRHIRTQLGKDFIVDDVYNQGD----RALMDSQKGCKN  354

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH-GNGGKI  989
                +Y   + +   +   +LGG R  H + N   +S Y +GENS+D D   N   N  K+
Sbjct  355   ESCEYLSSSVRNRGSKCVSLGGRRTSHNRINGCSDSIYESGENSVDTDYVPNPIANSSKM  414

Query  990   RDCFGSK------KAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                   K       +G  EKK+  K  K HECPFC ++F+SGQALGGHKRSHFIG A+V
Sbjct  415   IQSRSGKTPIEKSSSGKAEKKLGLKIEKVHECPFCPKVFRSGQALGGHKRSHFIGAARV  473



>ref|XP_002512106.1| hypothetical protein RCOM_1621120 [Ricinus communis]
 gb|EEF50775.1| hypothetical protein RCOM_1621120 [Ricinus communis]
Length=519

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 177/353 (50%), Gaps = 52/353 (15%)
 Frame = +3

Query  144   YKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGSVVEFSD  317
             YK + V S SLSL N +   +S V    EQEQEEVAKCLMMLSKDSG    + SV + SD
Sbjct  171   YKAIGVYSSSLSLVNGSLSSASDV----EQEQEEVAKCLMMLSKDSGFKGCFSSVADSSD  226

Query  318   NNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKS  497
             N SVVLETKSSS  ++ S K                   N  +       + + +K  + 
Sbjct  227   N-SVVLETKSSSPKLRISVK-------------------NGVSCVYNGNGILEIKKAKQH  266

Query  498   SIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYE  674
              ++      S++SDSGYF  G  KVESD+SV+GF           G  E ++  +E    
Sbjct  267   EVMSVGNEYSENSDSGYFKNGPKKVESDISVHGF----------TGIDEFKKQKIEFGSR  316

Query  675   NYDDFG--VASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKK  848
               D F   +     + +R         +E   Y +T    AS    +  + K        
Sbjct  317   FEDGFSPELGKRLSRVRRIKTELGKDLIEEDGYGETD--GASFKYDSRKRDKRNDPELLS  374

Query  849   SFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD--ETYNHGNGGKIRDCFG-----S  1007
             +  S   +G  R  H++TN   ES YG+GENS++ D   +    +  K + C G      
Sbjct  375   NIASKTCIGVQRTRHRRTNGCSESVYGSGENSIETDCAPSPLPSHNKKSQSCNGKTAIEQ  434

Query  1008  KKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ----VIN  1154
             K +G+ EKK+  +KGK HECPFC ++F+SGQALGGHKRSHF+GGAQ    VIN
Sbjct  435   KLSGSVEKKLSLRKGKIHECPFCFKVFRSGQALGGHKRSHFVGGAQDRTLVIN  487



>ref|XP_011012172.1| PREDICTED: uncharacterized protein LOC105116480 [Populus euphratica]
Length=505

 Score =   143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 132/354 (37%), Positives = 181/354 (51%), Gaps = 52/354 (15%)
 Frame = +3

Query  135   PKRYKKLVVKS---YSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGS  299
             P+R K++  K+   Y+ SL+  N+   SS S+I EQEQEEVAKCLMMLSKDSG    + S
Sbjct  150   PRRSKRMRYKTIDVYTTSLSLANAASLSSASDI-EQEQEEVAKCLMMLSKDSGFKGCFSS  208

Query  300   VVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDN  479
             + + SDNNSVVLE KSSS   + +  N     +                         + 
Sbjct  209   LADSSDNNSVVLEGKSSSTKTRINVNNAVDFVSSGIESL-------------------EM  249

Query  480   RKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGG  656
             +K M+  ++ TE  +S++SDSGYF  G  KVESDVSV+GF       + +K Y       
Sbjct  250   KKSMQRGLISTENDQSENSDSGYFRNGPKKVESDVSVHGFARN----DGIKKY-------  298

Query  657   VEKEYENYDDFGVASNSGKQ----KRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKK  824
              E E+ +  D  + + SGK+    +R         +E   Y +    +  S     N+  
Sbjct  299   -EVEFGSSFDDDIDAESGKRISRFRRVRTRLGKDFIEEDLYDQADGASMDSQKRCKNES-  356

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH-GNGGKIRDCF  1001
             YE L+ ++       LGG R  H KTN   +S Y +GENS+D D   N   N  ++    
Sbjct  357   YEFLSSRR--GKCVPLGGRRASHNKTNGCSDSIYESGENSVDTDYVPNPIPNSSRMIQSR  414

Query  1002  GSK------KAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
               K       +G  EK +  KKGK HECPFC ++F+SGQALGGHKRSHF G A+
Sbjct  415   SGKTPIEQNSSGNAEKNLGLKKGKLHECPFCPKVFRSGQALGGHKRSHFAGAAR  468



>ref|XP_002514689.1| hypothetical protein RCOM_1470470 [Ricinus communis]
 gb|EEF47795.1| hypothetical protein RCOM_1470470 [Ricinus communis]
Length=557

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 116/344 (34%), Positives = 156/344 (45%), Gaps = 62/344 (18%)
 Frame = +3

Query  165   SYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNW---YGSVVEFSDNNSVVL  335
             S SLS  NN +  SSSVSEID+QEQEEVA CLMMLS+D G W     SV E SDN+SV L
Sbjct  195   SSSLSFANNIN-ASSSVSEIDQQEQEEVAMCLMMLSRDVGQWGSGLNSVAESSDNSSVFL  253

Query  336   ETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRK-VMKSSIVHT  512
             E      ++ +SR     +               N T+    K  GD +   ++   +  
Sbjct  254   ENN----NLVSSRNEVKASVC-------------NGTETLKVKNFGDKKNGKLEDDDLRV  296

Query  513   EMAESQSSDSGYFLGENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFG  692
             E  +S+ S SG           +S  GF    KV    K   +  R       E   +  
Sbjct  297   ESRKSEFSVSG-----------ISRKGFTKNDKV---KKSPADDERAAENSAVELGKNLS  342

Query  693   -----VASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFN  857
                  ++S     KR  D S+ PE+++   K +               ++EC  C K F+
Sbjct  343   KETDMISSKRNSNKRKYDDSFHPELKSDYLKNSD-----------RSSRFECTTCNKVFH  391

Query  858   SYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI----------RDCFGS  1007
             SYQALGGHR  HKKT     S   + ENS++ + + +     K+           D    
Sbjct  392   SYQALGGHRASHKKTKGCFASRSDSNENSIETELSPDPTADSKLIIKSIKNEISVDQLAI  451

Query  1008  KKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGG  1139
             ++    E     KK KGHECP C ++F SGQALGGHKRSH + G
Sbjct  452   ERDNKAETSYGAKKSKGHECPVCFKVFPSGQALGGHKRSHLLAG  495



>ref|XP_007037499.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
 gb|EOY22000.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
Length=556

 Score =   138 bits (348),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 124/358 (35%), Positives = 168/358 (47%), Gaps = 61/358 (17%)
 Frame = +3

Query  165   SYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLE  338
             S + SLTN+    SSS+SEI EQEQEEVA  LMMLS+D G+W G  SV E SDNNSV LE
Sbjct  175   SSTFSLTNH---ASSSMSEI-EQEQEEVALSLMMLSRDVGHWGGLNSVAESSDNNSVFLE  230

Query  339   TKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEM  518
              K    ++KTS                    + NE +    +K     K ++S  V +E 
Sbjct  231   AK---FEIKTSSC------------------NGNEVRLLKKQK----EKELESGTVDSET  265

Query  519   AESQSSDSGYFLGENKVESDVSVNGFLAKCKVLNRVK-----------------GYVEPR  647
              ++ +  +  F      ++ + VN    +  V   VK                   VE  
Sbjct  266   FQAGAGQA-EFCASGLSKTGIRVNKSKNEVSVHESVKDERNSKSQLDGQFGAENSEVELS  324

Query  648   RGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKK--TKVVAASSPGTNANKK  821
             R  V++   N    G +S     KR    SYDPE+++GS  K  T V+ +        + 
Sbjct  325   RNLVKQTGVNRAQLG-SSKLNSSKRKLQYSYDPELKSGSVNKLTTDVLDSEFCKDPHKRS  383

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             K+EC  C K F+SYQALGGHR  HKK      S     ENS++ + + +     K+    
Sbjct  384   KFECTTCNKIFHSYQALGGHRASHKKIKGCFASRIDGSENSIETEHSPDPTADSKLVKSI  443

Query  1002  GSKKAGA---------TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
             G++   A          E     KK KGHECP C ++F SGQALGGHKRSH +  A+ 
Sbjct  444   GNEFPIAQLTADSDDKAEISYGVKKSKGHECPICLKVFPSGQALGGHKRSHLVAEAKA  501



>ref|XP_002281438.2| PREDICTED: zinc finger protein ZAT4-like [Vitis vinifera]
Length=563

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 127/340 (37%), Positives = 162/340 (48%), Gaps = 45/340 (13%)
 Frame = +3

Query  213   VSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngn  386
             VSEI EQEQEEVA  LMMLS+DSGNW G  SV E SDNNSV LE  SS    + +R    
Sbjct  184   VSEI-EQEQEEVAISLMMLSRDSGNWGGLNSVTESSDNNSVFLEAPSSFPTNRNTRIESK  242

Query  387   gngngkgvvykvcnR-DNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGEN  563
                   G       +   +E  NP      D +   K S    E   S +S +   L ++
Sbjct  243   TTNGCDGGEVVKLKKLIKDEKFNPSALDSEDFQFYCKQS----EFGASGNSRNDSKLNKS  298

Query  564   KVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDD----FGVASNSGKQKRTND  731
             +V      N    K KV +  +        G +   EN  D    F +  NS K+K  + 
Sbjct  299   EVLETNKSN----KLKVEDGFRFESSENELGKKLVKENGLDQAELFSIKYNSNKRKFRD-  353

Query  732   TSYDPEMETGSYKKTKVVAASSPGTNAN-------KKKYECLNCKKSFNSYQALGGHRPC  890
               YDPE++    KKT     ++ GT++        + K+EC  C K+F+SYQALGGHR  
Sbjct  354   -FYDPELKVNCSKKT----TNNDGTDSEICRDSQKRSKFECTTCNKTFHSYQALGGHRAS  408

Query  891   HKKTNPDMESGYGTGENSLD--------ADETY-----NHG---NGGKIRDCFGSKKAGA  1022
             HKK      S   + ENS+D        AD        NH    + G I     S  A  
Sbjct  409   HKKIKGCFASRIDSSENSIDPELSPDPTADSKLTKPCNNHSPSRSPGPIHGHTASASAVK  468

Query  1023  TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
              E  +  KK KGHECP C ++F SGQALGGHKRSH +GG+
Sbjct  469   AETILGSKKSKGHECPICLKVFSSGQALGGHKRSHLVGGS  508



>gb|KDP41283.1| hypothetical protein JCGZ_15690 [Jatropha curcas]
Length=500

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 168/330 (51%), Gaps = 59/330 (18%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSG--NWYGSVVEFSDNNSVVLETKSSS-IDMKTSRkngngngn  398
             EQEQEEVA CLMMLSKDSG    + S+ + SDNNSVVLETKSSS  ++K   K    N  
Sbjct  177   EQEQEEVAMCLMMLSKDSGFKGCFSSIADSSDNNSVVLETKSSSSPELKIGIKKNGVNCV  236

Query  399   gkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVES  575
                         NN       KK        K  ++ TE  +S++SDSGYF  G  KVES
Sbjct  237   Y-----------NNGNAVLEMKKA-------KKQVMSTENDQSENSDSGYFRNGPKKVES  278

Query  576   DVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEME  755
             ++SV+GF+   K     K  VE R      E E+ D       SG ++   +   D   E
Sbjct  279   EISVHGFVGNDKF---KKHKVEFRS---RFEEEDIDPELGKRLSGFRRIKKELGKDLVRE  332

Query  756   TGSYKKTK-----VVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDM-E  917
               S K++K     +   SS G+   K+    +N              R  HKK+N    +
Sbjct  333   EESRKRSKNEFNNLEFLSSNGSKIVKRPSVAVN--------------RSSHKKSNGGCSD  378

Query  918   SGYGTGENSLDADETYN--HGNGGKIRDCFG-----SKKAGATEKKVRPKKGKGHECPFC  1076
             S Y +GENS++ D   +  H +  +I+ C G      K +G  EKK   KKGK HECPFC
Sbjct  379   SIYESGENSINTDYVPSELHNSCKRIKSCNGKNPVEQKLSGNAEKKFGTKKGKVHECPFC  438

Query  1077  HRMFKSGQALGGHKRSHFIGGAQ----VIN  1154
              ++F+SGQALGGHKRSHF+GG +    VIN
Sbjct  439   FKVFRSGQALGGHKRSHFVGGGEDRTVVIN  468



>ref|XP_010680727.1| PREDICTED: probable serine/threonine-protein kinase clkA [Beta 
vulgaris subsp. vulgaris]
Length=603

 Score =   130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 166/327 (51%), Gaps = 52/327 (16%)
 Frame = +3

Query  216   SEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEF----SDNNSVVLETKSSSIDMKTSRkng  383
             SEID+ EQEEVA CLMMLS+DS     S   F    SDNNSV+LE  SSS  +   RK  
Sbjct  257   SEIDQHEQEEVAICLMMLSRDSSGHNKSCFNFTAESSDNNSVILEGGSSSNHVGIGRKRK  316

Query  384   ngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GE  560
             +   N                +    + +   ++ + + + H E+    +SDSGYF  G 
Sbjct  317   DFCLNNN------------TNKKKIKQVVVVAQQQIDNVVNHQEI---DNSDSGYFENGA  361

Query  561   NKVESDVSVNGFLAKCKVLNRVKGYVEPR-RGGVEKEYENYDDFGVASNS--GKQKRTND  731
              ++ESD SV+GF+       R  G+ +P+   G +   E++ D+   S     KQ+ +N 
Sbjct  362   KELESDDSVDGFV-------RNYGFKKPKSEFGSKIIAESFYDYDNDSRKRRNKQQVSNL  414

Query  732   TSYDPEMETGSYKKTKVVAAS----SPGTNANKK--KYECLNCKKSFNSYQALGGHRPCH  893
                 PE +  S KK K++       S   N NKK  KYEC  C K+F ++QALGGH   H
Sbjct  415   RDDSPESDENSSKKMKMMKQDYYRFSNNNNNNKKGSKYECCVCNKTFKTHQALGGHIISH  474

Query  894   KKTNPDMESGYGTGENSLDADETYNHGNGGKIR---DCFGSKKAGATEKKV---RPKKGK  1055
             +K           GENSLD           + +   +C   K A +T K +   + KK K
Sbjct  475   RKN----------GENSLDTSIISGKQQQQQQQIENNCNPKKLAASTTKNMGNTKSKKVK  524

Query  1056  GHECPFCHRMFKSGQALGGHKRSHFIG  1136
             GH+CP+C ++FKSGQALGGHKRSH IG
Sbjct  525   GHKCPYCPKVFKSGQALGGHKRSHMIG  551



>ref|XP_010106656.1| Zinc finger protein ZAT4 [Morus notabilis]
 gb|EXC11035.1| Zinc finger protein ZAT4 [Morus notabilis]
Length=510

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 151/326 (46%), Gaps = 63/326 (19%)
 Frame = +3

Query  180   LTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEFSDNNSVVLETKSSSID  359
             + NN +  SS+ SEI EQEQEEVA CLMMLS+D G    SV E SDN S   E   S   
Sbjct  181   IINNVNASSSAASEI-EQEQEEVAMCLMMLSRDFGG-SKSVAESSDNFS---ELSKSPPS  235

Query  360   MKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSD  539
              KTSR    GN            R+ N                       ++M+ ++ S 
Sbjct  236   TKTSRIMSGGNKTCSEFSRTKKLRNGNS---------------------WSKMSRTEVSS  274

Query  540   SGYFLGENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQK  719
              G FLG++K              K+L + + +VE  +    K    YDD G         
Sbjct  275   DG-FLGKDK--------------KILVKEEKFVEKLKSSTRKLP--YDDNG---------  308

Query  720   RTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKK  899
               ++  YDPE+   S    K+     P ++  + ++ECL C K+F+SYQALGGHR  HKK
Sbjct  309   DDDEAYYDPELRADSL---KISDPDMPKSSQKRSRFECLTCNKTFHSYQALGGHRASHKK  365

Query  900   TNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGAT------EKKVRPKKGKGH  1061
                   S   T E+S ++ ET       K ++   +            + K   KK KGH
Sbjct  366   NKGCFAS--STIESSENSIETEGGDENNKPKNHHFTNIESLINDGEDHQSKAEIKKSKGH  423

Query  1062  ECPFCHRMFKSGQALGGHKRSHFIGG  1139
             ECP C ++F SGQALGGHKRSH +GG
Sbjct  424   ECPICLKVFPSGQALGGHKRSHLVGG  449



>ref|XP_010532588.1| PREDICTED: uncharacterized protein LOC104808577 [Tarenaya hassleriana]
Length=479

 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 131/346 (38%), Positives = 165/346 (48%), Gaps = 63/346 (18%)
 Frame = +3

Query  156   VVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG-----NWYGSVVEFSDN  320
             V +S S+S  N NS   SSVSEI EQEQEE+A CLMMLSKDS      N   S+ E SDN
Sbjct  147   VNQSSSVSFANGNS---SSVSEI-EQEQEELALCLMMLSKDSSFRKAHNLGNSLGESSDN  202

Query  321   NSVVLETKS-SSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKS  497
             NSV+LETKS SS D+K       G                N  +    KK+G++ +   +
Sbjct  203   NSVILETKSLSSGDLKIVNVKDAGEFCC------------NADEILGAKKLGNHSQSRSA  250

Query  498   SIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYE  674
                   + +S +SDSGYF  G  K +SDVSV+GFL               R  G  K   
Sbjct  251   EDNDVLLDDSDNSDSGYFRNGPKKADSDVSVDGFL---------------RNTGSNKAV-  294

Query  675   NYDDFGVASNS-GKQ-KRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKK  848
               +   V SNS  KQ K  N      E+    YK+ +   +++      K K  C N +K
Sbjct  295   -IESGSVFSNSPAKQDKNLNRLRNAVELRKEWYKEGRTGRSATKYDLRKKGKRVCSNSRK  353

Query  849   SFN-SYQALGGHRPCHKKTNPDMESGYGTGENSLDADET--YNHGNGGKIRDCFGSKKAG  1019
                  + A G +           ES   +GENSL+AD     N    G+ +   G + + 
Sbjct  354   KMKYEFNANGFN-----------ESVNDSGENSLEADSCSDTNQNTPGESKIHQGRRSSK  402

Query  1020  ATEKKV-------RPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
             AT             KK KGHECP C R+FKSGQALGGHKRSHFIG
Sbjct  403   ATTAAATCSKKPNAKKKSKGHECPICFRVFKSGQALGGHKRSHFIG  448



>gb|KDP31317.1| hypothetical protein JCGZ_11693 [Jatropha curcas]
Length=543

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 106/328 (32%), Positives = 144/328 (44%), Gaps = 87/328 (27%)
 Frame = +3

Query  213   VSEIDEQEQEEVAKCLMMLSKDSGNW--YGSV-VEFSDNNSVVLETKSSSIDMKTSRkng  383
             VSEI EQEQEEVA CL+MLS+D G W    SV  + SDNNSV  ET              
Sbjct  225   VSEI-EQEQEEVAMCLIMLSRDVGQWGVLNSVSADSSDNNSVSFET--------------  269

Query  384   ngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGEN  563
                           N++N  T NP      ++RK        TE + S+ S  G+   ++
Sbjct  270   --------------NKNNLVTSNPTETVKVESRK--------TEYSVSRISRKGFIKNDD  307

Query  564   KVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYD  743
               +                      +P     E ++E   +    +    +KR    S+D
Sbjct  308   TTK----------------------KPNHDYDECKFELGKNLSKETEMVSKKRKFADSFD  345

Query  744   PEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESG  923
             PE+++   K           ++ +  ++EC  C K F+SYQALGGHR  HKKT     S 
Sbjct  346   PELKSEYLK----------NSDRSSSRFECTTCNKVFHSYQALGGHRASHKKTKGCFASK  395

Query  924   YGTGENSLDA-----DETYNHGNGGKIRDC-----FGSKKA-GATEKKVR----PKKGKG  1058
               + ENS++      D T    N   I+          + A G +E K       KK KG
Sbjct  396   IDSSENSIETEQLSPDRTPTERNKLTIKSVNKEVSLDHQLATGYSENKAETSYGAKKSKG  455

Query  1059  HECPFCHRMFKSGQALGGHKRSHFIGGA  1142
             HECP C ++F SGQALGGHKRSH +GG 
Sbjct  456   HECPICLKVFPSGQALGGHKRSHLVGGT  483



>ref|XP_007210777.1| hypothetical protein PRUPE_ppa019308mg [Prunus persica]
 gb|EMJ11976.1| hypothetical protein PRUPE_ppa019308mg [Prunus persica]
Length=539

 Score =   117 bits (294),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 110/347 (32%), Positives = 159/347 (46%), Gaps = 57/347 (16%)
 Frame = +3

Query  144   YKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEF----  311
             Y      S + S+ N     +SSVSEI EQEQEEVA CLMML +D+G+W G  ++F    
Sbjct  173   YMGTTTSSSNFSIAN---AATSSVSEI-EQEQEEVALCLMMLKRDAGHWGG--LKFVAHD  226

Query  312   -SDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKV  488
              SDNNSV  E  SS                                    T ++  + K 
Sbjct  227   SSDNNSVFSEAPSSG----------------------------------RTNRVNADIKG  252

Query  489   MKSSIVHTEMAESQSSDSGYFLGENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKE  668
               S     E+ + +   +   L    ++SD S +G   K ++L+ V G+   +   ++K+
Sbjct  253   KVSVCSGIEILKLKKKLNKKTLELGNLDSDFSKHGSRMKKELLSAV-GF--SKNDKLDKK  309

Query  669   YE-NYDDFGVASNSGKQKRTNDTSYDPE------METGSYKKTKVVAASSPGTNANKK-K  824
              E      G  +     KR    SYD E      ++T S  +  V+ + +   ++ K+ K
Sbjct  310   MELAQPQLGSNNKCNSSKRKFQESYDFESRSEQSLKTLSTTRGDVLDSEAVCKSSQKRSK  369

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI-RDCF  1001
             +EC  C K F SYQALGGHR  HKK      S   + EN+++ D +    +  K+ + C 
Sbjct  370   FECTTCNKVFRSYQALGGHRASHKKIKGCFASKVESSENTIETDLSPEPTSDSKLSKSCN  429

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                      K     + KGH CP C ++F SGQALGGHKRSH IGG+
Sbjct  430   NENPIEHDVKAEISTENKGHACPICLKVFPSGQALGGHKRSHLIGGS  476



>ref|XP_002893392.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69651.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   116 bits (291),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 164/355 (46%), Gaps = 75/355 (21%)
 Frame = +3

Query  138   KRYKKLVVKSYSLS--------LTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--N  287
             +R K++VVK +           + N +   SS  SEI E EQEE+A+ LMMLS+DS    
Sbjct  137   RRSKRVVVKHHHKDAFVVGGNGIMNQSISASSDASEI-EPEQEEMARSLMMLSRDSSFKK  195

Query  288   WYGSVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKK  467
              + S+ E SDNNSV+LETKSSS         G           +   + N    +   K 
Sbjct  196   EHNSLAESSDNNSVILETKSSS---------GEQLKMFNVKNVEEYCKKNKLVVDNQMKA  246

Query  468   MGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEP  644
               DN  V+          +S +SDSGYF  G  K++SDVSV+GF     V+    G+   
Sbjct  247   GEDNGDVL---------YDSDNSDSGYFRNGPKKLDSDVSVDGFFRNKAVMGSGSGF---  294

Query  645   RRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKK  824
                               ++S  ++  N   +  E     YK+    + S   +     K
Sbjct  295   ------------------NSSPTKQNMNMNRFKKEW----YKEGGSGSGSGRSST----K  328

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFG  1004
             Y+  N K+ F SY   G  +  ++ T    ES Y +GE+SL+ D   +     KI     
Sbjct  329   YDLRNSKRGFPSY---GRKKIKYEFT----ESVYDSGEHSLETDSCADTNRTIKIH----  377

Query  1005  SKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGSHQT  1169
             SK A   +     KK KGHECP C R+FKSGQALGGHKRSHFIG     N  H+T
Sbjct  378   SKSAMVNKASGAKKKNKGHECPICFRVFKSGQALGGHKRSHFIG-----NQEHRT  427



>ref|XP_010527736.1| PREDICTED: uncharacterized protein LOC104805032 isoform X2 [Tarenaya 
hassleriana]
Length=367

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 120/325 (37%), Positives = 155/325 (48%), Gaps = 75/325 (23%)
 Frame = +3

Query  204   SSSVSEIDEQEQEEVAKCLMMLSKDSGNW------YGSVVEFSDNNSVVLETKSSSIDMK  365
             S S SE++++EQEE+A CLMMLS+D  N+         V E SD NSV+LETKSSS ++K
Sbjct  73    SCSASEVEQEEQEELALCLMMLSRDYSNFKKVQNFVNCVGESSDTNSVILETKSSSGELK  132

Query  366   TSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVH-TEMAESQSSDS  542
                                         N        N+K +KS   +   + +S +SDS
Sbjct  133   HVGGFRC---------------------NADEISAAKNQKQLKSPQENGVLLYDSDNSDS  171

Query  543   GYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQ-  716
             GYF  G  KV+SDVS++GFL               R  G  K       FG +++  KQ 
Sbjct  172   GYFRNGPRKVDSDVSIDGFL---------------RNAGSNKAMME-SGFGFSNSPAKQD  215

Query  717   KRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHK  896
             K  N      E    SYK+         G++ +  KY+ L   K  +SY          K
Sbjct  216   KNLNRLRNGTEFRKESYKE--------GGSSRSSAKYD-LRKSKRVSSYS--------RK  258

Query  897   K--TNPDMESGYGTGENSLDADET--YNHGNGGKIRDCFGSKKAGATEKKVRPKK-GKGH  1061
             K  TN   ES + +GENSL+AD     NH +   +        A A  KK R KK  KGH
Sbjct  259   KIETNELNESVHDSGENSLEADSCSDMNHNSSKAL-------IAAAACKKTRAKKRSKGH  311

Query  1062  ECPFCHRMFKSGQALGGHKRSHFIG  1136
             ECP C R+FKSGQALGGHKRSHF+G
Sbjct  312   ECPICFRVFKSGQALGGHKRSHFMG  336



>ref|XP_010552554.1| PREDICTED: zinc finger protein ZAT4-like isoform X2 [Tarenaya 
hassleriana]
Length=368

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 147/310 (47%), Gaps = 72/310 (23%)
 Frame = +3

Query  246   VAKCLMMLSKDSGNW------YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkg  407
             +A CLMMLS+D  N+         V E SD NSV+LETKSSS ++K      +  G    
Sbjct  87    LALCLMMLSRDYSNFKKVQNFVNCVGESSDTNSVILETKSSSGELK------HVGGFRCN  140

Query  408   vvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVS  584
                    ++ N+ ++P      +   V+        + +S +SDSGYF  G  KV+SDVS
Sbjct  141   ADEISAAKNQNQLKSP------EENGVL--------LYDSDNSDSGYFRNGPRKVDSDVS  186

Query  585   VNGFLAKCKVLNRVKGYVEPRRGGVEKEY-ENYDDFGVASNSGKQKRTNDTSYDPEMETG  761
             ++GFL               R  G  K   E+  +F  +  + + K  N      E    
Sbjct  187   IDGFL---------------RNAGSNKAMMESGSEFSNSPAAKQDKNFNRLRNGTEFRKE  231

Query  762   SYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKK--TNPDMESGYGTG  935
             SYK+         G++ +  KY+ L   K  +SY          KK  TN   ES + +G
Sbjct  232   SYKE--------GGSSRSSAKYD-LRKSKRVSSYS--------RKKIETNELNESVHDSG  274

Query  936   ENSLDADET--YNHGNGGKIRDCFGSKKAGATEKKVRPKK-GKGHECPFCHRMFKSGQAL  1106
             ENSL+AD     NH +   +        A A  KK R KK  KGHECP C R+FKSGQAL
Sbjct  275   ENSLEADSCSDMNHNSSKAL-------IAAAACKKTRAKKRSKGHECPICFRVFKSGQAL  327

Query  1107  GGHKRSHFIG  1136
             GGHKRSHF+G
Sbjct  328   GGHKRSHFMG  337



>ref|NP_173983.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
 gb|AAF98586.1|AC013427_29 Contains similarity to C2H2 zinc finger protein (PEThy;ZPT4-2) 
from Petunia hybrida gb|AB000456 and contains three Zinc finger 
(C2H2 type) PF|00096 motifs [Arabidopsis thaliana]
 dbj|BAH30318.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30709.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
Length=455

 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 122/359 (34%), Positives = 169/359 (47%), Gaps = 81/359 (23%)
 Frame = +3

Query  138   KRYKKLVVKSYSLS--------LTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWY  293
             +R K++VVK +  +        + N +   SS  SEI E EQEE+A+ LMMLS+DS    
Sbjct  138   RRSKRVVVKPHHKAAFVVGGNGIMNQSISASSDASEI-EPEQEEMARSLMMLSRDSSFKK  196

Query  294   G--SVVEFSDNNSVVLETKSSS---IDMKTSRkngngngngkgvvykvcnRDNNETQNPP  458
             G  S+ E SDNNSV+LETKSSS   + M   +                    N E     
Sbjct  197   GHNSLAESSDNNSVILETKSSSGEQVKMFNVK--------------------NVEELCKK  236

Query  459   TKKMGDNRKVMKSSIVHTEMA-ESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKG  632
              K + DN+  M+S   + ++  +S +SDSGYF  G  K++SDVSV+GF     ++    G
Sbjct  237   NKLVVDNQ--MRSGEENGDVHYDSDNSDSGYFRNGPKKLDSDVSVDGFFRNKTIMGSGSG  294

Query  633   YVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNA  812
             +                      NS   K+  D +         YK+    + S  G ++
Sbjct  295   F----------------------NSSPTKQDRDMN---RFRKEWYKEGGSGSGSGSGRSS  329

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIR  992
              K  Y+    K+ F S+   G  +  ++ T    ES Y +GE+SL+ D   +     KI 
Sbjct  330   TK--YDLRKSKRGFPSH---GRKKIKYEFT----ESVYDSGEHSLETDSCADTNRTIKIH  380

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGSHQT  1169
                 SK     +     KK KGHECP C R+FKSGQALGGHKRSHFIG     N  H+T
Sbjct  381   ----SKSPMVKKANGAKKKSKGHECPICFRVFKSGQALGGHKRSHFIG-----NQEHRT  430



>ref|XP_010527735.1| PREDICTED: uncharacterized protein LOC104805032 isoform X1 [Tarenaya 
hassleriana]
Length=445

 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 120/325 (37%), Positives = 155/325 (48%), Gaps = 75/325 (23%)
 Frame = +3

Query  204   SSSVSEIDEQEQEEVAKCLMMLSKDSGNW------YGSVVEFSDNNSVVLETKSSSIDMK  365
             S S SE++++EQEE+A CLMMLS+D  N+         V E SD NSV+LETKSSS ++K
Sbjct  151   SCSASEVEQEEQEELALCLMMLSRDYSNFKKVQNFVNCVGESSDTNSVILETKSSSGELK  210

Query  366   TSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVH-TEMAESQSSDS  542
                                         N        N+K +KS   +   + +S +SDS
Sbjct  211   HVGGFRC---------------------NADEISAAKNQKQLKSPQENGVLLYDSDNSDS  249

Query  543   GYFL-GENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQ-  716
             GYF  G  KV+SDVS++GFL               R  G  K       FG +++  KQ 
Sbjct  250   GYFRNGPRKVDSDVSIDGFL---------------RNAGSNKAMME-SGFGFSNSPAKQD  293

Query  717   KRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHK  896
             K  N      E    SYK+         G++ +  KY+ L   K  +SY          K
Sbjct  294   KNLNRLRNGTEFRKESYKE--------GGSSRSSAKYD-LRKSKRVSSYS--------RK  336

Query  897   K--TNPDMESGYGTGENSLDADET--YNHGNGGKIRDCFGSKKAGATEKKVRPKK-GKGH  1061
             K  TN   ES + +GENSL+AD     NH +   +        A A  KK R KK  KGH
Sbjct  337   KIETNELNESVHDSGENSLEADSCSDMNHNSSKAL-------IAAAACKKTRAKKRSKGH  389

Query  1062  ECPFCHRMFKSGQALGGHKRSHFIG  1136
             ECP C R+FKSGQALGGHKRSHF+G
Sbjct  390   ECPICFRVFKSGQALGGHKRSHFMG  414



>ref|XP_010552553.1| PREDICTED: zinc finger protein ZAT4-like isoform X1 [Tarenaya 
hassleriana]
Length=446

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 108/310 (35%), Positives = 145/310 (47%), Gaps = 72/310 (23%)
 Frame = +3

Query  246   VAKCLMMLSKDSGNW------YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkg  407
             +A CLMMLS+D  N+         V E SD NSV+LETKSSS ++K      +  G    
Sbjct  165   LALCLMMLSRDYSNFKKVQNFVNCVGESSDTNSVILETKSSSGELK------HVGGFRCN  218

Query  408   vvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVS  584
                    ++ N+ ++P    +               + +S +SDSGYF  G  KV+SDVS
Sbjct  219   ADEISAAKNQNQLKSPEENGV--------------LLYDSDNSDSGYFRNGPRKVDSDVS  264

Query  585   VNGFLAKCKVLNRVKGYVEPRRGGVEKEY-ENYDDFGVASNSGKQKRTNDTSYDPEMETG  761
             ++GFL               R  G  K   E+  +F  +  + + K  N      E    
Sbjct  265   IDGFL---------------RNAGSNKAMMESGSEFSNSPAAKQDKNFNRLRNGTEFRKE  309

Query  762   SYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKK--TNPDMESGYGTG  935
             SYK+         G++ +  KY+ L   K  +SY          KK  TN   ES + +G
Sbjct  310   SYKE--------GGSSRSSAKYD-LRKSKRVSSYS--------RKKIETNELNESVHDSG  352

Query  936   ENSLDADET--YNHGNGGKIRDCFGSKKAGATEKKVRPKK-GKGHECPFCHRMFKSGQAL  1106
             ENSL+AD     NH +   +        A A  KK R KK  KGHECP C R+FKSGQAL
Sbjct  353   ENSLEADSCSDMNHNSSKAL-------IAAAACKKTRAKKRSKGHECPICFRVFKSGQAL  405

Query  1107  GGHKRSHFIG  1136
             GGHKRSHF+G
Sbjct  406   GGHKRSHFMG  415



>ref|XP_010499021.1| PREDICTED: uncharacterized protein LOC104776622 [Camelina sativa]
Length=468

 Score =   105 bits (261),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 157/358 (44%), Gaps = 76/358 (21%)
 Frame = +3

Query  138   KRYKKLVVKSYSLS---------LTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNW  290
             +R K++VVK +  +         + N  S   S  SEI E EQ+E A  LMMLS DSG  
Sbjct  137   RRSKRVVVKHHHKAAFVVGDDNGIMNQFSSAFSDASEI-EPEQKETALSLMMLSMDSGFK  195

Query  291   YG------SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQN  452
              G      S  E SDNNSVVLETKSSS ++                  +     N    +
Sbjct  196   KGHNLMVNSFPESSDNNSVVLETKSSSGEL---------LKMFNVNNVEAFCNKNKLVVD  246

Query  453   PPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVK  629
               T+   DN  V+          +S +SDSGYF  G  K++SDVSV+GF        R  
Sbjct  247   NKTRSGEDNGGVL---------YDSDNSDSGYFRNGPKKLDSDVSVDGF-------TRNS  290

Query  630   GYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMET--GSYKKTKVVAASSPG  803
             G+                D      SG    ++ T  D +M      + K     +   G
Sbjct  291   GF----------------DNKAVMGSGSGFNSSPTKQDKDMNRFRKEWYKEGGSGSGGSG  334

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDM-ESGYGTGENSL-DADETYNHGN  977
             +  +  KY+    K+ F SY          KK   +  ES Y +GE+SL D D   +   
Sbjct  335   SGRSSSKYDLRKSKRGFPSYG--------RKKIKYEFSESVYDSGEHSLLDTDSCADTNR  386

Query  978   GGKIRDCFGS--KKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
               KI        KKA  T KK    K KGHECP C R+FKSGQALGGHKRSHFIG  +
Sbjct  387   TIKIHHSKSPIVKKASGTVKK----KSKGHECPICFRVFKSGQALGGHKRSHFIGNQE  440



>ref|XP_010477841.1| PREDICTED: uncharacterized protein LOC104756882 [Camelina sativa]
Length=470

 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 120/354 (34%), Positives = 155/354 (44%), Gaps = 75/354 (21%)
 Frame = +3

Query  138   KRYKKLVVKSY---SLSLTNNNSI------GSSSVSEIDEQEQEEVAKCLMMLSKDSGNW  290
             +R K++VVK +   +  + ++N          S  SEI E EQ+E+A  LMMLS DSG  
Sbjct  140   RRSKRVVVKHHHKAAFVVGDDNGTMNQFNSAYSDASEI-EPEQKEMALSLMMLSMDSGFK  198

Query  291   YG------SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQN  452
              G      S  E SDNNSV+LETKSSS                           NN    
Sbjct  199   KGHNLVVNSFAESSDNNSVILETKSSS------------------GERLKMVNVNNVEAF  240

Query  453   PPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVK  629
                 K+G + K          + +S +SDSGYF  G  K+ SDVSV+GF        R  
Sbjct  241   CNKNKLGVDNKTRSGEDNGGVLYDSDNSDSGYFRNGPKKLYSDVSVDGF-------TRNS  293

Query  630   GYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMET--GSYKKTKVVAASSPG  803
             G+                D      SG    ++ T  D +M      + K     +   G
Sbjct  294   GF----------------DNKAVMGSGSGFNSSPTKQDKDMNRFRKEWYKEGGSGSGGSG  337

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDM-ESGYGTGENSLDADETYNHGNG  980
             +  +  KY+    K+ F SY          KK   +  ES Y +GE+SL+ D   +    
Sbjct  338   SGRSSTKYDLRKSKRGFPSYG--------RKKIKYEFSESVYDSGEHSLETDSCADTNRT  389

Query  981   GKIRDCFG--SKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
              KI       +KKA  T KK    K KGHECP C R+FKSGQALGGHKRSHFIG
Sbjct  390   IKIHHSKSPMAKKASGTVKK----KSKGHECPICFRVFKSGQALGGHKRSHFIG  439



>gb|KGN64038.1| hypothetical protein Csa_1G039050 [Cucumis sativus]
Length=505

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 156/337 (46%), Gaps = 73/337 (22%)
 Frame = +3

Query  213   VSEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEFSDNNSVVLETKSSSIDMKTSRkngngn  392
             VS+ ++QEQEEVA CLMMLS+D G +Y S  E SDNN +  +  S       S+      
Sbjct  162   VSDQNDQEQEEVALCLMMLSRDVGGFY-STTESSDNNFMPKQVPSLVPKNHFSKV-----  215

Query  393   gngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENKVE  572
                               +  P+  MG  +      +  +EM      DSG    E   E
Sbjct  216   -----------------VEAIPSVYMGQLKDFHSRKLKLSEM------DSGCLKFE---E  249

Query  573   SDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSG---KQKRTNDTSYD  743
             S+  ++    K   +N+            E++++  D FG +SN+     Q + N + ++
Sbjct  250   SNSEISASAVK---MNKN-----------EEKFQQDDIFGSSSNNQTDINQPQFNSSKFN  295

Query  744   P-----------EMETGSYKKTKV--VAASSPGTNANKKKYECLNCKKSFNSYQALGGHR  884
                         E+ + S++++    + + S  +   + K++C +C K F+SYQALGGHR
Sbjct  296   SDQRKFHELSNGELRSNSFRRSTPNELNSESYKSKGKRSKFQCNSCNKIFHSYQALGGHR  355

Query  885   PCHKKTNPDMESGYGTGENSLDAD-------ETYNHGNGGKIRDCFGSKKAGATEKKVRP  1043
               HKKT   + S     ENS++ +       E+ +     ++ +   S+     EKK+R 
Sbjct  356   ASHKKTKGCLASKTENSENSIETEISNDPTFESKSTATALEVENHQESEIHMGYEKKIR-  414

Query  1044  KKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
                K H+C  C ++F SGQALGGHKRSH I G++  N
Sbjct  415   ---KHHQCSICFKIFSSGQALGGHKRSHLINGSESRN  448



>ref|XP_010904961.1| PREDICTED: zinc finger protein ZAT9-like [Elaeis guineensis]
Length=495

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 103/342 (30%), Positives = 146/342 (43%), Gaps = 79/342 (23%)
 Frame = +3

Query  204   SSSVSEIDEQEQEEVAKCLMMLSKDSGNW--YGSVVEFSDNNSVVLETKSSSIDMKTSRk  377
             S+ V E+ E+EQE+VA  LMMLS+D+G W    S  E SD NSVVL+   S  D      
Sbjct  158   STQVLEL-EKEQEDVALSLMMLSRDTGFWSSISSTAE-SDKNSVVLKNLDSEGD------  209

Query  378   ngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLG  557
                                          ++G  +K  +S  +     + +        G
Sbjct  210   -----------------------------EIGKGKK--RSEFISLRYGDRRD-------G  231

Query  558   ENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTN---  728
               KVESDVS +    K     + K Y          E+E+ D+   AS  G  K+ +   
Sbjct  232   LKKVESDVSDDDGFVKDDEFKKPKAYTSD-----TDEFEHADE---ASRKGSLKKKDLSC  283

Query  729   -------DTSYDPEMETGSYKKTKVVAASSPG--------TNANKKKYECLNCKKSFNSY  863
                     T +D +  +G+ K +K  + S  G         +  + +YEC  C K F SY
Sbjct  284   CLAELGRKTRFD-QWHSGTGKYSKSGSRSEFGASKADFSKVSIKRGRYECTTCNKFFPSY  342

Query  864   QALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRP  1043
             QALGGHR  HK+    + S      NSL+ + +       ++ D    K  G        
Sbjct  343   QALGGHRASHKRIKVLLVSRTEGSNNSLETEASIKPAQLEELVD----KNVGIDTSSEAS  398

Query  1044  KKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGSHQT  1169
             KK K HECP CH +F S QALGGHK+SH +  +   + +HQT
Sbjct  399   KKVKDHECPICHNLFSSSQALGGHKKSHLVVSSDGADLTHQT  440



>emb|CDP18404.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   103 bits (258),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 104/337 (31%), Positives = 146/337 (43%), Gaps = 72/337 (21%)
 Frame = +3

Query  246   VAKCLMMLSKDSGNWYG--SV--VEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvv  413
             VA  L+MLS+D+ NW G  SV   E SD NS  LE +SS                     
Sbjct  197   VAMSLIMLSRDASNWGGLKSVGGGESSDYNSEFLEARSS---------------------  235

Query  414   ykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAE-----SQSSDSGYFLGENKVE-S  575
                    N   Q+  T+      K++KSS + ++M         S  SG    E +V+ S
Sbjct  236   -------NQNKQDCKTES-----KILKSSSLDSKMKSKIKQPEPSKASGMSRKEFRVKSS  283

Query  576   DVSVNGFLAKCKV-LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEM  752
             +VS + FL    +  N+V+   E ++  VE      +      N  K +R      DPE+
Sbjct  284   EVSTDAFLGDVFIKKNKVEEGAELQQSKVELPKNQSESESKKQNLSK-RRCIALHDDPEL  342

Query  753   ETGSYKKTKVVAASSPGT-----NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDME  917
              +  Y  TK+    S        +  K K+EC  C K+F+SYQALGGHR  HK+    + 
Sbjct  343   -SADYSITKLACGVSDSELLYLGSDRKSKFECTTCNKAFHSYQALGGHRASHKRMKGCLG  401

Query  918   SGYGTGENSLDADETYNHGNGGKIR-DC--------------------FGSKKAGATEKK  1034
             S   + ENS + + + N     K+R  C                    +GSK+       
Sbjct  402   SKIDSSENSTETEISPNQTADSKLRIKCYSNDIDTTTDGSKEKVEMTDYGSKEIKTVHTD  461

Query  1035  VRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
                KK K HECP C ++F SGQALGGHKR+H    A+
Sbjct  462   YGFKKDKSHECPICFKLFPSGQALGGHKRAHLAAEAK  498



>ref|XP_010936336.1| PREDICTED: zinc finger protein ZAT1-like [Elaeis guineensis]
Length=498

 Score =   102 bits (254),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 104/320 (33%), Positives = 137/320 (43%), Gaps = 73/320 (23%)
 Frame = +3

Query  231   QEQEEVAKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngk  404
             +EQE VA  LMMLS D+G W G   V E SD NSVVLE   S  D               
Sbjct  166   KEQENVALSLMMLSSDTGFWSGISPVAESSDKNSVVLEDLGSEGD---------------  210

Query  405   gvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENKVESDVS  584
                                 ++G  +K        +E   S++ D G   G  K+ESDVS
Sbjct  211   --------------------EIGKAKK-------RSEFIASRNGDKGD--GLKKMESDVS  241

Query  585   ---VNGFLAKCKVLNRVKGYVE-----------PRRGGVEKEYENYDDFGVASNSGKQKR  722
                 NGF+ K     + K Y              R+G +EK+  N    G+A   G++ R
Sbjct  242   NDDDNGFV-KDDEFKKPKAYASDTDEFEYSYEASRKGSLEKKDLNC---GLA-ELGRKTR  296

Query  723   TND--TSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHK  896
             ++   +      + GS  +  V        +  + +YEC  C K F SYQALGGHR  HK
Sbjct  297   SDQWHSVVGKYSKLGSRSEIGVSNGEFSKVSLKRGRYECATCNKFFPSYQALGGHRASHK  356

Query  897   KTNPDMESGYGTGENSLDADETYNHGNGGK-IRDCFGSKKAGATEKKVRPKKGKGHECPF  1073
             +      S     ENSL+ D +       + I    G   +    KKV     K HECP 
Sbjct  357   RIKGCFASRTEGSENSLETDASIEPAQFEESIHKNVGIDASSEASKKV-----KSHECPI  411

Query  1074  CHRMFKSGQALGGHKRSHFI  1133
             C ++F SGQALGGHKRSH +
Sbjct  412   CGKVFSSGQALGGHKRSHLV  431



>ref|XP_006306284.1| hypothetical protein CARUB_v10012148mg [Capsella rubella]
 gb|EOA39182.1| hypothetical protein CARUB_v10012148mg [Capsella rubella]
Length=459

 Score =   102 bits (253),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 154/347 (44%), Gaps = 66/347 (19%)
 Frame = +3

Query  138   KRYKKLVVKSYSLS--LTNNNSIGSSSVSEID-----EQEQEEVAKCLMMLSKDSGNWYG  296
             +R K++VVK +  +  L  +N I + S S        E EQ+E+A  LM+LS DS    G
Sbjct  134   RRSKRVVVKHHYKANFLVGDNGIMNQSNSAYSDASGIEPEQQEMAMSLMLLSMDSSFKKG  193

Query  297   ------SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPP  458
                   S  E SDNNSV+LETKSSS                           NN  +   
Sbjct  194   HNLVVNSFAESSDNNSVILETKSSS------------------GEQLKMFNVNNVEELCK  235

Query  459   TKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNRVKGY  635
               K+  + +V         + +S +SDSGYF  G  K++SD SV+GFL            
Sbjct  236   KNKLNVDNQVRSGEDNGDVLYDSDNSDSGYFRNGPKKLDSDFSVDGFL------------  283

Query  636   VEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNAN  815
                R  G       +D+      SG    ++    D       YK+    + S  G ++ 
Sbjct  284   ---RNTG-------FDNSKAVMGSGSGFNSSPAKQDKNWNRFRYKEGGSGSGSGSGRSST  333

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             K  Y+    K+ F SY   G  +  ++ T    ES Y +GE SL+ D   +     KI  
Sbjct  334   K--YDLRKSKRGFPSY---GRKKIKYEFT----ESVYDSGEYSLETDSCADTNRTIKIHS  384

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                  K  +T  K   KK KGHECP C R+FKSGQALGGHKRSHFIG
Sbjct  385   KSPMVKKASTGAK---KKSKGHECPICFRVFKSGQALGGHKRSHFIG  428



>gb|EPS71098.1| hypothetical protein M569_03665 [Genlisea aurea]
Length=382

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 73/117 (62%), Gaps = 4/117 (3%)
 Frame = +3

Query  801   GTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNG  980
             G+   + KYECLNCKK+F+SYQALGGHRPCH+++  + ES  G      ++      G  
Sbjct  225   GSLQKRSKYECLNCKKAFSSYQALGGHRPCHRRSCCEEESKTGENSPEEESSSIAALGAA  284

Query  981   GKIRDCFGSKKAGATEKKVRPKKGK-GHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                R    S  A   EKK + KK K  H CPFC R+FK+GQALGGHKRSHFIG  ++
Sbjct  285   ASKRT---SAAAAMYEKKNKGKKSKLPHVCPFCDRVFKNGQALGGHKRSHFIGNHRI  338



>ref|XP_007155253.1| hypothetical protein PHAVU_003G186100g [Phaseolus vulgaris]
 gb|ESW27247.1| hypothetical protein PHAVU_003G186100g [Phaseolus vulgaris]
Length=563

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 72/128 (56%), Gaps = 12/128 (9%)
 Frame = +3

Query  807   NANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD------ETY  965
             N+NK+ K+EC  C K+F+SYQALGGHR  HKK      S   + ENS++ D       T 
Sbjct  380   NSNKRGKFECTTCNKTFHSYQALGGHRASHKKIKGCFASRNESSENSIETDLPPDPITTE  439

Query  966   NHGNGGKIRDCFGSKKAGA-----TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
             N       R+  G  + GA      E     KK KGHECP C ++F SGQALGGHKRSH 
Sbjct  440   NKLMSNTDREYLGESQHGAGFHDEVETVTESKKSKGHECPICLKVFPSGQALGGHKRSHM  499

Query  1131  IGGAQVIN  1154
              GG++  N
Sbjct  500   TGGSESRN  507



>ref|XP_008805104.1| PREDICTED: zinc finger protein ZAT1-like [Phoenix dactylifera]
Length=496

 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 98/339 (29%), Positives = 143/339 (42%), Gaps = 65/339 (19%)
 Frame = +3

Query  195   SIGSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYG-SVVEFSDNNSVVLETKSSSIDMKT  368
             SI +SS   ++ E+EQE+VA+ LMMLS+D+  W G S    SD NSVVLE  SS  D   
Sbjct  156   SISASSTPVLELEKEQEDVARSLMMLSRDTSFWSGISSAAESDKNSVVLENLSSERD---  212

Query  369   SRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGY  548
                                             ++G  +K  +S  + +     +      
Sbjct  213   --------------------------------EIGKGKK--RSEFISSRNGNRRD-----  233

Query  549   FLGENKVESDVSVNGFLAKCKVLNRVKGYVE-----------PRRGGVEKEYENYDDFGV  695
               G  KVESDVS +    K +   + K                R+G ++K+  NY    +
Sbjct  234   --GLKKVESDVSYDDGFVKDEKFKKPKASASDIDEFEYSNEASRKGSLKKKDLNYCLAKL  291

Query  696   ASNSG-KQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQAL  872
                +G  Q  +    Y    ++GS  +  V        +  + +YEC  C K F SYQAL
Sbjct  292   EKKTGFDQLHSGVGKYS---KSGSRSEFDVSKDDFSKVSMKRGRYECTACNKFFPSYQAL  348

Query  873   GGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKG  1052
             GGHR  HK+      S      NSL+ D +       ++ +    KK G        KK 
Sbjct  349   GGHRASHKRMKVLFASRIEASNNSLEIDASIKPARLEELVE----KKVGLDTSSEASKKV  404

Query  1053  KGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGSHQT  1169
             K HECP C ++F S Q+L GH++SH +  +     +HQT
Sbjct  405   KSHECPICRKVFSSSQSLRGHRKSHLVASSDGGGLTHQT  443



>ref|XP_010462889.1| PREDICTED: uncharacterized protein LOC104743517 [Camelina sativa]
Length=726

 Score =   100 bits (250),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 120/355 (34%), Positives = 156/355 (44%), Gaps = 80/355 (23%)
 Frame = +3

Query  138   KRYKKLVVKSY----SLSLTNNNSI------GSSSVSEIDEQEQEEVAKCLMMLSKDSGN  287
             +R K++VVK +    +  + ++N I        S  SEI E EQ+E+A  LMMLS DSG 
Sbjct  399   RRSKRVVVKHHHHKAAFVVGDDNGIMKQFNSAYSDASEI-EPEQKEMALSLMMLSMDSGF  457

Query  288   WYG------SVVEFSDNNSVVLET-KSSSIDMKTSRkngngngngkgvvykvcnRDNNET  446
               G      S  E SDNNSV+LET KSSS ++                        NN  
Sbjct  458   KKGHNLVVNSFAESSDNNSVILETNKSSSGEL------------------LKMFNVNNVE  499

Query  447   QNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENKVESDVSVNGFLAKCKVLNR  623
                   K+G + K          + +S +SDSGYF  G  K+ SDVSV+G      V+  
Sbjct  500   AFCKKNKLGVDNKTRSGEDNGGVLYDSDNSDSGYFRNGPKKLYSDVSVDGGFDNKAVMGS  559

Query  624   VKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTS-YDPEMETGSYKKTKVVAASSP  800
               G+                      NS   K+  D + +  E     + K     +   
Sbjct  560   GSGF----------------------NSSPTKQDKDMNRFRKE-----WYKEGGSGSGGS  592

Query  801   GTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDM-ESGYGTGENSLDADETYNHGN  977
             G+  +  KY+    K+ F SY          KK   +  ES Y +GE+SLD D   +   
Sbjct  593   GSGRSSTKYDLRKSKRGFPSYG--------RKKIKYEFSESVYDSGEHSLDTDSCADTNR  644

Query  978   GGKIRDCFGS--KKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
               KI        KKA  T K    KK KGHECP C R+FKSGQALGGHKRSHFIG
Sbjct  645   TIKIHHSKSPMVKKASGTVK----KKSKGHECPICFRVFKSGQALGGHKRSHFIG  695



>ref|XP_006440700.1| hypothetical protein CICLE_v10019977mg [Citrus clementina]
 gb|ESR53940.1| hypothetical protein CICLE_v10019977mg [Citrus clementina]
Length=476

 Score = 99.4 bits (246),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 95/178 (53%), Gaps = 12/178 (7%)
 Frame = +3

Query  657   VEKEYE-NYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKK--KY  827
             ++KE E +  + G +  +   K+    S+DPE+ + S+K++   A+ +     ++K  K+
Sbjct  244   LKKETELDQAELGSSKQNSTSKKNVCNSFDPELRSDSFKRSTTDASDAEFYKDSQKRSKF  303

Query  828   ECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGS  1007
             EC  C K F+SYQALGGHR  HKK      +   + ENS++A+ + +     K+     +
Sbjct  304   ECATCNKIFHSYQALGGHRASHKKIKGCFATKIDSSENSIEAEHSPDPTADSKLIKSINN  363

Query  1008  KK-------AGATEKKVRPKKG--KGHECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
             +        A   + +     G  K HECP C ++F SGQALGGHKRSH +GG +  N
Sbjct  364   ENSADHFFVADCDDHRAETSCGAKKKHECPICRKVFPSGQALGGHKRSHLLGGNEARN  421


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +3

Query  165  SYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGN--WYGSVVEFSDNNSVVLE  338
            S S+S+ NN + GSSSVSEI EQEQEEVA CLMMLS+D G+     SV E SDNNSV LE
Sbjct  162  SCSISVANNKNNGSSSVSEI-EQEQEEVAMCLMMLSRDVGSRGVLNSVAESSDNNSVFLE  220



>gb|EPS61299.1| hypothetical protein M569_13499, partial [Genlisea aurea]
Length=152

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 66/113 (58%), Gaps = 28/113 (25%)
 Frame = +3

Query  795   SPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHG  974
             S  +NA   KYEC +C K F SYQALGGH+PCHK+ N D    Y +GENS + + + N+G
Sbjct  43    SKSSNAGGGKYECFDCSKIFASYQALGGHKPCHKR-NLDR---YESGENSPE-ESSPNNG  97

Query  975   NGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              GGK                        H CPFC R+FK+GQALGGHKRSHFI
Sbjct  98    GGGK-----------------------SHVCPFCDRVFKNGQALGGHKRSHFI  127



>ref|XP_006600569.1| PREDICTED: zinc finger protein ZAT4-like isoform X1 [Glycine 
max]
 ref|XP_006600570.1| PREDICTED: zinc finger protein ZAT4-like isoform X2 [Glycine 
max]
 gb|KHN18341.1| Zinc finger protein ZAT4 [Glycine soja]
Length=580

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 143/340 (42%), Gaps = 61/340 (18%)
 Frame = +3

Query  249   AKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykv  422
             A  LMMLS+D   W G  SV E SDNNS   E +SS   ++T+                 
Sbjct  206   AMSLMMLSRDVSPWSGRHSVAESSDNNSAYFEARSS---VRTNLVTKF------------  250

Query  423   cnRDNNETQNPP----TKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENKVESDVSVN  590
                D +    PP      K  DN+  + +S     +  + S         + + +++  N
Sbjct  251   ---DCSNKNFPPKTAKVTKQSDNKWEVGNSENPNSIRGTSSQLLTTIAASDNITTEIPEN  307

Query  591   GF-LAKCKVLNRVKGYVEPRRGGVEKEYEN-YDDF----------GVASNSGKQKRTNDT  734
             GF + K +V N  KGY    R   E EY +  +D           G  S   K   T   
Sbjct  308   GFRVNKSRVSN--KGY---ERAKSELEYVSALEDSEGEHGRSRVNGTESVLSKSVTTTGN  362

Query  735   SYDP--------EMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPC  890
              Y          EM++      K   A S   +  + K+EC  C K F+SYQALGGHR  
Sbjct  363   KYSSIKTKFSGSEMKSNKNLVDKASEAESSKNSNKRGKFECTTCNKIFHSYQALGGHRAS  422

Query  891   HKKTNPDMESGYGTGENSLDAD------ETYNHGNGGKIRDCFGSKKAGAT-----EKKV  1037
             HKK      S   + ENS++ D       T N        +     + GA+     E   
Sbjct  423   HKKIKGCFASTNESSENSIETDPSPDPIATENKLMKNSDSEYLVEHQHGASLHNEGETVN  482

Query  1038  RPKKGKG-HECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
               KK KG HECP C ++F SGQALGGHKRSH +GG++  N
Sbjct  483   ESKKSKGHHECPICFKVFPSGQALGGHKRSHMVGGSESRN  522



>gb|KDO54593.1| hypothetical protein CISIN_1g038961mg, partial [Citrus sinensis]
Length=457

 Score = 97.1 bits (240),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 88/168 (52%), Gaps = 11/168 (7%)
 Frame = +3

Query  684   DFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKK--KYECLNCKKSFN  857
             + G +  +   K+    S+DPE+ + S K++   A+ +     ++K  K+EC  C K F+
Sbjct  235   ELGSSKQNSTSKKNVCNSFDPELRSDSLKRSTTDASDAEFYKDSQKRSKFECATCNKIFH  294

Query  858   SYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKK-------A  1016
             SYQALGGHR  HKK      +   + ENS++A+ + +     K+     ++        A
Sbjct  295   SYQALGGHRASHKKIKGCFATKIDSSENSIEAEHSPDPTADSKLIKSINNENSADHFFVA  354

Query  1017  GATEKKVRPKKG--KGHECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
                + +     G  K HECP C ++F SGQALGGHKRSH +GG +  N
Sbjct  355   DCDDHRAETSCGAKKKHECPICLKVFPSGQALGGHKRSHLLGGNEARN  402


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +3

Query  165  SYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGN--WYGSVVEFSDNNSV  329
            S S+S+ NN + GSSSVSEI EQEQEEVA CLMMLS+D G+     SV E SDNNS+
Sbjct  159  SCSISVANNKNNGSSSVSEI-EQEQEEVAMCLMMLSRDVGSRGILNSVAESSDNNSL  214



>ref|XP_008356637.1| PREDICTED: uncharacterized protein LOC103420355 [Malus domestica]
Length=504

 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 64/115 (56%), Gaps = 11/115 (10%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH--GNGGKI  989
             + K+EC  C K F SYQALGGHR  HKKT     S + + EN+++ D +      N   I
Sbjct  337   RSKFECTTCNKVFRSYQALGGHRASHKKTKGCFASKFESSENTMETDISPKSCCNNDNPI  396

Query  990   RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
                     A +T         KGH CP C+R+F SGQALGGHKRSH IG A++ N
Sbjct  397   EQEIAESSAKST---------KGHSCPICYRVFSSGQALGGHKRSHLIGEAKITN  442



>ref|XP_006477628.1| PREDICTED: zinc finger protein ZAT4-like [Citrus sinensis]
Length=476

 Score = 96.7 bits (239),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 88/168 (52%), Gaps = 11/168 (7%)
 Frame = +3

Query  684   DFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKK--KYECLNCKKSFN  857
             + G +  +   K+    S+DPE+ + S K++   A+ +     ++K  K+EC  C K F+
Sbjct  254   ELGSSKQNSTSKKNVCNSFDPELRSDSLKRSTTDASDAEFYKDSQKRSKFECATCNKIFH  313

Query  858   SYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKK-------A  1016
             SYQALGGHR  HKK      +   + ENS++A+ + +     K+     ++        A
Sbjct  314   SYQALGGHRASHKKIKGCFATKIDSSENSIEAEHSPDPTADSKLIKSINNENSADHFFVA  373

Query  1017  GATEKKVRPKKG--KGHECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
                + +     G  K HECP C ++F SGQALGGHKRSH +GG +  N
Sbjct  374   DCDDHRAETSCGAKKKHECPICLKVFPSGQALGGHKRSHLLGGNEARN  421


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +3

Query  165  SYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGN--WYGSVVEFSDNNSVVLE  338
            S S+S+ NN + GSSSVSEI EQEQEEVA CLMMLS+D G+     SV E SDNNSV LE
Sbjct  162  SCSISVANNKNNGSSSVSEI-EQEQEEVAMCLMMLSRDVGSRGILNSVAESSDNNSVYLE  220



>ref|XP_004490147.1| PREDICTED: UPF0396 protein-like [Cicer arietinum]
Length=522

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 150/318 (47%), Gaps = 50/318 (16%)
 Frame = +3

Query  204   SSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGSVVEFSDNNSVVLETKSSSIDMKTSRk  377
             SSSVSE+ EQEQE+VA CLMMLS+DS     +  V E SDNNSVVLE KS S+D K +  
Sbjct  205   SSSVSEV-EQEQEDVALCLMMLSRDSTYKGRFALVTESSDNNSVVLEAKSPSVDTKFA--  261

Query  378   ngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLG  557
                             NR  N+      KK+  + K +KS  +      S S D  Y  G
Sbjct  262   ---------------VNRGKNKAFEVVEKKLNKDVK-LKSVGIGYVSDNSNSEDFNY--G  303

Query  558   ENKVESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTS  737
               KV+SD S + F    K   +V        G  E EYE+           +++  N   
Sbjct  304   PKKVDSDESSDDFFMNEKKSKKV--------GFGEHEYESSKKI-----MSRERSKNSNE  350

Query  738   YDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDME  917
             +   +   S  K  V ++S     +N + Y+        N  + L   R     ++   +
Sbjct  351   FKKLVLDDSVGKILVGSSSMKNGYSNDEMYD-------ENGGKELKIERESFSSSD---D  400

Query  918   SGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKG---HECPFCHRMF  1088
             S Y + ENS D+D +Y        ++  G K    ++K  +  K K    HECP C+++F
Sbjct  401   SAYESDENSTDSD-SYQAPKTQTNKNLIGKKTKYTSKKGKKKMKSKKSKEHECPICNKIF  459

Query  1089  KSGQALGGHKRSHFIGGA  1142
             KSGQALGGHKRSHF+GG+
Sbjct  460   KSGQALGGHKRSHFVGGS  477



>ref|XP_004508691.1| PREDICTED: uncharacterized protein LOC101491614 [Cicer arietinum]
Length=564

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 69/126 (55%), Gaps = 12/126 (10%)
 Frame = +3

Query  807   NANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADET-------  962
             N+NK+ K+EC  C K F+SYQALGGHR  HKKT     S     ENS++ D +       
Sbjct  385   NSNKRGKFECTTCNKIFHSYQALGGHRASHKKTKGCFASKIENSENSIETDLSPEQTVAA  444

Query  963   ---YNHGNGGKIRDCFGSKKAGATEKKVR-PKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
                + H N    R    S+        V+  KK KGHECP C ++F+SGQALGGHKRSH 
Sbjct  445   YVKHGHNNISLSRGLGRSEYVEKIADTVKETKKIKGHECPICFKVFQSGQALGGHKRSHM  504

Query  1131  IGGAQV  1148
             +    V
Sbjct  505   VAAGVV  510



>ref|XP_009339147.1| PREDICTED: zinc finger protein ZAT4-like [Pyrus x bretschneideri]
Length=506

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 63/113 (56%), Gaps = 11/113 (10%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH--GNGGKI  989
             + K+EC  C K F SYQALGGHR  HKKT     S   +GEN+++ D +      N   I
Sbjct  339   RSKFECTTCNKVFRSYQALGGHRASHKKTKGCFASKIESGENTMETDISPGSCCNNDNPI  398

Query  990   RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                     A +T         KGH CP C+R+F SGQALGGHKRSH IG A++
Sbjct  399   EQEIAESGAKST---------KGHSCPICYRVFSSGQALGGHKRSHLIGEAKI  442



>ref|XP_006579519.1| PREDICTED: uncharacterized protein LOC102669916 [Glycine max]
Length=569

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 71/125 (57%), Gaps = 12/125 (10%)
 Frame = +3

Query  807   NANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE------TY  965
             N+NK+ K+EC  C K F+SYQALGGHR  HKK      S   + ENS++ D       T 
Sbjct  384   NSNKRGKFECTTCNKIFHSYQALGGHRASHKKIKGCFASRNESSENSIETDLSPDPIITE  443

Query  966   NHGNGGKIRDCFGSKKAGAT-----EKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
             N        +C    + GA+     E     KK KGHECP C ++F SGQALGGHKRSH 
Sbjct  444   NKLMKNGDSECVVEHQHGASFHNEVETVNESKKSKGHECPICLKVFPSGQALGGHKRSHM  503

Query  1131  IGGAQ  1145
             +GG++
Sbjct  504   VGGSE  508



>ref|XP_009338601.1| PREDICTED: zinc finger protein ZAT9-like [Pyrus x bretschneideri]
Length=508

 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 61/113 (54%), Gaps = 11/113 (10%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH--GNGGKI  989
             + K+EC  C K F SYQALGGHR  HKK      S   + EN+++ D +      N   I
Sbjct  341   RSKFECTTCNKVFRSYQALGGHRASHKKIKGCFASKIESSENTMETDISPESCCNNENPI  400

Query  990   RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                     A +T         KGH CP CHR+F SGQALGGHKRSH IG A++
Sbjct  401   EKEIAESSAKST---------KGHSCPICHRVFPSGQALGGHKRSHLIGEAKI  444



>ref|XP_007157592.1| hypothetical protein PHAVU_002G082200g [Phaseolus vulgaris]
 gb|ESW29586.1| hypothetical protein PHAVU_002G082200g [Phaseolus vulgaris]
Length=507

 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 172/364 (47%), Gaps = 70/364 (19%)
 Frame = +3

Query  126   THHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NWYGS  299
             T  P+R K++  K+    L+++N+   SSVSE+ EQ QEEVA+CLMMLSKDS     +  
Sbjct  163   TSTPRRSKRMRFKT----LSSSNNQAQSSVSEV-EQGQEEVARCLMMLSKDSSYKGRFAL  217

Query  300   VVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDN  479
               E SDNNSVVLE KS S + K +  N NG                N   +   +K  + 
Sbjct  218   FTESSDNNSVVLEAKSPSPETKVTMMNSNGK---------------NFMSSAYVEKKLEQ  262

Query  480   RKVMKSSIVHTEMA-ESQSSDSGYFL-------------GENKVESDVSVNGFLAKC---  608
              K +K    + E+  +S +SDSGYF              G +K E+  S  G+L      
Sbjct  263   PKDLK--FKYAEVGYDSDNSDSGYFRYGPKEVDSTDSNNGNSKNEAMSSKAGYLTGFEDY  320

Query  609   -----KVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKK  773
                  KVL+R +      +  V +++EN    G A+     K+   ++YD   +      
Sbjct  321   DVESRKVLSRGRSSSIEFKKFVLEDWENDRQDGGAARKFDSKKFKKSNYDSLGQNLGGVS  380

Query  774   TKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA  953
             ++ +         N  KY+CL   +  N Y                 +S Y + ENS D 
Sbjct  381   SRKIGNGFANDKVN--KYKCLTSDRD-NGYD----------------DSAYESDENSTDT  421

Query  954   DETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             D +Y      + R+          +KK++ KK K HECP C+++F+SGQALGGHKRSHFI
Sbjct  422   D-SYPAPKAYRNRNL----SGQKGKKKLKSKKSKAHECPICNKIFRSGQALGGHKRSHFI  476

Query  1134  GGAQ  1145
             GG++
Sbjct  477   GGSE  480



>ref|XP_009801846.1| PREDICTED: zinc finger protein ZAT9-like [Nicotiana sylvestris]
Length=475

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 62/111 (56%), Gaps = 9/111 (8%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE-TYNHGNGGKIR  992
             K K+EC  C KSF+SYQALGGHR  HK+T           EN +D  E   N     KI 
Sbjct  316   KIKFECTACNKSFHSYQALGGHRASHKRTK--------GCENIIDEIEHMQNLAADNKIT  367

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             +   S      E     KK KG+ECP C ++F+SGQALGGHKRSH I  A+
Sbjct  368   NTKNSSNDSTIETSSVSKKLKGYECPICFKIFQSGQALGGHKRSHLIAEAK  418



>ref|XP_009623743.1| PREDICTED: zinc finger protein ZAT9-like [Nicotiana tomentosiformis]
Length=483

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 69/124 (56%), Gaps = 19/124 (15%)
 Frame = +3

Query  795   SPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS-LDADETYNH  971
             + G N+ K K+EC  C KSF+SYQALGGHR  HK            GENS +D +   N 
Sbjct  308   TEGFNSKKIKFECTTCNKSFHSYQALGGHRASHKNI---------KGENSSIDIEHLQNK  358

Query  972   G--NGGKIRDCFGSKKAGATEKKVRP----KKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             G  +   I++C       A  +K+      KK K HECP C ++F SGQALGGHKRSH I
Sbjct  359   GVDHIKLIKNC---SSESAINEKIETNSGSKKLKNHECPICFKIFSSGQALGGHKRSHLI  415

Query  1134  GGAQ  1145
               A+
Sbjct  416   AEAK  419



>gb|AHN52235.1| C2H2-type zinc finger protein 4 [Glycine max]
Length=549

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 107/341 (31%), Positives = 145/341 (43%), Gaps = 63/341 (18%)
 Frame = +3

Query  249   AKCLMMLSKDSGNWYG--SVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykv  422
             A  LMMLS+D   W G  SV E SDNNS   E +SS   ++T+                 
Sbjct  175   AMSLMMLSRDVSPWSGRHSVAESSDNNSAYFEARSS---VRTNLVTKF------------  219

Query  423   cnRDNNETQNPP----TKKMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENKVESDVSVN  590
                D +    PP      K  DN+  + +S     +  + S         + + +++  N
Sbjct  220   ---DCSNKNFPPKTAKVTKQSDNKWEVGNSENPNSIRGTSSQLLTTIAASDNITTEIPEN  276

Query  591   GF-LAKCKVLNRVKGYVEPRRGGVEKEYEN-YDDF----------GVASNSGKQKRTNDT  734
             GF + K +V N  KGY    R   E EY +  +D           G  S   K   T   
Sbjct  277   GFRVNKSRVSN--KGY---ERAKSELEYVSALEDSEGEHGRSRVNGTESVLSKSVTTTGN  331

Query  735   SYDP--------EMETGSYKKTKVVAASSPGTNANKK-KYECLNCKKSFNSYQALGGHRP  887
              Y          EM++      K   A S   N+NK+ K+EC  C K  +SYQALGGHR 
Sbjct  332   KYSSIKTKFSGSEMKSNKNLVDKASEAES-SKNSNKRGKFECTTCNKISHSYQALGGHRA  390

Query  888   CHKKTNPDMESGYGTGENSLDAD------ETYNHGNGGKIRDCFGSKKAGAT-----EKK  1034
              HKK      S   + ENS++ D       T N        +     + GA+     E  
Sbjct  391   SHKKIKGCFASTNESSENSIETDPSPDPIATENKLMKNSDSEYLVEHQHGASLHNEGETV  450

Query  1035  VRPKKGKG-HECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
                KK KG HECP C ++F SG+ALGGHKRSH +GG++  N
Sbjct  451   NESKKSKGHHECPICFKVFPSGRALGGHKRSHMVGGSESRN  491



>gb|KHN48727.1| Zinc finger protein ZAT4 [Glycine soja]
Length=569

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 69/125 (55%), Gaps = 12/125 (10%)
 Frame = +3

Query  807   NANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE------TY  965
             N+NK+ K+EC  C K F+SYQALGGHR  HKK      S   + ENS++ D       T 
Sbjct  384   NSNKRGKFECTTCNKIFHSYQALGGHRASHKKIKGCFASRNESSENSIETDLSPDPIITE  443

Query  966   NHGNGGKIRDCFGSKKAGAT-----EKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
             N        +C    + GA+     E     KK KGHECP C ++F  GQALGGHKRSH 
Sbjct  444   NKLMKNGDSECVVEHQHGASFHNEVETVNESKKSKGHECPICLKVFPCGQALGGHKRSHM  503

Query  1131  IGGAQ  1145
             +GG +
Sbjct  504   VGGFE  508



>ref|XP_011090203.1| PREDICTED: zinc finger protein ZAT4-like [Sesamum indicum]
Length=378

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 56/109 (51%), Gaps = 25/109 (23%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY C  C K F SYQALGGHR  HKK  P+          ++DA        GG      
Sbjct  240   KYRCEACNKLFRSYQALGGHRASHKKIKPN---------TAVDAPPQVVEKIGGS-----  285

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                     E+K+       HECPFCHR+F SGQALGGHKRSHF+G   +
Sbjct  286   ----KAVVEEKI-------HECPFCHRIFSSGQALGGHKRSHFLGAGAI  323



>dbj|BAA21919.1| ZPT2-10 [Petunia x hybrida]
 dbj|BAA96070.1| C2H2 zinc-finger protein ZPT2-10 [Petunia x hybrida]
Length=253

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 68/139 (49%), Gaps = 35/139 (25%)
 Frame = +3

Query  726   NDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTN  905
             N  SYD +++T      KV       T   + KY C  C K F SYQALGGHR  HKK  
Sbjct  101   NSASYDEDVKTEDSVVVKVTT-----TRRGRGKYICETCNKVFRSYQALGGHRASHKKIK  155

Query  906   PDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRM  1085
                          +  +ET N+GN                E +V  +K K HECP C+R+
Sbjct  156   -------------VSINETKNNGN---------------VESEV--QKDKIHECPVCYRV  185

Query  1086  FKSGQALGGHKRSHFIGGA  1142
             F SGQALGGHKRSH IG A
Sbjct  186   FSSGQALGGHKRSHGIGVA  204



>ref|XP_008239874.1| PREDICTED: zinc finger protein ZAT4-like [Prunus mume]
Length=540

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 79/150 (53%), Gaps = 8/150 (5%)
 Frame = +3

Query  717   KRTNDTSYDPE------METGSYKKTKVVAASSPGTNANKK-KYECLNCKKSFNSYQALG  875
             KR    SYD E      ++T S  +  V+ + +   ++ K+ K+EC  C K F SYQALG
Sbjct  328   KRKFQESYDFESRSEQSLKTLSTTRGDVLDSEAVCKSSQKRSKFECTTCNKVFRSYQALG  387

Query  876   GHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI-RDCFGSKKAGATEKKVRPKKG  1052
             GHR  HKK      S   + EN+++ D +    +  K+ + C          K     + 
Sbjct  388   GHRASHKKIKGCFASKVESSENTIETDLSPEPTSDSKLSKSCKNENPIKHDVKAEISTEN  447

Query  1053  KGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
             KGH CP C ++F SGQALGGHKRSH IGG+
Sbjct  448   KGHACPICLKVFPSGQALGGHKRSHLIGGS  477


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  144  YKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEF----  311
            Y      S + S+ N     +SSVSEI EQEQEEVA CLMML +D+G+W G  ++F    
Sbjct  173  YMGTTTSSSNFSIAN---AATSSVSEI-EQEQEEVALCLMMLKRDAGHWGG--LKFIAHD  226

Query  312  -SDNNSVVLETKSS  350
             SDNNSV  E  SS
Sbjct  227  SSDNNSVFSEAPSS  240



>dbj|BAA21928.1| ZPT4-4 [Petunia x hybrida]
Length=477

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 78/154 (51%), Gaps = 29/154 (19%)
 Frame = +3

Query  684   DFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSY  863
             DF V SN+ K K   D + D E+   S KK K               ++C  C KSF+SY
Sbjct  295   DFSVTSNTKKLK---DHASDSELNQDSEKKIK---------------FQCTTCNKSFHSY  336

Query  864   QALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRP  1043
             QALGGH   H+KT  D+++       + D+    N        D FG K    +      
Sbjct  337   QALGGHSTSHRKTK-DLQN------QATDSKIIKNSSKNNSTIDEFGEKDESFS----VS  385

Query  1044  KKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             KK KG+ECP C ++F+SGQALGGHKRSH I  A+
Sbjct  386   KKLKGYECPLCFKIFQSGQALGGHKRSHLIAEAK  419



>ref|XP_010030507.1| PREDICTED: zinc finger protein ZAT9-like [Eucalyptus grandis]
 gb|KCW83695.1| hypothetical protein EUGRSUZ_B00572 [Eucalyptus grandis]
Length=498

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 83/152 (55%), Gaps = 9/152 (6%)
 Frame = +3

Query  699   SNSGKQKRTNDTSYDPEMETGSYKKTKV--VAASSPGTNANKKKYECLNCKKSFNSYQAL  872
             ++S K+K T  +SYDPE++    +K     + +    +   + +++C  C K+F+SYQAL
Sbjct  286   TDSSKRKLT--SSYDPELKVNLPQKWDADNLDSQILHSPVKRSRFQCTTCNKTFHSYQAL  343

Query  873   GGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPK--  1046
             GGHR  HKK  P + S   + +N ++   + +     K       +     +K+V  +  
Sbjct  344   GGHRASHKKAMPTLASEIKSNDNGIEMAISPDPTVDVKPLKLRKPESTSNLDKEVVLRND  403

Query  1047  ---KGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                K K HECP C+++F SGQALGGHKRSH +
Sbjct  404   LKIKSKEHECPICYKVFLSGQALGGHKRSHLL  435



>ref|XP_008786152.1| PREDICTED: uncharacterized protein LOC103704576 [Phoenix dactylifera]
Length=498

 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 9/106 (8%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             + +++C  C K+F+SYQALGGHR  HK+T      G    ENSL+AD + +     ++  
Sbjct  333   RSRFQCTTCNKTFHSYQALGGHRASHKRTK-----GCSGSENSLEADASVDQAAAEEM--  385

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 +  G       PKK KGHEC  C ++F SGQALGGHKR+H +
Sbjct  386   --DGQGVGIEAANGSPKKAKGHECLLCGKVFASGQALGGHKRAHLV  429



>ref|XP_006415937.1| hypothetical protein EUTSA_v10009600mg [Eutrema salsugineum]
 gb|ESQ34290.1| hypothetical protein EUTSA_v10009600mg [Eutrema salsugineum]
Length=452

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 107/316 (34%), Positives = 143/316 (45%), Gaps = 65/316 (21%)
 Frame = +3

Query  228   EQEQEEVAKCLMMLSKDSGNWYG------SVVEFSDNNSVVLETKSSSIDMKTSRkngng  389
             E EQEE+A  LMMLS+DS    G      S+ E SDNNSV+LETKSSS +    +     
Sbjct  164   EPEQEEMALSLMMLSRDSSFKKGHNLVVNSLAESSDNNSVILETKSSSGEQ--LKMVNVK  221

Query  390   ngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQSSDSGYFL-GENK  566
             N        K    DNN+ +        DN  ++          +S +SDSGYF  G  K
Sbjct  222   NVEESCKKEKHGGVDNNQLRYGE-----DNGDIL---------YDSDNSDSGYFRNGPKK  267

Query  567   VESDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDP  746
             ++SDVSV+G         R  G+          + ++   FG   NS   K+  + +   
Sbjct  268   LDSDVSVDGLF-------RNTGF----------DNKSVMRFGSGLNSSTTKQDKNLN---  307

Query  747   EMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCH--KKTNPDM-E  917
                    +  K  + S  G+  +  KY+    K+ F          PC+  KK   +  E
Sbjct  308   -------RFRKEWSGSGSGSGRSSTKYDLRKSKRGF----------PCYGRKKIKYEFTE  350

Query  918   SGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSG  1097
             S Y +GE+SL+ D   +     KI     S            KK KGHECP C R+FKSG
Sbjct  351   SVYDSGEHSLETDSCADTNRTIKIHS--KSPMVVKKPSGGSKKKSKGHECPICFRVFKSG  408

Query  1098  QALGGHKRSHFIGGAQ  1145
             QALGGHKRSHFIG  +
Sbjct  409   QALGGHKRSHFIGNQE  424



>ref|XP_008393205.1| PREDICTED: uncharacterized protein LOC103455400 [Malus domestica]
Length=509

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 60/113 (53%), Gaps = 11/113 (10%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH--GNGGKI  989
             + K+EC  C K F SYQALGGHR  HKK      S     EN+++ D +      N   I
Sbjct  342   RSKFECTTCNKVFRSYQALGGHRASHKKIKGCFASKIEGSENTMETDISPESCCNNENPI  401

Query  990   RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                     A +T         KGH CP C+R+F SGQALGGHKRSH IG A++
Sbjct  402   EQEIAESSAKST---------KGHSCPICYRVFPSGQALGGHKRSHLIGEAKI  445



>emb|CAN68959.1| hypothetical protein VITISV_019273 [Vitis vinifera]
Length=1073

 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 98/346 (28%), Positives = 151/346 (44%), Gaps = 67/346 (19%)
 Frame = +3

Query  222   IDEQEQEEVAKCLMMLSKDSGNW--YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngng  395
             + E E EE A CLM+LS+   +W  + SV E SDNNSV+ E KSS  +    +  G    
Sbjct  360   LSEPELEEGALCLMLLSRAVRSWEEFYSVPESSDNNSVIAEAKSSHQNTPIIKDEGENFV  419

Query  396   ngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHT-------EMAESQSSDSGYFL  554
             +           D  ET    +K + +  K+++S ++ +       +  E+ SSDSG+  
Sbjct  420   S-----------DGRET----SKMLKEKEKMLESCVLESGNVLFEKKTTETGSSDSGFVS  464

Query  555   G-ENKVESDVSVNGFLAK----------CKVLNRVKGYVEPRRGGVEKEYENYDDFGVA-  698
               E +VE +V  +  L K          C      K + E +    + E  N D   +  
Sbjct  465   HHETRVELEVCADDGLKKKLDVESQYELCDSEIEKKFHSEIKIKTTDVELGNIDLLTIGL  524

Query  699   --SNS-----GKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFN  857
               +NS        KR      +P++E G++   +  AA       NK+ Y+C  C K F 
Sbjct  525   QEANSEYVKHNSSKRAKCEPSEPDLE-GNFCNKRSPAAQ------NKRIYKCSICSKIFQ  577

Query  858   SYQALGGHR---------PCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSK  1010
             S++ LGGHR          C K    +     G   + L+  E YN  +        G +
Sbjct  578   SHRVLGGHRMRCLASKSKSCGKSIQTNKILPDGKANSKLEKRE-YNENS-------IGQE  629

Query  1011  KAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
              A  +      K+ K +EC  C ++F SGQALGGHKR+H+ G ++ 
Sbjct  630   AARVSGMNCELKRSKDYECEICFKVFASGQALGGHKRAHYAGSSET  675



>ref|XP_010661128.1| PREDICTED: zinc finger protein 845-like [Vitis vinifera]
Length=570

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 98/346 (28%), Positives = 151/346 (44%), Gaps = 67/346 (19%)
 Frame = +3

Query  222   IDEQEQEEVAKCLMMLSKDSGNW--YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngng  395
             + E E EE A CLM+LS+   +W  + SV E SDNNSV+ E KSS  +    +  G    
Sbjct  196   LSEPELEEGALCLMLLSRAVRSWEEFYSVPESSDNNSVIAEAKSSHQNTPIIKDEGENFV  255

Query  396   ngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHT-------EMAESQSSDSGYFL  554
             +           D  ET    +K + +  K+++S ++ +       +  E+ SSDSG+  
Sbjct  256   S-----------DGRET----SKMLKEKEKMLESCVLESGNVLFEKKTTETGSSDSGFVS  300

Query  555   G-ENKVESDVSVNGFLAK----------CKVLNRVKGYVEPRRGGVEKEYENYDDFGVA-  698
               E +VE +V  +  L K          C      K + E +    + E  N D   +  
Sbjct  301   HHETRVELEVCADDGLKKKLDVESQYELCDSEIEKKFHSEIKIKTTDVELGNIDLLTIGL  360

Query  699   --SNS-----GKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFN  857
               +NS        KR      +P++E G++   +  AA       NK+ Y+C  C K F 
Sbjct  361   QEANSEYVKHNSSKRAKCEPSEPDLE-GNFCNKRSPAAQ------NKRIYKCSICSKIFQ  413

Query  858   SYQALGGHR---------PCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSK  1010
             S++ LGGHR          C K    +     G   + L+  E YN  +        G +
Sbjct  414   SHRVLGGHRMRCLASKSKSCGKSIQTNKILPDGKANSKLEKRE-YNENS-------IGQE  465

Query  1011  KAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
              A  +      K+ K +EC  C ++F SGQALGGHKR+H+ G ++ 
Sbjct  466   AARVSGMNCELKRSKDYECEICFKVFASGQALGGHKRAHYAGSSET  511



>ref|XP_004236489.1| PREDICTED: zinc finger protein ZAT1-like [Solanum lycopersicum]
Length=445

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 98/216 (45%), Gaps = 49/216 (23%)
 Frame = +3

Query  531   SSDSGYFLGENKVESDVSVNG--FLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASN  704
             S D   ++G N V    S N   FL K +++ +VK   +  +G   K   N         
Sbjct  205   SRDVSNWVGNNHVTDQCSDNNSQFLTKSELIKKVKNGKKTEQGESSKSVTN---------  255

Query  705   SGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHR  884
              G+++   +   D + +    +    V  S P     K K+EC  C KSF+SYQALGGHR
Sbjct  256   -GQKRNRTEVLDDEKKKKMKMENENRVVISDP-----KIKFECTTCNKSFHSYQALGGHR  309

Query  885   PCHK---------KTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKV  1037
               HK          T+ D+     TG+N  +  +           +C GSKK        
Sbjct  310   ASHKNSKGDQTCAATHIDLAKQIKTGDNETEFGQ-----------NC-GSKK--------  349

Query  1038  RPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
                + K HECP C+++F SGQALGGHKRSH I  A+
Sbjct  350   ---QLKMHECPICYKIFPSGQALGGHKRSHLIAEAK  382



>ref|XP_009395200.1| PREDICTED: zinc finger protein ZAT4-like [Musa acuminata subsp. 
malaccensis]
Length=460

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 88/171 (51%), Gaps = 8/171 (5%)
 Frame = +3

Query  630   GYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTN  809
             G+ E     + K Y++ DDF  AS +  +K++ + + D      +   TK V        
Sbjct  228   GFAEDDDLKMPKSYDS-DDFDEASTTCFKKKSLNCNADRLDAYDAKSSTKPVDIDFHKPP  286

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGY---GTGENSLDADETYNHGNG  980
               K +Y+CL C KSF+SYQA GGHR  H +    +E+G     T +NS+++    N    
Sbjct  287   KQKNRYKCLICNKSFHSYQAFGGHRSSHMRMKASIEAGTDGSSTCKNSIES----NAYTA  342

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              K  D    ++AG        KK K + CP C ++F SGQALGGHKRSHF+
Sbjct  343   TKQTDEDSGRRAGTGTGSEASKKVKEYNCPICCKVFSSGQALGGHKRSHFL  393



>emb|CBI27269.3| unnamed protein product [Vitis vinifera]
Length=554

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 22/107 (21%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             + KY+CL C K+F+S+QALGGHR  HK+      + +G+G+  +  D             
Sbjct  377   RSKYQCLTCNKTFHSHQALGGHRANHKRK----LARFGSGKTPIAQD-------------  419

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                   +G  EKK+  +K  GH CP C ++F+SGQALGGHK+SHF+G
Sbjct  420   -----LSGKAEKKIGSRKSNGHMCPICFKVFRSGQALGGHKKSHFVG  461



>ref|XP_009595361.1| PREDICTED: zinc finger protein ZAT4-like [Nicotiana tomentosiformis]
Length=432

 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 63/121 (52%), Gaps = 22/121 (18%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIR-  992
             K K+EC  C KSF SYQALGGHR  HK+T        G    ++  + T N     K+  
Sbjct  266   KIKFECTTCNKSFYSYQALGGHRASHKRTK-------GCENITIAIEHTQNQAADNKLTN  318

Query  993   ----------DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                       D FG K     E     KK +G+ECP C ++F+SGQALGGHKRSH I  A
Sbjct  319   TKNSSNDSTIDEFGEK----VETSSVSKKLEGYECPICFKIFQSGQALGGHKRSHLIAKA  374

Query  1143  Q  1145
             +
Sbjct  375   K  375



>ref|XP_006345158.1| PREDICTED: zinc finger protein ZAT9-like [Solanum tuberosum]
Length=453

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 100/208 (48%), Gaps = 32/208 (15%)
 Frame = +3

Query  531   SSDSGYFLGENKVESDVSVNG--FLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASN  704
             S D   ++G N V    S N   FL K +++ +VK       G  E+        G +S 
Sbjct  203   SRDVSNWVGHNNVTDQCSDNNSQFLTKSELIKKVKN------GKTEQ--------GESSK  248

Query  705   SGKQKRTNDTSYDPEMETGSYKKTKV-VAASSPGTNANKKKYECLNCKKSFNSYQALGGH  881
             S    +  + S +P +     KK K+ V   +   +  K K+EC  C KSF+SYQALGGH
Sbjct  249   SLINGKKRNKS-EPLIHGDDEKKKKIKVENENRVISDPKIKFECTTCNKSFHSYQALGGH  307

Query  882   RPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGH  1061
             R  HK  N   E+  GT     D D      NG      FG +  G+       K+ K H
Sbjct  308   RASHK--NSKGETCTGT-----DIDHVKQIKNGNNNESEFG-QNCGSK------KQLKMH  353

Query  1062  ECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             ECP C+++F SGQALGGHKRSH I  A+
Sbjct  354   ECPICYKIFPSGQALGGHKRSHLIAEAK  381



>gb|KEH31995.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=516

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = +3

Query  807   NANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH----  971
             N NK+ K+EC  C K F+SYQALGGHR  HKK      S   + ENS++ +   +H    
Sbjct  341   NFNKRGKFECTTCNKIFHSYQALGGHRASHKKNKGCFASKIESSENSIEFETDLSHHEPT  400

Query  972   --GNGGKIRDCFGSKKAGATEKKVR--PKKGKG-HECPFCHRMFKSGQALGGHKRSHFIG  1136
                   KI D     +     + VR   KK KG HECP C ++F+SGQALGGHKRSH + 
Sbjct  401   TESKLMKISDNIEYVQNMGERETVRDSKKKIKGHHECPICFKVFQSGQALGGHKRSHIVA  460



>ref|XP_009400680.1| PREDICTED: zinc finger protein ZAT9-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 59/130 (45%), Gaps = 32/130 (25%)
 Frame = +3

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTN---PDMESGYGTGENSL  947
             +  A S P     + +Y+C  CKK F SYQALGGHR  HK+TN   P  E    +  +S+
Sbjct  187   RPAARSRPPPRKGRSRYQCSACKKVFRSYQALGGHRASHKRTNGCRPVTEPRINSEADSV  246

Query  948   DADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSH  1127
             DA+                                K HECP C R+F SGQALG HKRSH
Sbjct  247   DAN-----------------------------ADAKVHECPLCFRVFSSGQALGSHKRSH  277

Query  1128  FIGGAQVING  1157
                 A  + G
Sbjct  278   LTSSATTVAG  287



>ref|XP_011093296.1| PREDICTED: uncharacterized protein LOC105173302 [Sesamum indicum]
Length=483

 Score = 87.0 bits (214),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 83/160 (52%), Gaps = 33/160 (21%)
 Frame = +3

Query  696   ASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALG  875
             AS S +++R N  ++       ++ K K + + SP     K  +EC  CKK FNS+QALG
Sbjct  186   ASASREEERRNHNTF---TSRANFDKAKGLVSPSP-----KGLFECKACKKVFNSHQALG  237

Query  876   GHRPCHKK--------------TNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKK  1013
             GHR  HKK              TN   E    T E SL   ++ ++   G+     GS  
Sbjct  238   GHRASHKKVKGCYAAKQEQQDETNL-AEDDVITHEESLIPPKSTSYFQFGQ-----GSTI  291

Query  1014  AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              GAT++K      KGHEC  CHR+F SGQALGGHKR H+I
Sbjct  292   IGATKRK-----SKGHECSICHRVFPSGQALGGHKRCHWI  326



>ref|XP_008775635.1| PREDICTED: uncharacterized protein LOC103695954 [Phoenix dactylifera]
Length=989

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             + ++EC +C K F+SYQALGGHR  HK+    M+S  G+ ENSL+ D +  H   G++ D
Sbjct  824   RSRFECTSCNKIFHSYQALGGHRASHKR----MKSCCGS-ENSLETDASVEHAAVGEMVD  878

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
                 + AG        KK K H+C  C ++F SGQALGGHKRSH 
Sbjct  879   ----RGAGIEAANGLSKKAKSHQCLLCGKVFASGQALGGHKRSHL  919



>ref|XP_008344613.1| PREDICTED: zinc finger protein ZAT1-like [Malus domestica]
 ref|XP_008363200.1| PREDICTED: zinc finger protein ZAT1-like [Malus domestica]
Length=490

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 62/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH------  971
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H      
Sbjct  215   ANKALFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHLEDSMADDDVITHEEFFPN  274

Query  972   GNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              +   ++   GS    A   K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  275   KSNSTLQFDHGSNTPSAYTSK---RKSKVHECSICHRIFSSGQALGGHKRCHWI  325



>gb|KHN03635.1| Zinc finger protein ZAT9 [Glycine soja]
Length=464

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 170/359 (47%), Gaps = 59/359 (16%)
 Frame = +3

Query  117   SQSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NW  290
             ++++  P+R K +  K+ S     NN+   SS     EQEQEEVA+CLMMLSKDS     
Sbjct  120   TETSSAPRRSKGMKFKTLS-----NNNQPQSSSVSEVEQEQEEVARCLMMLSKDSSYKGR  174

Query  291   YGSVVEFSDNNSVVLETKSSSIDMKTSRkngn--gngngkgvvykvcnRDNNETQNPPTK  464
             +  + E SDNNS+V+ TKS S++ K +        N      V +    + N+     + 
Sbjct  175   FALLTESSDNNSIVI-TKSPSLETKVTTMINGYGKNSMSSAYVERKLELEQNKDLKFKSA  233

Query  465   KMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENKVESDVSVNGF-----LAKCKVLNRVK  629
             ++G +     S           S+D G+F  E K      +NGF     +   KVL+R +
Sbjct  234   EVGYDSDNSDSGYFRYGPKSDVSNDDGFFRNEVKSSKVGYLNGFDQEYDVESRKVLSRGR  293

Query  630   GYVEPRRGGVEKEYENYD-DFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGT  806
                      V +++ENYD + GVA+ +   K+   ++YD  +                G 
Sbjct  294   SRSSEFNEFVLEDWENYDREDGVAARTFDSKKFKKSNYDDSL----------------GQ  337

Query  807   N---ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE---TYN  968
             N    + +KYECL   + +N          C        +S Y + ENS D D       
Sbjct  338   NLGGVSTRKYECLT-NEMYNG---------CSD------DSAYESDENSTDTDSYPAPKA  381

Query  969   HGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             H N   +     S + G  +KK++ KK K HECP C+++F+SGQALGGHKRSHF+GG++
Sbjct  382   HSNRNNL-----SVQKGKKKKKLKSKKSKAHECPICNKIFRSGQALGGHKRSHFVGGSE  435



>ref|XP_010939263.1| PREDICTED: zinc finger protein ZAT1-like [Elaeis guineensis]
Length=490

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             + ++EC  C K+F+SYQALGGHR  HK+       G    ENSL+ D +       K  D
Sbjct  325   RSRFECTTCNKTFHSYQALGGHRASHKRMK-----GCCGSENSLETDASVEQAATQKAVD  379

Query  996   -CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              C G + A    KK      K HEC  C ++F SGQALGGHKRSH +
Sbjct  380   RCVGIEAANGLSKKA-----KSHECLLCGKVFASGQALGGHKRSHLV  421



>ref|XP_010919569.1| PREDICTED: zinc finger protein ZAT9-like [Elaeis guineensis]
Length=508

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 67/136 (49%), Gaps = 8/136 (6%)
 Frame = +3

Query  744   PEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESG  923
             P   T + +K K  AA  P     +  +EC  CKK F+S+QALGGHR  HKK      + 
Sbjct  211   PIAVTATTEKPK--AAVFPPPAVPRGMFECKACKKVFSSHQALGGHRASHKKVKGCFAAK  268

Query  924   YGTGENSLDADETYNHGNGGKIRDCFGSKKAGA----TEKKVRP--KKGKGHECPFCHRM  1085
                 E +L  DE   H N        G   A      T   + P  KK K HEC  CHR+
Sbjct  269   IDDLEEALPDDEVITHDNNNSEMAAAGMAMAIVPFDNTPLAIMPLKKKSKVHECSICHRV  328

Query  1086  FKSGQALGGHKRSHFI  1133
             F SGQALGGHKR H+I
Sbjct  329   FASGQALGGHKRCHWI  344



>ref|XP_009350429.1| PREDICTED: uncharacterized protein LOC103941954 [Pyrus x bretschneideri]
Length=459

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 62/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH------  971
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H      
Sbjct  184   ANKCLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHLEDSMADDDVITHEEFFPN  243

Query  972   GNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              +   ++   GS    A   K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  244   KSNSTLQFNHGSNTPSAYTSK---RKSKVHECSICHRIFSSGQALGGHKRCHWI  294



>ref|XP_004231156.1| PREDICTED: zinc finger protein ZAT4-like [Solanum lycopersicum]
Length=519

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 71/134 (53%), Gaps = 8/134 (6%)
 Frame = +3

Query  741   DPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMES  920
             D ++E     +  ++ +        K  +EC  CKK FNS+QALGGHR  HKK    ++ 
Sbjct  220   DKDLEHDRKSEFFIIPSLDKAKGVPKGLFECKACKKLFNSHQALGGHRASHKK----VKG  275

Query  921   GYGTGENSLDADETYNHGN---GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFK  1091
              Y   +N LD D T++  N   G K        + G++      +K K HEC  CHR+F 
Sbjct  276   CYAAKQNQLD-DNTHDQDNYLKGSKSSSYNYQFEQGSSLTGASKRKSKVHECSICHRVFS  334

Query  1092  SGQALGGHKRSHFI  1133
             +GQALGGHKR H+I
Sbjct  335   TGQALGGHKRCHWI  348



>ref|XP_006582555.1| PREDICTED: probable cyclin-dependent serine/threonine-protein 
kinase DDB_G0292550-like [Glycine max]
 gb|KHN17800.1| Zinc finger protein ZAT4 [Glycine soja]
Length=560

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 69/129 (53%), Gaps = 19/129 (15%)
 Frame = +3

Query  810   ANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS--LDADETYNHGNG  980
             +NK+ K+EC  CKK F+SYQALGGHR  HK+      S   + ENS  L+A+ + +    
Sbjct  364   SNKRGKFECTTCKKIFHSYQALGGHRASHKRIKGCFASRNESSENSTELEAELSPDPTTE  423

Query  981   GKI----------------RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGG  1112
              K+                     ++     E     KKGKGHECP CH++F SGQALGG
Sbjct  424   SKLLKNEYVEEHEMVTNVTTATTTTQFDNEVETVRDSKKGKGHECPICHKVFPSGQALGG  483

Query  1113  HKRSHFIGG  1139
             HKRSH + G
Sbjct  484   HKRSHHLAG  492



>ref|XP_006348001.1| PREDICTED: zinc finger protein ZAT4-like [Solanum tuberosum]
Length=523

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 66/116 (57%), Gaps = 17/116 (15%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI  989
             A K  +EC  C+K FNS+QALGGHR  HKK    ++  Y   ++ LD + T++  N  K 
Sbjct  242   APKGLFECKACRKVFNSHQALGGHRASHKK----VKGCYAAKQDQLDDNNTHDQDNYFK-  296

Query  990   RDCFGSKKA--------GATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 GSK +        G++      KK K HEC  CHR+F +GQALGGHKR H+I
Sbjct  297   ----GSKSSSYNYQFEQGSSLTGASRKKSKVHECSICHRVFSTGQALGGHKRCHWI  348



>gb|KDP28801.1| hypothetical protein JCGZ_14572 [Jatropha curcas]
Length=361

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 58/108 (54%), Gaps = 25/108 (23%)
 Frame = +3

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIR  992
             N+ KY+C  CKK F SYQALGGHR  HKK    +++     E  L   ET N G      
Sbjct  228   NRGKYKCETCKKVFKSYQALGGHRASHKK----LKNYTQNRETEL---ETENAGTS----  276

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                      A EKKV       HECP+C R+F SGQALGGHKRSH  G
Sbjct  277   -------TSAVEKKV-------HECPYCFRVFSSGQALGGHKRSHVTG  310



>ref|XP_003517826.2| PREDICTED: uncharacterized protein LOC100805520 [Glycine max]
Length=522

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 170/359 (47%), Gaps = 59/359 (16%)
 Frame = +3

Query  117   SQSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NW  290
             ++++  P+R K +  K+ S     NN+   SS     EQEQEEVA+CLMMLSKDS     
Sbjct  178   TETSSAPRRSKGMKFKTLS-----NNNQPQSSSVSEVEQEQEEVARCLMMLSKDSSYKGR  232

Query  291   YGSVVEFSDNNSVVLETKSSSIDMKTSRkngn--gngngkgvvykvcnRDNNETQNPPTK  464
             +  + E SDNNS+V+ TKS S++ K +        N      V +    + N+     + 
Sbjct  233   FALLTESSDNNSIVI-TKSPSLETKVTTMINGYGKNSMSSAYVERKLELEQNKDLKFKSA  291

Query  465   KMGDNRKVMKSSIVHTEMAESQSSDSGYFLGENKVESDVSVNGF-----LAKCKVLNRVK  629
             ++G +     S           S+D G+F  E K      +NGF     +   KVL+R +
Sbjct  292   EVGYDSDNSDSGYFRYGPKSDVSNDDGFFRNEVKSSKVGYLNGFDQEYDVESRKVLSRGR  351

Query  630   GYVEPRRGGVEKEYENYD-DFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGT  806
                      V +++ENYD + GVA+ +   K+   ++YD  +                G 
Sbjct  352   SRSSEFNEFVLEDWENYDREDGVAARTFDSKKFKKSNYDDSL----------------GQ  395

Query  807   N---ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE---TYN  968
             N    + +KYECL   + +N          C        +S Y + ENS D D       
Sbjct  396   NLGGVSTRKYECLT-NEMYNG---------CSD------DSAYESDENSTDTDSYPAPKA  439

Query  969   HGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             H N   +     S + G  +KK++ KK K HECP C+++F+SGQALGGHKRSHF+GG++
Sbjct  440   HSNRNNL-----SVQKGKKKKKLKSKKSKAHECPICNKIFRSGQALGGHKRSHFVGGSE  493



>ref|XP_010923648.1| PREDICTED: zinc finger protein ZAT4 [Elaeis guineensis]
Length=500

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             + ++EC  C K+F+SYQALGGHR  HK+    M+  YG+ ENSL+ D + +     ++ D
Sbjct  335   RSQFECSTCNKTFHSYQALGGHRASHKR----MKGCYGS-ENSLETDASVDLPAVEEMVD  389

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 +  G        KK KGHEC  C ++F SGQALGGHKR+H +
Sbjct  390   ----QGEGIEAANGLSKKAKGHECLLCGKVFSSGQALGGHKRAHLV  431



>ref|XP_009350427.1| PREDICTED: zinc finger protein ZAT1-like [Pyrus x bretschneideri]
Length=490

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 62/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNH------  971
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H      
Sbjct  215   ANKCLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHLEDSMADDDVITHEEFFPN  274

Query  972   GNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              +   ++   GS    A   K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  275   KSNSTLQFNHGSNTPSAYTSK---RKSKVHECSICHRIFSSGQALGGHKRCHWI  325



>ref|XP_008232569.1| PREDICTED: zinc finger protein ZAT9-like [Prunus mume]
Length=493

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 61/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN----  977
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H      
Sbjct  214   ANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHLEDSMADDDVITHEEFFPN  273

Query  978   --GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                  ++   GS    A   K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  274   KPNSTLQFDHGSNTPSAYTSK---RKAKVHECSICHRVFSSGQALGGHKRCHWI  324



>emb|CDP09474.1| unnamed protein product [Coffea canephora]
Length=489

 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 86/192 (45%), Gaps = 38/192 (20%)
 Frame = +3

Query  594   FLAKCKV-LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYK  770
              LA+C V L   +  VEP         E            +++R N  +        +Y 
Sbjct  156   LLARCLVDLANARFEVEPEESCASASKE------------EERRINPVT--------AYF  195

Query  771   KTKVVAASSP---GTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGEN  941
              T ++A+  P      A+K  +EC  CKK FNS+QALGGHR  HKK      +     ++
Sbjct  196   NTPLIASRVPLDKPKGASKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAAKQDQQDD  255

Query  942   SLDADETYNHGNGGKIRDCFGSKKA--------GATEKKVRPKKGKGHECPFCHRMFKSG  1097
             S  AD+         I D F   K+        G T      +K K HEC  CHR+F +G
Sbjct  256   SSLADDDVT------IHDEFFPSKSPSSLQFEQGPTMAGASRRKSKVHECTICHRVFSTG  309

Query  1098  QALGGHKRSHFI  1133
             QALGGHKR H+I
Sbjct  310   QALGGHKRCHWI  321



>ref|XP_007219076.1| hypothetical protein PRUPE_ppa014890mg [Prunus persica]
 gb|EMJ20275.1| hypothetical protein PRUPE_ppa014890mg [Prunus persica]
Length=493

 Score = 84.7 bits (208),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 61/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN----  977
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H      
Sbjct  214   ANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHLEDSMADDDVITHEEFFPN  273

Query  978   --GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                  ++   GS    A   K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  274   KPNSTLQFDHGSNTPSAYTSK---RKAKVHECSICHRVFSSGQALGGHKRCHWI  324



>ref|XP_004301124.1| PREDICTED: uncharacterized protein LOC101302461 [Fragaria vesca 
subsp. vesca]
Length=489

 Score = 84.7 bits (208),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 59/112 (53%), Gaps = 4/112 (4%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS--LDADETYNH--GNGG  983
             + KYEC  C K F SYQALGGHR  HKK      S   + EN+   D D + +H   +G 
Sbjct  313   RSKYECGTCNKVFRSYQALGGHRASHKKIKGCFASKIESSENTAEFDTDLSTDHPVASGH  372

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGG  1139
                      +    + +    K KGH CP C ++F +GQALGGHKRSH I G
Sbjct  373   SKLSNLIHHQDVVVKAESNSTKSKGHSCPICLKVFPTGQALGGHKRSHLIVG  424



>ref|XP_009761173.1| PREDICTED: zinc finger protein ZAT1-like [Nicotiana sylvestris]
Length=462

 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 58/113 (51%), Gaps = 17/113 (15%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N+ KKK+EC  C K+F+SYQALGGHR  HK          G     L  + +       K
Sbjct  303   NSKKKKFECTICNKNFHSYQALGGHRASHKNI-----ENKGVDHIKLIKNCSSESAINEK  357

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             I    GSKK             K HECP C ++F SGQALGGHKRSH I  A+
Sbjct  358   IETNSGSKKL------------KNHECPICFKIFSSGQALGGHKRSHLIADAK  398



>ref|XP_009785654.1| PREDICTED: zinc finger protein ZAT4-like [Nicotiana sylvestris]
Length=465

 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 73/146 (50%), Gaps = 17/146 (12%)
 Frame = +3

Query  696   ASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALG  875
             AS   ++ R   T   P + T      K   ASS G       +EC  CKK FNS+QALG
Sbjct  192   ASKEEERARNPMTYLTPLVTTRVPLDNKAKGASSKGL------FECKACKKVFNSHQALG  245

Query  876   GHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGK  1055
             GHR  HKK    ++  Y   ++ LD D      +   I D F  + + +       +K K
Sbjct  246   GHRASHKK----VKGCYAAKQDQLD-DSLIGDQDMNIIHDEFTLQASKSM------RKSK  294

Query  1056  GHECPFCHRMFKSGQALGGHKRSHFI  1133
              HEC  CHR+F +GQALGGHKR H+I
Sbjct  295   IHECSICHRVFSTGQALGGHKRCHWI  320



>ref|XP_008375807.1| PREDICTED: zinc finger protein ZAT9-like [Malus domestica]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 60/114 (53%), Gaps = 9/114 (8%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN----  977
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H      
Sbjct  216   ANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHLEDSMADDDVITHEEFLPN  275

Query  978   --GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                  ++   GS        K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  276   KPNSTLQFDHGSNNPSVYTSK---RKSKVHECSICHRIFSSGQALGGHKRCHWI  326



>ref|XP_011072829.1| PREDICTED: zinc finger protein ZAT4-like [Sesamum indicum]
Length=475

 Score = 84.3 bits (207),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             K+ C  CKK+F SYQALGGHR  HKK      S   T +NS + + + N  +  K+  C 
Sbjct  309   KFMCAICKKAFPSYQALGGHRASHKKFK---GSCAPTTQNSPETENSLNQSDSTKLSKCT  365

Query  1002  GSKK-----AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               +      A      V  K+ K HECP C ++F SGQALGGHKRSH +
Sbjct  366   SRESPVDVFAEKIVSDVVGKRSKDHECPICFKVFPSGQALGGHKRSHLV  414



>ref|XP_008796146.1| PREDICTED: zinc finger protein ZAT4-like [Phoenix dactylifera]
Length=493

 Score = 84.3 bits (207),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 56/115 (49%), Gaps = 2/115 (2%)
 Frame = +3

Query  795   SPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHG  974
             +P     +  +EC  CKK F+S+QALGGHR  HKK      +     + +   DE   H 
Sbjct  215   APAPAVPRGMFECKACKKVFSSHQALGGHRASHKKVKGCFAAKLDDLDEAPPDDEVITHD  274

Query  975   NGGKIRDCFGSKKAGATEKKVRP--KKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             N                   V P  KK K HEC  CHR+F SGQALGGHKR H+I
Sbjct  275   NNSNSEMAMAIVPFDNPPLAVMPLKKKSKVHECSICHRVFASGQALGGHKRCHWI  329



>ref|XP_011033858.1| PREDICTED: zinc finger protein ZAT9-like [Populus euphratica]
Length=477

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 81/160 (51%), Gaps = 28/160 (18%)
 Frame = +3

Query  693   VASNSGKQKRTNDTSYDPEMETGSYK----KTKVVAASSPGTNANKKKYECLNCKKSFNS  860
              AS S +++R N  ++   M    YK    K KV+A         K  +EC  CKK FNS
Sbjct  180   CASASKEEERRNPLNF---MANVEYKPPLDKAKVIA---------KGMFECKACKKVFNS  227

Query  861   YQALGGHRPCHKKT--------NPDMESGYGT-GENSLDADETYNHGNGGKIRDCFGSKK  1013
             +QALGGHR  HKK         +  ME       E+ +  DE ++  +   ++   GS  
Sbjct  228   HQALGGHRASHKKVKGCYAARLDQGMEDSLADHDEDFITNDEFFSTKSTSTLQFDHGSTP  287

Query  1014  AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               A+  K   +K K HEC  CHR+F SGQALGGHKR H++
Sbjct  288   PLASTSK---RKSKVHECSICHRVFSSGQALGGHKRCHWL  324



>gb|KDP28802.1| hypothetical protein JCGZ_14573 [Jatropha curcas]
Length=481

 Score = 84.0 bits (206),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 75/152 (49%), Gaps = 11/152 (7%)
 Frame = +3

Query  693   VASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQAL  872
              AS S  ++R N  ++   M   +Y+  K+  A      ANK  +EC  CKK FNS+QAL
Sbjct  176   CASASKDEERRNPMNFIAPM---AYRAPKMDKAKG---VANKGMFECKACKKVFNSHQAL  229

Query  873   GGHRPCHKKTNPDMESGYGTG-ENSLDADETYNHGNGGKIRDC----FGSKKAGATEKKV  1037
             GGHR  HKK      +    G ++SL  D+   H      +      F      A     
Sbjct  230   GGHRASHKKVKGCFAARLDQGPDDSLVDDDVITHEEFFPAKSTSTFQFDHGPNHAPLPST  289

Query  1038  RPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  290   SKRKSKVHECSICHRVFSSGQALGGHKRCHWI  321



>ref|XP_002301264.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE80537.1| zinc finger family protein [Populus trichocarpa]
Length=332

 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 58/107 (54%), Gaps = 24/107 (22%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY+C  C K F SYQALGGHR  HKK                   + Y   N  K+    
Sbjct  196   KYKCETCNKVFKSYQALGGHRASHKKL------------------KVYTPSNEPKLER--  235

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
              ++ AGA+     P+K K HECP+C R+F SGQALGGHKRSH IG A
Sbjct  236   -TENAGASTS--LPEK-KTHECPYCFRVFSSGQALGGHKRSHLIGVA  278



>gb|EYU31947.1| hypothetical protein MIMGU_mgv1a021269mg [Erythranthe guttata]
Length=302

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 52/107 (49%), Gaps = 27/107 (25%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY C  C K F SYQALGGHR  HKK   +                T         R   
Sbjct  167   KYRCEECNKLFRSYQALGGHRASHKKIKLN----------------TPPPPPPSPPRKVS  210

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
             GS           P + K HECPFC R+F SGQALGGHKR+HFIGGA
Sbjct  211   GS-----------PPEKKVHECPFCDRVFSSGQALGGHKRTHFIGGA  246



>ref|XP_001780762.1| predicted protein [Physcomitrella patens]
 gb|EDQ54401.1| predicted protein [Physcomitrella patens]
Length=1107

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 67/133 (50%), Gaps = 22/133 (17%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKK-------TNPD----MESGYGTGENSLDA  953
              + + KYEC  CK+ F S+QALGGHR  HKK       TNPD    ++    T  ++ D 
Sbjct  899   TSTRPKYECATCKRQFKSHQALGGHRASHKKVKGCFARTNPDDGGALDHSMDTSMDADDD  958

Query  954   DETYNHGNGGKIRDCFGSKKAGATE--KKVRP---------KKGKGHECPFCHRMFKSGQ  1100
              E +N     K+          + E  K +R          +K K HEC  CHR+F SGQ
Sbjct  959   SEQHNAKFEEKLLQELPETSLTSLEEDKAIRADNEEMPTTARKNKSHECSICHRVFNSGQ  1018

Query  1101  ALGGHKRSHFIGG  1139
             ALGGHKR H+ GG
Sbjct  1019  ALGGHKRCHWGGG  1031



>ref|XP_011017453.1| PREDICTED: zinc finger protein ZAT4-like [Populus euphratica]
Length=478

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 90/189 (48%), Gaps = 29/189 (15%)
 Frame = +3

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEME-TGSYKK  773
             LA C ++      V+P    +E E E       AS S +++R N T++   ME     +K
Sbjct  157   LANCLMMLSNGTTVDP----LETEPEE----SCASASKEEERRNPTNFMAPMEHKPPLEK  208

Query  774   TKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKK------TNPDMESGYGTG  935
              K +A         K  +EC  CKK FNS+QALGGHR  HKK      +  D   GY   
Sbjct  209   AKGIA---------KGMFECKACKKVFNSHQALGGHRASHKKVKGCYASRLDKGMGYSVA  259

Query  936   ENSLDA---DETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQAL  1106
             ++  DA   +E +       ++   GS          R  K K HEC  CHR+F SGQAL
Sbjct  260   DHDEDAVTHEEFFPAKLTSTLQFDHGSTPPLMASASKR--KSKVHECSICHRVFSSGQAL  317

Query  1107  GGHKRSHFI  1133
             GGHKR H++
Sbjct  318   GGHKRCHWL  326



>ref|XP_010934138.1| PREDICTED: zinc finger protein ZAT4-like [Elaeis guineensis]
Length=503

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 59/113 (52%), Gaps = 17/113 (15%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA----DETYNHGNGGKIR  992
             +EC  CKK F S+QALGGHR  HKK    ++  +    + LD     DE  NH N     
Sbjct  235   FECKACKKVFTSHQALGGHRASHKK----VKGCFAAKLDDLDEVPPDDEVINHDNNNTSS  290

Query  993   DC------FGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             +       F +     T  K   KK K HEC  CHR+F SGQALGGHKR H+I
Sbjct  291   EMAMAIVPFDNPPLAVTPLK---KKSKVHECSICHRVFTSGQALGGHKRCHWI  340



>ref|XP_007219458.1| hypothetical protein PRUPE_ppa021208mg [Prunus persica]
 gb|EMJ20657.1| hypothetical protein PRUPE_ppa021208mg [Prunus persica]
Length=391

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 54/115 (47%), Gaps = 23/115 (20%)
 Frame = +3

Query  798   PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN  977
             P T   + KY+C  C K F SYQALGGHR  HKK          +  N +   E     N
Sbjct  250   PRTRTTRGKYKCETCNKVFKSYQALGGHRASHKKIK-------ASNPNPIYEHELEQENN  302

Query  978   GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
              G          +   E+K        HECP C R+F SGQALGGHKRSH  G A
Sbjct  303   AGA---------SSVAERKT-------HECPVCFRVFSSGQALGGHKRSHVTGSA  341



>ref|XP_007134733.1| hypothetical protein PHAVU_010G071300g [Phaseolus vulgaris]
 gb|ESW06727.1| hypothetical protein PHAVU_010G071300g [Phaseolus vulgaris]
Length=329

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 55/111 (50%), Gaps = 27/111 (24%)
 Frame = +3

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGG  983
             +N  + +Y+C  C K F SYQALGGHR  HKK   + E+ +   E  L+           
Sbjct  181   SNKVRGRYKCETCDKVFRSYQALGGHRASHKKMKLNSETEFQKTEPELE-----------  229

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                           EKKV       HECP C R+F SGQALGGHKR+H IG
Sbjct  230   ---------HVAVAEKKV-------HECPVCFRVFGSGQALGGHKRTHVIG  264



>emb|CDY41155.1| BnaA09g38600D [Brassica napus]
Length=248

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 60/131 (46%), Gaps = 36/131 (27%)
 Frame = +3

Query  765   YKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKK---TNPDMESGYGTG  935
             +KK KV    S  T   K +Y C  C K F SYQALGGHR  HKK   TN   ++ YG  
Sbjct  118   WKKNKVGYKISRATTTTKGRYTCETCGKVFKSYQALGGHRASHKKNRVTNKTEQTEYGN-  176

Query  936   ENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGH  1115
                                         A EK++       HECP C R+F SGQALGGH
Sbjct  177   -------------------------VVVAPEKRI-------HECPICLRVFASGQALGGH  204

Query  1116  KRSHFIGGAQV  1148
             KRSH IG   V
Sbjct  205   KRSHGIGNFSV  215



>ref|XP_010919568.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein ZAT4 [Elaeis 
guineensis]
Length=373

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 64/129 (50%), Gaps = 34/129 (26%)
 Frame = +3

Query  777   KVVAASS---PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTN----PDMESGYGTG  935
             ++VA+ S   P     + KY+C  CKK F SYQALGGHR  HKK+     P +++     
Sbjct  207   QIVASRSRPLPPAARGRSKYQCGTCKKVFRSYQALGGHRASHKKSRGGCIPAVQTQIHDA  266

Query  936   ENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGH  1115
             E+S         GN  +                   +  K HECPFC R+F SGQALGGH
Sbjct  267   ESS--------KGNADR-------------------EANKVHECPFCFRVFGSGQALGGH  299

Query  1116  KRSHFIGGA  1142
             KRSH +  A
Sbjct  300   KRSHLVSSA  308



>ref|XP_002540465.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF21918.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 59/110 (54%), Gaps = 10/110 (9%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE---TYNHGNGGKIRD  995
             +EC  CKK FNS+QALGGHR  HKK      +    G +   ADE   T+      K   
Sbjct  2     FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDQGLDDSLADEDVITHEEFFPTKSSS  61

Query  996   CF----GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              F    GS    A+  K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  62    TFQFDHGSNPPLASTSK---RKSKVHECSICHRVFSSGQALGGHKRCHWI  108



>ref|XP_009594478.1| PREDICTED: zinc finger protein ZAT4-like [Nicotiana tomentosiformis]
Length=467

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 17/146 (12%)
 Frame = +3

Query  696   ASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALG  875
             AS   ++ R   T   P + T      K   ASS G       +EC  CKK FNS+QALG
Sbjct  194   ASKDEERARNPMTYLTPLVTTRVPLDNKAKGASSKGL------FECKACKKVFNSHQALG  247

Query  876   GHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGK  1055
             GHR  HKK    ++  Y   ++ LD D   +  +     D F  + + +       +K K
Sbjct  248   GHRASHKK----VKGCYAAKQDQLD-DSLIDDQDMNITHDEFTLQASKSM------RKSK  296

Query  1056  GHECPFCHRMFKSGQALGGHKRSHFI  1133
              HEC  CHR+F +GQALGGHKR H+I
Sbjct  297   IHECSICHRVFSTGQALGGHKRCHWI  322



>ref|XP_010258927.1| PREDICTED: zinc finger protein ZAT1-like [Nelumbo nucifera]
Length=357

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 57/113 (50%), Gaps = 20/113 (18%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY+C  CKK F SYQALGGHR  HKK         G   +S  A  T+   +        
Sbjct  227   KYQCGTCKKVFRSYQALGGHRASHKKIR-------GCTPSSSPAARTHEAESE------L  273

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGS  1160
             G+      ++++       HECP C R+F SGQALGGHKRSH  G A   N +
Sbjct  274   GNAGTSVVDRRI-------HECPVCFRVFASGQALGGHKRSHLSGSATAANST  319



>ref|XP_004308477.1| PREDICTED: uncharacterized protein LOC101307639 [Fragaria vesca 
subsp. vesca]
Length=507

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 59/113 (52%), Gaps = 16/113 (14%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFG  1004
             +EC  CKK FNS+QALGGHR  HKK      +     E+S+  D+   H       + F 
Sbjct  226   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDQHEDSMADDDVITH------EEFFP  279

Query  1005  SKKAGATE----------KKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             SK + + +               +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  280   SKPSSSLQFDHGSNAPSSAYTSKRKSKVHECSICHRIFSSGQALGGHKRCHWI  332



>ref|XP_010264307.1| PREDICTED: zinc finger protein ZAT4-like [Nelumbo nucifera]
Length=493

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 23/190 (12%)
 Frame = +3

Query  597   LAKCKV-LNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKK  773
             LA C V L+  +  V+P     E+          AS S +++R N     P     +++ 
Sbjct  159   LANCLVMLSTARVDVDPLVADAEES--------CASASKEEERRNPVGVVPLQLPIAHRL  210

Query  774   TKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA  953
             +   A   P        +EC  CKK FNS+QALGGHR  HKK      +     ++SL  
Sbjct  211   SSEKAKGVPAGGM----FECKACKKVFNSHQALGGHRASHKKVKGCFAAKMDDLDDSLAE  266

Query  954   DETYNH-GNGGKIRDCFGSKKAGATEKKVRP---------KKGKGHECPFCHRMFKSGQA  1103
             ++   H G G   +    +        ++ P         +K K HEC  CHR+F SGQA
Sbjct  267   EDVITHDGYGNPTKSSINATLPFEQVSQLPPLAAIPSTSKRKSKLHECSICHRVFSSGQA  326

Query  1104  LGGHKRSHFI  1133
             LGGHKR H++
Sbjct  327   LGGHKRCHWV  336



>ref|XP_008448369.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis melo]
Length=505

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 95/190 (50%), Gaps = 31/190 (16%)
 Frame = +3

Query  660   EKEYENYDDFGVASNSGKQKRTNDTSYDP----------------EMETGSYKKTKV--V  785
             E++++  D FG +SN+  Q   N   +D                 E+ + S++++    +
Sbjct  265   EEKFQQDDIFGSSSNN--QTDINQLQFDSSKFNSDQRKFHELSNGELRSNSFRRSTPNEL  322

Query  786   AASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD---  956
              + S  +   + K++C +C K F+SYQALGGHR  HKK    + S     ENS++ +   
Sbjct  323   NSESYKSKGKRSKFQCNSCNKIFHSYQALGGHRASHKKAKGCLASKTENSENSIETEISN  382

Query  957   ----ETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRS  1124
                 E+ +     ++ +   S+     EKK R    K H+C  C ++F SGQALGGHKRS
Sbjct  383   DPTFESKSTATALEVENQQESEIHMGYEKKNR----KHHQCSICLKIFSSGQALGGHKRS  438

Query  1125  HFIGGAQVIN  1154
             H I G++  N
Sbjct  439   HLISGSESRN  448



>ref|XP_007157656.1| hypothetical protein PHAVU_002G087500g [Phaseolus vulgaris]
 gb|ESW29650.1| hypothetical protein PHAVU_002G087500g [Phaseolus vulgaris]
Length=541

 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 72/142 (51%), Gaps = 18/142 (13%)
 Frame = +3

Query  762   SYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGEN  941
             S+ K K   A S  ++  + K+EC  CKK F+SYQALGGHR  HKK      S   + EN
Sbjct  329   SWVKNKSPEAESSKSSNKRGKFECTTCKKIFHSYQALGGHRASHKKIKGCFASRNESSEN  388

Query  942   S--LDADETYNHGNGGKI----------------RDCFGSKKAGATEKKVRPKKGKGHEC  1067
             S   +AD + +     K+                     +      E++   KKGKGHEC
Sbjct  389   STEFEADLSPDPTTESKLLKNEYVEEHEMVTVTATGTTATGFDNEEERERESKKGKGHEC  448

Query  1068  PFCHRMFKSGQALGGHKRSHFI  1133
             P C ++F SGQALGGHKRSH +
Sbjct  449   PICLKVFPSGQALGGHKRSHHL  470



>ref|XP_004133770.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus]
 ref|XP_004173205.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus]
Length=317

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 56/110 (51%), Gaps = 21/110 (19%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N N+  Y+C  C K F SYQALGGHR  HKK    +               TYN+   G 
Sbjct  180   NRNRGNYKCETCNKVFRSYQALGGHRASHKKIKVSL---------------TYNNPQLGS  224

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
               +   +  +G+  ++      K HECP C R+F SGQALGGHKRSH  G
Sbjct  225   HHENAATPSSGSMAER------KIHECPVCFRVFSSGQALGGHKRSHVTG  268



>ref|XP_010089243.1| Zinc finger protein ZAT3 [Morus notabilis]
 gb|EXB37568.1| Zinc finger protein ZAT3 [Morus notabilis]
Length=549

 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 85/196 (43%), Gaps = 17/196 (9%)
 Frame = +3

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYD-------PEME  755
             LA C ++      V+P      +  E+         +  QKR N  ++        PE  
Sbjct  159   LANCLMMLSNAAAVDPMATAAAEPEESCASASRDEEAQAQKRINTLNFIAPISFRVPENN  218

Query  756   TGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTN----PDMESG  923
               +       A      + +K  +EC  CKK FNS+QALGGHR  HKK        ++  
Sbjct  219   NYNNMNMNNKAKGVASNSNSKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHN  278

Query  924   YGTGENSLDADE-TYNHGNGGKIRDCFGSKKAG-----ATEKKVRPKKGKGHECPFCHRM  1085
              G  E   D D  T+      K+      +++G     A+      +K K HEC  CHR+
Sbjct  279   QGLDEILADDDVITHEEFFSTKLATMDHHRQSGSNTTLASLAATSKRKSKVHECSICHRI  338

Query  1086  FKSGQALGGHKRSHFI  1133
             F SGQALGGHKR H+I
Sbjct  339   FSSGQALGGHKRCHWI  354



>ref|XP_006837069.1| hypothetical protein AMTR_s00110p00085760 [Amborella trichopoda]
 gb|ERM99922.1| hypothetical protein AMTR_s00110p00085760 [Amborella trichopoda]
Length=651

 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 56/114 (49%), Gaps = 5/114 (4%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKT-----NPDMESGYGTGENSLDADETYNHGNG  980
             K KYEC  C KSF+SYQALGGHR  HKK        D        E S D   +      
Sbjct  452   KGKYECTTCNKSFHSYQALGGHRASHKKVKGCFARIDGSDNSTETEVSPDQRPSMPDEKL  511

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                R     +  G+ E    P K K HECP C R+F SGQALGGHKRSH    A
Sbjct  512   KPYRLVNLMEGEGSGETNCGPSKSKIHECPICFRVFTSGQALGGHKRSHMASEA  565



>ref|XP_003520110.2| PREDICTED: uncharacterized protein DDB_G0286591-like [Glycine 
max]
Length=501

 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 176/375 (47%), Gaps = 90/375 (24%)
 Frame = +3

Query  117   SQSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NW  290
             ++++  P+R K++  K+ S S  NNN+   SS     EQEQEE+A+CLMMLSKDS     
Sbjct  156   TETSSAPRRSKRMKSKTLSSSNNNNNNQPQSSSVSEVEQEQEELARCLMMLSKDSSYKGR  215

Query  291   YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKM  470
             +  + E SDNNSVV+ TKS S++ K +                     N   +N   +K+
Sbjct  216   FALLTESSDNNSVVI-TKSPSLETKVTTMM------------------NVYGKNSMERKL  256

Query  471   G-DNRKVMKSSIVHTEMAESQSSDSGYF------------LGENKVESDVS--VNGF---  596
               +  K +K   V     +S +SDSGYF               N+V+S     +NGF   
Sbjct  257   ELEQHKDLKFKSVEVGY-DSDNSDSGYFRYGPKSDESNDEFFRNEVKSSKVGYLNGFDQE  315

Query  597   ---LAKCKVLNRVKGYVEPRRGGVEKEYENYD--DFGVASNSGKQKRTNDTSYDPEMETG  761
                +   KVL+R +      +  V +++E+YD  D  VA+     K+   ++YD +    
Sbjct  316   YDVVESRKVLSRGRSRSSEFKKFVLEDWESYDREDGDVAARKFGSKKFKKSNYDDD----  371

Query  762   SYKKTKVVAASSPGTN---ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGT  932
                        S G N    + +KYECL  ++          +  C        +S Y +
Sbjct  372   -----------SLGQNLGGVSTRKYECLTSER----------YNGCSD------DSAYES  404

Query  933   GENSLDADE----TYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQ  1100
              ENS D D       +H N   +            +KK++ KK K HECP C+++F+SGQ
Sbjct  405   DENSTDTDSYPAPKAHHSNRNNL-------SGNKGKKKLKSKKSKAHECPICNKIFRSGQ  457

Query  1101  ALGGHKRSHFIGGAQ  1145
             ALGGHKRSHFIGG++
Sbjct  458   ALGGHKRSHFIGGSE  472



>ref|XP_009405969.1| PREDICTED: zinc finger protein ZAT4-like [Musa acuminata subsp. 
malaccensis]
Length=320

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 59/125 (47%), Gaps = 32/125 (26%)
 Frame = +3

Query  768   KKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTN---PDMESGYGTGE  938
             + +   A S P     + +++C  CKK F SYQALGGHR  HK+ N   P +E    +  
Sbjct  164   RDSWAAARSRPPLRRGRSRHQCDACKKVFRSYQALGGHRASHKRINGCVPAVERRVASSA  223

Query  939   NSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHK  1118
             + +D +                                + +ECPFC R+F SGQALGGHK
Sbjct  224   DGVDTN-----------------------------ADARVYECPFCFRVFSSGQALGGHK  254

Query  1119  RSHFI  1133
             RSHF+
Sbjct  255   RSHFM  259



>ref|XP_011017454.1| PREDICTED: zinc finger protein ZAT4-like [Populus euphratica]
Length=372

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 57/107 (53%), Gaps = 24/107 (22%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY+C  C K F SYQALGGHR  HKK                   + Y      K+    
Sbjct  236   KYKCETCNKVFKSYQALGGHRASHKKL------------------KVYTPSKAPKLEP--  275

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
              ++ AGA+     P+K K HECP+C R+F SGQALGGHKRSH IG A
Sbjct  276   -TENAGASTS--LPEK-KTHECPYCFRVFSSGQALGGHKRSHLIGVA  318



>ref|XP_007134731.1| hypothetical protein PHAVU_010G071100g [Phaseolus vulgaris]
 gb|ESW06725.1| hypothetical protein PHAVU_010G071100g [Phaseolus vulgaris]
Length=486

 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTN-------PDMESGYGTGENSLDADETYNHGNGG  983
             +EC  CKK FNS+QALGGHR  HKK          +++    T ++ +  +E +   +  
Sbjct  231   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDNLDDNLITDDDVITHEELFATKSNS  290

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              ++   GS    A+  K   +K K HEC  CHR F SGQALGGHKR H+I
Sbjct  291   TLQFDHGSNPTLASSSK---RKSKVHECSICHRSFSSGQALGGHKRCHWI  337



>ref|XP_008375818.1| PREDICTED: zinc finger protein ZAT9-like [Malus domestica]
Length=386

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 58/115 (50%), Gaps = 22/115 (19%)
 Frame = +3

Query  798   PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNP-DMESGYGTGENSLDADETYNHG  974
             P     ++KY+C  C K F SYQALGGHR  HKK    ++   Y   E  L+ +     G
Sbjct  235   PRIRTARRKYKCETCNKVFKSYQALGGHRASHKKIKASNLNPIY---EPELEQENLNAAG  291

Query  975   NGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGG  1139
             N   +            E+K+       HECP C R+F SGQALGGHKRSH + G
Sbjct  292   NSSSV-----------AERKI-------HECPVCFRVFSSGQALGGHKRSHVMTG  328



>gb|KHN30002.1| Zinc finger protein ZAT1 [Glycine soja]
Length=494

 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 175/375 (47%), Gaps = 90/375 (24%)
 Frame = +3

Query  117   SQSTHHPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSG--NW  290
             ++++  P+R K++  K+ S S  NNN+   SS     EQEQEE+A+CLMMLSKDS     
Sbjct  149   TETSSAPRRSKRMKSKTLSSSNNNNNNQPQSSSVSEVEQEQEELARCLMMLSKDSSYKGR  208

Query  291   YGSVVEFSDNNSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKM  470
             +  + E SDNNSVV+ TKS S++ K +                     N   +N   +K+
Sbjct  209   FALLTESSDNNSVVI-TKSPSLETKVTTMM------------------NVYGKNSMERKL  249

Query  471   G-DNRKVMKSSIVHTEMAESQSSDSGYF------------LGENKVESDVS--VNGF---  596
               +  K +K   V     +S +SDSGYF               N+V+S     +NGF   
Sbjct  250   ELEQHKDLKFKSVEVGY-DSDNSDSGYFRYGPKSDESNDEFFRNEVKSSKVGYLNGFDQE  308

Query  597   ---LAKCKVLNRVKGYVEPRRGGVEKEYENYD--DFGVASNSGKQKRTNDTSYDPEMETG  761
                +   KVL+R +      +  V +++E+YD  D  VA+     K+   ++YD +    
Sbjct  309   YDVVESRKVLSRGRSRSSEFKKFVLEDWESYDREDGDVAARKFGSKKFKKSNYDDD----  364

Query  762   SYKKTKVVAASSPGTN---ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGT  932
                        S G N    + +KYECL  ++    Y                 +S Y +
Sbjct  365   -----------SLGQNLGGVSTRKYECLTSER----YNGCSD------------DSAYES  397

Query  933   GENSLDADE----TYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQ  1100
              ENS D D       +H N   +            +KK++ KK K HECP C+++F+SGQ
Sbjct  398   DENSTDTDSYPAPKAHHSNRNNL-------SGNKGKKKLKSKKSKAHECPICNKIFRSGQ  450

Query  1101  ALGGHKRSHFIGGAQ  1145
             ALGGHKRSHFIGG++
Sbjct  451   ALGGHKRSHFIGGSE  465



>ref|XP_002511650.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50319.1| conserved hypothetical protein [Ricinus communis]
Length=480

 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 75/154 (49%), Gaps = 17/154 (11%)
 Frame = +3

Query  693   VASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQAL  872
              AS S  ++R N  ++   M   +Y+   V  A        K  +EC  CKK FNS+QAL
Sbjct  179   CASASKDEERRNPMNF---MAPIAYRAAPVDKAK----GVAKGMFECKACKKVFNSHQAL  231

Query  873   GGHRPCHKKTNPDMESGYGTGENSLDADE---TYNHGNGGKIRDCF----GSKKAGATEK  1031
             GGHR  HKK      +    G +   ADE   T+      K    F    GS    A+  
Sbjct  232   GGHRASHKKVKGCFAARLDQGLDDSLADEDVITHEEFFPTKSSSTFQFDHGSNPPLASTS  291

Query  1032  KVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  292   K---RKSKVHECSICHRVFSSGQALGGHKRCHWI  322



>gb|KEH16508.1| C2H2-type zinc finger protein, putative [Medicago truncatula]
Length=361

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 55/111 (50%), Gaps = 32/111 (29%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI  989
               K +Y+C  C K F SYQALGGHR  HKK  P++     T E S               
Sbjct  235   VRKGRYKCETCNKVFKSYQALGGHRASHKKIKPNI-----TVEES---------------  274

Query  990   RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                  S +    EKKV       HECP C R+F SGQALGGHKR+H I G+
Sbjct  275   -----SPEFEIVEKKV-------HECPVCFRVFNSGQALGGHKRTHVIHGS  313



>ref|XP_008787063.1| PREDICTED: zinc finger protein ZAT9-like [Phoenix dactylifera]
Length=376

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 57/118 (48%), Gaps = 31/118 (26%)
 Frame = +3

Query  801   GTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTN----PDMESGYGTGENSLDADETYN  968
             G    + KY+C  CKK F SYQALGGHR  HKK+     P +++     E+S        
Sbjct  222   GAARGRSKYQCGTCKKVFRSYQALGGHRASHKKSRGGCIPAVQAQIHDAESS--------  273

Query  969   HGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
              GN  +                      K HECPFC R+F SGQALGGHKRSH +  A
Sbjct  274   EGNADR-------------------GPSKVHECPFCFRVFSSGQALGGHKRSHLVSSA  312



>ref|XP_008437783.1| PREDICTED: zinc finger protein ZAT9 [Cucumis melo]
Length=373

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 56/110 (51%), Gaps = 21/110 (19%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N N+  Y+C  C K F SYQALGGHR  HKK    +               TYN+   G 
Sbjct  236   NRNRGNYKCETCNKVFRSYQALGGHRASHKKIKVSL---------------TYNNPQLGS  280

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
               +   +  +G+  ++      K HECP C R+F SGQALGGHKRSH  G
Sbjct  281   HHENAATPSSGSIAER------KIHECPVCFRVFSSGQALGGHKRSHVTG  324



>gb|KGN56354.1| hypothetical protein Csa_3G117400 [Cucumis sativus]
Length=369

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 56/110 (51%), Gaps = 21/110 (19%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N N+  Y+C  C K F SYQALGGHR  HKK    +               TYN+   G 
Sbjct  232   NRNRGNYKCETCNKVFRSYQALGGHRASHKKIKVSL---------------TYNNPQLGS  276

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
               +   +  +G+  ++      K HECP C R+F SGQALGGHKRSH  G
Sbjct  277   HHENAATPSSGSMAER------KIHECPVCFRVFSSGQALGGHKRSHVTG  320



>ref|XP_011090189.1| PREDICTED: uncharacterized protein LOC105170939 [Sesamum indicum]
Length=515

 Score = 81.3 bits (199),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 92/192 (48%), Gaps = 31/192 (16%)
 Frame = +3

Query  594   FLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKK  773
              LA+C ++      V+P    VE E         AS S +++R + T++  +    +   
Sbjct  158   LLARC-LVQLANTRVDPPVA-VEPEE------SCASASREEERRHPTTFLGQTTNRAAFD  209

Query  774   TKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA  953
              K    SSP     +  +EC  CKK FNS+QALGGHR  HKK    ++  Y   ++ +D 
Sbjct  210   QKAKGVSSP-----RGLFECKACKKVFNSHQALGGHRASHKK----VKGCYAAKQDQVD-  259

Query  954   DETYNHGNGGKI----RDCFGSKKAGATEKKVRP--------KKGKGHECPFCHRMFKSG  1097
              E  N      +     +   SK A + + +  P        +K K HEC  CHR+F SG
Sbjct  260   -ENSNLAAEDDVITNNEEFLPSKSASSLQFEQGPAALVGAARRKSKVHECSICHRVFTSG  318

Query  1098  QALGGHKRSHFI  1133
             QALGGHKR H+I
Sbjct  319   QALGGHKRCHWI  330



>ref|XP_011090067.1| PREDICTED: zinc finger protein ZAT4-like [Sesamum indicum]
Length=473

 Score = 81.3 bits (199),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHG-NGGKIR  992
             K ++ C  CKK+F SYQALGGHR  HKK N          E S++ + ++N   N  K+ 
Sbjct  331   KSRFSCSICKKAFASYQALGGHRASHKKFNG---CCAPRSETSMETESSHNQSDNHSKL-  386

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                 S+        +  KK K HECP C ++F SGQALGGHKRSH  G
Sbjct  387   --IKSESPIGNFADIGSKKNKEHECPICFKVFPSGQALGGHKRSHLTG  432


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +3

Query  204  SSSVSEIDEQEQEEVAKCLMMLSKDSGNW---YGSVVEFSDNNSVVLETK  344
            S+SVSEID+QEQEEVA  L++LS D G+W     SV+E S+N++ VLE +
Sbjct  186  SASVSEIDQQEQEEVALSLIILSMDKGDWSRVTNSVLESSNNSAKVLEAE  235



>ref|XP_006445329.1| hypothetical protein CICLE_v10024047mg [Citrus clementina]
 ref|XP_006490849.1| PREDICTED: zinc finger protein ZAT4-like [Citrus sinensis]
 gb|ESR58569.1| hypothetical protein CICLE_v10024047mg [Citrus clementina]
 gb|KDO85695.1| hypothetical protein CISIN_1g040791mg [Citrus sinensis]
Length=465

 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 63/117 (54%), Gaps = 10/117 (9%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYN-------  968
             ANK  +EC  CKK FNS+QALGGHR  HKK      +     ++SL ADE ++       
Sbjct  203   ANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSL-ADEDHDVITHEEF  261

Query  969   --HGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 +   ++   G+    A       +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  262   FPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQALGGHKRCHWI  318



>ref|XP_008796144.1| PREDICTED: zinc finger protein ZAT4-like [Phoenix dactylifera]
Length=368

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 56/116 (48%), Gaps = 23/116 (20%)
 Frame = +3

Query  795   SPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHG  974
             SP +   K KY+C  CKK F SYQALGGHR  HKK+      G      +   D   + G
Sbjct  215   SPASARVKSKYQCGTCKKLFRSYQALGGHRASHKKSR----GGCIPAVQARIHDVESSEG  270

Query  975   NGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
             N  +                   + GK HEC FC R+F SGQALGGHKRSH    A
Sbjct  271   NADR-------------------EAGKVHECSFCFRVFGSGQALGGHKRSHLASSA  307



>ref|XP_009804983.1| PREDICTED: zinc finger protein ZAT9-like [Nicotiana sylvestris]
Length=332

 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 54/110 (49%), Gaps = 32/110 (29%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N  + KY C  C K+F SYQALGGHR  HKK                   +  N+ N   
Sbjct  189   NRGRGKYRCETCNKNFRSYQALGGHRASHKKI------------------KVSNYNNEV-  229

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                    +  G  E+K+       HECP C+R+F SGQALGGHKRSH IG
Sbjct  230   ------VENVGVIEEKI-------HECPICYRVFSSGQALGGHKRSHVIG  266



>ref|XP_006345608.1| PREDICTED: zinc finger protein ZAT4-like [Solanum tuberosum]
Length=479

 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 61/111 (55%), Gaps = 16/111 (14%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI  989
             +NK  +EC  CKK FNS+QALGGHR  HKK    ++  Y   ++ LD     ++      
Sbjct  221   SNKGLFECKACKKVFNSHQALGGHRASHKK----VKGCYAAKQDQLDDSLIDDNDMNITQ  276

Query  990   RDCF---GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              D F   GSK           +K K HEC  CHR+F +GQALGGHKR H+I
Sbjct  277   DDQFTLQGSKSM---------RKSKIHECSICHRVFSTGQALGGHKRCHWI  318



>ref|XP_002301263.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE80536.1| zinc finger family protein [Populus trichocarpa]
Length=478

 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 87/194 (45%), Gaps = 39/194 (20%)
 Frame = +3

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEME-TGSYKK  773
             LA C ++      V+P    +E E E       AS S +++R N T++   ME     +K
Sbjct  157   LANCLMMLSNATTVDP----LETEPEE----SCASASKEEERRNPTNFMAPMEHKPPLEK  208

Query  774   TKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA  953
              K  A         K  +EC  CKK FNS+QALGGHR  HKK         G   + LD 
Sbjct  209   AKGTA---------KGMFECKACKKVFNSHQALGGHRASHKKVK-------GCYASRLDQ  252

Query  954   DETY---NHGNGGKIRDCFGSKKAGATEK-----------KVRPKKGKGHECPFCHRMFK  1091
                Y   +H       + F   K  +T +               +K K HEC  CHR+F 
Sbjct  253   SMDYSLADHDEDVVTHEEFFPAKLTSTLQFDHGSTPPLMASTSKRKSKVHECSICHRVFS  312

Query  1092  SGQALGGHKRSHFI  1133
             SGQALGGHKR H++
Sbjct  313   SGQALGGHKRCHWL  326



>ref|XP_009385228.1| PREDICTED: zinc finger protein ZAT1-like [Musa acuminata subsp. 
malaccensis]
Length=490

 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 63/137 (46%), Gaps = 9/137 (7%)
 Frame = +3

Query  750   METGSYKKTKVVAASSPGT--NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESG  923
             M   +  +T    A +P T  +  +  +EC  CKK F S+QALGGHR  HKK      + 
Sbjct  201   MTIAATAETPKAPALAPPTLPSVPRGMFECKACKKVFTSHQALGGHRASHKKVKGCFAAK  260

Query  924   YGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRP-------KKGKGHECPFCHR  1082
                 + +L  +E   H              A    +   P       KK K HEC  CHR
Sbjct  261   LEALDEALPDEEVITHEKNASEMAAASMSMAIVPYENSAPLAIAPLKKKPKLHECSICHR  320

Query  1083  MFKSGQALGGHKRSHFI  1133
             +F SGQALGGHKR H+I
Sbjct  321   VFTSGQALGGHKRCHWI  337



>ref|XP_004240265.1| PREDICTED: zinc finger protein ZAT4-like [Solanum lycopersicum]
Length=481

 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 61/111 (55%), Gaps = 16/111 (14%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI  989
             +NK  +EC  CKK FNS+QALGGHR  HKK    ++  Y   ++ LD     ++      
Sbjct  223   SNKGLFECKACKKVFNSHQALGGHRASHKK----VKGCYAAKQDQLDDSLIDDNDMNITQ  278

Query  990   RDCF---GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              D F   GSK           +K K HEC  CHR+F +GQALGGHKR H+I
Sbjct  279   DDQFTLQGSKSM---------RKSKIHECSICHRVFSTGQALGGHKRCHWI  320



>ref|XP_010678415.1| PREDICTED: uncharacterized protein LOC104893969 [Beta vulgaris 
subsp. vulgaris]
Length=563

 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 103/236 (44%), Gaps = 60/236 (25%)
 Frame = +3

Query  516   MAESQSSDSGYFLGENKV-ESDVSVNGFLAKCKVLNRVKGYVEPRR-------------G  653
             + +++S+ SGY     K+ E +VS NGF++     + +K   E +R             G
Sbjct  248   IIKAESAVSGYVKDGAKIKEYEVSENGFVSN----DHIKQSFESKRKIAQSVTSRCVKKG  303

Query  654   GVEKEYEN-------YDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNA  812
                +EYE        YD   +  N    +  ND S      T  +K++K           
Sbjct  304   SKIEEYEVSENGISLYDQKNIDHNELDSEFYNDVS-----RTSCFKRSK-----------  347

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKT---------NPDMESGYGTGENSLDADETY  965
                 +EC  C K F+SYQALGGHR  HKK          +P +E     G    DA  + 
Sbjct  348   ----FECTTCNKVFHSYQALGGHRASHKKLLGGGKCSPPSPKLEPSNVAGN---DASISP  400

Query  966   NHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              H    ++    G    G++      K  + HECP C+R+F SGQALGGHKRSH +
Sbjct  401   THKQQEQLVSEMG---IGSSSSSSTKKVVQKHECPICYRVFPSGQALGGHKRSHLL  453



>ref|XP_004986893.1| PREDICTED: zinc finger protein ZAT4-like [Setaria italica]
Length=405

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 60/122 (49%), Gaps = 25/122 (20%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTN---------PD-----MESGYGTGENSLDA  953
             + +YEC  C ++F SYQALGGHR  HK+ N         PD     +E+       SLD 
Sbjct  257   RGRYECPGCGRAFQSYQALGGHRASHKRINSNCCIAKAAPDKPELSVETNASFSTASLDT  316

Query  954   DETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
             + T +  N   +              K +P K    ECP C ++F SGQALGGHKRSH I
Sbjct  317   EYTADITNNTAV-----------VALKAKPPKAIKFECPICFKVFGSGQALGGHKRSHSI  365

Query  1134  GG  1139
              G
Sbjct  366   AG  367



>emb|CBI16587.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 60/117 (51%), Gaps = 22/117 (19%)
 Frame = +3

Query  789   ASSPGTNANKKKY--ECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADET  962
              SSPG++   + +  EC  CKK FNS+QALGGHR  HKK      +     + SL  ++ 
Sbjct  134   VSSPGSDGEDESWMFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDESLADEDV  193

Query  963   YNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               H       D F              +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  194   ITH-------DEFS-------------RKSKVHECSICHRVFSSGQALGGHKRCHWI  230



>gb|AAY40249.1| Cys2/His2 zinc-finger transcription factor [Silene latifolia]
Length=309

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 56/106 (53%), Gaps = 26/106 (25%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             KKKY+C  C K F SYQALGGHR  HKKT                 D+ +   N    R+
Sbjct  172   KKKYKCDTCNKVFRSYQALGGHRASHKKT------------RVTAPDDDHREKN----RN  215

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                +K+    EKK+       H+CP C R+F SGQALGGHKRSH I
Sbjct  216   VVATKEG---EKKI-------HKCPICFRVFASGQALGGHKRSHVI  251



>ref|XP_004306958.1| PREDICTED: zinc finger protein ZAT9-like [Fragaria vesca subsp. 
vesca]
Length=404

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 57/126 (45%), Gaps = 25/126 (20%)
 Frame = +3

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSL----DADETYNH  971
             T +++ KY+C  C K F SYQALGGHR  HKK      S      N +    + D   NH
Sbjct  254   TKSSRGKYKCETCNKVFKSYQALGGHRASHKKIK--AASAANPNPNRIVYKPEPDPEINH  311

Query  972   GNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVI  1151
               G                        K HECP C R+F SGQALGGHKRSH  G A + 
Sbjct  312   NAGSS-------------------SFVKTHECPVCFRVFSSGQALGGHKRSHVTGSAAIN  352

Query  1152  NGSHQT  1169
                H T
Sbjct  353   YTHHHT  358



>ref|XP_003559736.2| PREDICTED: zinc finger protein ZAT5-like [Brachypodium distachyon]
Length=359

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 58/121 (48%), Gaps = 6/121 (5%)
 Frame = +3

Query  783   VAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADET  962
              A SS   N  + +YEC  C ++F SYQALGGHR  HK+ N    S   T +  LD  E 
Sbjct  207   AAISSSENNPKRGRYECPGCGRAFQSYQALGGHRASHKRIN----SNCCTTKVFLDQPEP  262

Query  963   YNHGN--GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                 N                     V+PK     ECP C ++F SGQALGGHKRSH I 
Sbjct  263   SVDTNVSSFSTPSSPPPSPQAMAPVVVKPKNNVKFECPICSKVFGSGQALGGHKRSHSIA  322

Query  1137  G  1139
             G
Sbjct  323   G  323



>ref|XP_010264306.1| PREDICTED: zinc finger protein ZAT1-like [Nelumbo nucifera]
Length=358

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 58/116 (50%), Gaps = 20/116 (17%)
 Frame = +3

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIR  992
              + +Y+C  CKK F SYQALGGHR  HKK         G   +S  A  T+      ++ 
Sbjct  225   TRGRYQCGTCKKVFRSYQALGGHRASHKKIK-------GCTPSSSPASRTH------ELE  271

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGS  1160
                G+      ++++       HECP C R+F SGQALGGHKRSH    A   N +
Sbjct  272   SELGNAGTSVVDRRI-------HECPVCFRVFGSGQALGGHKRSHLSASATAANST  320



>ref|XP_004504528.1| PREDICTED: zinc finger protein ZAT4-like [Cicer arietinum]
Length=496

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 55/111 (50%), Gaps = 8/111 (7%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTG-ENSLDADETYNH-------GNG  980
             +EC  CKK FNS+QALGGHR  HKK      +      E+SL  D+   H        N 
Sbjct  230   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDNNLEDSLVEDDVITHEEFFPSKSNS  289

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 D  GS            +K K HEC  CHR F SGQALGGHKR H+I
Sbjct  290   TLQFDQHGSSNNPTLMASSSKRKSKVHECSICHRSFSSGQALGGHKRCHWI  340



>ref|XP_008344330.1| PREDICTED: zinc finger protein ZAT9-like [Malus domestica]
Length=384

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 60/115 (52%), Gaps = 20/115 (17%)
 Frame = +3

Query  798   PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN  977
             P T   + KY+C  C K   SYQALGGHR  HKK              +L+A+  Y    
Sbjct  236   PRTRTARGKYKCETCNKVLKSYQALGGHRASHKKIM------------ALNANPIYKPEL  283

Query  978   GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
               +  +  G+  + A E+K+       HECP C R+F SGQALGGHKRSH + G+
Sbjct  284   XQENYNVAGNSSSVA-ERKI-------HECPVCFRVFSSGQALGGHKRSHVMSGS  330



>ref|XP_007052173.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
 gb|EOX96330.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
Length=571

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 57/116 (49%), Gaps = 27/116 (23%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY C  C K F SYQALGGHR  HKK          T E  L+A+      N G      
Sbjct  438   KYRCETCNKVFKSYQALGGHRASHKKIK---AYSPATHETELEAE------NVGA-----  483

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGSHQT  1169
                    TEKK+       HECP C R+F SGQALGGHKRSH  G  QV+  +  T
Sbjct  484   ----CSVTEKKI-------HECPVCFRVFSSGQALGGHKRSHVTG--QVVATTEST  526



>ref|XP_009116736.1| PREDICTED: zinc finger protein ZAT9-like [Brassica rapa]
Length=321

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 54/119 (45%), Gaps = 36/119 (30%)
 Frame = +3

Query  801   GTNANKKKYECLNCKKSFNSYQALGGHRPCHKK---TNPDMESGYGTGENSLDADETYNH  971
              T   K +Y C  C K F SYQALGGHR  HKK   TN   ++ YG              
Sbjct  203   ATTTTKGRYTCETCGKVFKSYQALGGHRASHKKNRVTNKTEQTEYGN-------------  249

Query  972   GNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                             A EK++       HECP C R+F SGQALGGHKRSH IG   V
Sbjct  250   -------------VVVAPEKRI-------HECPICLRVFASGQALGGHKRSHGIGNFSV  288



>ref|XP_006578555.1| PREDICTED: probable cyclin-dependent serine/threonine-protein 
kinase DDB_G0292550-like [Glycine max]
Length=557

 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 69/132 (52%), Gaps = 22/132 (17%)
 Frame = +3

Query  810   ANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS--LDADETYNHGNG  980
             +NK+ K+EC  CKK F+SYQALGGHR  HK+      S   + ENS  L+A+ + +H   
Sbjct  358   SNKRGKFECTTCKKIFHSYQALGGHRASHKRIKGCFASRNESSENSTELEAELSPDHTTE  417

Query  981   GKI-------------RDCFGSKKAGATE-----KKVR-PKKGKGHECPFCHRMFKSGQA  1103
              K+                  +     T+       VR  KKGK HEC  C ++F SGQA
Sbjct  418   NKLLKNEYVEEHEMVTTVTTTTTTTAITDFDNEINTVRDSKKGKVHECSICLKIFPSGQA  477

Query  1104  LGGHKRSHFIGG  1139
             LGGHKRSH + G
Sbjct  478   LGGHKRSHHLAG  489



>gb|KDO85696.1| hypothetical protein CISIN_1g044606mg, partial [Citrus sinensis]
Length=413

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 56/112 (50%), Gaps = 24/112 (21%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N ++ KY+C  CKK F SYQALGGHR  HKK    ++      E  LD +          
Sbjct  271   NRSRGKYKCETCKKVFKSYQALGGHRASHKK----IKFYTPVQETELDQE----------  316

Query  987   IRDCFGSKKAGATEKKVRPKKG--KGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                      AGA+     P     K HECP C R+F SGQALGGHKR+H  G
Sbjct  317   --------NAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTG  360



>gb|KCW78319.1| hypothetical protein EUGRSUZ_D02498, partial [Eucalyptus grandis]
Length=537

 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 85/196 (43%), Gaps = 41/196 (21%)
 Frame = +3

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKT  776
             LA C ++    G V+P     E+          AS S  ++R    S+   +   S   T
Sbjct  210   LANC-LMMLSNGMVDPSSAEPEE--------SCASASKDEERRRPISFIAPLAFRSPPTT  260

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKT------NPDMESGYGTGE  938
                    P  N  +  +EC  CKK FNS+QALGGHR  HKK         D    +   E
Sbjct  261   DKAKGVIP--NKGQGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARVDHAYDWVPDE  318

Query  939   NSLDADE-----------TYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRM  1085
             +++  DE            ++HG    +          +T K+    K K HEC  CHR+
Sbjct  319   DAITQDEFFMTKSMASNSPFDHGLSSSL---------PSTSKR----KSKVHECSICHRV  365

Query  1086  FKSGQALGGHKRSHFI  1133
             F SGQALGGHKR H+I
Sbjct  366   FSSGQALGGHKRCHWI  381



>ref|XP_009624701.1| PREDICTED: zinc finger protein ZAT9-like [Nicotiana tomentosiformis]
Length=332

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 54/110 (49%), Gaps = 32/110 (29%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N  + KY C  C K+F SYQALGGHR  HKK                    +YN+     
Sbjct  189   NRGRGKYRCETCNKNFRSYQALGGHRASHKKIKVS----------------SYNNE----  228

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                    +  G  E+K+       HECP C+R+F SGQALGGHKRSH IG
Sbjct  229   -----VVENVGVIEEKI-------HECPVCYRVFSSGQALGGHKRSHAIG  266



>ref|XP_009416826.1| PREDICTED: zinc finger protein ZAT3-like [Musa acuminata subsp. 
malaccensis]
Length=424

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 59/112 (53%), Gaps = 13/112 (12%)
 Frame = +3

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLD-ADETYNHGNG  980
             T   +  ++C  C K F SYQALGGHR  HK+    M+  +G   + +D + ET    NG
Sbjct  279   TTKKRSWFDCKPCNKVFRSYQALGGHRARHKR----MKGCHGHRLHGVDNSMETDGSING  334

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                 + FG        +   PK  KGH CP C + F SGQALGGHKRSH + 
Sbjct  335   TATEETFG--------RHGSPKSTKGHRCPICSKFFSSGQALGGHKRSHLVA  378



>ref|XP_006445328.1| hypothetical protein CICLE_v10020499mg [Citrus clementina]
 ref|XP_006490850.1| PREDICTED: zinc finger protein ZAT9-like [Citrus sinensis]
 gb|ESR58568.1| hypothetical protein CICLE_v10020499mg [Citrus clementina]
Length=394

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 56/112 (50%), Gaps = 24/112 (21%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N ++ KY+C  CKK F SYQALGGHR  HKK    ++      E  LD +          
Sbjct  252   NRSRGKYKCETCKKVFKSYQALGGHRASHKK----IKFYTPVQETELDQE----------  297

Query  987   IRDCFGSKKAGATEKKVRPKKG--KGHECPFCHRMFKSGQALGGHKRSHFIG  1136
                      AGA+     P     K HECP C R+F SGQALGGHKR+H  G
Sbjct  298   --------NAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTG  341



>ref|XP_009412857.1| PREDICTED: zinc finger protein ZAT4-like [Musa acuminata subsp. 
malaccensis]
Length=484

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 59/120 (49%), Gaps = 31/120 (26%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA----DETYNHGNGGKIR  992
             +EC  CKK F+S+QALGGHR  HKK    ++  +    + LD     DE   H N     
Sbjct  227   FECKACKKVFSSHQALGGHRASHKK----VKGCFAVKHDGLDEAPPDDEVITHENVA---  279

Query  993   DCFGSKKAGATEKKVRP-------------KKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                    A +T   + P             K+ K HEC  CHR+F SGQALGGHKR H+I
Sbjct  280   -------AASTSTAIVPFDDPAPLAITPLRKRSKVHECSICHRVFTSGQALGGHKRCHWI  332



>gb|KHN24637.1| Zinc finger protein ZAT4 [Glycine soja]
Length=225

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 57/113 (50%), Gaps = 17/113 (15%)
 Frame = +3

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGG  983
             +N  + +Y+C  C+K F SYQALGGHR  HKK   +         N+ + DE        
Sbjct  57    SNKVRGRYKCETCEKVFRSYQALGGHRASHKKIKLNNCENKNKNNNNNNDDEAEQ-----  111

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                     +     EKK+       HECP C R+F SGQALGGHKR+H IG +
Sbjct  112   -----LEVQHVVVVEKKI-------HECPVCFRVFASGQALGGHKRTHVIGSS  152



>ref|XP_011033847.1| PREDICTED: zinc finger protein ZAT9-like isoform X2 [Populus 
euphratica]
Length=388

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 54/110 (49%), Gaps = 30/110 (27%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKT---NPDMESGYGTGENSLDADETYNHGNGGKIR  992
             KY+C  C K F SYQALGGHR  HKK     P  E      EN                 
Sbjct  248   KYKCETCNKVFKSYQALGGHRASHKKLKVYTPSKEPNLEPTEN-----------------  290

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                    AGA+     P+K K H CPFC R+F SGQALGGHKRSH IG A
Sbjct  291   -------AGASTS--LPEK-KIHGCPFCFRVFSSGQALGGHKRSHVIGVA  330



>ref|XP_006291511.1| hypothetical protein CARUB_v10017660mg [Capsella rubella]
 gb|EOA24409.1| hypothetical protein CARUB_v10017660mg [Capsella rubella]
Length=317

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 55/111 (50%), Gaps = 25/111 (23%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             K +Y+C  C K F SYQALGGHR  HKK     ++    GE          H N   +  
Sbjct  198   KGRYKCETCGKVFKSYQALGGHRASHKKNRVSNKTEQRGGET--------EHDNVVVV--  247

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
                     A EK++       HECP C R+F SGQALGGHKRSH IG   V
Sbjct  248   --------AAEKRI-------HECPICFRVFASGQALGGHKRSHGIGNLSV  283



>ref|XP_010053941.1| PREDICTED: zinc finger protein ZAT9 [Eucalyptus grandis]
Length=384

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 52/110 (47%), Gaps = 32/110 (29%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNP-DMESGYGTGENSLDADETYNHGNGG  983
             N N+  + C  C ++F SYQALGGHR  HKK+   D  +    GEN+             
Sbjct  244   NQNRGNFRCETCGRTFRSYQALGGHRASHKKSKLGDPAAAENVGENA-------------  290

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                                P   K HECPFC R+F SGQALGGHKRSH I
Sbjct  291   ------------------NPGSSKVHECPFCFRVFASGQALGGHKRSHAI  322



>ref|XP_010053943.1| PREDICTED: zinc finger protein ZAT4-like [Eucalyptus grandis]
Length=502

 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 85/196 (43%), Gaps = 41/196 (21%)
 Frame = +3

Query  597   LAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKT  776
             LA C ++    G V+P     E+          AS S  ++R    S+   +   S   T
Sbjct  162   LANC-LMMLSNGMVDPSSAEPEE--------SCASASKDEERRRPISFIAPLAFRSPPTT  212

Query  777   KVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKT------NPDMESGYGTGE  938
                    P  N  +  +EC  CKK FNS+QALGGHR  HKK         D    +   E
Sbjct  213   DKAKGVIP--NKGQGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARVDHAYDWVPDE  270

Query  939   NSLDADE-----------TYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRM  1085
             +++  DE            ++HG    +          +T K+    K K HEC  CHR+
Sbjct  271   DAITQDEFFMTKSMASNSPFDHGLSSSL---------PSTSKR----KSKVHECSICHRV  317

Query  1086  FKSGQALGGHKRSHFI  1133
             F SGQALGGHKR H+I
Sbjct  318   FSSGQALGGHKRCHWI  333



>ref|XP_003605324.1| Zinc finger protein [Medicago truncatula]
Length=504

 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 56/113 (50%), Gaps = 13/113 (12%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKT----------NPDMESGYGTGENSLDADETYNHG  974
             +EC  CKK FNS+QALGGHR  HKK           NPD        ++ +  DE +   
Sbjct  227   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDQNPD---DSIVEDDVITQDEFFPSK  283

Query  975   NGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 ++   G+            +K K HEC  CHR F SGQALGGHKR H+I
Sbjct  284   PNSTLQYDHGTSNNPTLMASSSKRKSKVHECSICHRSFSSGQALGGHKRCHWI  336



>ref|XP_011033839.1| PREDICTED: zinc finger protein ZAT9-like isoform X1 [Populus 
euphratica]
Length=399

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 54/110 (49%), Gaps = 30/110 (27%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKT---NPDMESGYGTGENSLDADETYNHGNGGKIR  992
             KY+C  C K F SYQALGGHR  HKK     P  E      EN                 
Sbjct  248   KYKCETCNKVFKSYQALGGHRASHKKLKVYTPSKEPNLEPTEN-----------------  290

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                    AGA+     P+K K H CPFC R+F SGQALGGHKRSH IG A
Sbjct  291   -------AGASTS--LPEK-KIHGCPFCFRVFSSGQALGGHKRSHVIGVA  330



>gb|AES87521.2| Cys2/His2 zinc-finger transcription factor [Medicago truncatula]
Length=485

 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 56/113 (50%), Gaps = 13/113 (12%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKT----------NPDMESGYGTGENSLDADETYNHG  974
             +EC  CKK FNS+QALGGHR  HKK           NPD        ++ +  DE +   
Sbjct  227   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDQNPD---DSIVEDDVITQDEFFPSK  283

Query  975   NGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 ++   G+            +K K HEC  CHR F SGQALGGHKR H+I
Sbjct  284   PNSTLQYDHGTSNNPTLMASSSKRKSKVHECSICHRSFSSGQALGGHKRCHWI  336



>ref|XP_010258926.1| PREDICTED: zinc finger protein ZAT9-like [Nelumbo nucifera]
Length=490

 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN---GGKIRD  995
             +EC  CKK FNS+QALGGHR  HKK      +     + SL  ++   H       K   
Sbjct  223   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDDHDESLVEEDVITHDEFLIPTKSNA  282

Query  996   CFGSKKAGATEKKVRPK-KGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 ++A      +  K K K HEC  CHR+F SGQALGGHKR H++
Sbjct  283   ILPFEQASQPPLAIPAKRKSKVHECSICHRVFSSGQALGGHKRCHWV  329



>emb|CDX71799.1| BnaC08g30750D [Brassica napus]
Length=260

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 54/123 (44%), Gaps = 34/123 (28%)
 Frame = +3

Query  801   GTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNG  980
              T   K +Y C  C K F SYQALGGHR  HKK     ++ Y                  
Sbjct  144   ATTTTKGRYTCETCGKVFKSYQALGGHRASHKKNRVTNKTDYDI----------------  187

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVINGS  1160
                          A EK++       HECP C R+F SGQALGGHKRSH +G   V N  
Sbjct  188   ----------VVVAAEKRI-------HECPICLRVFASGQALGGHKRSHGLGNLSV-NPH  229

Query  1161  HQT  1169
             HQ 
Sbjct  230   HQV  232



>gb|KCW78318.1| hypothetical protein EUGRSUZ_D02497, partial [Eucalyptus grandis]
Length=373

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 52/110 (47%), Gaps = 32/110 (29%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNP-DMESGYGTGENSLDADETYNHGNGG  983
             N N+  + C  C ++F SYQALGGHR  HKK+   D  +    GEN+             
Sbjct  244   NQNRGNFRCETCGRTFRSYQALGGHRASHKKSKLGDPAAAENVGENA-------------  290

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                                P   K HECPFC R+F SGQALGGHKRSH I
Sbjct  291   ------------------NPGSSKVHECPFCFRVFASGQALGGHKRSHAI  322



>ref|XP_004506485.1| PREDICTED: zinc finger protein ZAT9-like [Cicer arietinum]
Length=332

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 58/113 (51%), Gaps = 27/113 (24%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTN-PDMESGYGTGENSLDADETYNHGNGGKIR  992
             + +Y+C  C K F SYQALGGHR  HKK    + E G  + E  ++     N+ NG    
Sbjct  197   RARYKCDTCNKMFRSYQALGGHRASHKKIKLINDEIGVDSEEEKIN----INNING----  248

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVI  1151
                               + K HECP C+R+F SGQALGGHKR+H I G+  I
Sbjct  249   ------------------ESKIHECPVCYRVFNSGQALGGHKRTHGIVGSTTI  283



>ref|XP_009402052.1| PREDICTED: zinc finger protein ZAT1-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 60/129 (47%), Gaps = 21/129 (16%)
 Frame = +3

Query  789   ASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYN  968
             A  P  +  +  +EC  CKK F+S+QALGGHR  HKK         G     LDA +  +
Sbjct  220   AGPPLPSVPRGTFECKACKKVFSSHQALGGHRASHKKVK-------GCFAAKLDALDEAS  272

Query  969   HGNGGKIRDCFGSKKAGATEKKVRP--------------KKGKGHECPFCHRMFKSGQAL  1106
                     D   S+   +    + P              KK K HEC  CHR+F SGQAL
Sbjct  273   PDEEVMTHDKCSSEMVASMSMAIVPFENTTGPLAVAPLKKKSKVHECSICHRVFTSGQAL  332

Query  1107  GGHKRSHFI  1133
             GGHKR H+I
Sbjct  333   GGHKRCHWI  341



>emb|CDP02295.1| unnamed protein product [Coffea canephora]
Length=849

 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 92/353 (26%), Positives = 157/353 (44%), Gaps = 41/353 (12%)
 Frame = +3

Query  132   HPKRYKKLVVKSYSLSLTNNNSIGSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYG--SVV  305
             +P++ + ++    S S + + +  SSS++E DE E  + A CLMMLS+   NW G    +
Sbjct  185   YPRKKRSVMRYKSSHSFSYSTANASSSLNENDEVE--DAAICLMMLSRGVSNWDGVDCPL  242

Query  306   EFSDN-NSVVLETKSSSIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNR  482
              ++DN  S   E KS S+  ++++ +                 D  E    P +++    
Sbjct  243   VYTDNATSAYFEAKSVSLPEESTKVDAEDVVGNP---------DEVEMPEKPIEELYSCF  293

Query  483   KVMKSSIVHTEMAESQSSDSGYFLG-ENKVESDVSVNGFLAK-----CKVLN--------  620
                 +S+ +  +++     S +  G E K E +  V   L +      ++L+        
Sbjct  294   FGSANSLSNQNVSQFNELSSEFASGNEKKAELEFRVYEPLCRGEPNESRLLDVSGVELDG  353

Query  621   -RVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASS  797
                 G VEP +   +    + +D  +  +    K+    ++ PE+E  S  +    A   
Sbjct  354   SDSAGVVEPLKDQSKAVGMDQEDIQLM-DPNPCKKVEINAHAPELEICSSDRADT-ADEI  411

Query  798   PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN  977
                +  K++Y C  C  SF+S++ALGGH   HK TN     G+ +   +  +  T    N
Sbjct  412   FKISEKKREYRCRACNMSFSSHRALGGHSNKHK-TN-----GHCSASGTESSHLTDIECN  465

Query  978   GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
             G       GS   G     ++  K K HECP C ++F +GQALGGHKR+H+ G
Sbjct  466   GTSAEA--GSD--GVAMADLQLTKTKDHECPICFKVFSTGQALGGHKRAHYAG  514



>gb|KHN23998.1| Zinc finger protein ZAT4 [Glycine soja]
Length=556

 Score = 78.2 bits (191),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 22/132 (17%)
 Frame = +3

Query  810   ANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS--LDADETYNHGNG  980
             +NK+ K+EC  CKK F+SYQALGGHR  HK+      S   + ENS  L+A+ + +H   
Sbjct  357   SNKRGKFECTTCKKIFHSYQALGGHRASHKRIKGCFASRNESSENSTELEAELSPDHTTE  416

Query  981   GK-IRDCFGSKKAGATEKK-----------------VR-PKKGKGHECPFCHRMFKSGQA  1103
              K +++ +  +    T                    VR  KKGK HEC  C ++F SGQA
Sbjct  417   NKLLKNEYVEEHEMVTTVTTTTKTTAITDFDNEINTVRDSKKGKVHECSICLKIFPSGQA  476

Query  1104  LGGHKRSHFIGG  1139
             LGGHKRSH + G
Sbjct  477   LGGHKRSHHLAG  488



>gb|EPS74461.1| hypothetical protein M569_00297, partial [Genlisea aurea]
Length=204

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 60/117 (51%), Gaps = 10/117 (9%)
 Frame = +3

Query  780   VVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADE  959
             V+ AS   +   K  +EC  CKK FNS+QALGGHR  HKK      S   T EN+ + + 
Sbjct  98    VMEASPAESPKAKGIFECKACKKVFNSHQALGGHRASHKKVKGCFASK--TDENAGEDEV  155

Query  960   TYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
               N+G     R               R  K K HEC  CHR+F SG+ALGGHKR H+
Sbjct  156   ITNNGEYTPAR--------AYVSTAPRNGKTKKHECSICHRVFPSGRALGGHKRCHW  204



>ref|XP_006347910.1| PREDICTED: zinc finger protein ZAT9-like [Solanum tuberosum]
Length=330

 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 48/107 (45%), Gaps = 31/107 (29%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY C  C K F SYQALGGHR  HKK     E       N++  +E              
Sbjct  188   KYRCETCNKVFRSYQALGGHRASHKKIKLSNEVVESARNNNVVVEE--------------  233

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                              K H+CP C+R+F SGQALGGHKRSH IG  
Sbjct  234   -----------------KIHQCPVCYRVFPSGQALGGHKRSHTIGAV  263



>ref|XP_009345136.1| PREDICTED: zinc finger protein ZAT9-like [Pyrus x bretschneideri]
Length=382

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 60/115 (52%), Gaps = 20/115 (17%)
 Frame = +3

Query  798   PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN  977
             P T   + K +C  C K F SYQALGGHR  HKK              +L+A+  Y    
Sbjct  236   PRTRTARGKNKCETCNKVFKSYQALGGHRASHKKIK------------ALNANPIYKPEL  283

Query  978   GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
               +  +  G+  + A E+K+       HECP C R+F SGQALGGHKRSH + G+
Sbjct  284   EQENYNVAGNSSSVA-ERKI-------HECPVCFRVFSSGQALGGHKRSHVMSGS  330



>ref|XP_002320706.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE99021.2| zinc finger family protein [Populus trichocarpa]
Length=307

 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 56/112 (50%), Gaps = 30/112 (27%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKT---NPDMESGYGTGENSLDADETYNHGNGGK  986
             +++Y+C  C K F SYQALGGHR  HKK     P  E      EN               
Sbjct  169   EEEYKCETCNKVFKSYQALGGHRASHKKLKVYTPSKEPNLEPTEN---------------  213

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                      AGA+     P+K K H CPFC R+F SGQALGGHKRSH IG A
Sbjct  214   ---------AGASTS--LPEK-KIHGCPFCLRVFSSGQALGGHKRSHVIGVA  253



>ref|XP_006652617.1| PREDICTED: uncharacterized protein LOC102714091 [Oryza brachyantha]
Length=544

 Score = 77.8 bits (190),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 61/132 (46%), Gaps = 35/132 (27%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKK-------------TNPDMESG--YGTGENSLDADE  959
             +EC  CKK F+S+QALGGHR  HKK             T P   SG  +     + DA  
Sbjct  266   FECKACKKVFSSHQALGGHRASHKKVKGCFAARLDSNITEPPQHSGVAHANTNATFDASN  325

Query  960   TYNHGNGGKIRDCFGSKKAGATEKKVRPK--------------KGKGHECPFCHRMFKSG  1097
             T    N G       S+ A      + P+              KGK HEC  CHR+F SG
Sbjct  326   TDGDANAGT------SEAAAELSMAIVPRDPPVAALAAAPLKKKGKMHECSVCHRLFTSG  379

Query  1098  QALGGHKRSHFI  1133
             QALGGHKR H++
Sbjct  380   QALGGHKRCHWL  391



>ref|XP_010512387.1| PREDICTED: zinc finger protein ZAT9-like [Camelina sativa]
Length=323

 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 58/115 (50%), Gaps = 21/115 (18%)
 Frame = +3

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGG  983
             T   K +Y+C  C K F SYQALGGHR  HKK                 +++T    N  
Sbjct  193   TTTTKGRYKCETCGKVFKSYQALGGHRASHKKNRV--------------SNKTEQQRNET  238

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQV  1148
             +  +   S  A + EK++       HECP C R+F SGQALGGHKRSH IG   V
Sbjct  239   EHDNVVVSVVAASAEKRI-------HECPICFRVFASGQALGGHKRSHGIGNLSV  286



>ref|XP_002278612.1| PREDICTED: zinc finger protein ZAT9 [Vitis vinifera]
Length=467

 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 57/110 (52%), Gaps = 4/110 (4%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN---GGK  986
             K  +EC  CKK FNS+QALGGHR  HKK      +     + SL  ++   H       K
Sbjct  212   KGMFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDESLADEDVITHDEFSVPSK  271

Query  987   IRDCFGSKKAG-ATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                 F  + A  A       +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  272   STSTFQFEHASNAALSFPSKRKSKVHECSICHRVFSSGQALGGHKRCHWI  321



>ref|XP_001779240.1| predicted protein [Physcomitrella patens]
 gb|EDQ55928.1| predicted protein [Physcomitrella patens]
Length=181

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 72/159 (45%), Gaps = 17/159 (11%)
 Frame = +3

Query  660   EKEYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAAS--SPGTNANKKKYEC  833
             E+E+         SN G Q      + D E +T S +   +      + G++A + KYEC
Sbjct  38    EREWRGIQPPAEKSNPGGQGSGQHAASDNESDTESIEAAYMSNGDRHTQGSSA-RSKYEC  96

Query  834   LNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKK  1013
               CK+ F S+QALGGHR  HKK                 A  + N   GG          
Sbjct  97    ATCKRQFKSHQALGGHRASHKKVK------------GCFARTSVN--EGGAHEQSLEFMD  142

Query  1014  AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
             A   E     +K K HEC  CHR+F SGQALGGHKR H+
Sbjct  143   AEDEEMLNAARKTKAHECSICHRVFNSGQALGGHKRCHW  181



>ref|XP_002320707.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE99022.1| zinc finger family protein [Populus trichocarpa]
Length=462

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 57/106 (54%), Gaps = 9/106 (8%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             K  +EC  CKK FNS+QALGGHR  HKK    ++  Y    +    D   +H       D
Sbjct  213   KGMFECKACKKVFNSHQALGGHRASHKK----VKGCYAARLDQGMEDSLADHDEDFITND  268

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              F S K+ +T +         HEC  CHR+F SGQALGGHKR H++
Sbjct  269   EFFSTKSTSTLQF-----DHVHECSICHRVFSSGQALGGHKRCHWL  309



>gb|KEH29190.1| Cys2/His2 zinc-finger transcription factor [Medicago truncatula]
Length=378

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 55/105 (52%), Gaps = 20/105 (19%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             +Y+C  C K F SYQALGGHR  HKK     ESG   G+ S+       H     I    
Sbjct  219   RYKCDTCNKVFRSYQALGGHRASHKKNKQVAESG---GDYSIS-----QHHEKINI----  266

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
               K    +EKK+       HECP C R F SGQALGGH+R+H IG
Sbjct  267   -EKNINVSEKKI-------HECPICFREFASGQALGGHRRTHNIG  303



>gb|KHM99417.1| Zinc finger protein ZAT3 [Glycine soja]
Length=475

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 55/107 (51%), Gaps = 4/107 (4%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD---  995
             +EC  CKK FNS+QALGGHR  HKK      +     +++L  D+   H      +    
Sbjct  218   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDNLDDNLMEDDVITHEEFFPTKSNST  277

Query  996   -CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               F    +  +      +K K HEC  CHR F SGQALGGHKR H+I
Sbjct  278   LQFDHGSSNPSLASSSKRKSKVHECSICHRSFSSGQALGGHKRCHWI  324



>ref|XP_004494014.1| PREDICTED: zinc finger protein ZAT4-like [Cicer arietinum]
Length=355

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 54/112 (48%), Gaps = 35/112 (31%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKT---NPDMESGYGTGENSLDADETYNHGNGGK  986
             K +Y+C  C K F SYQALGGHR  HKK    N ++E      E                
Sbjct  226   KGRYKCETCNKVFKSYQALGGHRASHKKIKLMNINVEESPPEFE----------------  269

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                      +G  EKK+       HECP C R+F SGQALGGHKR+H I G+
Sbjct  270   ---------SGIVEKKI-------HECPVCFRVFSSGQALGGHKRTHVIHGS  305



>gb|KGN56355.1| hypothetical protein Csa_3G117410 [Cucumis sativus]
Length=564

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 62/117 (53%), Gaps = 23/117 (20%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD-----ETY--------  965
             +EC  CKK FNS+QALGGHR  HKK    ++  +    + +D D     + Y        
Sbjct  296   FECKACKKVFNSHQALGGHRASHKK----VKGCFAARLDHMDIDTRENDDVYEDSLFPTK  351

Query  966   -NHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              NH +       + +  A A+++K      K HEC  CHR+F SGQALGGHKR H+I
Sbjct  352   PNHKSSSSSAFHYENPMASASKRKT-----KVHECSICHRIFSSGQALGGHKRCHWI  403



>ref|XP_004134285.1| PREDICTED: uncharacterized protein LOC101222211 [Cucumis sativus]
 ref|XP_004170258.1| PREDICTED: uncharacterized protein LOC101225110 [Cucumis sativus]
Length=525

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 62/117 (53%), Gaps = 23/117 (20%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD-----ETY--------  965
             +EC  CKK FNS+QALGGHR  HKK    ++  +    + +D D     + Y        
Sbjct  296   FECKACKKVFNSHQALGGHRASHKK----VKGCFAARLDHMDIDTRENDDVYEDSLFPTK  351

Query  966   -NHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              NH +       + +  A A+++K      K HEC  CHR+F SGQALGGHKR H+I
Sbjct  352   PNHKSSSSSAFHYENPMASASKRKT-----KVHECSICHRIFSSGQALGGHKRCHWI  403



>ref|XP_010934955.1| PREDICTED: zinc finger protein ZAT1-like [Elaeis guineensis]
Length=357

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 77/187 (41%), Gaps = 36/187 (19%)
 Frame = +3

Query  573   SDVSVNGFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPEM  752
             SDVS    +A+C +L     +   R G      E  DD     + G  +   D  Y+ + 
Sbjct  143   SDVSPEEDVARCLMLLSRDAWARLRAG------EQADD---QQSDGWDETAEDEDYNVDG  193

Query  753   ETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGT  932
             E G      + +A+       + +Y+C  CKK F SYQALGGHR  HKK           
Sbjct  194   EDG---DEGIGSAARSRRRGRRSRYQCGTCKKFFRSYQALGGHRASHKKV----------  240

Query  933   GENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKG-HECPFCHRMFKSGQALG  1109
                             G +R   G +  G    +    +    H CPFC R+F S QALG
Sbjct  241   -------------AGSGSVRAAGGIQIGGEDSSEFNANRNSSLHRCPFCSRVFGSAQALG  287

Query  1110  GHKRSHF  1130
             GHKRSH 
Sbjct  288   GHKRSHL  294



>ref|XP_008437784.1| PREDICTED: uncharacterized protein LOC103483116 [Cucumis melo]
Length=562

 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 62/117 (53%), Gaps = 23/117 (20%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDAD-----ETY--------  965
             +EC  CKK FNS+QALGGHR  HKK    ++  +    + +D D     + Y        
Sbjct  292   FECKACKKVFNSHQALGGHRASHKK----VKGCFAARLDHMDIDSRENDDVYEDSLFPTK  347

Query  966   -NHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
              NH +       + +  A A+++K      K HEC  CHR+F SGQALGGHKR H+I
Sbjct  348   PNHKSSSSSAFHYENPLASASKRKT-----KVHECSICHRIFSSGQALGGHKRCHWI  399



>ref|XP_008669045.1| PREDICTED: zinc finger protein ZAT1-like [Zea mays]
 tpg|DAA36529.1| TPA: hypothetical protein ZEAMMB73_243689 [Zea mays]
Length=307

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 61/120 (51%), Gaps = 21/120 (18%)
 Frame = +3

Query  771   KTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLD  950
             +  VVAA    T   + +YEC  CKK F SYQALGGHR  + +         G G     
Sbjct  152   RPAVVAA----TAQKRTRYECPACKKVFRSYQALGGHRASNVRG--------GRGGCCAP  199

Query  951   ADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
                T        + +C GS++    + K +P     HECP+C R+F SGQALGGHKRSH 
Sbjct  200   PLSTPPPAPLQPLPECEGSEE----DSKAQP-----HECPYCFRVFPSGQALGGHKRSHL  250



>ref|XP_009385850.1| PREDICTED: zinc finger protein ZAT1-like [Musa acuminata subsp. 
malaccensis]
Length=338

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 55/108 (51%), Gaps = 29/108 (27%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGT---GENSLDADETYNHGNGGK  986
             + +Y+C  CKK F SYQALGGHR  HK+   +     G    G++  DAD          
Sbjct  198   RTRYQCGTCKKYFRSYQALGGHRASHKRVGVECFPIAGIRNRGKDPSDAD----------  247

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
                      A   + KV        ECP+C+R+F SGQALGGHKRSHF
Sbjct  248   ---------AADRDPKV-------FECPYCYRVFSSGQALGGHKRSHF  279



>ref|XP_010942825.1| PREDICTED: zinc finger protein ZAT10-like [Elaeis guineensis]
Length=239

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 54/106 (51%), Gaps = 21/106 (20%)
 Frame = +3

Query  813   NKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIR  992
              ++KY+C  C K+F+SYQALGGH+  H+K N                      G G +  
Sbjct  85    TRQKYKCSVCGKAFSSYQALGGHKASHRKPNIP--------------------GGGAEEV  124

Query  993   DCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
             D  GS  A +T        G+ HEC  CHR F +GQALGGHKR H+
Sbjct  125   DSIGSTVA-STISSSGGGSGRAHECSVCHRTFPTGQALGGHKRRHY  169



>ref|XP_008453249.1| PREDICTED: zinc finger protein ZAT1-like [Cucumis melo]
Length=505

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 104/229 (45%), Gaps = 21/229 (9%)
 Frame = +3

Query  519   AESQSSDSGYFLGENKVESDVSV-NGFLAKCKVL--NRVKG--------YVEPRRGGVEK  665
             AES  ++S +    + VES  SV NG    C+++  N++KG          E R G    
Sbjct  220   AESSDNNSKFLEAPSVVESKTSVSNG----CELVKSNKLKGKKMEFEVKQSEERAGSTMI  275

Query  666   EYENYDDFGVASNSGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKK--KYECLN  839
             +    +    + +S K+   N   +  +M   S KKT      S      KK  K+EC  
Sbjct  276   KKSQLNQRAGSKSSLKKNEQNQGRFSSDMFFKSPKKTLAEFWDSKICKKPKKRSKFECDI  335

Query  840   CKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAG  1019
             C K F+SYQALGGHR  HKK            E   + +E     + G++      K   
Sbjct  336   CNKIFDSYQALGGHRASHKKLKGCFIESAMEDEEEEEDEEEIGSESSGEMTISANPKAES  395

Query  1020  ATEKKV----RPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVIN  1154
                K +    R +K   H+CP C ++F SGQALGGHKRSH + G++  N
Sbjct  396   KGSKGINNGGRIEKNSKHKCPICEKVFASGQALGGHKRSHLMNGSETKN  444



>ref|XP_002880157.1| hypothetical protein ARALYDRAFT_483645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56416.1| hypothetical protein ARALYDRAFT_483645 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 50/107 (47%), Gaps = 29/107 (27%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             + N+ +++C  C K F SYQALGGHR  HKK                             
Sbjct  196   DKNRGRFKCETCGKVFKSYQALGGHRASHKKNKA--------------------------  229

Query  987   IRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSH  1127
                C    +   TE  +  K+ K HECP C R+F SGQALGGHKRSH
Sbjct  230   ---CMTKTEQVKTEYVLGAKEKKVHECPICFRVFTSGQALGGHKRSH  273



>gb|KHM99419.1| Zinc finger protein ZAT9 [Glycine soja]
Length=365

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 54/113 (48%), Gaps = 27/113 (24%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTN-PDMESGYGTGENSLDADETYNHGNGG  983
             N  + +Y+C  C+K F SYQALGGHR  HKK    +  +     E  L+           
Sbjct  215   NKVRGRYKCETCEKVFRSYQALGGHRASHKKIKLNNNNNNNNNNEGELEVQHV-------  267

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                           EKK+       HECP C R+F SGQALGGHKR+H IG +
Sbjct  268   ------------VVEKKI-------HECPVCFRVFASGQALGGHKRTHVIGSS  301



>ref|XP_002465113.1| hypothetical protein SORBIDRAFT_01g032230 [Sorghum bicolor]
 gb|EER92111.1| hypothetical protein SORBIDRAFT_01g032230 [Sorghum bicolor]
Length=415

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 58/120 (48%), Gaps = 19/120 (16%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDM-----------ESGYGTGENSLD-ADE  959
             + +YEC  C ++F SYQALGGHR  HK+ N +            E    T  +S   A  
Sbjct  265   RGRYECPGCGRAFQSYQALGGHRASHKRINSNCSIAKAVVDHQPEQSVETNTSSFSTASP  324

Query  960   TYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGG  1139
               N+G G  I              K +P K    ECP C R+F SGQALGGHKRSH I G
Sbjct  325   DPNYG-GADI------APTAVVALKAKPHKPIKFECPICFRVFGSGQALGGHKRSHSIAG  377



>emb|CDP09473.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 55/105 (52%), Gaps = 17/105 (16%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             KY C  C K+F SYQALGGHR  HK+          + E  +   ET N  +        
Sbjct  178   KYRCETCNKAFRSYQALGGHRASHKRIKAH---NSNSTEEEVAGVETGNAASAA------  228

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
              +  +   E+K+       HECP C+R+F SGQALGGHKRSH +G
Sbjct  229   -AVSSVVVEEKI-------HECPVCYRIFSSGQALGGHKRSHVMG  265



>ref|XP_003517016.1| PREDICTED: zinc finger protein ZAT9-like [Glycine max]
Length=365

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 54/113 (48%), Gaps = 27/113 (24%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTN-PDMESGYGTGENSLDADETYNHGNGG  983
             N  + +Y+C  C+K F SYQALGGHR  HKK    +  +     E  L+           
Sbjct  215   NKVRGRYKCETCEKVFRSYQALGGHRASHKKIKLNNNNNNNNNNEGELEVQHV-------  267

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                           EKK+       HECP C R+F SGQALGGHKR+H IG +
Sbjct  268   ------------VVEKKI-------HECPVCFRVFASGQALGGHKRTHVIGSS  301



>ref|XP_009140851.1| PREDICTED: zinc finger protein ZAT5-like [Brassica rapa]
Length=287

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFG  1004
             YEC  C ++F+S+QALGGHR  HKK    +E+   T    + A  + +          FG
Sbjct  118   YECKTCSRTFSSFQALGGHRASHKKPRVSIEA--KTKLPLMQAKSSGSEEGQKSNFKVFG  175

Query  1005  SKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQVI  1151
             S  A  +   +  K  K HEC  C   F SGQALGGH R H      VI
Sbjct  176   SSLASLSSNIIISKANKVHECSICGSEFTSGQALGGHMRRHRTATTAVI  224



>gb|AFF57513.1| Cys2/His2-type zinc finger protein [Chrysanthemum x morifolium]
Length=248

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 22/114 (19%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFG  1004
             ++C  C K+F SYQALGGH+  H+K NP  E+ +     +     + +  +GG      G
Sbjct  96    HKCTVCDKTFGSYQALGGHKASHRKNNPGAETEHSAAATTATTTSSASGTHGG-----VG  150

Query  1005  SKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF---IGGAQVING  1157
             S              G+ HEC  CHR F +GQALGGHKR H+   IGG +  +G
Sbjct  151   S--------------GRSHECSICHRSFPTGQALGGHKRRHYEGVIGGGKAASG  190



>ref|NP_001239999.1| uncharacterized protein LOC100780611 [Glycine max]
 gb|ACU20788.1| unknown [Glycine max]
Length=388

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 17/113 (15%)
 Frame = +3

Query  804   TNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGG  983
             +N  + +Y+C  C+K F SYQALGGHR  HKK   +         N+ + DE        
Sbjct  220   SNKVRGRYKCETCEKVFRSYQALGGHRASHKKIKLNNCENKNKNNNNNNDDEA-------  272

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                +    +     EKK+       HECP C R+F SGQALGGHKR+H IG +
Sbjct  273   ---EQLEVQHVVVVEKKI-------HECPVCFRVFASGQALGGHKRTHVIGSS  315



>gb|EYU25508.1| hypothetical protein MIMGU_mgv1a012456mg [Erythranthe guttata]
Length=250

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 74/171 (43%), Gaps = 26/171 (15%)
 Frame = +3

Query  648   RGGVEKEYENYDDFGVASNSGKQKRTNDTSYDPE------METGSYKKTKVVAASSPGTN  809
             RG  E+EY       +A         + ++  P       + T S   T+V+  +   T+
Sbjct  35    RGPTEEEYLALCLIMLARGGRGAAAASTSAVLPHRNTFRGVRTQSPPSTRVMVPADQATS  94

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKI  989
             A+K  Y+C  C K+F SYQALGGH+  H+K N                    +H      
Sbjct  95    ASKLVYKCSVCDKAFGSYQALGGHKASHRKLN------------GGGGGSGEDHSTT---  139

Query  990   RDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                  S  A  T        G+ HEC  CHR F SGQALGGHKR H+ GGA
Sbjct  140   -----SVSATTTTTSTSGGGGRSHECSICHRCFPSGQALGGHKRCHYEGGA  185



>ref|XP_008787061.1| PREDICTED: zinc finger protein ZAT9-like [Phoenix dactylifera]
Length=500

 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 56/114 (49%), Gaps = 15/114 (13%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTN-------PDMESGYGTGENSLDAD----ETYNH  971
             +EC  CKK F+S+QALGGHR  HKK          D++     GE   D D    E    
Sbjct  228   FECRACKKVFSSHQALGGHRASHKKVKGCFAAKLDDLDEAPTDGEVITDHDNNNSEMAAA  287

Query  972   GNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                  I   F +     T  K   K  K HEC  CHR+F SGQALGGHKR H+I
Sbjct  288   AMAMAIVP-FDNPPLAVTPLK---KMSKVHECSICHRVFTSGQALGGHKRCHWI  337



>dbj|BAM66957.1| Zinc finger protein [Chrysanthemum x morifolium]
Length=249

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 22/114 (19%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCFG  1004
             ++C  C K+F SYQALGGH+  H+K NP  E+ +     +     + +  +GG      G
Sbjct  96    HKCTVCDKTFGSYQALGGHKASHRKNNPGAETEHSAAATTATTTSSASGTHGG-----VG  150

Query  1005  SKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF---IGGAQVING  1157
             S              G+ HEC  CHR F +GQALGGHKR H+   IGG +  +G
Sbjct  151   S--------------GRSHECSICHRSFPTGQALGGHKRRHYEGVIGGGKAASG  190



>ref|XP_007200542.1| hypothetical protein PRUPE_ppa011687mg [Prunus persica]
 gb|EMJ01741.1| hypothetical protein PRUPE_ppa011687mg [Prunus persica]
Length=200

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 57/103 (55%), Gaps = 5/103 (5%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRDCF  1001
             ++EC +CKK F S+QALGGHR  HK    +++  +    +  + D+ ++H NG   RD  
Sbjct  37    RFECSSCKKVFGSHQALGGHRASHK----NVKGCFAITRSDGEVDQDHHH-NGDGERDDE  91

Query  1002  GSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
                      K V    G GH+C  C R+F SGQALGGH R H+
Sbjct  92    DDDVMEENNKMVMVLGGSGHKCSVCWRVFSSGQALGGHMRCHW  134



>ref|XP_003516436.1| PREDICTED: zinc finger protein ZAT4-like [Glycine max]
Length=481

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 55/107 (51%), Gaps = 4/107 (4%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD---  995
             +EC  CKK FNS+QALGGHR  HKK      +     ++++  D+   H      +    
Sbjct  226   FECKACKKVFNSHQALGGHRASHKKVKGCFAAKLDNLDDNIMEDDVITHEEFFPTKSNST  285

Query  996   -CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               F    +  +      +K K HEC  CHR F SGQALGGHKR H+I
Sbjct  286   LQFDHGSSNPSLASSSKRKPKVHECSICHRSFSSGQALGGHKRCHWI  332



>ref|XP_008232572.1| PREDICTED: zinc finger protein ZAT9-like [Prunus mume]
Length=396

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 50/108 (46%), Gaps = 23/108 (21%)
 Frame = +3

Query  798   PGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGN  977
             P T   + KY+C  C K F SYQALGGHR  HKK          +  N +   E     N
Sbjct  250   PRTRTTRGKYKCETCNKVFKSYQALGGHRASHKKIK-------ASNPNPIYDHELEQENN  302

Query  978   GGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKR  1121
              G          +   E+K        HECP C R+F SGQALGGHKR
Sbjct  303   AG---------ASSVAERKT-------HECPVCFRVFSSGQALGGHKR  334



>ref|XP_006402568.1| hypothetical protein EUTSA_v10006508mg [Eutrema salsugineum]
 gb|ESQ44021.1| hypothetical protein EUTSA_v10006508mg [Eutrema salsugineum]
Length=320

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 64/142 (45%), Gaps = 31/142 (22%)
 Frame = +3

Query  741   DPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMES  920
             D E   G  K +K+   ++ G      +Y C  C K F SYQALGGHR  HKK       
Sbjct  180   DTEESEGYNKSSKINRTTTKG------RYTCETCGKVFKSYQALGGHRASHKKNRV----  229

Query  921   GYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQ  1100
                + +    ++  YN               A   EK++       HECP C R+F SGQ
Sbjct  230   ---SNKTEQRSETEYN-----------NVVIAVTAEKRI-------HECPICLRVFASGQ  268

Query  1101  ALGGHKRSHFIGGAQVINGSHQ  1166
             ALGGHKRSH IG   V    HQ
Sbjct  269   ALGGHKRSHGIGNLSVNYHHHQ  290



>ref|XP_010044422.1| PREDICTED: uncharacterized protein LOC104433394 [Eucalyptus grandis]
Length=458

 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 59/104 (57%), Gaps = 6/104 (6%)
 Frame = +3

Query  843   KKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD---CFGSKK  1013
             +K F+S   L  H+ CHKK      S Y + +   + D ++N      IRD   C G + 
Sbjct  322   EKIFDSPMKLAKHKDCHKKLKMSASSEYESSKAGGEIDTSHNPAR--VIRDQEFCTG-ET  378

Query  1014  AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             A   EKK   +K   HECP C R+F+SGQALGGHKRSHF+ G++
Sbjct  379   ATRKEKKTGTRKNNRHECPICFRVFRSGQALGGHKRSHFLAGSK  422


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = +3

Query  201  GSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEFSD---NNSVVLETKSSSIDMKTS  371
            GSS+VSEI  QEQEEVAKCLMMLS+D+ ++ G+     D   +NS   E KS S D+++ 
Sbjct  160  GSSAVSEIG-QEQEEVAKCLMMLSRDTSHFKGACTWIRDGSNHNSDPFEAKSLSSDVRSG  218

Query  372  R  374
            +
Sbjct  219  K  219



>gb|KCW86511.1| hypothetical protein EUGRSUZ_B03164, partial [Eucalyptus grandis]
Length=453

 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 59/104 (57%), Gaps = 6/104 (6%)
 Frame = +3

Query  843   KKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD---CFGSKK  1013
             +K F+S   L  H+ CHKK      S Y + +   + D ++N      IRD   C G + 
Sbjct  318   EKIFDSPMKLAKHKDCHKKLKMSASSEYESSKAGGEIDTSHNPAR--VIRDQEFCTG-ET  374

Query  1014  AGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGAQ  1145
             A   EKK   +K   HECP C R+F+SGQALGGHKRSHF+ G++
Sbjct  375   ATRKEKKTGTRKNNRHECPICFRVFRSGQALGGHKRSHFLAGSK  418


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = +3

Query  201  GSSSVSEIDEQEQEEVAKCLMMLSKDSGNWYGSVVEFSD---NNSVVLETKSSSIDMKTS  371
            GSS+VSEI  QEQEEVAKCLMMLS+D+ ++ G+     D   +NS   E KS S D+++ 
Sbjct  156  GSSAVSEIG-QEQEEVAKCLMMLSRDTSHFKGACTWIRDGSNHNSDPFEAKSLSSDVRSG  214

Query  372  R  374
            +
Sbjct  215  K  215



>ref|XP_010325535.1| PREDICTED: zinc finger protein ZAT9-like [Solanum lycopersicum]
Length=350

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 60/123 (49%), Gaps = 31/123 (25%)
 Frame = +3

Query  771   KTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLD  950
             + KV   SS G    + KY C  C K F SYQALGGHR  HKK            + S +
Sbjct  195   EVKVTTKSSRG----RGKYRCETCNKFFRSYQALGGHRASHKKI-----------KLSNE  239

Query  951   ADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
               E+  H N         +      E+K+       H+CP C+R+F SGQALGGHKRSH 
Sbjct  240   VIESAAHNN---------NNNNAVIEEKI-------HQCPVCYRVFPSGQALGGHKRSHT  283

Query  1131  IGG  1139
             IG 
Sbjct  284   IGA  286



>ref|NP_001050407.1| Os03g0425900 [Oryza sativa Japonica Group]
 gb|AAS07213.1| putative zinc finger protein (C2H2-type) [Oryza sativa Japonica 
Group]
 gb|ABF96715.1| Zinc finger, C2H2 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12321.1| Os03g0425900 [Oryza sativa Japonica Group]
 dbj|BAG97302.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 61/131 (47%), Gaps = 2/131 (2%)
 Frame = +3

Query  747   EMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGY  926
             + E  + K+ K   A+S      + +YEC  C ++F SYQALGGHR  HK+ N +     
Sbjct  253   DTEIRTKKRRKTTGAASTAGGEKRGRYECHGCGRAFLSYQALGGHRASHKRINSNCSLVK  312

Query  927   GTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQAL  1106
                +    + ET        +        A    K V  KK     CP C + F SGQAL
Sbjct  313   PPADQPEPSIETSFSSASTSVSPADTMISAATISKTV--KKATKFVCPICSKEFGSGQAL  370

Query  1107  GGHKRSHFIGG  1139
             GGHKRSH I G
Sbjct  371   GGHKRSHSIAG  381



>ref|XP_010112022.1| Zinc finger protein ZAT9 [Morus notabilis]
 gb|EXC32403.1| Zinc finger protein ZAT9 [Morus notabilis]
Length=418

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 58/121 (48%), Gaps = 34/121 (28%)
 Frame = +3

Query  792   SSPGTNANKK-KYECLNCKKSFNSYQALGGHRPCHKK----TNPDMESGYGTGENSLDAD  956
             SS  TN   + KY+C  C K F SYQALGGHR  HKK    ++P +E          +  
Sbjct  244   SSRNTNTRTRGKYKCETCSKVFRSYQALGGHRASHKKIKISSSPALE----------EIH  293

Query  957   ETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIG  1136
             E+     G  I             KK+       HECP C R+F SGQALGGHKRSH + 
Sbjct  294   ESLRENAGSVI------------TKKI-------HECPVCFRVFSSGQALGGHKRSHVLS  334

Query  1137  G  1139
              
Sbjct  335   A  335



>ref|XP_008660066.1| PREDICTED: zinc finger protein ZAT4-like [Zea mays]
 gb|AFW88133.1| hypothetical protein ZEAMMB73_893978 [Zea mays]
Length=379

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 55/109 (50%), Gaps = 7/109 (6%)
 Frame = +3

Query  822   KYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDA-DETYNHGNGGKIRDC  998
             +YEC  C+++F SYQALGGHR  HK+ N    S     +  +D   E     N       
Sbjct  236   RYECPGCRRAFQSYQALGGHRASHKRIN----SNCSIAKPVVDQRPERIVETNISSFNIN  291

Query  999   FGSKKA--GATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGG  1139
             + +  A       K +  K    ECP C R+F SGQALGGHKRSH I G
Sbjct  292   YTTHMATTAVVALKAKSHKAIKFECPICFRVFGSGQALGGHKRSHSIAG  340



>ref|XP_010933668.1| PREDICTED: zinc finger protein ZAT9-like [Elaeis guineensis]
Length=364

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 53/105 (50%), Gaps = 23/105 (22%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             + KY+C  CKK F SYQALGGHR  HKK+     +      + +++ E    GN  +   
Sbjct  221   RSKYQCGTCKKVFRSYQALGGHRASHKKSGVACITAVQAQIHDVESSE----GNADR---  273

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
                             +  K HEC FC R+F SGQALGGHKRSH 
Sbjct  274   ----------------EANKVHECSFCFRVFSSGQALGGHKRSHL  302



>ref|XP_010692450.1| PREDICTED: uncharacterized protein LOC104905560 [Beta vulgaris 
subsp. vulgaris]
Length=916

 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 69/146 (47%), Gaps = 30/146 (21%)
 Frame = +3

Query  771   KTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKT----------------  902
             K K V  ++     +K  +EC  CK++FNS+QALGGHR  HKK                 
Sbjct  242   KAKGVVTTTSNNPNSKGLFECKACKRTFNSHQALGGHRASHKKVKGCYAAKMDQVLYQDH  301

Query  903   ---------NPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGK  1055
                      N D  +  G+ ++ L       +    ++ + +G+  +       RPK  K
Sbjct  302   HCSSSNNGDNEDNLAVLGSDQDHLITKSCTTY----QLENNYGASPSLPLVISKRPK-SK  356

Query  1056  GHECPFCHRMFKSGQALGGHKRSHFI  1133
              HEC  CHR+F SGQALGGHKR H+I
Sbjct  357   VHECSICHRVFSSGQALGGHKRCHWI  382


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 56/112 (50%), Gaps = 24/112 (21%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             +KKY+C  C + F SYQALGGHR  HKK     +                      + R 
Sbjct  770   RKKYQCETCLRVFRSYQALGGHRASHKKARVCQQHEQQQE----------------EARK  813

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSH-FIGGAQV  1148
             C  SKK    EKKV       HECP C R+F SGQALGGHKRSH FI G  +
Sbjct  814   CVLSKKEEKEEKKV-------HECPVCLRVFASGQALGGHKRSHVFINGGNI  858



>ref|XP_007140808.1| hypothetical protein PHAVU_008G143900g [Phaseolus vulgaris]
 gb|ESW12802.1| hypothetical protein PHAVU_008G143900g [Phaseolus vulgaris]
Length=384

 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 28/114 (25%)
 Frame = +3

Query  807   NANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGK  986
             N  + +Y+C  C K F SYQALGGHR  HKK   +++         +D +E         
Sbjct  251   NRVRGRYKCDTCNKVFRSYQALGGHRASHKKIKVNVK---------MDGEEA--------  293

Query  987   IRDCFGSKKAGA--TEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
               +    KK+G    EKK+       HECP C R+F SGQALGGHKR+H  G A
Sbjct  294   --EVEHRKKSGTCGVEKKI-------HECPVCFRVFASGQALGGHKRTHVTGSA  338



>ref|XP_002324101.2| hypothetical protein POPTR_0017s12740g [Populus trichocarpa]
 gb|EEF04234.2| hypothetical protein POPTR_0017s12740g [Populus trichocarpa]
Length=549

 Score = 75.1 bits (183),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 78/144 (54%), Gaps = 8/144 (6%)
 Frame = +3

Query  723   TNDTSYDP-EMETGSYKKTK-VVAASSPGTNANKKK--YECLNCKKSFNSYQALGGHRPC  890
              N  +YD  + E G   + + VVA  S  T +  KK  + C  C ++F SYQ+LGGH+  
Sbjct  346   INQANYDASDAEMGQDARLQMVVATDSDITESPSKKGDFRCRICNRNFISYQSLGGHQTF  405

Query  891   HKKTNPDMESGYGTGE-NSLDADETYNHGNGGKI---RDCFGSKKAGATEKKVRPKKGKG  1058
             H+K++  ++      +  ++ + ET   G   KI   ++    +  G   K    K+GK 
Sbjct  406   HRKSSIGLKVDSCKRDIQAIFSPETKAIGKLVKIECIQESVKQETDGVIVKDCESKEGKE  465

Query  1059  HECPFCHRMFKSGQALGGHKRSHF  1130
             H+CP C ++F SGQALGGHKR+HF
Sbjct  466   HKCPVCFKVFLSGQALGGHKRAHF  489



>ref|XP_009360635.1| PREDICTED: zinc finger protein 90-like [Pyrus x bretschneideri]
Length=539

 Score = 75.1 bits (183),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 70/137 (51%), Gaps = 2/137 (1%)
 Frame = +3

Query  726   NDTSYDPEMETGSYKKTKVVAASSP--GTNANKKKYECLNCKKSFNSYQALGGHRPCHKK  899
             +D +    M++G   K K+ A  S     +  K++++C  C K F +YQALGGH+  HK 
Sbjct  345   SDVAAFRSMKSGLNNKPKLYATESEVFADSQKKREHKCRLCNKVFGTYQALGGHQRVHKS  404

Query  900   TNPDMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCH  1079
             TN          E+ +  ++        K+     S  + A E+  R  + KGH+C  C 
Sbjct  405   TNTTSVVNIEDYEDGIPTNKFSKMEYSCKLAKTECSDSSAAEEEMERVIENKGHKCSICL  464

Query  1080  RMFKSGQALGGHKRSHF  1130
             ++F +GQALGGHKR HF
Sbjct  465   KVFATGQALGGHKRVHF  481



>ref|XP_011035855.1| PREDICTED: uncharacterized protein LOC105133516 [Populus euphratica]
Length=540

 Score = 75.1 bits (183),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 69/124 (56%), Gaps = 8/124 (6%)
 Frame = +3

Query  780   VVAASSPGTNANKKK--YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGE-NSLD  950
             VV   S  T +  KK  + C  C ++F SYQ+LGGH+  H+K++  +++     +  ++ 
Sbjct  357   VVTTDSDITESPSKKGNFRCRICNRNFISYQSLGGHQTFHRKSSIGLKTDSCKRDIQAIF  416

Query  951   ADETYNHGNGGKIRDCFG----SKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHK  1118
             + ET   G   KI DC       +  G   K    K+GK H+CP C ++F SGQALGGHK
Sbjct  417   SPETKATGKLVKI-DCIQESVKQETDGVIVKDCESKEGKEHKCPICFKVFLSGQALGGHK  475

Query  1119  RSHF  1130
             R+HF
Sbjct  476   RAHF  479



>ref|XP_002511651.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50320.1| zinc finger protein, putative [Ricinus communis]
Length=272

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 53/106 (50%), Gaps = 21/106 (20%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLDADETYNHGNGGKIRD  995
             K KY C  CKK F SYQALGGHR  HKK    + S     E   + +      +G     
Sbjct  119   KGKYRCETCKKVFKSYQALGGHRASHKKLK--LHSPIQERELETENNNNNAATSGS----  172

Query  996   CFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
                      + KK+       HECP+C R+F SGQALGGHKRSH +
Sbjct  173   --------VSVKKI-------HECPYCFRVFSSGQALGGHKRSHVV  203



>emb|CDY36493.1| BnaC03g48520D [Brassica napus]
Length=241

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 15/110 (14%)
 Frame = +3

Query  810   ANKKKYECLNCKKSFNSYQALGGHRPCHKK---TNPDMESGYGTGENSLDADETYNHGNG  980
             ++ + ++C  C KSFNSYQALGGH+  H+K    N ++ S      N+       +HGNG
Sbjct  90    SDHRDFKCTVCGKSFNSYQALGGHKTSHRKPPANNVNVPSSQEPSNNN-------SHGNG  142

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHF  1130
             G +   F      +    +    GK H C  C + F SGQALGGHKRSH+
Sbjct  143   GSV--VFSGNGTASNGVNL---SGKIHTCSICFKSFSSGQALGGHKRSHY  187



>gb|EAZ27392.1| hypothetical protein OsJ_11341 [Oryza sativa Japonica Group]
Length=395

 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 61/131 (47%), Gaps = 2/131 (2%)
 Frame = +3

Query  747   EMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGY  926
             + E  + K+ K   A+S      + +YEC  C ++F SYQALGGHR  HK+ N +     
Sbjct  231   DTEIRTKKRRKTTGAASTAGGEKRGRYECHGCGRAFLSYQALGGHRASHKRINSNCSLVK  290

Query  927   GTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQAL  1106
                +    + ET        +        A    K V  KK     CP C + F SGQAL
Sbjct  291   PPADQPEPSIETSFSSASTSVSPADTMISAATISKTV--KKATKFVCPICSKEFGSGQAL  348

Query  1107  GGHKRSHFIGG  1139
             GGHKRSH I G
Sbjct  349   GGHKRSHSIAG  359



>ref|XP_009110025.1| PREDICTED: zinc finger protein ZAT9-like [Brassica rapa]
 ref|XP_009110026.1| PREDICTED: zinc finger protein ZAT9-like [Brassica rapa]
Length=423

 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 109/342 (32%), Positives = 146/342 (43%), Gaps = 100/342 (29%)
 Frame = +3

Query  192   NSIGSSSVSEID-EQEQEEVAKCLMMLSKDSGNWYG------SVVEFSDNNSVVLETKSS  350
             N  GS+S  +   E EQEE+A  LMM+S+DS    G      S+ E SDN SV+LETKSS
Sbjct  149   NQYGSASSDDTGIEPEQEEMALSLMMMSRDSSFKKGHNMVVNSLAESSDNYSVILETKSS  208

Query  351   SIDMKTSRkngngngngkgvvykvcnRDNNETQNPPTKKMGDNRKVMKSSIVHTEMAESQ  530
             S                          +  +  +   KK  DN   +++  V   M ES 
Sbjct  209   S-------------------------GEQLKKVDECCKK--DNLGRVENGDV---MYESD  238

Query  531   SSDSGYFL-GENKVESDVSVN-GFLAKCKVLNRVKGYVEPRRGGVEKEYENYDDFGVASN  704
             +SDSGYF  G  K++SDV V+ GF  K                             +  N
Sbjct  239   NSDSGYFRNGPKKLDSDVFVDDGFSNKA---------------------------AMGFN  271

Query  705   SGKQKRTNDTSYDPEMETGSYKKTKVVAASSPGTNANKKKYECLNCKKSFNSYQALGGHR  884
             S + K  N            +KK      S  G+  +  KY+    K+ F          
Sbjct  272   SSQDKSLN-----------RFKK----EWSGTGSGRSATKYDLRKSKRGF----------  306

Query  885   PCH--KKTNPDM-ESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGK  1055
             PC+  K+T  ++ ES Y +G+    + ET +  +  KI          A+      KK K
Sbjct  307   PCYGRKRTKYELAESVYDSGDQL--SLETESCADTIKIHSNKSIMVKKASGGGGAKKKSK  364

Query  1056  GHECPFCHRMFKSGQALGGHKRSHFIGGAQ----VINGSHQT  1169
             GHECP C R+FKSGQALGGHKRSHF+G  +    VI   HQ 
Sbjct  365   GHECPICFRVFKSGQALGGHKRSHFLGNHEHRTLVIQQQHQV  406



>ref|XP_009407610.1| PREDICTED: zinc finger protein ZAT4-like [Musa acuminata subsp. 
malaccensis]
Length=429

 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 55/113 (49%), Gaps = 21/113 (19%)
 Frame = +3

Query  816   KKKYECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENSLD----ADETYNHGNGG  983
             + ++EC +C K F+S+QALGGHR  HK+            ENS +    ADE      G 
Sbjct  282   RSQFECKSCNKVFDSHQALGGHRASHKRMKGCRGHRTHVAENSTETDASADEAATEDTGS  341

Query  984   KIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFIGGA  1142
                   GS KA            KGH C  C R F SGQALGGHKRSH +  A
Sbjct  342   ------GSSKAN-----------KGHRCLICSRFFSSGQALGGHKRSHLVATA  377



>ref|XP_007052174.1| C2H2-type zinc finger family protein [Theobroma cacao]
 gb|EOX96331.1| C2H2-type zinc finger family protein [Theobroma cacao]
Length=477

 Score = 74.7 bits (182),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 11/111 (10%)
 Frame = +3

Query  825   YECLNCKKSFNSYQALGGHRPCHKKTNPDMESGYGTGENS--------LDADETYNHGNG  980
             +EC  CKK FNS+QALGGHR  HKK      +     ++S        +  +E +   + 
Sbjct  217   FECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHIDDSQADEDHDVITHEEFFPTKST  276

Query  981   GKIRDCFGSKKAGATEKKVRPKKGKGHECPFCHRMFKSGQALGGHKRSHFI  1133
               ++   G+    A+  K   +K K HEC  CHR+F SGQALGGHKR H+I
Sbjct  277   STLQFDQGTSAPLASTSK---RKSKVHECSICHRVFSSGQALGGHKRCHWI  324



>ref|XP_002526088.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF36282.1| zinc finger protein, putative [Ricinus communis]
Length=577

 Score = 75.1 bits (183),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 73/138 (53%), Gaps = 10/138 (7%)
 Frame = +3

Query  738   YDPEMETGSYKKTKVVAASSPGTNANKK-KYECLNCKKSFNSYQALGGHRPCHKKTNP--  908
             +D EM  G    T+++ +++   ++ KK +++C  C K F ++QALGGH+  H+ +    
Sbjct  381   FDAEM--GKDSCTEIICSTANFDDSKKKNQFQCRICSKMFLTHQALGGHQTLHRTSKSSA  438

Query  909   -----DMESGYGTGENSLDADETYNHGNGGKIRDCFGSKKAGATEKKVRPKKGKGHECPF  1073
                  + + G  T      +D     G    I++    ++ G T    + KK K H+CP 
Sbjct  439   ALKIDNCQEGIQTNSFPEKSDARSEAGKLDSIKNSVEQEEDGMTTTGYQLKKSKEHKCPI  498

Query  1074  CHRMFKSGQALGGHKRSH  1127
             C ++F SGQALGGHKR+H
Sbjct  499   CSKLFVSGQALGGHKRAH  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4543083181056