BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86903_g1_i1 len=549 path=[1:0-548]

Length=549
                                                                      Score     E

ref|XP_009588286.1|  PREDICTED: uncharacterized protein LOC104085872  95.5    2e-20   
ref|XP_009794591.1|  PREDICTED: zinc finger protein 5-like            84.3    1e-16   
ref|XP_010254962.1|  PREDICTED: uncharacterized protein LOC104595774  75.5    3e-13   
ref|XP_007226910.1|  hypothetical protein PRUPE_ppa016136mg           72.8    2e-12   
ref|XP_010318936.1|  PREDICTED: uncharacterized protein LOC101257456  72.0    2e-12   
ref|XP_008244960.1|  PREDICTED: zinc finger protein 5-like            72.4    3e-12   
gb|KDP21293.1|  hypothetical protein JCGZ_21764                       72.0    3e-12   
emb|CBI32082.3|  unnamed protein product                              72.0    3e-12   
ref|XP_003631292.2|  PREDICTED: zinc finger protein 5 isoform X2      71.6    5e-12   
emb|CAN76449.1|  hypothetical protein VITISV_029869                   70.5    8e-12   Vitis vinifera
ref|XP_010652954.1|  PREDICTED: zinc finger protein 5 isoform X1      71.2    8e-12   
gb|AIY30133.1|  C2H2 zinc finger protein 5                            70.5    1e-11   
ref|XP_010272057.1|  PREDICTED: uncharacterized protein LOC104607957  68.2    8e-11   
ref|XP_009775695.1|  PREDICTED: zinc finger protein 5-like isofor...  65.9    1e-10   
ref|XP_010663212.1|  PREDICTED: zinc finger protein JAGGED-like       66.6    1e-10   
ref|XP_006378183.1|  Zinc finger protein 5                            66.6    2e-10   
ref|XP_009775693.1|  PREDICTED: zinc finger protein 5-like isofor...  65.9    3e-10   
ref|XP_003633811.1|  PREDICTED: uncharacterized protein LOC100852925  66.6    4e-10   
emb|CDP20077.1|  unnamed protein product                              65.1    5e-10   
ref|XP_007044496.1|  C2H2 and C2HC zinc fingers superfamily prote...  65.5    6e-10   
ref|XP_011007072.1|  PREDICTED: zinc finger protein 5-like            65.5    6e-10   
ref|XP_002311793.2|  hypothetical protein POPTR_0008s19780g           63.9    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004297672.1|  PREDICTED: zinc finger protein 5-like            62.8    5e-09   
ref|XP_010043824.1|  PREDICTED: zinc finger protein 5                 62.4    1e-08   
ref|XP_003613371.1|  Zinc finger protein                              59.7    5e-08   
gb|AFK39899.1|  unknown                                               59.7    5e-08   
ref|XP_010066707.1|  PREDICTED: zinc finger protein 6-like            59.3    9e-08   
ref|XP_008798066.1|  PREDICTED: zinc finger protein 6                 57.4    3e-07   
ref|XP_004504507.1|  PREDICTED: zinc finger protein 5-like            57.8    3e-07   
ref|XP_010100522.1|  Zinc finger protein 5                            57.0    9e-07   
ref|XP_011034193.1|  PREDICTED: zinc finger protein 5                 56.6    9e-07   
ref|XP_006836743.1|  hypothetical protein AMTR_s00088p00145510        56.6    1e-06   
ref|XP_006290051.1|  hypothetical protein CARUB_v10003685mg           55.1    1e-06   
ref|XP_007157512.1|  hypothetical protein PHAVU_002G075900g           55.8    2e-06   
ref|XP_008353004.1|  PREDICTED: zinc finger protein 5-like            55.8    2e-06   
ref|XP_009360452.1|  PREDICTED: zinc finger protein 5                 55.8    2e-06   
ref|XP_007212443.1|  hypothetical protein PRUPE_ppa017203mg           53.5    2e-06   
gb|ADL36635.1|  C2H2L domain class transcription factor               55.5    3e-06   
ref|XP_002520214.1|  conserved hypothetical protein                   54.7    3e-06   Ricinus communis
ref|XP_007036108.1|  DNA glycosylase superfamily protein isoform 1    55.8    3e-06   
ref|XP_008389587.1|  PREDICTED: zinc finger protein 5                 55.5    3e-06   
ref|XP_011087078.1|  PREDICTED: zinc finger protein 5                 55.1    3e-06   
gb|KDP31147.1|  hypothetical protein JCGZ_11523                       54.3    4e-06   
gb|KHN28676.1|  Zinc finger protein 6                                 55.1    4e-06   
ref|XP_010913477.1|  PREDICTED: uncharacterized protein LOC105039151  54.7    4e-06   
ref|XP_006574581.1|  PREDICTED: zinc finger protein 5-like            54.7    4e-06   
gb|EMT14411.1|  Zinc finger protein 7                                 53.1    7e-06   
ref|XP_009789685.1|  PREDICTED: zinc finger protein 5-like            54.3    8e-06   
ref|XP_004513737.1|  PREDICTED: zinc finger protein 6-like            54.3    8e-06   
gb|KHN01119.1|  Zinc finger protein 6                                 53.9    9e-06   
ref|NP_001237195.1|  uncharacterized protein LOC100527006             53.5    1e-05   
gb|EPS62851.1|  zinc finger family protein                            50.4    2e-05   
ref|XP_007142933.1|  hypothetical protein PHAVU_007G029500g           52.8    2e-05   
gb|KDO82619.1|  hypothetical protein CISIN_1g024763mg                 52.8    3e-05   
ref|XP_006483768.1|  PREDICTED: zinc finger protein 5-like            52.8    3e-05   
ref|XP_006438491.1|  hypothetical protein CICLE_v10032466mg           52.4    3e-05   
emb|CDP00218.1|  unnamed protein product                              52.4    4e-05   
ref|NP_001183924.1|  hypothetical protein                             52.4    4e-05   
gb|ACU15330.1|  unknown                                               51.6    4e-05   Glycine max [soybeans]
gb|KGN51841.1|  hypothetical protein Csa_5G603380                     52.0    4e-05   
ref|XP_003561884.1|  PREDICTED: zinc finger protein 8-like            52.0    4e-05   
ref|XP_008668586.1|  PREDICTED: hypothetical protein isoform X3       52.4    4e-05   
ref|NP_001237732.1|  Cys2-His2 zinc finger protein                    51.6    5e-05   
gb|KFK35033.1|  hypothetical protein AALP_AA5G225200                  52.0    5e-05   
ref|XP_009122902.1|  PREDICTED: zinc finger protein 8-like            50.8    5e-05   
ref|XP_010470783.1|  PREDICTED: zinc finger protein 6-like isofor...  51.6    5e-05   
gb|AFK47742.1|  unknown                                               51.6    5e-05   
ref|XP_010415456.1|  PREDICTED: zinc finger protein 6-like            51.6    5e-05   
ref|XP_008668585.1|  PREDICTED: hypothetical protein isoform X2       52.0    5e-05   
ref|XP_010312072.1|  PREDICTED: zinc finger protein 8-like            51.2    5e-05   
ref|XP_004986901.1|  PREDICTED: uncharacterized protein LOC101764888  51.6    6e-05   
ref|XP_010682396.1|  PREDICTED: zinc finger protein 5                 51.2    6e-05   
ref|XP_010551250.1|  PREDICTED: zinc finger protein 6-like            51.6    7e-05   
ref|XP_002888657.1|  hypothetical protein ARALYDRAFT_894600           51.2    7e-05   
ref|XP_003562779.1|  PREDICTED: zinc finger protein 7-like            50.4    7e-05   
gb|EPS67309.1|  hypothetical protein M569_07467                       48.1    1e-04   
ref|XP_009393846.1|  PREDICTED: zinc finger protein 2-like            50.4    1e-04   
ref|XP_009357012.1|  PREDICTED: zinc finger protein 6-like            50.8    1e-04   
gb|KFK41250.1|  hypothetical protein AALP_AA2G104900                  50.4    1e-04   
ref|XP_011007643.1|  PREDICTED: zinc finger protein 6                 50.8    1e-04   
gb|EPS70937.1|  hypothetical protein M569_03822                       48.9    1e-04   
ref|XP_002314851.1|  zinc finger family protein                       50.4    1e-04   Populus trichocarpa [western balsam poplar]
emb|CDX98817.1|  BnaC09g50180D                                        49.7    1e-04   
ref|XP_010921946.1|  PREDICTED: zinc finger protein 6-like            50.4    1e-04   
ref|XP_003576583.1|  PREDICTED: zinc finger protein 8-like            50.4    2e-04   
ref|XP_010046588.1|  PREDICTED: zinc finger protein 6-like            50.1    2e-04   
gb|EPS70964.1|  hypothetical protein M569_03795                       47.8    2e-04   
ref|XP_001758910.1|  predicted protein                                47.4    2e-04   
ref|XP_004236684.1|  PREDICTED: zinc finger protein 4-like            50.1    2e-04   
ref|XP_006389433.1|  zinc finger family protein                       50.4    2e-04   
ref|XP_003525841.1|  PREDICTED: zinc finger protein 7-like            49.7    2e-04   
ref|XP_010532310.1|  PREDICTED: zinc finger protein 6-like            50.1    2e-04   
ref|XP_006346762.1|  PREDICTED: zinc finger protein 4-like            50.1    2e-04   
ref|XP_009783842.1|  PREDICTED: zinc finger protein 6                 49.7    2e-04   
emb|CAN72502.1|  hypothetical protein VITISV_027276                   49.7    2e-04   Vitis vinifera
ref|XP_008446260.1|  PREDICTED: zinc finger protein 5                 50.1    2e-04   
ref|XP_009391446.1|  PREDICTED: zinc finger protein 8-like            50.1    3e-04   
gb|EAY87723.1|  hypothetical protein OsI_09139                        50.1    3e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006855327.1|  hypothetical protein AMTR_s00057p00086480        49.7    3e-04   
ref|XP_010415245.1|  PREDICTED: zinc finger protein 6-like            49.3    3e-04   
ref|XP_008339649.1|  PREDICTED: zinc finger protein 6                 49.7    3e-04   
ref|XP_002515318.1|  hypothetical protein RCOM_1348010                48.9    3e-04   Ricinus communis
ref|XP_009611707.1|  PREDICTED: zinc finger protein 5                 49.3    3e-04   
ref|XP_010511613.1|  PREDICTED: zinc finger protein 6-like            48.9    3e-04   
ref|XP_006849571.1|  hypothetical protein AMTR_s00024p00186840        49.7    3e-04   
ref|NP_177003.1|  zinc finger-related protein                         49.3    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004158538.1|  PREDICTED: zinc finger protein 6-like            48.1    3e-04   
ref|XP_003532346.1|  PREDICTED: zinc finger protein 6                 48.5    3e-04   
ref|XP_011070208.1|  PREDICTED: zinc finger protein 3-like            49.3    3e-04   
gb|KHN24923.1|  Zinc finger protein 6                                 48.5    4e-04   
ref|XP_002283623.2|  PREDICTED: zinc finger protein 6                 49.3    4e-04   Vitis vinifera
gb|KDO70862.1|  hypothetical protein CISIN_1g022595mg                 49.7    4e-04   
ref|XP_003614563.1|  Zinc finger protein                              49.3    4e-04   
ref|XP_006492912.1|  PREDICTED: uncharacterized protein LOC102617549  49.7    4e-04   
ref|XP_010511826.1|  PREDICTED: zinc finger protein 6-like            49.3    4e-04   
ref|XP_008678504.1|  PREDICTED: zinc finger protein GIS-like          49.3    4e-04   
gb|ACU15388.1|  unknown                                               48.5    4e-04   Glycine max [soybeans]
ref|XP_011076533.1|  PREDICTED: zinc finger protein 6                 48.9    4e-04   
emb|CDY35394.1|  BnaA03g19660D                                        49.3    4e-04   
ref|XP_009356243.1|  PREDICTED: zinc finger protein 6-like            48.9    4e-04   
ref|XP_006429921.1|  hypothetical protein CICLE_v10012347mg           49.3    4e-04   
gb|KDO76950.1|  hypothetical protein CISIN_1g044930mg                 48.9    4e-04   
ref|XP_006468726.1|  PREDICTED: zinc finger protein 6-like            48.9    4e-04   
gb|AFK33843.1|  unknown                                               49.3    4e-04   
ref|XP_006448438.1|  hypothetical protein CICLE_v10016426mg           48.9    5e-04   
ref|XP_004954091.1|  PREDICTED: uncharacterized protein LOC101767903  48.9    5e-04   
ref|XP_009783843.1|  PREDICTED: zinc finger protein 6-like            48.5    5e-04   
ref|XP_008243415.1|  PREDICTED: zinc finger protein 6                 47.4    5e-04   
ref|XP_006292550.1|  hypothetical protein CARUB_v10018785mg           48.9    5e-04   
ref|XP_010516450.1|  PREDICTED: zinc finger protein GIS-like          48.9    5e-04   
emb|CDX79901.1|  BnaA05g02550D                                        48.9    5e-04   
ref|NP_001145628.1|  uncharacterized LOC100279115                     48.9    6e-04   Zea mays [maize]
ref|NP_001158974.1|  uncharacterized protein LOC100303926             48.9    6e-04   Zea mays [maize]
ref|XP_010670596.1|  PREDICTED: zinc finger protein 1-like            48.9    6e-04   
ref|XP_010470784.1|  PREDICTED: zinc finger protein 6-like isofor...  48.9    6e-04   
ref|XP_007139171.1|  hypothetical protein PHAVU_008G007400g           47.8    6e-04   
ref|XP_010555928.1|  PREDICTED: zinc finger protein 5-like            48.1    6e-04   
gb|KGN63129.1|  hypothetical protein Csa_2G404810                     47.8    6e-04   
ref|XP_008467196.1|  PREDICTED: zinc finger protein 6-like            48.5    6e-04   
ref|XP_011070783.1|  PREDICTED: zinc finger protein 6-like            48.5    6e-04   
ref|XP_004171266.1|  PREDICTED: zinc finger protein 6-like            48.5    6e-04   
ref|XP_009619423.1|  PREDICTED: zinc finger protein 8-like            48.5    6e-04   
ref|XP_004493346.1|  PREDICTED: zinc finger protein KNUCKLES-like     47.0    6e-04   
gb|KEH41742.1|  C2H2 and C2HC zinc finger protein, putative           48.9    6e-04   
ref|XP_006301738.1|  hypothetical protein CARUB_v10022199mg           48.5    6e-04   
gb|AEX13416.1|  hypothetical protein UMN_2521_01                      47.4    7e-04   
gb|AEX13418.1|  hypothetical protein UMN_2521_01                      47.4    7e-04   
gb|AEX13429.1|  hypothetical protein UMN_2521_01                      47.4    7e-04   
ref|XP_004289747.1|  PREDICTED: zinc finger protein 7-like            48.1    7e-04   
ref|XP_003610899.1|  Zinc finger protein                              48.9    7e-04   
ref|XP_006391147.1|  hypothetical protein EUTSA_v10019825mg           48.5    7e-04   
ref|XP_006362275.1|  PREDICTED: zinc finger protein 3-like            47.8    8e-04   
ref|XP_006482232.1|  PREDICTED: zinc finger protein 6-like            48.1    8e-04   
gb|KDO59051.1|  hypothetical protein CISIN_1g046730mg                 48.1    8e-04   
ref|XP_006355929.1|  PREDICTED: zinc finger protein 5-like            48.5    8e-04   
emb|CDP00646.1|  unnamed protein product                              48.1    8e-04   
ref|XP_007139172.1|  hypothetical protein PHAVU_008G007400g           47.8    8e-04   
gb|EMS58646.1|  Zinc finger protein 7                                 48.1    8e-04   
ref|XP_004497070.1|  PREDICTED: zinc finger protein 6-like            48.5    8e-04   
gb|KCW86763.1|  hypothetical protein EUGRSUZ_B03372                   48.5    9e-04   
ref|XP_010421563.1|  PREDICTED: uncharacterized protein LOC104707012  48.5    9e-04   
ref|XP_002871225.1|  zinc finger family protein                       47.8    9e-04   
emb|CDY22545.1|  BnaC03g23550D                                        48.1    9e-04   
gb|KDP32969.1|  hypothetical protein JCGZ_13000                       47.8    0.001   
ref|XP_007031965.1|  Uncharacterized protein TCM_017291               47.0    0.001   
ref|XP_008803531.1|  PREDICTED: zinc finger protein 6-like            48.1    0.001   
gb|KDP35694.1|  hypothetical protein JCGZ_10880                       47.8    0.001   
ref|XP_004238719.1|  PREDICTED: zinc finger protein 5-like            48.1    0.001   



>ref|XP_009588286.1| PREDICTED: uncharacterized protein LOC104085872 [Nicotiana tomentosiformis]
Length=235

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 115/177 (65%), Gaps = 15/177 (8%)
 Frame = +1

Query  10   SPGSDKKHFRLFGFKVDPCANE-VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVS  186
            +  SDKK  R+FGF+++PC  + +  RSE  ESV+S +T   ++ ++  +   +    V 
Sbjct  29   TSASDKK-LRIFGFELNPCLKDSICSRSERHESVSSFETFMDERPKEKTSICMNSSGIVL  87

Query  187  PEAKE--KNSSVS-VVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreN  357
            P   E  +N SVS V+ELKYEC FCLKKFS S+ALGGHQNAHR+ERLKK+RM++E +R +
Sbjct  88   PNPNENLRNLSVSAVMELKYECHFCLKKFSNSRALGGHQNAHRRERLKKKRMDLEAKRAS  147

Query  358  GFNLYRSSAMRNTGVIIYPHSFIGFDDLSCIPTVAFPNPVMNLSNIWPHHSSSTNLP  528
                Y ++ +RN GV +YP+S+        +PT+ + + +++ S+++ H  + T+ P
Sbjct  148  SSMFYLNALIRNNGV-MYPYSY--------VPTIVYGSSLISFSSVY-HCQNGTHSP  194



>ref|XP_009794591.1| PREDICTED: zinc finger protein 5-like [Nicotiana sylvestris]
Length=214

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 106/176 (60%), Gaps = 14/176 (8%)
 Frame = +1

Query  16   GSDKKHFRLFGFKVDPCANE-VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
             SDKK  R+FGF+V+PC  + +  RSE  ESV+SS+T   +  E+  +   +    V P 
Sbjct  31   ASDKK-LRIFGFEVNPCLKDSICSRSERHESVSSSETFMDETPEEKPSICLNSSGIVLPN  89

Query  193  AKE---KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGF  363
              E   K +  +V+ELKYEC FCLK+F  S+ALGGHQNAHRKERLKK+RM++E +  +  
Sbjct  90   PNENLRKLNVSAVMELKYECHFCLKRFLNSRALGGHQNAHRKERLKKKRMDLEAKMASSS  149

Query  364  NLYRSSAMRNTGVIIYPHSFIGFDDLSCIPTVAFPNPVMNLSNIWPHHSSSTNLPY  531
              Y +  + N G I+YP+S       S +PT+   +  +  S+++ +  + TN PY
Sbjct  150  MFYLNPIIINNG-IMYPYS-------SYVPTIVCGSSHIRFSSVY-NCQNDTNPPY  196



>ref|XP_010254962.1| PREDICTED: uncharacterized protein LOC104595774 [Nelumbo nucifera]
Length=310

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 18/99 (18%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANE---VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSP  189
            +++K  RLFGF+VDP AN+        E DES NSS+TVSS + EK+             
Sbjct  81   TEEKKLRLFGFEVDPYANDGRCSRASEEGDESANSSNTVSSQREEKSM------------  128

Query  190  EAKEKNSSVSVVE-LKYECRFCLKKFSTSQALGGHQNAH  303
              KEK  +    E  KYEC+FC K+F+ SQALGGHQNAH
Sbjct  129  --KEKIPTGEPAEDKKYECQFCFKEFANSQALGGHQNAH  165



>ref|XP_007226910.1| hypothetical protein PRUPE_ppa016136mg [Prunus persica]
 gb|EMJ28109.1| hypothetical protein PRUPE_ppa016136mg [Prunus persica]
Length=265

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 64/103 (62%), Gaps = 14/103 (14%)
 Frame = +1

Query  7    HSPGS-DKKHFRLFGFKVDPCANE---VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPE  174
            HS GS  +K  RLFGF++ P  NE   +   +E DESVNSS+++S  +      +++ P 
Sbjct  15   HSAGSCVEKKLRLFGFELSPSKNEDSSIKGFAEGDESVNSSNSISYGRE----VHMNKPA  70

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  + EK+S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  71   ------SNEKSSTSEADEKKFECQYCFKEFANSQALGGHQNAH  107



>ref|XP_010318936.1| PREDICTED: uncharacterized protein LOC101257456 [Solanum lycopersicum]
Length=228

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 7/145 (5%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDK--VEKAFAYLSSPEESV-SP  189
            SDKK  R+FGF+V PC+N++           SS     D+  VEK    +SS    + +P
Sbjct  67   SDKK-LRIFGFEVSPCSNDIISSKSESGESISSSETFEDERLVEKTSISMSSSSIVLPNP  125

Query  190  EAKEKNSSVSVV-ELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGFN  366
                +N S SV  + KYECRFCLKKF+ S+ALGGHQNAHRKERLKK+RM++E +R +   
Sbjct  126  NENLRNLSSSVFSKFKYECRFCLKKFANSRALGGHQNAHRKERLKKKRMDLEAKRASSM-  184

Query  367  LYRSSAMRNTGVIIYPHSFIGFDDL  441
            L+  S +RN GV IYP+  +   +L
Sbjct  185  LHFFSLIRNGGV-IYPYYSLSHQNL  208



>ref|XP_008244960.1| PREDICTED: zinc finger protein 5-like [Prunus mume]
Length=265

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 14/103 (14%)
 Frame = +1

Query  7    HSPGS-DKKHFRLFGFKVDPCANE---VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPE  174
            HS GS  +K  RLFGF++ P  NE   +   +E DESVNSS+++S  +      +++ P 
Sbjct  15   HSAGSCVEKKLRLFGFELSPSKNEDSSIKGSAEGDESVNSSNSISYGRE----VHMNKPA  70

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  + EK+S+    + K+EC++C K+F+ SQALGGHQNAH
Sbjct  71   ------SNEKSSTSEADDKKFECQYCFKEFANSQALGGHQNAH  107



>gb|KDP21293.1| hypothetical protein JCGZ_21764 [Jatropha curcas]
Length=252

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 17/96 (18%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANE-VFPR--SETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEA  195
            +K  +LFGF+++PC NE  +P+  +E DESVNSS+TVS +  EK   +  S +E   PE 
Sbjct  26   EKKLKLFGFELNPCRNEESYPKGCAEGDESVNSSNTVSHEG-EKPVMHKDSTKE---PED  81

Query  196  KEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             +K          +EC++C K+F+ SQALGGHQNAH
Sbjct  82   NKK----------FECQYCFKEFANSQALGGHQNAH  107



>emb|CBI32082.3| unnamed protein product [Vitis vinifera]
Length=247

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 24/99 (24%)
 Frame = +1

Query  25   KKHFRLFGFKVDP------CANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVS  186
            +K  RLFGF++DP      C  E   R   DESVNSS+T SS + + +            
Sbjct  26   EKKLRLFGFELDPYKKGESCLKESVER---DESVNSSNTDSSGREKPSI-----------  71

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                EKNS+V   + K+EC++C K+F+ SQALGGHQNAH
Sbjct  72   ----EKNSTVEPEDKKFECQYCFKEFANSQALGGHQNAH  106



>ref|XP_003631292.2| PREDICTED: zinc finger protein 5 isoform X2 [Vitis vinifera]
Length=284

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 24/99 (24%)
 Frame = +1

Query  25   KKHFRLFGFKVDP------CANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVS  186
            +K  RLFGF++DP      C  E   R   DESVNSS+T SS + + +            
Sbjct  63   EKKLRLFGFELDPYKKGESCLKESVER---DESVNSSNTDSSGREKPSI-----------  108

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                EKNS+V   + K+EC++C K+F+ SQALGGHQNAH
Sbjct  109  ----EKNSTVEPEDKKFECQYCFKEFANSQALGGHQNAH  143



>emb|CAN76449.1| hypothetical protein VITISV_029869 [Vitis vinifera]
Length=224

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 26/147 (18%)
 Frame = +1

Query  25   KKHFRLFGFKVDP------CANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVS  186
            +K  RLFGF++DP      C  E   R   DESVNSS+T SS + EK             
Sbjct  26   EKKLRLFGFELDPYKKGESCLKESVER---DESVNSSNTDSSGR-EKP------------  69

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGFN  366
              + EKNS+V   + K+EC++C K+F+ SQALGGHQNAH+KER+KK+R++++ R+ +  N
Sbjct  70   --SXEKNSTVEPEDKKFECQYCFKEFANSQALGGHQNAHKKERMKKKRLQLQARKAS-IN  126

Query  367  LYRSSAMRNTGVIIYPHSFIGFDDLSC  447
             Y    ++N     Y  S + F D SC
Sbjct  127  HYL-QPLQNNHSFTYHGSALWFYDPSC  152



>ref|XP_010652954.1| PREDICTED: zinc finger protein 5 isoform X1 [Vitis vinifera]
Length=296

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 24/99 (24%)
 Frame = +1

Query  25   KKHFRLFGFKVDP------CANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVS  186
            +K  RLFGF++DP      C  E   R   DESVNSS+T SS + + +            
Sbjct  75   EKKLRLFGFELDPYKKGESCLKESVER---DESVNSSNTDSSGREKPSI-----------  120

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                EKNS+V   + K+EC++C K+F+ SQALGGHQNAH
Sbjct  121  ----EKNSTVEPEDKKFECQYCFKEFANSQALGGHQNAH  155



>gb|AIY30133.1| C2H2 zinc finger protein 5 [Gossypium hirsutum]
Length=239

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 56/96 (58%), Gaps = 22/96 (23%)
 Frame = +1

Query  25   KKHFRLFGFKVDPC---ANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEA  195
            +K  RLFGF+++P     + +    E DESVNSS+T+SS                    A
Sbjct  20   EKKLRLFGFELNPSNSNGDSMKVCGEGDESVNSSNTISST-------------------A  60

Query  196  KEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            KEK+S V   + K+EC++C K+F+ SQALGGHQNAH
Sbjct  61   KEKSSMVEADDKKFECQYCFKEFANSQALGGHQNAH  96



>ref|XP_010272057.1| PREDICTED: uncharacterized protein LOC104607957 [Nelumbo nucifera]
Length=261

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 11/139 (8%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            S++K  RLFGF+VDPCAN+            S  +   D+   +   +SS      P  K
Sbjct  35   SEEKKLRLFGFEVDPCAND---------GRCSRGSEEGDESSNSSITVSSQTRREKP-CK  84

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGFNLYRS  378
            EK  +  + + +YEC+FC K+F+ SQALGGHQNAH+KERLKK+R++++ RR +  N Y  
Sbjct  85   EKAPTAELEDKRYECQFCFKEFANSQALGGHQNAHKKERLKKKRLQLQARRAS-VNYYLQ  143

Query  379  SAMRNTGVIIYPHSFIGFD  435
                N   I +P + + +D
Sbjct  144  PMQNNQAFIYHPSASLFYD  162



>ref|XP_009775695.1| PREDICTED: zinc finger protein 5-like isoform X2 [Nicotiana sylvestris]
Length=137

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 16/101 (16%)
 Frame = +1

Query  4    FHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSS-DTVSSDKVEKAFAYLSSPEES  180
            F   G   K  ++FGF++DPC   +       ESVNSS  T+S+ +           E+ 
Sbjct  21   FSKSGMKIKRLKIFGFELDPCQKYMKGELGDRESVNSSCSTISAGR-----------EKQ  69

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             S +AK+ + +    E K+EC +CLK+FS SQALGGHQNAH
Sbjct  70   PSNDAKDDDPT----EKKFECHYCLKEFSNSQALGGHQNAH  106



>ref|XP_010663212.1| PREDICTED: zinc finger protein JAGGED-like [Vitis vinifera]
 emb|CAN68189.1| hypothetical protein VITISV_013677 [Vitis vinifera]
Length=196

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 55/99 (56%), Gaps = 26/99 (26%)
 Frame = +1

Query  16   GSDKKHFRLFGFKVDP-CAN-EVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESV-S  186
            G DKK  RLFGF+VD  C   E+   SE DE+ NS D             LS  E+SV  
Sbjct  33   GEDKK-LRLFGFEVDLYCKGAELQGGSELDETANSPDVA-----------LSKMEKSVEK  80

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            PE K           KYEC+FCLK+F+ SQALGGHQNAH
Sbjct  81   PEHK-----------KYECQFCLKEFANSQALGGHQNAH  108



>ref|XP_006378183.1| Zinc finger protein 5 [Populus trichocarpa]
 gb|ERP55980.1| Zinc finger protein 5 [Populus trichocarpa]
Length=261

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 14/97 (14%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANE---VFPRSETD-ESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
            +K  RLFGF+++PC N    V    E D ESVNSS+TV S + EK     SS      P 
Sbjct  28   EKKLRLFGFELNPCKNNESCVKGCVEGDHESVNSSNTVLSSEREKPVKEKSSSSGHHGP-  86

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            A +K         K+EC++C K+F+ SQALGGHQNAH
Sbjct  87   ADDK---------KFECQYCFKEFANSQALGGHQNAH  114



>ref|XP_009775693.1| PREDICTED: zinc finger protein 5-like isoform X1 [Nicotiana sylvestris]
Length=221

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 16/101 (16%)
 Frame = +1

Query  4    FHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSS-DTVSSDKVEKAFAYLSSPEES  180
            F   G   K  ++FGF++DPC   +       ESVNSS  T+S+ +           E+ 
Sbjct  21   FSKSGMKIKRLKIFGFELDPCQKYMKGELGDRESVNSSCSTISAGR-----------EKQ  69

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             S +AK+ + +    E K+EC +CLK+FS SQALGGHQNAH
Sbjct  70   PSNDAKDDDPT----EKKFECHYCLKEFSNSQALGGHQNAH  106



>ref|XP_003633811.1| PREDICTED: uncharacterized protein LOC100852925 [Vitis vinifera]
Length=289

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 18/95 (19%)
 Frame = +1

Query  28   KHFRLFGFKVDPCANE---VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            K  RLFGF V+PCAN+        E DES++SS+T S  K EK                +
Sbjct  99   KKLRLFGFDVNPCANDGKRSVESEEGDESLSSSNTPSPWK-EKTL--------------Q  143

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             K+S+  + E +Y C++C K+F+ SQALGGHQNAH
Sbjct  144  GKSSTKLLKERRYACQYCRKEFANSQALGGHQNAH  178



>emb|CDP20077.1| unnamed protein product [Coffea canephora]
Length=219

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 56/104 (54%), Gaps = 11/104 (11%)
 Frame = +1

Query  22   DKKHFRLFGFKVDPCANEV-FPRSETDESVNSSDTVSS--DKVEKAFAYLSSPEESVS--  186
            D K  +LFGF++D C      PRSE DESV+SSDTV S  DK       +S     V   
Sbjct  28   DNKRLKLFGFEIDSCQKSTTAPRSERDESVSSSDTVLSKADKNLPGKGCISVDSSKVVHS  87

Query  187  -----PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                 P+A   N   S+   K++C FC KK + SQA GGHQNA+
Sbjct  88   RTDELPKA-AGNPLCSIELQKFKCEFCSKKCTNSQAFGGHQNAY  130



>ref|XP_007044496.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma 
cacao]
 gb|EOY00328.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma 
cacao]
Length=250

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 53/96 (55%), Gaps = 22/96 (23%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCAN---EVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEA  195
            +K  RLFGF+++P  N    +   +E DESVNSS T  +                     
Sbjct  27   EKKLRLFGFELNPSKNNDNSLKSSAEGDESVNSSSTRETP-------------------T  67

Query  196  KEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            KEK+S+    + K+EC++C K+F+ SQALGGHQNAH
Sbjct  68   KEKSSTGETDDKKFECQYCFKEFANSQALGGHQNAH  103



>ref|XP_011007072.1| PREDICTED: zinc finger protein 5-like [Populus euphratica]
Length=261

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 57/97 (59%), Gaps = 14/97 (14%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANE---VFPRSETD-ESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
            +K  RLFGF+++PC N    +    E D ESVNSS+TV S + EK     SS      P 
Sbjct  28   EKKLRLFGFELNPCKNNKSCMKGCVEGDHESVNSSNTVLSSEREKPVKEKSSSSGHHGP-  86

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            A +K         K+EC++C K+F+ SQALGGHQNAH
Sbjct  87   ADDK---------KFECQYCFKEFANSQALGGHQNAH  114



>ref|XP_002311793.2| hypothetical protein POPTR_0008s19780g, partial [Populus trichocarpa]
 gb|EEE89160.2| hypothetical protein POPTR_0008s19780g, partial [Populus trichocarpa]
Length=174

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 19/97 (20%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCA-NEVFPRSETD---ESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
            ++  RLFGF+++P   NE   +  T+   ESVNSS+T SS++ +                
Sbjct  28   ERKLRLFGFELNPYKHNESSMKGSTEGDHESVNSSNTASSERAKPV--------------  73

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             KEK+SS    + K+ C++C K+F+ SQALGGHQNAH
Sbjct  74   -KEKSSSAGPGDKKFGCQYCFKEFANSQALGGHQNAH  109



>ref|XP_004297672.1| PREDICTED: zinc finger protein 5-like [Fragaria vesca subsp. 
vesca]
Length=254

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 22/93 (24%)
 Frame = +1

Query  28   KHFRLFGFKVDPCAN-EVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEK  204
            K  RLFGF+++P  N +   ++E DESVNSS+T  +               S S EA++ 
Sbjct  24   KKLRLFGFELNPYKNVDENIKAEGDESVNSSNTWKA---------------STSSEAEQL  68

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            ++       K+EC++C K+F+ SQALGGHQNAH
Sbjct  69   DNK------KFECQYCFKEFANSQALGGHQNAH  95



>ref|XP_010043824.1| PREDICTED: zinc finger protein 5 [Eucalyptus grandis]
 gb|KCW85821.1| hypothetical protein EUGRSUZ_B02564 [Eucalyptus grandis]
Length=273

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 16/97 (16%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANE----VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
            +K  +LFGF+++P  N+         E DESVNSS+TV      +A    +     V  E
Sbjct  34   EKKLKLFGFELNPPKNDPTCSKLESPEGDESVNSSNTVKEKSSARA---TTDHHHQVDDE  90

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  K         K+EC++C K+F+ SQALGGHQNAH
Sbjct  91   SHNK---------KFECQYCFKEFANSQALGGHQNAH  118



>ref|XP_003613371.1| Zinc finger protein [Medicago truncatula]
Length=223

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 11/93 (12%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEK  204
            +K  RLFGF+++P  N        +E V + ++   D+   +   +SS  + +    +EK
Sbjct  11   EKRLRLFGFELNPTKN-------NNEGV-AKESNEGDESVNSSNSISSGGDKI---VQEK  59

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            NSS    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  60   NSSKDQDERKFECQYCFKEFANSQALGGHQNAH  92



>gb|AFK39899.1| unknown [Medicago truncatula]
Length=223

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 11/93 (12%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEK  204
            +K  RLFGF+++P  N        +E V + ++   D+   +   +SS  + +    +EK
Sbjct  11   EKRLRLFGFELNPTKN-------NNEGV-AKESNEGDESVNSSNSISSGGDKI---VQEK  59

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            NSS    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  60   NSSKDQDERKFECQYCFKEFANSQALGGHQNAH  92



>ref|XP_010066707.1| PREDICTED: zinc finger protein 6-like [Eucalyptus grandis]
Length=246

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = +1

Query  10   SPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSP  189
            SPG+     +LFGF V           E D +V+   TV ++         ++P  S SP
Sbjct  12   SPGAAATRLKLFGFNVS---------DEEDSAVSDPITVGANGGGGGGGGKATP--SGSP  60

Query  190  EAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            E           E KYEC++C ++F+ SQALGGHQNAH
Sbjct  61   EGSVPVGGGG--ERKYECQYCCREFANSQALGGHQNAH  96



>ref|XP_008798066.1| PREDICTED: zinc finger protein 6 [Phoenix dactylifera]
Length=219

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 21/95 (22%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
             ++K  RLFGF +D      + R+  +   N   T S    EK+               K
Sbjct  22   GEEKQLRLFGFVLD-----AYGRANVE--ANQMHTRSIAPREKS--------------DK  60

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            E++    + E +Y CRFCLK+F+ SQALGGHQNAH
Sbjct  61   ERSQGGGLEERRYGCRFCLKEFANSQALGGHQNAH  95



>ref|XP_004504507.1| PREDICTED: zinc finger protein 5-like [Cicer arietinum]
Length=244

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            D  +  S +K  RLFGF+++P  N        +E +        D+   +   +SS  E 
Sbjct  13   DGENGNSVEKRLRLFGFELNPTKN--------NEGLVKESNNEGDESVNSSNSISSGGEK  64

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +    +EK S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  65   I---VEEKTSTRGQDERKFECQYCFKEFANSQALGGHQNAH  102



>ref|XP_010100522.1| Zinc finger protein 5 [Morus notabilis]
 gb|EXB82656.1| Zinc finger protein 5 [Morus notabilis]
Length=287

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 57/115 (50%), Gaps = 31/115 (27%)
 Frame = +1

Query  1    DFHSPGS-DKKHFRLFGFKVDPCANEVFPRSET-------------DESVNSSDTVSSDK  138
            D HS GS  +K  +LFGF+++PC        ET             DESVNSS++V    
Sbjct  18   DGHSSGSCIEKKLKLFGFELNPCKINNNIDHETSSLKGGGSSAELGDESVNSSNSVP---  74

Query  139  VEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
              K     SSP+                 + K+EC++C K+F+ SQALGGHQNAH
Sbjct  75   -PKEITIKSSPDHINH-------------DRKFECQYCFKEFANSQALGGHQNAH  115



>ref|XP_011034193.1| PREDICTED: zinc finger protein 5 [Populus euphratica]
Length=253

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 17/97 (18%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCA-NEVFPRSETD---ESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
            ++  RLFGF+++P   NE   +  T    E VNSS+T SS++           E+ V  E
Sbjct  28   ERKLRLFGFELNPYKHNESSIKGSTGGDHERVNSSNTASSER-----------EKPV--E  74

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             K  ++     + K+ C++C K+F+ SQALGGHQNAH
Sbjct  75   EKSSSACRGAGDKKFGCQYCFKEFANSQALGGHQNAH  111



>ref|XP_006836743.1| hypothetical protein AMTR_s00088p00145510 [Amborella trichopoda]
 gb|ERM99596.1| hypothetical protein AMTR_s00088p00145510 [Amborella trichopoda]
Length=264

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 20/125 (16%)
 Frame = +1

Query  28   KHFRLFGFKVDPCA-------NEVFPRS---ETDESVNSSDTVSSDKVEKAFAYLSSPEE  177
            K  RLFGF+VD          N  F RS   ET ++V   D  SS  + +    L     
Sbjct  32   KKVRLFGFEVDSYVPKEEQDINACFKRSKGIETCQTVEVGDDQSSSNILEQNERLDEAR-  90

Query  178  SVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreN  357
            S S E ++K         KYEC++C ++F+ SQALGGHQNAH+KER K +R++    R N
Sbjct  91   SGSNEREDK---------KYECQYCFREFANSQALGGHQNAHKKERQKNKRLQQLQARRN  141

Query  358  GFNLY  372
              N +
Sbjct  142  TLNCF  146



>ref|XP_006290051.1| hypothetical protein CARUB_v10003685mg [Capsella rubella]
 gb|EOA22949.1| hypothetical protein CARUB_v10003685mg [Capsella rubella]
Length=180

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 7/72 (10%)
 Frame = +1

Query  208  SSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGFNLYRSSAM  387
            S+ S+   KY+C++C K+F  SQALGGHQNAHRKER   ++  +    ++G +LYRSS  
Sbjct  18   STGSLENQKYKCKYCPKRFDKSQALGGHQNAHRKERELTKKRNLGQLNQSGLDLYRSS--  75

Query  388  RNTGVIIYPHSF  423
                   YP+ F
Sbjct  76   -----FSYPYKF  82



>ref|XP_007157512.1| hypothetical protein PHAVU_002G075900g [Phaseolus vulgaris]
 gb|ESW29506.1| hypothetical protein PHAVU_002G075900g [Phaseolus vulgaris]
Length=239

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 14/95 (15%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            S +K  RLFGF+++P        S   +   +S    S   +K                +
Sbjct  19   STEKRLRLFGFELNPSKEGCLKESGEGDESVNSSNSVSSGGDKT--------------VQ  64

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            EK S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  65   EKTSAKDPYEKKFECQYCFKEFANSQALGGHQNAH  99



>ref|XP_008353004.1| PREDICTED: zinc finger protein 5-like [Malus domestica]
Length=263

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETD-ESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKE  201
            +K  RLFGF+++P  NE     ET  +   S+     D+   +   +S P +       E
Sbjct  13   EKKLRLFGFELNPNRNE-----ETSMKGGRSAAEGGGDESVNSSNSVSHPIKLERYRENE  67

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            K+S+    + K+EC++C K+F+ SQALGGHQNAH
Sbjct  68   KSSTSEPDDKKFECQYCFKEFANSQALGGHQNAH  101



>ref|XP_009360452.1| PREDICTED: zinc finger protein 5 [Pyrus x bretschneideri]
Length=263

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETD-ESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKE  201
            +K  RLFGF+++P  NE     ET  +   SS     D+   +   +S P +       E
Sbjct  13   EKKLRLFGFELNPLRNE-----ETSIKGGGSSAEGGGDESVNSSNSVSHPIKLERSRENE  67

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            K+S+    + K+EC++C K+F+ SQALGGHQNAH
Sbjct  68   KSSTSEPDDKKFECQYCFKEFANSQALGGHQNAH  101



>ref|XP_007212443.1| hypothetical protein PRUPE_ppa017203mg, partial [Prunus persica]
 gb|EMJ13642.1| hypothetical protein PRUPE_ppa017203mg, partial [Prunus persica]
Length=125

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 15/96 (16%)
 Frame = +1

Query  28   KHFRLFGFKVDPCANE---VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            K  RLFGF++ P  +E   +    E D+SVNSS++V           L   E  ++  A 
Sbjct  33   KKLRLFGFELSPSKSEDSSIKGSVEGDDSVNSSNSV-----------LYGREVHMNKPAS  81

Query  199  EKNSSVSVVE-LKYECRFCLKKFSTSQALGGHQNAH  303
             K SS S  +  K+EC++  K+F+ S+ALGG QNAH
Sbjct  82   NKKSSTSEADDKKFECQYGFKEFANSKALGGCQNAH  117



>gb|ADL36635.1| C2H2L domain class transcription factor [Malus domestica]
Length=263

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETD-ESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKE  201
            +K  RLFGF+++P  NE     ET  +   SS     D+   +   +S P +       E
Sbjct  13   EKKLRLFGFELNPRRNE-----ETSIKGGGSSAEGGGDESVNSSNSVSHPIKLERSRENE  67

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            K+S+    + K+EC++C K+F+ SQALGGHQNAH
Sbjct  68   KSSTSEPDDKKFECQYCFKEFANSQALGGHQNAH  101



>ref|XP_002520214.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42269.1| conserved hypothetical protein [Ricinus communis]
Length=224

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 13/93 (14%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEK  204
            +K  +LFGF+++P  N        DES   S  V  D  E   +  +   E   P  KEK
Sbjct  26   EKKLKLFGFELNPIRN--------DESCKGS--VEGD--ESVNSSNTVSSEREKP-VKEK  72

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +S     + K+EC++C K+F+ SQALGGHQNAH
Sbjct  73   SSVGEPDDKKFECQYCFKEFANSQALGGHQNAH  105



>ref|XP_007036108.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20609.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
Length=446

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             KEK+ +  + + KYEC+FCLKKF+ SQALGGHQNAH
Sbjct  265  VKEKSVTRKLEKRKYECQFCLKKFTNSQALGGHQNAH  301



>ref|XP_008389587.1| PREDICTED: zinc finger protein 5 [Malus domestica]
Length=263

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEK  204
            +K  RLFGF+++P  NE      + +   SS     D+   +   +S P +       EK
Sbjct  13   EKKLRLFGFELNPRRNE----EASIKGGGSSAEGGGDESVNSSNSVSHPIKLERSRENEK  68

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +S+    + K+EC++C K+F+ SQALGGHQNAH
Sbjct  69   SSTSEPDDKKFECQYCFKEFANSQALGGHQNAH  101



>ref|XP_011087078.1| PREDICTED: zinc finger protein 5 [Sesamum indicum]
Length=243

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 55/101 (54%), Gaps = 27/101 (27%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPC------ANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            S +K  +LFG +++P        ++ FP S+ DES+NSS   SS   EK    L      
Sbjct  14   SPEKKLKLFGVELEPSDILETDRDKGFP-SDRDESINSS--ASSTVTEKPTGEL------  64

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
               E ++K         K+EC++CLK F+ SQALGGHQNAH
Sbjct  65   ---ELEDK---------KFECQYCLKVFANSQALGGHQNAH  93



>gb|KDP31147.1| hypothetical protein JCGZ_11523 [Jatropha curcas]
Length=197

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 63/142 (44%), Gaps = 20/142 (14%)
 Frame = +1

Query  28   KHFRLFGFKVDP---CANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            K  RLFGF V+P       +    E D S  S + VSS+               V   A 
Sbjct  4    KILRLFGFVVNPHIKGEKRLKCLEEGDPSGKSPEKVSSE---------------VKKSAT  48

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGFNLYRS  378
             + S   + + KYEC+FC K+F   QALGGHQNAH ++   KRR          FN Y  
Sbjct  49   GRCSGYELKQEKYECQFCSKEFKNPQALGGHQNAH-RKERLKRRRMQLQETSKSFNFYL-  106

Query  379  SAMRNTGVIIYPHSFIGFDDLS  444
             A  N   ++Y +S   FD  S
Sbjct  107  DAPYNQNNLVYHNSLSCFDAFS  128



>gb|KHN28676.1| Zinc finger protein 6 [Glycine soja]
Length=246

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 21/105 (20%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPR--SETDESVNSSDTV--SSDKVEKAFAYLSS  168
            D  +  S +K  RLFGF+++P + E   +   E DESVNSS++     DK          
Sbjct  13   DCDNGNSTEKRLRLFGFELNPSSKEGCAKESGEGDESVNSSNSASSGGDKT---------  63

Query  169  PEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                     +EK S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  64   --------VQEKTSAKDPDERKFECQYCYKEFANSQALGGHQNAH  100



>ref|XP_010913477.1| PREDICTED: uncharacterized protein LOC105039151 [Elaeis guineensis]
Length=232

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 22/94 (23%)
 Frame = +1

Query  22   DKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKE  201
            ++K FRLFGF +DPC      R + +E  +       +K +                  E
Sbjct  23   EEKPFRLFGFVLDPCK-----RGDVEEKSSMPVLHQGEKPDT-----------------E  60

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             +S   +   +Y C+FC K+F+ SQALGGHQNAH
Sbjct  61   GSSGGGLEARRYGCQFCFKEFANSQALGGHQNAH  94



>ref|XP_006574581.1| PREDICTED: zinc finger protein 5-like [Glycine max]
Length=246

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 21/105 (20%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPR--SETDESVNSSDTV--SSDKVEKAFAYLSS  168
            D  +  S +K  RLFGF+++P + E   +   E DESVNSS++     DK          
Sbjct  13   DCDNGNSTEKRLRLFGFELNPSSKEGCAKESGEGDESVNSSNSASSGGDKT---------  63

Query  169  PEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                     +EK S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  64   --------VQEKTSANDPDERKFECQYCYKEFANSQALGGHQNAH  100



>gb|EMT14411.1| Zinc finger protein 7 [Aegilops tauschii]
Length=179

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 5/85 (6%)
 Frame = +1

Query  49   FKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVE  228
             K  P A E     + DE+  + D  S+  ++     L S E +  PEAK     V+  +
Sbjct  1    MKRGPEAEEQILGKQGDEAGRADDNTSTPWLKLGLDALRS-EAAKPPEAK----PVATPQ  55

Query  229  LKYECRFCLKKFSTSQALGGHQNAH  303
              + C +CL+KF +SQALGGHQNAH
Sbjct  56   RTFSCNYCLRKFFSSQALGGHQNAH  80



>ref|XP_009789685.1| PREDICTED: zinc finger protein 5-like [Nicotiana sylvestris]
Length=257

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = +1

Query  22   DKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKE  201
            + K  +LFGF+++P      P+ + +   +  D  S +    +       +E + P +  
Sbjct  29   ENKRLKLFGFELEPS-----PKIQKNSKEDQGDHESVNSSSASTVSSGRDQEKLLPASNS  83

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            K     +++ K+EC++C K+F+ SQALGGHQNAH
Sbjct  84   KPDHEEIMK-KFECQYCFKQFANSQALGGHQNAH  116



>ref|XP_004513737.1| PREDICTED: zinc finger protein 6-like [Cicer arietinum]
Length=274

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 14/95 (15%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTV--SSDKVEKAFAYLSSPE---ESVSPEAK  198
             +LFGF V         + E D+   ++  +  +SD   K     +SP    ESVS +  
Sbjct  20   LKLFGFSV---------QEENDDESQATQPLQDASDSAVKGSTGNTSPSGSTESVSVDGG  70

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                + S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  71   TSGLNPSSGDRKYECQYCCREFANSQALGGHQNAH  105



>gb|KHN01119.1| Zinc finger protein 6 [Glycine soja]
Length=241

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 48/95 (51%), Gaps = 14/95 (15%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            S +K  RLFGF+++P  +     S   +   +S    S   +K                +
Sbjct  19   STEKRLRLFGFELNPSKDGYAKESGEGDESVNSSNSVSSGGDKT--------------VQ  64

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            EK S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  65   EKPSAKDSDERKFECQYCYKEFANSQALGGHQNAH  99



>ref|NP_001237195.1| uncharacterized protein LOC100527006 [Glycine max]
 gb|ACU16043.1| unknown [Glycine max]
Length=252

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 48/95 (51%), Gaps = 14/95 (15%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            S +K  RLFGF+++P  +     S   +   +S    S   +K                +
Sbjct  19   STEKRLRLFGFELNPSKDGYAKESGEGDESVNSSNSVSSGGDKT--------------VQ  64

Query  199  EKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            EK S+    E K+EC++C K+F+ SQALGGHQNAH
Sbjct  65   EKPSAKDSDERKFECQYCYKEFANSQALGGHQNAH  99



>gb|EPS62851.1| zinc finger family protein, partial [Genlisea aurea]
Length=96

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 44/90 (49%), Gaps = 13/90 (14%)
 Frame = +1

Query  40   LFGFKVD--PCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
            LFGF +D  P A+E    S  DE V        D+ E   +   +P  +  P  +     
Sbjct  3    LFGFMLDGSPTASEA---STPDEPV------VDDQGEATHSEAETP--ARGPPDEVAGDD  51

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            V      + C FC +KF+TSQALGGHQNAH
Sbjct  52   VETAARTFRCGFCTRKFATSQALGGHQNAH  81



>ref|XP_007142933.1| hypothetical protein PHAVU_007G029500g [Phaseolus vulgaris]
 gb|ESW14927.1| hypothetical protein PHAVU_007G029500g [Phaseolus vulgaris]
Length=264

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 9/90 (10%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             +LFGF V    +E     E DE V   D  + D   KA +  +SP  S    A   + +
Sbjct  20   LKLFGFSV----HEDITVEEEDEVVMHDD--AEDTTTKASS--TSPSASRD-SAGAGSGT  70

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  71   PSSGDRKYECQYCCREFANSQALGGHQNAH  100



>gb|KDO82619.1| hypothetical protein CISIN_1g024763mg [Citrus sinensis]
Length=263

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 23/103 (22%)
 Frame = +1

Query  25   KKHFRLFGFKV----------DPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPE  174
            +K  RLFGF++          + C   +   +E DESVNSS+T SS   + + +      
Sbjct  26   EKKLRLFGFELNPCNNNNTNDETC--RLKGSAEGDESVNSSNTASSGSEKPSSS-----R  78

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  SP   E +        K+EC++C K+F+ SQALGGHQNAH
Sbjct  79   DKSSPPTGESDYK------KFECQYCFKEFANSQALGGHQNAH  115



>ref|XP_006483768.1| PREDICTED: zinc finger protein 5-like [Citrus sinensis]
Length=263

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 23/103 (22%)
 Frame = +1

Query  25   KKHFRLFGFKV----------DPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPE  174
            +K  RLFGF++          + C   +   +E DESVNSS+T SS   + + +      
Sbjct  26   EKKLRLFGFELNPCNNNNTNDETC--RLKGSAEGDESVNSSNTASSGSEKPSSS-----R  78

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  SP   E +        K+EC++C K+F+ SQALGGHQNAH
Sbjct  79   DKSSPPTGESDYK------KFECQYCFKEFANSQALGGHQNAH  115



>ref|XP_006438491.1| hypothetical protein CICLE_v10032466mg [Citrus clementina]
 gb|ESR51731.1| hypothetical protein CICLE_v10032466mg [Citrus clementina]
Length=263

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 23/103 (22%)
 Frame = +1

Query  25   KKHFRLFGFKV----------DPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPE  174
            +K  RLFGF++          + C   +   +E DESVNSS+T SS   + + +      
Sbjct  26   EKKLRLFGFELNPCNNNNTNDETC--RLKGSAEGDESVNSSNTASSGSEKPSSS-----R  78

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  SP   E +        K+EC++C K+F+ SQALGGHQNAH
Sbjct  79   DKSSPPTGESDYK------KFECQYCFKEFANSQALGGHQNAH  115



>emb|CDP00218.1| unnamed protein product [Coffea canephora]
Length=260

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 18/100 (18%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANE-------VFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESV  183
            +K  +LFGF++DPC N        +F   E+  S +S+ +   D++       + P+E  
Sbjct  28   EKKLKLFGFELDPCQNGDHNDLKGLFENDESVNSSSSTVSSGRDQILDQ----NLPKEKT  83

Query  184  SPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             P     +        K+ C++CLK F+ SQALGGHQNAH
Sbjct  84   PPREPADDK-------KFVCQYCLKCFANSQALGGHQNAH  116



>ref|NP_001183924.1| hypothetical protein [Zea mays]
 ref|XP_008668584.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR38771.1| unknown [Zea mays]
 tpg|DAA40176.1| TPA: hypothetical protein ZEAMMB73_681585 [Zea mays]
Length=298

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 40/90 (44%), Gaps = 16/90 (18%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFGFKV P           D +  SS T +SD         S+     +  +      
Sbjct  43   IRLFGFKVPP-----------DAAATSSSTGTSDATAA-----SATVAGQAAVSGAGAGD  86

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  K+EC +C + F TSQALGGHQNAH
Sbjct  87   GGGGGRKFECHYCRRNFPTSQALGGHQNAH  116



>gb|ACU15330.1| unknown [Glycine max]
 gb|KHN27057.1| Zinc finger protein 7 [Glycine soja]
Length=210

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 7/111 (6%)
 Frame = +1

Query  109  NSSDTVSSDKVEKAFAYLS-SPEESVSPEAKEKNSSVSVVELK----YECRFCLKKFSTS  273
            N ++ V++ + E    +LS   +  ++  A+E+NSS   +       + C FC++KF +S
Sbjct  32   NITEIVTTPEGENLGEWLSLGLKGDINMPAEEQNSSSRPLHSNNNKVFSCNFCMRKFYSS  91

Query  274  QALGGHQNAHrkerlkkrrmevevrreNGFNLYRSSAMRNTGVIIYPHSFI  426
            QALGGHQNAH++ER   R          GF+   S A R+ G  I PHS +
Sbjct  92   QALGGHQNAHKREREAARSYHQSHHHRIGFSYTTSLATRSLG--IKPHSLV  140



>gb|KGN51841.1| hypothetical protein Csa_5G603380 [Cucumis sativus]
Length=257

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 14/104 (13%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCAN--EVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAK  198
            +K  +LFG +++P  N    F      ESVNSS T ++      F   SS  +    E  
Sbjct  27   EKKVKLFGIELNPSNNFCNNFHDQGDHESVNSSTTTAT---TVCFDQRSSTNQQEQEEDD  83

Query  199  EKNSSVSVV---------ELKYECRFCLKKFSTSQALGGHQNAH  303
            ++ ++  VV           K+EC++CLK+F+ SQALGGHQNAH
Sbjct  84   QEEAADIVVISNNNNNKKATKFECQYCLKEFTNSQALGGHQNAH  127



>ref|XP_003561884.1| PREDICTED: zinc finger protein 8-like [Brachypodium distachyon]
Length=284

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 4/50 (8%)
 Frame = +1

Query  166  SPEESVSPEAKEKNSSVSVVE----LKYECRFCLKKFSTSQALGGHQNAH  303
            SP   ++P A  ++SS ++       K+EC +C + F TSQALGGHQNAH
Sbjct  64   SPGAGITPAAATQSSSTTIAAPDSNRKFECHYCCRHFPTSQALGGHQNAH  113



>ref|XP_008668586.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=295

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 40/90 (44%), Gaps = 16/90 (18%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFGFKV P           D +  SS T +SD         S+     +  +      
Sbjct  43   IRLFGFKVPP-----------DAAATSSSTGTSDATA-----ASATVAGQAAVSGAGAGD  86

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  K+EC +C + F TSQALGGHQNAH
Sbjct  87   GGGGGRKFECHYCRRNFPTSQALGGHQNAH  116



>ref|NP_001237732.1| Cys2-His2 zinc finger protein [Glycine max]
 emb|CAK24965.1| Cys2-His2 zinc finger protein [Glycine max]
Length=210

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 7/111 (6%)
 Frame = +1

Query  109  NSSDTVSSDKVEKAFAYLS-SPEESVSPEAKEKNSSVSVVELK----YECRFCLKKFSTS  273
            N ++ V++ + E    +LS   +  ++  A+E+NSS   +       + C FC++KF +S
Sbjct  32   NITEIVTTPEGENLGEWLSLGLKGDINMPAEEQNSSSRPLHSNNNKVFSCNFCMRKFYSS  91

Query  274  QALGGHQNAHrkerlkkrrmevevrreNGFNLYRSSAMRNTGVIIYPHSFI  426
            QALGGHQNAH++ER   R          GF+   S A R+ G  I PHS +
Sbjct  92   QALGGHQNAHKREREAARSYHQSHHHRIGFSYTTSLATRSLG--IKPHSLV  140



>gb|KFK35033.1| hypothetical protein AALP_AA5G225200 [Arabis alpina]
Length=253

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             KE NS+ ++   ++EC +C + F TSQALGGHQNAH
Sbjct  77   TKEDNSNNNITNRRFECHYCFRNFPTSQALGGHQNAH  113



>ref|XP_009122902.1| PREDICTED: zinc finger protein 8-like [Brassica rapa]
Length=169

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +N S  + +LKY+C++C K+FS  QALGGHQNAH
Sbjct  24   ENDSELIEKLKYKCKYCHKRFSKRQALGGHQNAH  57



>ref|XP_010470783.1| PREDICTED: zinc finger protein 6-like isoform X1 [Camelina sativa]
Length=249

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 48/101 (48%), Gaps = 6/101 (6%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DF S  +     +LFGF V+    E F    +D+SV ++ +  S +  +  A  S     
Sbjct  5    DFSSKTTTTSRLKLFGFSVE--GEEDF----SDQSVKTNQSSVSPERGEFPAGSSGRSGG  58

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                           E KYEC++C ++F  SQALGGHQNAH
Sbjct  59   GVRSRGGGGGGGGGGERKYECQYCCREFGNSQALGGHQNAH  99



>gb|AFK47742.1| unknown [Lotus japonicus]
Length=219

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 20/93 (22%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEK  204
            +K  RLFGF+++P +  V    E DESVNSS +VSS             E++V    +EK
Sbjct  21   EKRLRLFGFELNP-SKIVRESGEGDESVNSSTSVSS-----------GGEKTV----QEK  64

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            N      E K+EC+FC K+F+ SQALGGHQNAH
Sbjct  65   NPD----ERKFECQFCFKEFANSQALGGHQNAH  93



>ref|XP_010415456.1| PREDICTED: zinc finger protein 6-like [Camelina sativa]
Length=249

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 48/101 (48%), Gaps = 6/101 (6%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DF S  +     +LFGF V+    E F    +D+SV ++ +  S +  +  A  S     
Sbjct  5    DFSSKTTTTSRLKLFGFSVE--GEEDF----SDQSVKTNQSSVSPERGEFPAGSSGRSGG  58

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                           E KYEC++C ++F  SQALGGHQNAH
Sbjct  59   GVRSRGGGGGGGGGGERKYECQYCCREFGNSQALGGHQNAH  99



>ref|XP_008668585.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=297

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 40/90 (44%), Gaps = 16/90 (18%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFGFKV P           D +  SS T +SD         S+     +  +      
Sbjct  43   IRLFGFKVPP-----------DAAATSSSTGTSDATA-----ASATVAGQAAVSGAGAGD  86

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  K+EC +C + F TSQALGGHQNAH
Sbjct  87   GGGGGRKFECHYCRRNFPTSQALGGHQNAH  116



>ref|XP_010312072.1| PREDICTED: zinc finger protein 8-like [Solanum lycopersicum]
Length=205

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +1

Query  178  SVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S+S    +K   V  +  KYEC +C + F TSQALGGHQNAH
Sbjct  60   SISANRIDKTGHVDEISRKYECYYCFRSFPTSQALGGHQNAH  101



>ref|XP_004986901.1| PREDICTED: uncharacterized protein LOC101764888 [Setaria italica]
Length=268

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 42/90 (47%), Gaps = 14/90 (16%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFGF V P         +   +V+ SD V     + +    +     ++P     +  
Sbjct  47   VRLFGFDVPP---------DAAATVSPSDDVKESSAKDSTTTTAEATAPMAPPGPGASGG  97

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  ++ECR+C + F TSQALGGHQNAH
Sbjct  98   -----RRFECRYCCRNFRTSQALGGHQNAH  122



>ref|XP_010682396.1| PREDICTED: zinc finger protein 5 [Beta vulgaris subsp. vulgaris]
Length=226

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 13/90 (14%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFGF++D      +  +E +ES NSS+TVSS   EK+        +  +      N+ 
Sbjct  5    LRLFGFELD-----TYKNNEGEESTNSSNTVSSGNKEKS--------DDNNRRCSSVNNI  51

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            + + + K+EC++C K+F+ SQALGGHQNAH
Sbjct  52   IEIEQKKFECQYCYKEFANSQALGGHQNAH  81



>ref|XP_010551250.1| PREDICTED: zinc finger protein 6-like [Tarenaya hassleriana]
Length=296

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 49/101 (49%), Gaps = 22/101 (22%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DF S  +  +  +LFGF VD   ++ F  + TD +              AF     P  S
Sbjct  49   DFRSKTATSR-LKLFGFSVDGDIDDDFSATSTDPT--------------AF----PPASS  89

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                A E+       + KYEC++C ++F+ SQALGGHQNAH
Sbjct  90   AVSVAGERGGGG---DRKYECQYCCREFANSQALGGHQNAH  127



>ref|XP_002888657.1| hypothetical protein ARALYDRAFT_894600 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64916.1| hypothetical protein ARALYDRAFT_894600 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 11/91 (12%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDT-VSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
             +LFGF VD    E F    +D+SV +S + VS ++ E    + +          + +  
Sbjct  15   LKLFGFSVD--GEEDF----SDQSVKTSQSSVSPERGE----FPAGSSGRSGGGVRSRGG  64

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                 E KYEC++C ++F  SQALGGHQNAH
Sbjct  65   GGGGGERKYECQYCCREFGNSQALGGHQNAH  95



>ref|XP_003562779.1| PREDICTED: zinc finger protein 7-like [Brachypodium distachyon]
Length=179

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 5/81 (6%)
 Frame = +1

Query  61   PCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYE  240
            P A E    ++ DE+ ++ D  S+  +      L S EES   EAK    +V+  +  + 
Sbjct  5    PEAEEQKLANQVDEAGHAEDNTSTLWLRLGLDALRS-EESKPREAK----TVATPQRTFS  59

Query  241  CRFCLKKFSTSQALGGHQNAH  303
            C +C++KF +SQALGGHQNAH
Sbjct  60   CNYCMRKFFSSQALGGHQNAH  80



>gb|EPS67309.1| hypothetical protein M569_07467, partial [Genlisea aurea]
Length=68

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +1

Query  196  KEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +E+N S      KYECR+C ++F+ SQALGGHQNAH
Sbjct  13   QERNQSALHFR-KYECRYCFREFANSQALGGHQNAH  47



>ref|XP_009393846.1| PREDICTED: zinc finger protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=191

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  235  YECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNGFNLYRSSAMRNTGVIIYP  414
            + C FC++KF +SQALGGHQNAH++ER   RR     +   GF+LY SS      + ++ 
Sbjct  66   FSCNFCMRKFFSSQALGGHQNAHKRERGASRRPHQSQKMMMGFSLYASSLQ---SLTVHS  122

Query  415  HSFI  426
            HS +
Sbjct  123  HSLV  126



>ref|XP_009357012.1| PREDICTED: zinc finger protein 6-like [Pyrus x bretschneideri]
Length=234

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +1

Query  124  VSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVV-ELKYECRFCLKKFSTSQALGGHQNA  300
            V  D VE + A L S + + +P    +++  S   + KYEC++C ++F+ SQALGGHQNA
Sbjct  28   VQEDDVESS-AVLDSTKTATTPSGSPESAPFSTSGDRKYECQYCCREFANSQALGGHQNA  86

Query  301  H  303
            H
Sbjct  87   H  87



>gb|KFK41250.1| hypothetical protein AALP_AA2G104900 [Arabis alpina]
Length=236

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 50/112 (45%), Gaps = 35/112 (31%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DF S  S  +  +LFGF VD         SE D S  S  T  S               S
Sbjct  5    DFRSKTSTSR-LKLFGFNVD--------GSEEDFSEQSVKTNQS---------------S  40

Query  181  VSPEAKE-----------KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            VSPE+KE              +    E KYEC++C ++F  SQALGGHQNAH
Sbjct  41   VSPESKEFPAGSSGRSGGGARNRGGGERKYECQYCCREFGNSQALGGHQNAH  92



>ref|XP_011007643.1| PREDICTED: zinc finger protein 6 [Populus euphratica]
Length=317

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 18/96 (19%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES-VSPEA  195
            S     +LFGF V          SE +E + ++D++ S          +SP++S  +   
Sbjct  82   STSTRLKLFGFNV----------SEDEEQITTTDSLKSSSC-------NSPDDSSFATAT  124

Query  196  KEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                ++ S    KYEC++C ++F+ SQALGGHQNAH
Sbjct  125  TTVPATASGDSRKYECQYCCREFANSQALGGHQNAH  160



>gb|EPS70937.1| hypothetical protein M569_03822, partial [Genlisea aurea]
Length=125

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  205  NSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +SS +V   KYEC++C + F+ SQALGGHQNAH
Sbjct  15   SSSTAVDGRKYECQYCFRGFANSQALGGHQNAH  47



>ref|XP_002314851.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF01022.1| zinc finger family protein [Populus trichocarpa]
Length=247

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 18/96 (19%)
 Frame = +1

Query  19   SDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES-VSPEA  195
            S     +LFGF V          SE +E + ++D++ S          +SP++S  +   
Sbjct  12   STSTRLKLFGFNV----------SEDEEQITTTDSLKSSSC-------NSPDDSSFATAT  54

Query  196  KEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                ++ S    KYEC++C ++F+ SQALGGHQNAH
Sbjct  55   TTVPATASGDSRKYECQYCCREFANSQALGGHQNAH  90



>emb|CDX98817.1| BnaC09g50180D [Brassica napus]
Length=169

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +N S  + +LKY+C++C K FS  QALGGHQNAH
Sbjct  24   ENDSELIEKLKYKCKYCHKTFSKRQALGGHQNAH  57



>ref|XP_010921946.1| PREDICTED: zinc finger protein 6-like [Elaeis guineensis]
Length=245

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 46/92 (50%), Gaps = 28/92 (30%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVS--PEAKEKN  207
             +LFGF+V          SE DE+                 + SSPE + +  P +    
Sbjct  18   LKLFGFQV----------SEDDEAD----------------HQSSPEAAATSDPSSTITA  51

Query  208  SSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            ++ S    KYEC++C ++F+ SQALGGHQNAH
Sbjct  52   ATASGDGRKYECQYCCREFANSQALGGHQNAH  83



>ref|XP_003576583.1| PREDICTED: zinc finger protein 8-like [Brachypodium distachyon]
Length=311

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 42/90 (47%), Gaps = 19/90 (21%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFGF         FP      + +SS T + D    A A    P ++ S        +
Sbjct  54   IRLFGFD--------FPPDVGGTAASSSVTTNGD----AAANHGDPGQAAS-------GT  94

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             S    K+EC +C + F TSQALGGHQNAH
Sbjct  95   ASGAGRKFECHYCCRNFPTSQALGGHQNAH  124



>ref|XP_010046588.1| PREDICTED: zinc finger protein 6-like [Eucalyptus grandis]
 gb|KCW86311.1| hypothetical protein EUGRSUZ_B03001 [Eucalyptus grandis]
Length=219

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  172  EESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            + S SP  +    S S V+ K+EC++C ++F+ SQALGGHQNAH
Sbjct  43   KTSPSPSDESAGVSSSSVDRKFECQYCCREFANSQALGGHQNAH  86



>gb|EPS70964.1| hypothetical protein M569_03795, partial [Genlisea aurea]
Length=94

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = +1

Query  178  SVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S+ P   +        + ++ECRFC K F TSQALGGHQNAH
Sbjct  39   SIRPNDDDDTYVRLARKKRFECRFCCKNFPTSQALGGHQNAH  80



>ref|XP_001758910.1| predicted protein [Physcomitrella patens]
 gb|EDQ76416.1| predicted protein [Physcomitrella patens]
Length=74

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  232  KYECRFCLKKFSTSQALGGHQNAH  303
            KYEC+FC ++F++SQALGGHQNAH
Sbjct  20   KYECQFCGREFASSQALGGHQNAH  43



>ref|XP_004236684.1| PREDICTED: zinc finger protein 4-like [Solanum lycopersicum]
 ref|XP_010319231.1| PREDICTED: zinc finger protein 4-like [Solanum lycopersicum]
Length=234

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  148  AFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             F+  S+ +ES +  A  + S  +VV   + C FC +KF +SQALGGHQNAH
Sbjct  49   GFSVSSTCDESSNELAASQTSGEAVVRRVFTCNFCKRKFYSSQALGGHQNAH  100



>ref|XP_006389433.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP48347.1| zinc finger family protein [Populus trichocarpa]
Length=303

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 5/80 (6%)
 Frame = +1

Query  79   FPRSET----DESVNSSDTVSSDKVE-KAFAYLSSPEESVSPEAKEKNSSVSVVELKYEC  243
            FP+S      D   +S D++   K+E   F+ ++    S + E+ ++ S  S     + C
Sbjct  60   FPKSSACGLLDLKPHSDDSIRGSKLEFNLFSPINVGYSSHAKESMDEASKQSTEPRVFSC  119

Query  244  RFCLKKFSTSQALGGHQNAH  303
             FC +KFSTSQALGGHQNAH
Sbjct  120  SFCRRKFSTSQALGGHQNAH  139



>ref|XP_003525841.1| PREDICTED: zinc finger protein 7-like [Glycine max]
 gb|KHN21423.1| Zinc finger protein 7 [Glycine soja]
Length=199

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +1

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAHrkerlkkrrmevevrreNG  360
            V   A++  SS  +   ++ C FC++KF +SQALGGHQNAH++ER   R          G
Sbjct  51   VEAAAEQNLSSRPLHNKEFSCNFCMRKFYSSQALGGHQNAHKREREAARSYHQSHHHRMG  110

Query  361  FNLYRSSAMRNTGVIIYPHSFI  426
               Y S A R+ G  I PHS +
Sbjct  111  L-AYTSLASRSLG--IQPHSLV  129



>ref|XP_010532310.1| PREDICTED: zinc finger protein 6-like [Tarenaya hassleriana]
Length=247

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 45/90 (50%), Gaps = 6/90 (7%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             +LFGF V+   ++    SET E+ +   T     V         P  S     +E   S
Sbjct  15   LKLFGFSVEGDIDDDL--SETTEASSLVKTHHRSSVASPEPCGFPPSSSAVTGGREGGES  72

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                + KYEC++C ++F+ SQALGGHQNAH
Sbjct  73   ----DRKYECQYCCREFANSQALGGHQNAH  98



>ref|XP_006346762.1| PREDICTED: zinc finger protein 4-like [Solanum tuberosum]
Length=236

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  148  AFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             F+  S+ +ES +  A  + S  +VV   + C FC +KF +SQALGGHQNAH
Sbjct  51   GFSVSSTCDESSNELAASQTSGEAVVRRVFTCNFCKRKFYSSQALGGHQNAH  102



>ref|XP_009783842.1| PREDICTED: zinc finger protein 6 [Nicotiana sylvestris]
Length=224

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (48%), Gaps = 28/90 (31%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             +LFGF V           + D+ V+S+   SS           SPE    P +  +   
Sbjct  20   LKLFGFNVT---------DDQDQEVDSTTKTSS----------GSPESGGFPASDGR---  57

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  KYEC++C ++F+ SQALGGHQNAH
Sbjct  58   ------KYECQYCCREFANSQALGGHQNAH  81



>emb|CAN72502.1| hypothetical protein VITISV_027276 [Vitis vinifera]
Length=221

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 41/91 (45%), Gaps = 31/91 (34%)
 Frame = +1

Query  31   HFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
              ++FGF V             DE V SS T S            SPE    P   ++  
Sbjct  18   RLKIFGFNVS-----------EDEDVESSKTPSG-----------SPESGGFPATGDR--  53

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                   KYEC++C ++F+ SQALGGHQNAH
Sbjct  54   -------KYECQYCCREFANSQALGGHQNAH  77



>ref|XP_008446260.1| PREDICTED: zinc finger protein 5 [Cucumis melo]
Length=257

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEV--FPRSETDESVNSSDT----VSSDKVEKAFAYLSSPEESVS  186
            +K  +LFG +++P  N    F      ESVNSS T    V  D+   +       ++   
Sbjct  26   EKKVKLFGIELNPSNNSCNKFHDQGDHESVNSSTTTTTTVCFDQRSSSNQQEQEEDDQEE  85

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                   ++ +    K+EC++CLK+F+ SQALGGHQNAH
Sbjct  86   AANIVIINNNNRKATKFECQYCLKEFTNSQALGGHQNAH  124



>ref|XP_009391446.1| PREDICTED: zinc finger protein 8-like [Musa acuminata subsp. 
malaccensis]
Length=263

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +1

Query  163  SSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S+ E S +P A   +S  S    K+EC +C +KF TSQALGGHQNAH
Sbjct  64   STTETSNTPSAANADSGESA--RKFECHYCCRKFPTSQALGGHQNAH  108



>gb|EAY87723.1| hypothetical protein OsI_09139 [Oryza sativa Indica Group]
Length=279

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 43/90 (48%), Gaps = 13/90 (14%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             RLFG +    +N++  R  T+    S D  +   V           E  +   K   ++
Sbjct  33   IRLFGCEF---SNDLQLRP-TEAGAGSPDAANGSTVTS---------EGSNGGTKNGGAA  79

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             +  E K+EC +C + F TSQALGGHQNAH
Sbjct  80   TAAAERKFECHYCCRNFPTSQALGGHQNAH  109



>ref|XP_006855327.1| hypothetical protein AMTR_s00057p00086480 [Amborella trichopoda]
 gb|ERN16794.1| hypothetical protein AMTR_s00057p00086480 [Amborella trichopoda]
Length=227

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 25/92 (27%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDE--SVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKN  207
             +LFGF+V          +E+DE  S N    V  ++       +S  E +VS   +E N
Sbjct  35   LKLFGFQV----------TESDEESSANFRQAVPVNETA-----VSVREMAVS--VREDN  77

Query  208  SSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S       KYEC+FC ++F+ SQALGGHQNAH
Sbjct  78   SR------KYECQFCCREFANSQALGGHQNAH  103



>ref|XP_010415245.1| PREDICTED: zinc finger protein 6-like [Camelina sativa]
Length=198

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +1

Query  112  SSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGH  291
            +++T SS K+        + E++ SP+ + +  S S    KYEC++C ++F+ SQALGGH
Sbjct  2    ATETTSSLKLFGINLLEPTSEQNRSPQPRPEPGSGSESR-KYECQYCCREFANSQALGGH  60

Query  292  QNAH  303
            QNAH
Sbjct  61   QNAH  64



>ref|XP_008339649.1| PREDICTED: zinc finger protein 6 [Malus domestica]
Length=234

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +1

Query  124  VSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVV-ELKYECRFCLKKFSTSQALGGHQNA  300
            V  D VE + A L S + + +P    +++  S   + KYEC++C ++F+ SQALGGHQNA
Sbjct  28   VQEDDVESS-AVLDSTKTATTPSDSPESAPFSTSGDRKYECQYCCREFANSQALGGHQNA  86

Query  301  H  303
            H
Sbjct  87   H  87



>ref|XP_002515318.1| hypothetical protein RCOM_1348010 [Ricinus communis]
 gb|EEF47302.1| hypothetical protein RCOM_1348010 [Ricinus communis]
Length=196

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +1

Query  172  EESVSPEAKEKNSSVSVVEL-KYECRFCLKKFSTSQALGGHQNAH  303
            E+ V+   +  +S+ S VE+ K+EC FC + F+ SQALGGHQNAH
Sbjct  31   EQDVAKSGETTSSNCSSVEIRKFECHFCGRAFANSQALGGHQNAH  75



>ref|XP_009611707.1| PREDICTED: zinc finger protein 5 [Nicotiana tomentosiformis]
Length=243

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +1

Query  22   DKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESV-----S  186
            + K  +LFGF++DP      P+ +     +  D  S +    +       +E +      
Sbjct  29   ENKRLKLFGFELDPS-----PKIQKKSKEDQGDHESVNSSSASTVSSGRDQEKLIASNGK  83

Query  187  PEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            P+ +E       +  K+EC++C K+F+ SQALGGHQNAH
Sbjct  84   PDHEE-------IMKKFECQYCFKQFANSQALGGHQNAH  115



>ref|XP_010511613.1| PREDICTED: zinc finger protein 6-like [Camelina sativa]
Length=198

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +1

Query  112  SSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGH  291
            +++T SS K+        + E++ SP+ + +  S S    KYEC++C ++F+ SQALGGH
Sbjct  2    ATETTSSLKLFGINLLEPTSEQNRSPQPRPEPGSGSESR-KYECQYCCREFANSQALGGH  60

Query  292  QNAH  303
            QNAH
Sbjct  61   QNAH  64



>ref|XP_006849571.1| hypothetical protein AMTR_s00024p00186840 [Amborella trichopoda]
 gb|ERN11152.1| hypothetical protein AMTR_s00024p00186840 [Amborella trichopoda]
Length=262

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 48/101 (48%), Gaps = 27/101 (27%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            D  +P  + +  +LFG + +             +S NS +  S + VE+           
Sbjct  45   DPKAPTLETRPIKLFGIEFN------------QKSQNSGENSSQNSVEEE----------  82

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
               E KE+N+  +    K+EC +C + F TSQALGGHQNAH
Sbjct  83   ---ETKEQNTPTT--GRKFECHYCFRNFPTSQALGGHQNAH  118



>ref|NP_177003.1| zinc finger-related protein [Arabidopsis thaliana]
 gb|AAG52593.1|AC016447_2 putative zinc finger protein; 21453-22187 [Arabidopsis thaliana]
 gb|ABK59680.1| At1g68360 [Arabidopsis thaliana]
 dbj|BAH30364.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34785.1| zinc finger-related protein [Arabidopsis thaliana]
Length=244

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (53%), Gaps = 11/91 (12%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSS-DTVSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
             +LFGF VD    E F    +D+SV ++  +VS ++ E    + +          + +  
Sbjct  15   LKLFGFSVD--GEEDF----SDQSVKTNLSSVSPERGE----FPAGSSGRSGGGVRSRGG  64

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                 E KYEC++C ++F  SQALGGHQNAH
Sbjct  65   GGGGGERKYECQYCCREFGNSQALGGHQNAH  95



>ref|XP_004158538.1| PREDICTED: zinc finger protein 6-like [Cucumis sativus]
Length=153

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  232  KYECRFCLKKFSTSQALGGHQNAH  303
            K+ECR+C ++FS SQALGGHQNAH
Sbjct  42   KFECRYCCRQFSNSQALGGHQNAH  65



>ref|XP_003532346.1| PREDICTED: zinc finger protein 6 [Glycine max]
Length=172

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +1

Query  166  SPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            SPE+    E    NS   +   KYEC++C ++F+ SQALGGHQNAH
Sbjct  27   SPEDQTH-ELASSNSETFMNSRKYECQYCCREFANSQALGGHQNAH  71



>ref|XP_011070208.1| PREDICTED: zinc finger protein 3-like [Sesamum indicum]
Length=252

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 6/53 (11%)
 Frame = +1

Query  163  SSPEESVSPE----AKEKNSSVSVV--ELKYECRFCLKKFSTSQALGGHQNAH  303
            ++P  +V PE    A ++N +V+    E +Y C++C KKFS  QALGGHQNAH
Sbjct  27   TAPSAAVLPEEPQQAVQENRAVNAADQEREYGCKYCHKKFSNKQALGGHQNAH  79



>gb|KHN24923.1| Zinc finger protein 6 [Glycine soja]
Length=172

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +1

Query  166  SPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            SPE+    E    NS   +   KYEC++C ++F+ SQALGGHQNAH
Sbjct  27   SPEDQTH-ELASSNSETFMNSRKYECQYCCREFANSQALGGHQNAH  71



>ref|XP_002283623.2| PREDICTED: zinc finger protein 6 [Vitis vinifera]
 emb|CBI26997.3| unnamed protein product [Vitis vinifera]
Length=260

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 41/90 (46%), Gaps = 31/90 (34%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             ++FGF V             DE V SS T S            SPE    P   ++   
Sbjct  58   LKIFGFNVS-----------EDEDVESSKTPSG-----------SPESGGFPATGDR---  92

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                  KYEC++C ++F+ SQALGGHQNAH
Sbjct  93   ------KYECQYCCREFANSQALGGHQNAH  116



>gb|KDO70862.1| hypothetical protein CISIN_1g022595mg [Citrus sinensis]
Length=294

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 45/98 (46%), Gaps = 14/98 (14%)
 Frame = +1

Query  10   SPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSP  189
            +P  +K   RLFG +              + S  +++ VS              E S + 
Sbjct  33   TPVKEKSAIRLFGIEFGGTGATAGEECSAESSAETTNVVSE-------------ESSAAI  79

Query  190  EAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  E N++V     ++EC +C + F TSQALGGHQNAH
Sbjct  80   KENETNNNVDT-NRRFECHYCCRNFPTSQALGGHQNAH  116



>ref|XP_003614563.1| Zinc finger protein [Medicago truncatula]
Length=264

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (49%), Gaps = 9/90 (10%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             +LFGF V         + E ++S          +        S   ESVS +    + +
Sbjct  22   LKLFGFSV---------QEENEDSSPPPPRQPPLEDGTGNTSPSGSTESVSGDGGASSIN  72

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
             +  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  73   PTSGDRKYECQYCCREFANSQALGGHQNAH  102



>ref|XP_006492912.1| PREDICTED: uncharacterized protein LOC102617549 [Citrus sinensis]
Length=295

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 45/98 (46%), Gaps = 14/98 (14%)
 Frame = +1

Query  10   SPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSP  189
            +P  +K   RLFG +              + S  +++ VS              E S + 
Sbjct  33   TPVKEKSAIRLFGIEFGGTGATAGEECSAESSAETTNVVSE-------------ESSAAI  79

Query  190  EAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  E N++V     ++EC +C + F TSQALGGHQNAH
Sbjct  80   KENETNNNVDT-NRRFECHYCCRNFPTSQALGGHQNAH  116



>ref|XP_010511826.1| PREDICTED: zinc finger protein 6-like [Camelina sativa]
 ref|XP_010470785.1| PREDICTED: zinc finger protein 6-like isoform X3 [Camelina sativa]
Length=247

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 48/101 (48%), Gaps = 8/101 (8%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DF S  +     +LFGF V+    E F    +D+SV ++   SS   E+      S   S
Sbjct  5    DFSSKTTTTSRLKLFGFSVE--GEEDF----SDQSVKTNQ--SSVSPERGEFPAGSSGRS  56

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                           E KYEC++C ++F  SQALGGHQNAH
Sbjct  57   GGGVRSRGGGGGGGGERKYECQYCCREFGNSQALGGHQNAH  97



>ref|XP_008678504.1| PREDICTED: zinc finger protein GIS-like [Zea mays]
 gb|AFW61954.1| hypothetical protein ZEAMMB73_161546 [Zea mays]
Length=282

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  136  KVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            + EK  A ++ PE+  SP      +        ++C +CL+KF TSQALGGHQNAH
Sbjct  65   RKEKEKAMVAEPEDDKSPATAPGGAEKKRT---FKCNYCLRKFYTSQALGGHQNAH  117



>gb|ACU15388.1| unknown [Glycine max]
Length=176

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +1

Query  166  SPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            SPE+    E    NS   +   KYEC++C ++F+ SQALGGHQNAH
Sbjct  27   SPEDQTH-ELASSNSETFMNSRKYECQYCCREFANSQALGGHQNAH  71



>ref|XP_011076533.1| PREDICTED: zinc finger protein 6 [Sesamum indicum]
Length=231

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 42/91 (46%), Gaps = 28/91 (31%)
 Frame = +1

Query  31   HFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
              +LFGF +          +E  E V SS    S+          SPE    P A  +  
Sbjct  22   RLKLFGFNMS---------TEDQEEVESSTKTPSE----------SPERCGFPPADGR--  60

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                   KYEC++C ++F+ SQALGGHQNAH
Sbjct  61   -------KYECQYCCREFANSQALGGHQNAH  84



>emb|CDY35394.1| BnaA03g19660D [Brassica napus]
Length=248

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 8/51 (16%)
 Frame = +1

Query  175  ESVSPEAKEKNSSVSVVE--------LKYECRFCLKKFSTSQALGGHQNAH  303
            E+++   K++ SS +V E         ++EC +C +KF TSQALGGHQNAH
Sbjct  63   ETITTRIKDEGSSENVKEKEKDKSKNRRFECHYCFRKFPTSQALGGHQNAH  113



>ref|XP_009356243.1| PREDICTED: zinc finger protein 6-like [Pyrus x bretschneideri]
Length=234

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  124  VSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVV-ELKYECRFCLKKFSTSQALGGHQNA  300
            V  D VE   A L S + + +P    +++  S   + KYEC++C ++F+ SQALGGHQNA
Sbjct  28   VQEDDVESP-AVLDSTKTATTPSDSPESAPFSTSGDRKYECQYCCREFANSQALGGHQNA  86

Query  301  H  303
            H
Sbjct  87   H  87



>ref|XP_006429921.1| hypothetical protein CICLE_v10012347mg [Citrus clementina]
 gb|ESR43161.1| hypothetical protein CICLE_v10012347mg [Citrus clementina]
Length=294

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 45/98 (46%), Gaps = 14/98 (14%)
 Frame = +1

Query  10   SPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSP  189
            +P  +K   RLFG +              + S  +++ VS              E S + 
Sbjct  33   TPVKEKSAIRLFGIEFGGTGATAGEECSAESSAETANVVSE-------------ESSAAI  79

Query  190  EAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +  E N++V     ++EC +C + F TSQALGGHQNAH
Sbjct  80   KENETNNNVDT-NRRFECHYCCRNFPTSQALGGHQNAH  116



>gb|KDO76950.1| hypothetical protein CISIN_1g044930mg [Citrus sinensis]
Length=246

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  61   STSSTDRKYECQYCCREFANSQALGGHQNAH  91



>ref|XP_006468726.1| PREDICTED: zinc finger protein 6-like [Citrus sinensis]
 ref|XP_006495443.1| PREDICTED: zinc finger protein 6-like [Citrus sinensis]
Length=246

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  61   STSSTDRKYECQYCCREFANSQALGGHQNAH  91



>gb|AFK33843.1| unknown [Medicago truncatula]
Length=264

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            ESVS +    + + +  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  60   ESVSGDGGASSINPTSGDRKYECQYCCREFANSQALGGHQNAH  102



>ref|XP_006448438.1| hypothetical protein CICLE_v10016426mg [Citrus clementina]
 gb|ESR61678.1| hypothetical protein CICLE_v10016426mg [Citrus clementina]
Length=246

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  61   STSSTDRKYECQYCCREFANSQALGGHQNAH  91



>ref|XP_004954091.1| PREDICTED: uncharacterized protein LOC101767903 [Setaria italica]
Length=271

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            AK+   + +  E K+EC +C + F TSQALGGHQNAH
Sbjct  73   AKQSVGASAAAERKFECHYCCRNFPTSQALGGHQNAH  109



>ref|XP_009783843.1| PREDICTED: zinc finger protein 6-like [Nicotiana sylvestris]
Length=217

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 28/91 (31%)
 Frame = +1

Query  31   HFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
              +LFGF +           + ++ VNS+ T S            SPE    P +  +  
Sbjct  20   RLKLFGFNMT--------EEDQEQEVNSTKTSSG-----------SPESGSVPASDGR--  58

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                   KYEC++C ++F+ SQALGGHQNAH
Sbjct  59   -------KYECQYCSREFANSQALGGHQNAH  82



>ref|XP_008243415.1| PREDICTED: zinc finger protein 6 [Prunus mume]
Length=141

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +1

Query  124  VSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            V  D +E +   L S + S    + E     +  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  37   VQDDDLESSV--LDSTKTSTPSGSPESGGFSTTGDRKYECQYCCREFANSQALGGHQNAH  94



>ref|XP_006292550.1| hypothetical protein CARUB_v10018785mg [Capsella rubella]
 gb|EOA25448.1| hypothetical protein CARUB_v10018785mg [Capsella rubella]
Length=255

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +1

Query  172  EESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            EE  + +  + N+S+S    +YEC +C + F TSQALGGHQNAH
Sbjct  68   EEDQTGDNDKDNTSISN-NRRYECHYCFRNFPTSQALGGHQNAH  110



>ref|XP_010516450.1| PREDICTED: zinc finger protein GIS-like [Camelina sativa]
Length=257

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  172  EESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            EE       +KN+S  +   ++EC +C + F TSQALGGHQNAH
Sbjct  68   EEEDQTGDNDKNNSSIINNRRFECHYCFRNFPTSQALGGHQNAH  111



>emb|CDX79901.1| BnaA05g02550D [Brassica napus]
Length=250

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 3/43 (7%)
 Frame = +1

Query  175  ESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            E+V  + KEK+SS +    ++EC +C + F TSQALGGHQNAH
Sbjct  75   ENVKDKEKEKDSSNN---RRFECHYCFRNFPTSQALGGHQNAH  114



>ref|NP_001145628.1| uncharacterized LOC100279115 [Zea mays]
 gb|ACG48957.1| zinc finger protein [Zea mays]
 gb|AFW73708.1| zinc finger protein isoform 1 [Zea mays]
 gb|AFW73709.1| zinc finger protein isoform 2 [Zea mays]
Length=284

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +1

Query  178  SVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +V+ E+     S +  E K+EC +C + F TSQALGGHQNAH
Sbjct  61   TVTCESNGAAKSGAAAERKFECHYCCRNFPTSQALGGHQNAH  102



>ref|NP_001158974.1| uncharacterized protein LOC100303926 [Zea mays]
 gb|ACG30089.1| zinc finger protein [Zea mays]
Length=276

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +1

Query  178  SVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +V+ E+     S +  E K+EC +C + F TSQALGGHQNAH
Sbjct  61   TVTCESNGAAKSGAAAERKFECHYCCRNFPTSQALGGHQNAH  102



>ref|XP_010670596.1| PREDICTED: zinc finger protein 1-like [Beta vulgaris subsp. vulgaris]
Length=283

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 4/52 (8%)
 Frame = +1

Query  148  AFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            +   +S+P ES+    +E+N   +  ++ + C +C K FSTSQALGGHQNAH
Sbjct  53   SMVRISAPNESM----QEENPLETTTKVVFTCNYCKKVFSTSQALGGHQNAH  100



>ref|XP_010470784.1| PREDICTED: zinc finger protein 6-like isoform X2 [Camelina sativa]
Length=247

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 48/101 (48%), Gaps = 8/101 (8%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DF S  +     +LFGF V+    E F    +D+SV ++   SS   E+      S   S
Sbjct  5    DFSSKVTTTSRLKLFGFSVE--GEEDF----SDQSVKTNQ--SSISPERGEFPAGSSGRS  56

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                           E KYEC++C ++F  SQALGGHQNAH
Sbjct  57   GGGVRSRGGGGGGGGERKYECQYCCREFGNSQALGGHQNAH  97



>ref|XP_007139171.1| hypothetical protein PHAVU_008G007400g [Phaseolus vulgaris]
 gb|ESW11165.1| hypothetical protein PHAVU_008G007400g [Phaseolus vulgaris]
Length=176

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S S +  KYEC++C ++F+ SQALGGHQNAH
Sbjct  36   SESFMARKYECQYCFREFANSQALGGHQNAH  66



>ref|XP_010555928.1| PREDICTED: zinc finger protein 5-like [Tarenaya hassleriana]
Length=192

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  184  SPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            + E+   N++ S    +YEC +C K FS SQALGGHQNAH
Sbjct  54   TRESGNSNNTASYSGKRYECGYCRKGFSNSQALGGHQNAH  93



>gb|KGN63129.1| hypothetical protein Csa_2G404810 [Cucumis sativus]
Length=165

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  232  KYECRFCLKKFSTSQALGGHQNAH  303
            K+ECR+C ++FS SQALGGHQNAH
Sbjct  75   KFECRYCCRQFSNSQALGGHQNAH  98



>ref|XP_008467196.1| PREDICTED: zinc finger protein 6-like [Cucumis melo]
Length=214

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query  172  EESVSPEAKEKNSSV-SVVELKYECRFCLKKFSTSQALGGHQNAH  303
            ++  +P + +  ++V S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  36   QDDSTPTSSDSGAAVPSSGDRKYECQYCYREFANSQALGGHQNAH  80



>ref|XP_011070783.1| PREDICTED: zinc finger protein 6-like [Sesamum indicum]
Length=230

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 41/91 (45%), Gaps = 30/91 (33%)
 Frame = +1

Query  31   HFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
              +LFGF V           E  E V+S+ T            L SPE    P +  +  
Sbjct  22   RLKLFGFNV----------IEDQEEVDSTKTP-----------LGSPESGGFPASDGR--  58

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                   KYEC +C ++F+ SQALGGHQNAH
Sbjct  59   -------KYECHYCCREFANSQALGGHQNAH  82



>ref|XP_004171266.1| PREDICTED: zinc finger protein 6-like [Cucumis sativus]
 gb|AIS39467.1| multicellular trichome development C2H2 zinc finger transcription 
factor [Cucumis sativus]
 gb|KGN51544.1| hypothetical protein Csa_5G577350 [Cucumis sativus]
Length=213

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query  172  EESVSPEAKEKNSSV-SVVELKYECRFCLKKFSTSQALGGHQNAH  303
            ++  +P + +  ++V S  + KYEC++C ++F+ SQALGGHQNAH
Sbjct  35   QDDSTPTSSDSGAAVPSSGDRKYECQYCYREFANSQALGGHQNAH  79



>ref|XP_009619423.1| PREDICTED: zinc finger protein 8-like [Nicotiana tomentosiformis]
Length=248

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 24/101 (24%)
 Frame = +1

Query  25   KKHFRLFGFKVDPCANEVFPRSETDESVNSS------DTVSSDKVEKAF--AYLSSPEES  180
            +K  RLFG +++   N     ++  ES++S+      + ++++ V  A+  +++ + EES
Sbjct  33   EKPIRLFGKELEGGRNAT-TTTDMSESIDSNPFHDEPEIITANPVNYAYKESHIGNNEES  91

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                             KYEC++C + F TSQALGGHQNAH
Sbjct  92   ---------------NKKYECQYCFRNFPTSQALGGHQNAH  117



>ref|XP_004493346.1| PREDICTED: zinc finger protein KNUCKLES-like [Cicer arietinum]
Length=136

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +1

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            VS E+ + N   S +   +EC+FC +KF +SQALGGHQNAH
Sbjct  22   VSRESAKHN--CSTITRSFECQFCQRKFYSSQALGGHQNAH  60



>gb|KEH41742.1| C2H2 and C2HC zinc finger protein, putative [Medicago truncatula]
Length=262

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 15/97 (15%)
 Frame = +1

Query  13   PGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPE  192
            P + +K  RLFG +    A E       DES  S +T +++    +F         V   
Sbjct  29   PTNKEKGIRLFGIEFGGGATE-------DESSESPETTNNNNNINSF--------EVDNN  73

Query  193  AKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
               K+++ +    ++EC +C + F TSQALGGHQNAH
Sbjct  74   NNNKDNNNNENNRRFECHYCCRNFPTSQALGGHQNAH  110



>ref|XP_006301738.1| hypothetical protein CARUB_v10022199mg [Capsella rubella]
 gb|EOA34636.1| hypothetical protein CARUB_v10022199mg [Capsella rubella]
Length=251

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 11/91 (12%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDT-VSSDKVEKAFAYLSSPEESVSPEAKEKNS  210
             +LFGF VD    E F    +D+SV ++ + +S ++ E    + +               
Sbjct  15   LKLFGFSVD--GEEDF----SDQSVKTNQSSISPERGE----FPAGSSGRSGGGGARSRG  64

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                 E KYEC++C ++F  SQALGGHQNAH
Sbjct  65   GGGGGERKYECQYCCREFGNSQALGGHQNAH  95



>gb|AEX13416.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13417.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13421.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13422.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13423.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13428.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13431.1| hypothetical protein UMN_2521_01 [Pinus taeda]
Length=150

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  229  LKYECRFCLKKFSTSQALGGHQNAH  303
            +K+ECR+C + F TSQALGGHQNAH
Sbjct  91   VKFECRYCCRVFPTSQALGGHQNAH  115



>gb|AEX13418.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13419.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13420.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13424.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13425.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13426.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13427.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13430.1| hypothetical protein UMN_2521_01 [Pinus taeda]
 gb|AEX13432.1| hypothetical protein UMN_2521_01 [Pinus radiata]
Length=150

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  229  LKYECRFCLKKFSTSQALGGHQNAH  303
            +K+ECR+C + F TSQALGGHQNAH
Sbjct  91   VKFECRYCCRVFPTSQALGGHQNAH  115



>gb|AEX13429.1| hypothetical protein UMN_2521_01 [Pinus taeda]
Length=150

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  229  LKYECRFCLKKFSTSQALGGHQNAH  303
            +K+ECR+C + F TSQALGGHQNAH
Sbjct  91   VKFECRYCCRVFPTSQALGGHQNAH  115



>ref|XP_004289747.1| PREDICTED: zinc finger protein 7-like [Fragaria vesca subsp. 
vesca]
Length=189

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +1

Query  73   EVFPRSETDESVNSSDT--VSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECR  246
            E+ PR E  +  N  D    + D  +  +  LS    S+S E    + S       + C 
Sbjct  10   EIEPRKEQSKYSNRYDINEETEDLNQGEWLNLSLGGNSLSTEGDSDSQSKPASGKVFSCN  69

Query  247  FCLKKFSTSQALGGHQNAH  303
            FC++KF +SQALGGHQNAH
Sbjct  70   FCMRKFFSSQALGGHQNAH  88



>ref|XP_003610899.1| Zinc finger protein [Medicago truncatula]
 gb|AES93857.1| zinc finger-like protein [Medicago truncatula]
Length=387

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  190  EAKEKNSSVSVVELK-YECRFCLKKFSTSQALGGHQNAH  303
            E  EKN+    + L+ + C FC +KFSTSQALGGHQNAH
Sbjct  32   EKSEKNNDEKNLNLRSFSCLFCKRKFSTSQALGGHQNAH  70



>ref|XP_006391147.1| hypothetical protein EUTSA_v10019825mg [Eutrema salsugineum]
 gb|ESQ28433.1| hypothetical protein EUTSA_v10019825mg [Eutrema salsugineum]
Length=240

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 9/101 (9%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            DFH+  S  +  +LFGF V+    E F    +D+S+ ++ +  S + +   A  S   + 
Sbjct  5    DFHTKTSTSR-LKLFGFSVE--GEEDF----SDQSIKTNQSSISPESDDFPAGSSGRSDG  57

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
                 +         E KYEC++C ++F  SQALGGHQNAH
Sbjct  58   GG--VRSSRGGGGGGERKYECQYCCREFGNSQALGGHQNAH  96



>ref|XP_006362275.1| PREDICTED: zinc finger protein 3-like [Solanum tuberosum]
Length=188

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +1

Query  202  KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            K S + ++  KYEC +C + F TSQALGGHQNAH
Sbjct  25   KESHIEIMR-KYECHYCFRNFPTSQALGGHQNAH  57



>ref|XP_006482232.1| PREDICTED: zinc finger protein 6-like [Citrus sinensis]
Length=214

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 17/90 (19%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             +LFGF +    N+      TD    S   +S + +E         E  +S ++ +  + 
Sbjct  20   LKLFGFNISEDHNK-----NTDSFATSKTHLSDEALEL--------ETHISFQSNDNTN-  65

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
               +  KYEC++C ++F+ SQALGGHQNAH
Sbjct  66   ---ITRKYECQYCCREFANSQALGGHQNAH  92



>gb|KDO59051.1| hypothetical protein CISIN_1g046730mg [Citrus sinensis]
Length=214

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 17/90 (19%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             +LFGF +    N+      TD    S   +S + +E         E  +S ++ +  + 
Sbjct  20   LKLFGFNISEDHNK-----NTDSFATSKTHLSDEALEL--------ETHISFQSNDNTN-  65

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
               +  KYEC++C ++F+ SQALGGHQNAH
Sbjct  66   ---ITRKYECQYCCREFANSQALGGHQNAH  92



>ref|XP_006355929.1| PREDICTED: zinc finger protein 5-like [Solanum tuberosum]
Length=248

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  232  KYECRFCLKKFSTSQALGGHQNAH  303
            K+EC++CLK+F+ SQALGGHQNAH
Sbjct  101  KFECQYCLKQFANSQALGGHQNAH  124



>emb|CDP00646.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 47/101 (47%), Gaps = 31/101 (31%)
 Frame = +1

Query  1    DFHSPGSDKKHFRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEES  180
            ++ S  S+    +LFGF V             +E V+S+ T S            SP+  
Sbjct  5    EYQSKPSNNGRLKLFGFNV-----------TDEEEVDSTKTPSG-----------SPDSG  42

Query  181  VSPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
              P +  +         KYEC++C ++F+ SQALGGHQNAH
Sbjct  43   GFPASDGR---------KYECQYCCREFANSQALGGHQNAH  74



>ref|XP_007139172.1| hypothetical protein PHAVU_008G007400g [Phaseolus vulgaris]
 gb|ESW11166.1| hypothetical protein PHAVU_008G007400g [Phaseolus vulgaris]
Length=191

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  211  SVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            S S +  KYEC++C ++F+ SQALGGHQNAH
Sbjct  36   SESFMARKYECQYCFREFANSQALGGHQNAH  66



>gb|EMS58646.1| Zinc finger protein 7 [Triticum urartu]
Length=208

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 9/85 (11%)
 Frame = +1

Query  49   FKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVE  228
             K  P A E    S+ DE+  + ++  +  ++     L S EE+  PEA  + +      
Sbjct  34   MKRAPEAEEQKLASQGDEAGRADNSTPTPWLKLGLDALRS-EEAKPPEATPQRT------  86

Query  229  LKYECRFCLKKFSTSQALGGHQNAH  303
              + C +CL+KF +SQALGGHQNAH
Sbjct  87   --FSCNYCLRKFFSSQALGGHQNAH  109



>ref|XP_004497070.1| PREDICTED: zinc finger protein 6-like [Cicer arietinum]
Length=268

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  226  ELKYECRFCLKKFSTSQALGGHQNAH  303
            E KYEC++C ++F+ SQALGGHQNAH
Sbjct  67   ERKYECQYCCREFANSQALGGHQNAH  92



>gb|KCW86763.1| hypothetical protein EUGRSUZ_B03372 [Eucalyptus grandis]
Length=256

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 50/100 (50%), Gaps = 12/100 (12%)
 Frame = +1

Query  40   LFGFK---VDPCAN----EVFPRS---ETD--ESVNSSDTVSSDKVEKAFAYLSSPEESV  183
            LFGF    +  C N    E  P+S   E D  ESVNSS+T  S   +  +  L +     
Sbjct  44   LFGFDLTTIAACENRDEEEGTPKSDLVERDDHESVNSSNTDPSSSRDDKYKTLLANSNIR  103

Query  184  SPEAKEKNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
               +    S+    +  +EC++C K F+ SQALGGHQNAH
Sbjct  104  EGSSSVLTSNTHRSKKLFECQYCAKTFANSQALGGHQNAH  143



>ref|XP_010421563.1| PREDICTED: uncharacterized protein LOC104707012 [Camelina sativa]
Length=283

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +1

Query  94   TDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKFSTS  273
            TD  + S   VSSD+  K   + SS         K   S  + +   Y C FC K FSTS
Sbjct  37   TDLKLGSPQEVSSDRRTKNLCFGSSDVRRGREIMKIYPSKSNKI---YTCHFCKKGFSTS  93

Query  274  QALGGHQNAH  303
            QALGGHQNAH
Sbjct  94   QALGGHQNAH  103



>ref|XP_002871225.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47484.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  148  AFAYLSSPEESVSPEA-KEKNSSVS--VVELKYECRFCLKKFSTSQALGGHQNAH  303
             F + +S EES S ++  E N S+     E +++C +C + F TSQALGGHQNAH
Sbjct  23   GFEFGASHEESESKDSYNENNESIKDDNKEKRFKCHYCFRNFPTSQALGGHQNAH  77



>emb|CDY22545.1| BnaC03g23550D [Brassica napus]
Length=251

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 8/51 (16%)
 Frame = +1

Query  175  ESVSPEAKEKNSSVSVVELK--------YECRFCLKKFSTSQALGGHQNAH  303
            E  + + K+++SSV+V E +        +EC +C +KF TSQALGGHQNAH
Sbjct  63   EITTTKIKDESSSVNVKEKEKDKRNNRGFECHYCFRKFPTSQALGGHQNAH  113



>gb|KDP32969.1| hypothetical protein JCGZ_13000 [Jatropha curcas]
Length=197

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 18/73 (25%)
 Frame = +1

Query  118  DTVSSDKVEKAFAY-----------LSSPEESVSPEAKEKNSSVSVVELKYECRFCLKKF  264
            +T++++   K F +           +SS   S SPE+  +         KYEC++C ++F
Sbjct  12   NTITTNSTLKLFGFNILENNTDNNNISSKSPSGSPESDTETR-------KYECQYCCREF  64

Query  265  STSQALGGHQNAH  303
            + SQALGGHQNAH
Sbjct  65   ANSQALGGHQNAH  77



>ref|XP_007031965.1| Uncharacterized protein TCM_017291 [Theobroma cacao]
 gb|EOY02891.1| Uncharacterized protein TCM_017291 [Theobroma cacao]
Length=150

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +1

Query  151  FAYLSSPEESVSPEAKE-KNSSVSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            + + + P  +  P  K+ + +S S     ++C +C +KF TSQALGGHQNAH
Sbjct  7    YNFFNQPSSAPKPTKKQPQRASPSAPTRLFQCLYCPRKFYTSQALGGHQNAH  58



>ref|XP_008803531.1| PREDICTED: zinc finger protein 6-like [Phoenix dactylifera]
Length=251

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 24/90 (27%)
 Frame = +1

Query  34   FRLFGFKVDPCANEVFPRSETDESVNSSDTVSSDKVEKAFAYLSSPEESVSPEAKEKNSS  213
             ++FGF V          SE DE+ + S   +        A  S P  +++       ++
Sbjct  22   LKIFGFHV----------SEDDEAEHQSPPKA--------AATSDPSSTIN------GAT  57

Query  214  VSVVELKYECRFCLKKFSTSQALGGHQNAH  303
            V+    KYEC++C ++F+ SQALGGHQNAH
Sbjct  58   VAGDGRKYECQYCCREFANSQALGGHQNAH  87



>gb|KDP35694.1| hypothetical protein JCGZ_10880 [Jatropha curcas]
Length=205

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 12/89 (13%)
 Frame = +1

Query  46   GFKVDPCANEVFPRSETDESVNSSDTVSSD-KVE-KAFAYLSSPEESVSPEAK-EKNSSV  216
            G K DP           D  ++S++ V  D K+E      L + E    PE++ E+N++ 
Sbjct  17   GQKADPL---------LDLRLSSTNDVEVDSKLELNLLGVLGNKESPKIPESETERNNNK  67

Query  217  SVVELKYECRFCLKKFSTSQALGGHQNAH  303
               +  + C++C KKF+ SQALGGHQNAH
Sbjct  68   EGGKRNFVCKYCHKKFNNSQALGGHQNAH  96



>ref|XP_004238719.1| PREDICTED: zinc finger protein 5-like [Solanum lycopersicum]
Length=250

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  232  KYECRFCLKKFSTSQALGGHQNAH  303
            K+EC++CLK+F+ SQALGGHQNAH
Sbjct  101  KFECQYCLKQFANSQALGGHQNAH  124



Lambda      K        H        a         alpha
   0.314    0.130    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558743307496