BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86814_g1_i1 len=1341 path=[1:0-1340]

Length=1341
                                                                      Score     E

ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    155   6e-38   
gb|ABE96885.1|  polyphenol oxidase                                      154   1e-37   Nicotiana tabacum [American tobacco]
gb|AGK83468.1|  polyphenol oxidase                                      154   1e-37   
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    154   1e-37   
emb|CAA73103.1|  polyphenol oxidase                                     154   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    154   2e-37   
pir||S34786  catechol oxidase (EC 1.10.3.1) precursor - potato (f...    153   2e-37
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    153   3e-37   Solanum tuberosum [potatoes]
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     152   4e-37   
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                152   4e-37   
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    152   6e-37   Solanum lycopersicum
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     152   6e-37   
gb|AEO00529.1|  polyphenol oxidase                                      152   7e-37   
ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    152   7e-37   
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    151   1e-36   Solanum lycopersicum
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          150   2e-36   
gb|ACR61398.1|  polyphenol oxidase                                      150   3e-36   Solanum melongena [aubergine]
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          150   3e-36   
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          150   3e-36   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          150   3e-36   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          150   3e-36   
gb|AAB22610.1|  polyphenoloxidase                                       148   1e-35   Solanum lycopersicum
gb|AAA02877.1|  propolyphenol oxidase                                   147   2e-35   Solanum tuberosum [potatoes]
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     146   5e-35   
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       145   9e-35   
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     145   1e-34   
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                145   2e-34   
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    145   2e-34   Solanum lycopersicum
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                144   3e-34   Solanum melongena [aubergine]
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    144   4e-34   
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                144   4e-34   
gb|AAA85121.1|  polyphenol oxidase                                      143   8e-34   Solanum tuberosum [potatoes]
gb|AAA85123.1|  polyphenol oxidase                                      136   1e-33   Solanum tuberosum [potatoes]
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    142   1e-33   
ref|XP_010100574.1|  Polyphenol oxidase                                 142   2e-33   
dbj|BAO79387.1|  polyphenol_oxidase                                     142   2e-33   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    142   2e-33   
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    142   2e-33   
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    142   2e-33   
gb|AAA85122.1|  polyphenol oxidase                                      141   3e-33   Solanum tuberosum [potatoes]
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             140   4e-33   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     140   7e-33   Vitis vinifera
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             140   9e-33   
gb|AAU12256.1|  polyphenol oxidase                                      139   1e-32   Populus trichocarpa x Populus deltoides
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             139   1e-32   
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            139   2e-32   Populus tremuloides
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    139   2e-32   Solanum lycopersicum
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    139   2e-32   Solanum lycopersicum
gb|ACM43505.1|  polyphenoloxidase                                       138   3e-32   Camellia nitidissima
gb|ADR78836.1|  polyphenol oxidase                                      137   7e-32   
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    137   8e-32   
ref|XP_010100570.1|  Polyphenol oxidase                                 137   9e-32   
gb|ACN78382.1|  polyphenol oxidase                                      135   2e-31   Solanum quitoense [lulo]
gb|AEL95440.1|  polyphenol oxidase                                      135   3e-31   
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    135   3e-31   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             135   3e-31   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    135   3e-31   
gb|AHF20575.1|  polyphenol oxidase                                      135   4e-31   
gb|AAU12257.1|  polyphenol oxidase                                      135   5e-31   Populus trichocarpa x Populus deltoides
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             134   5e-31   Populus trichocarpa [western balsam poplar]
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                134   5e-31   
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    134   6e-31   Vicia faba [broad bean]
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             134   7e-31   
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 134   8e-31   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                134   1e-30   
ref|XP_010100573.1|  Polyphenol oxidase                                 129   1e-30   
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             134   1e-30   
emb|CDP22269.1|  unnamed protein product                                132   1e-30   
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    133   2e-30   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    133   2e-30   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   133   2e-30   
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             133   2e-30   
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             132   2e-30   
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    133   2e-30   
ref|XP_003605693.1|  Polyphenol oxidase A1                              131   3e-30   
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    132   4e-30   
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    132   4e-30   
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    132   4e-30   
emb|CDO99592.1|  unnamed protein product                                132   5e-30   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    131   6e-30   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       131   7e-30   Taraxacum officinale [dandelion]
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 131   9e-30   
gb|ABF19601.1|  polyphenol oxidase                                      130   1e-29   Camellia ptilophylla
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    130   1e-29   
ref|XP_007025703.1|  Larreatricin hydroxylase                           130   2e-29   
ref|XP_006370119.1|  hypothetical protein POPTR_0001s39670g             128   2e-29   
gb|AHC98007.1|  PPO                                                     130   2e-29   
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     130   2e-29   
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             129   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    129   4e-29   
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       129   4e-29   Populus trichocarpa x Populus deltoides
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    129   4e-29   
gb|ABR57235.1|  polyphenol oxidase                                      129   5e-29   Camellia sinensis [black tea]
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    129   7e-29   
emb|CAC29040.1|  catechol oxidase                                       127   7e-29   Ipomoea batatas [batate]
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 128   8e-29   
emb|CAC83610.1|  catechol oxidase                                       127   8e-29   Ipomoea batatas [batate]
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    128   9e-29   Antirrhinum majus [garden snapdragon]
gb|ACR82078.1|  polyphenol oxidase                                      128   1e-28   Camellia sinensis [black tea]
gb|ACJ04908.1|  polyphenol oxidase                                      128   1e-28   Camellia sinensis [black tea]
sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    127   2e-28   Ipomoea batatas [batate]
gb|ABF19602.1|  polyphenol oxidase                                      127   2e-28   Camellia sinensis var. assamica [Assam tea]
gb|AHX26182.1|  polyphenol oxidase                                      127   2e-28   
gb|AES87890.2|  polyphenoloxidase                                       127   3e-28   
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    127   3e-28   
gb|EEC71623.1|  hypothetical protein OsI_04042                          125   4e-28   Oryza sativa Indica Group [Indian rice]
dbj|BAA92317.1|  polyphenol oxidase I                                   126   5e-28   Ipomoea batatas [batate]
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    126   5e-28   
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    125   5e-28   
emb|CAG25740.1|  polyphenol oxidase A                                   120   6e-28   Solanum lycopersicum
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                125   6e-28   
gb|AFC36521.1|  polyphenol oxidase                                      125   8e-28   
gb|AHX26181.1|  polyphenol oxidase                                      125   8e-28   
gb|AII22006.1|  polyphenol oxidase-4                                    125   8e-28   
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          125   8e-28   Sorghum bicolor [broomcorn]
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             125   9e-28   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    125   1e-27   
gb|ADI44162.1|  polyphenol oxidase 1                                    125   1e-27   
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    125   1e-27   
gb|AEY78528.1|  polyphenol oxidase                                      124   2e-27   
gb|AAW78869.1|  polyphenol oxidase                                      124   2e-27   Ipomoea batatas [batate]
gb|ACN86310.1|  polyphenol oxidase                                      124   2e-27   Juglans regia
gb|ACN38060.1|  polyphenol oxidase                                      124   2e-27   Camellia sinensis [black tea]
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    124   2e-27   
gb|ABR24120.1|  polyphenol oxidase                                      124   2e-27   Camellia sinensis [black tea]
gb|ACR61399.1|  polyphenol oxidase                                      124   2e-27   Solanum melongena [aubergine]
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    125   2e-27   
gb|ACF17425.1|  polyphenol oxidase                                      124   2e-27   Camellia sinensis [black tea]
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    124   3e-27   Vitis vinifera
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    124   3e-27   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    123   4e-27   
gb|ABR10907.1|  polyphenol oxidase                                      123   4e-27   Camellia sinensis [black tea]
gb|ABM68052.1|  polyphenol oxidase                                      123   5e-27   Trifolium pratense [peavine clover]
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    123   5e-27   
gb|AAK13244.1|  polyphenol oxidase                                      123   5e-27   Trifolium pratense [peavine clover]
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    123   5e-27   
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  123   5e-27   
dbj|BAO79386.1|  polyphenol_oxidase                                     123   6e-27   
dbj|BAA21676.1|  polyphenol oxidase                                     123   6e-27   Malus domestica [apple tree]
gb|ADC92563.1|  polyphenol oxidase                                      123   6e-27   
gb|AAP33165.1|  polyphenol oxidase                                      123   7e-27   Medicago sativa [alfalfa]
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   7e-27   
gb|AAW58111.1|  polyphenol oxidase                                      117   7e-27   Prunus salicina var. cordata
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                122   7e-27   
gb|KHN07287.1|  Polyphenol oxidase A1, chloroplastic                    121   8e-27   
gb|AEQ30073.1|  polyphenol oxidase                                      122   9e-27   
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    121   9e-27   Ipomoea batatas [batate]
gb|ADI44161.1|  polyphenol oxidase 2                                    122   1e-26   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    122   1e-26   
gb|EYU26236.1|  hypothetical protein MIMGU_mgv1a027162mg                121   2e-26   
gb|AII22007.1|  polyphenol oxidase-5                                    122   2e-26   
ref|XP_011044088.1|  PREDICTED: polyphenol oxidase, chloroplastic...    119   2e-26   
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    121   2e-26   
emb|CAN62983.1|  hypothetical protein VITISV_035472                     121   2e-26   Vitis vinifera
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    121   2e-26   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    121   2e-26   
ref|XP_003593515.1|  Polyphenol oxidase                                 120   4e-26   
gb|AGC54425.1|  polyphenol oxidase 1                                    120   5e-26   
gb|ABR57236.1|  polyphenol oxidase                                      120   6e-26   Camellia sinensis [black tea]
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    119   7e-26   
gb|AAC69365.1|  polyphenol oxidase                                      117   8e-26   Diospyros kaki [Japanese persimmon]
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    119   1e-25   
gb|KCW45574.1|  hypothetical protein EUGRSUZ_L00687                     116   1e-25   
gb|EPS57764.1|  polyphenol oxidase                                      118   1e-25   
gb|ABY84850.1|  polyphenol oxidase                                      117   2e-25   Cydonia oblonga [wen po]
ref|XP_006583808.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    119   2e-25   
gb|AAK29783.1|  polyphenol oxidase                                      115   2e-25   Ananas comosus
dbj|BAA21677.1|  polyphenol oxidase                                     118   2e-25   Malus domestica [apple tree]
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    118   2e-25   Ricinus communis
emb|CAC83609.1|  catechol oxidase                                       117   3e-25   Ipomoea batatas [batate]
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    118   4e-25   
gb|AII22011.1|  polyphenol oxidase-9                                    117   5e-25   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   5e-25   
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   5e-25   
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   6e-25   
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    117   6e-25   
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   6e-25   
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         117   7e-25   
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    116   1e-24   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                116   1e-24   
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        116   1e-24   
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    115   1e-24   
gb|ADF59058.2|  polyphenol oxidase IV                                   115   2e-24   
ref|XP_009352971.1|  PREDICTED: polyphenol oxidase, chloroplastic...    114   2e-24   
gb|AEG78292.1|  polyphenol oxidase                                      115   2e-24   
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    115   2e-24   
gb|AFL03159.1|  polyphenol oxidase                                      115   2e-24   
gb|ABS88291.1|  polyphenol oxidase                                      115   3e-24   Pyrus x bretschneideri [bai li]
emb|CDP06093.1|  unnamed protein product                                115   3e-24   
gb|AAW65103.1|  polyphenol oxidase                                      115   3e-24   Prunus salicina var. cordata
gb|AAK13242.1|  polyphenol oxidase                                      115   3e-24   Trifolium pratense [peavine clover]
gb|AEE61322.1|  polyphenol oxidase I                                    115   4e-24   
gb|AAO16865.1|  polyphenol oxidase                                      114   4e-24   Ananas comosus
dbj|BAB64530.1|  polyphenol oxidase                                     114   4e-24   Pyrus pyrifolia [sha li]
sp|Q6UIL3.1|LAHY_LARTR  RecName: Full=(+)-larreatricin hydroxylas...    114   5e-24   Larrea tridentata
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    114   5e-24   
ref|XP_006574243.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   5e-24   
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    114   6e-24   
gb|ACM09905.1|  polyphenol oxidase 1/4                                  114   6e-24   Trifolium pratense [peavine clover]
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    113   1e-23   
ref|XP_007025704.1|  Larreatricin hydroxylase                           112   1e-23   
gb|AAK13243.1|  polyphenol oxidase                                      113   1e-23   Trifolium pratense [peavine clover]
ref|XP_006583806.1|  PREDICTED: polyphenol oxidase II, chloroplas...    113   1e-23   
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    113   1e-23   
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             113   1e-23   
ref|XP_006583805.1|  PREDICTED: polyphenol oxidase II, chloroplas...    113   1e-23   
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       112   2e-23   
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    113   2e-23   
gb|KHN07288.1|  Polyphenol oxidase, chloroplastic                       112   2e-23   
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    112   2e-23   
dbj|BAA85119.1|  polyphenol oxidase-like protein                        108   2e-23   Solanum melongena [aubergine]
dbj|BAP82256.1|  polyphenol oxidase                                     112   2e-23   
ref|XP_003605686.1|  Polyphenol oxidase                                 111   2e-23   
gb|KHN08552.1|  Polyphenol oxidase A1, chloroplastic                    112   2e-23   
dbj|BAP82255.1|  polyphenol oxidase                                     112   2e-23   
dbj|BAP82254.1|  polyphenol oxidase                                     112   2e-23   
ref|XP_008345878.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   2e-23   
ref|XP_004170849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    109   3e-23   
gb|ADF59059.2|  polyphenol oxidase V                                    112   3e-23   
ref|XP_010100566.1|  Polyphenol oxidase                                 112   3e-23   
dbj|BAM15848.1|  hypothetical protein                                   112   4e-23   
gb|AAC28935.1|  polyphenol oxidase precursor                            112   4e-23   Prunus armeniaca
dbj|BAM15846.1|  hypothetical protein                                   111   5e-23   
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    111   6e-23   
ref|XP_006377743.1|  hypothetical protein POPTR_0011s10940g             109   6e-23   
gb|AHX26180.1|  polyphenol oxidase                                      110   6e-23   
emb|CAG26911.1|  polyphenol oxidase                                     105   6e-23   Solanum lycopersicum
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   8e-23   
ref|XP_008446626.1|  PREDICTED: polyphenol oxidase I, chloroplast...    110   1e-22   
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   1e-22   
ref|XP_004171833.1|  PREDICTED: polyphenol oxidase, chloroplastic...    105   1e-22   
gb|AAW58109.2|  polyphenol oxidase                                      110   1e-22   Prunus salicina var. cordata
gb|ACJ04909.1|  polyphenol oxidase                                      110   1e-22   
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   1e-22   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             110   2e-22   
gb|ADG85002.1|  polyphenol oxidase                                      110   2e-22   
gb|ACB12083.1|  polyphenol oxidase                                      109   2e-22   Triticum monococcum [einkorn wheat]
gb|ACB12082.1|  polyphenol oxidase                                      109   2e-22   Triticum monococcum subsp. aegilopoides [wild einkorn]
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   2e-22   
gb|ACB12081.1|  polyphenol oxidase                                      109   2e-22   Triticum urartu
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       109   2e-22   
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   2e-22   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   2e-22   
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   2e-22   
emb|CBZ41491.1|  polyphenol oxidase precursor (chloroplast)             109   2e-22   
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   2e-22   
gb|AAT06525.1|  polyphenol oxidase                                      107   3e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             109   3e-22   
dbj|BAP82257.1|  polyphenol oxidase                                     108   4e-22   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    108   4e-22   
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    108   5e-22   
gb|KHN07285.1|  Polyphenol oxidase A1, chloroplastic                    108   6e-22   
gb|ABM68051.1|  polyphenol oxidase                                      108   7e-22   Trifolium pratense [peavine clover]
gb|ABI96924.1|  putative polyphenol oxidase                             105   7e-22   Frangula californica [California buckthorn]
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    108   7e-22   
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             108   8e-22   
gb|ABK62802.1|  polyphenol oxidase                                      107   8e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AEY79824.1|  polyphenol oxidase                                      107   9e-22   
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    107   9e-22   
gb|ACB12084.1|  polyphenol oxidase                                      107   9e-22   Triticum dicoccoides [wild emmer wheat]
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   1e-21   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    107   1e-21   
gb|ABK62804.1|  polyphenol oxidase                                      107   1e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             107   1e-21   
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    107   1e-21   
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   1e-21   
gb|AED02598.1|  polyphenol oxidase                                      107   1e-21   
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   1e-21   
ref|NP_001149552.1|  polyphenol oxidase II                              106   2e-21   Zea mays [maize]
gb|AAT06526.1|  polyphenol oxidase                                      103   2e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   2e-21   
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            107   2e-21   Ananas comosus
gb|AAO16863.1|  polyphenol oxidase                                      106   2e-21   Ananas comosus
gb|ABK62801.1|  polyphenol oxidase                                      106   2e-21   Triticum aestivum [Canadian hard winter wheat]
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                106   2e-21   Malus domestica [apple tree]
gb|AAT06527.1|  polyphenol oxidase                                      103   2e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          106   2e-21   Sorghum bicolor [broomcorn]
gb|AFW59500.1|  putative polyphenol oxidase family protein              106   3e-21   
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    106   3e-21   
ref|XP_010100565.1|  Polyphenol oxidase                                 106   3e-21   
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    105   3e-21   
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             105   4e-21   
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    105   4e-21   
gb|AHH92831.1|  polyphenol oxidase                                      105   4e-21   
gb|AII22008.1|  polyphenol oxidase-6                                    105   5e-21   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    105   5e-21   
gb|AGU01537.1|  polyphenol oxidase                                      105   5e-21   
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             105   5e-21   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    105   5e-21   
gb|AII22005.1|  polyphenol oxidase-3                                    105   5e-21   
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    105   6e-21   
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    104   9e-21   
dbj|BAJ10871.1|  polyphenol oxidase                                     104   1e-20   
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    104   1e-20   
gb|ACB12086.1|  polyphenol oxidase                                      103   2e-20   
dbj|BAH36897.1|  polyphenol oxidase                                     103   2e-20   
gb|AAS00454.1|  polyphenol oxidase                                      103   2e-20   
gb|ABK62803.1|  polyphenol oxidase                                      103   2e-20   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             103   2e-20   
gb|AII22010.1|  polyphenol oxidase-8                                    103   2e-20   
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    103   2e-20   
gb|ABI96932.1|  putative polyphenol oxidase                             102   3e-20   
gb|AEY79826.1|  polyphenol oxidase                                      103   3e-20   
gb|ADP89908.1|  polyphenol oxidase                                      102   3e-20   
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      103   3e-20   
gb|ABI96937.1|  putative polyphenol oxidase                             102   4e-20   
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             102   5e-20   
ref|XP_010263628.1|  PREDICTED: aureusidin synthase-like                102   7e-20   
gb|ABI96939.1|  putative polyphenol oxidase                             101   7e-20   
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       102   7e-20   
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       102   8e-20   
gb|ABI96934.1|  putative polyphenol oxidase                             100   8e-20   
gb|ABI96926.1|  putative polyphenol oxidase                             100   9e-20   
gb|AAT75166.1|  polyphenol oxidase                                      101   1e-19   
gb|AFN53703.1|  putative phenol oxidase                                 100   1e-19   
gb|ABI96951.1|  putative polyphenol oxidase                             100   1e-19   
gb|EYU34166.1|  hypothetical protein MIMGU_mgv1a003279mg                101   1e-19   
gb|ABI96928.1|  putative polyphenol oxidase                             100   1e-19   
gb|ABI96942.1|  putative polyphenol oxidase                             100   1e-19   
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    100   2e-19   
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    100   2e-19   
emb|CDP06099.1|  unnamed protein product                                100   2e-19   
gb|ABI96935.1|  putative polyphenol oxidase                           99.8    2e-19   
emb|CDP17936.1|  unnamed protein product                              96.3    3e-19   
gb|ABX09994.1|  chloroplast polyphenol oxidase                          100   3e-19   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    100   3e-19   
ref|XP_011076536.1|  PREDICTED: polyphenol oxidase I, chloroplast...    100   3e-19   
ref|XP_007033808.1|  Uncharacterized protein TCM_019921               99.4    4e-19   
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...  99.8    4e-19   
ref|XP_007214683.1|  hypothetical protein PRUPE_ppa022943mg           99.8    4e-19   
gb|ABN13632.1|  polyphenol oxidase                                    99.8    4e-19   
gb|ABI96948.1|  putative polyphenol oxidase                           99.0    5e-19   
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg              99.8    5e-19   
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...  99.8    5e-19   
ref|XP_002458568.1|  hypothetical protein SORBIDRAFT_03g035850        99.8    5e-19   
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...  99.4    5e-19   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...  99.4    6e-19   
gb|ABI96941.1|  putative polyphenol oxidase                           98.6    6e-19   
emb|CDP06098.1|  unnamed protein product                              99.4    6e-19   
ref|XP_010100568.1|  Polyphenol oxidase                               99.4    6e-19   
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...  99.4    6e-19   
gb|ABI96927.1|  putative polyphenol oxidase                           98.6    7e-19   
gb|ABI96930.1|  putative polyphenol oxidase                           98.2    7e-19   
ref|XP_004146641.1|  PREDICTED: polyphenol oxidase, chloroplastic...  99.0    7e-19   
gb|ADB44003.1|  polyphenol oxidase                                    93.6    8e-19   
ref|XP_010094347.1|  Polyphenol oxidase                               94.7    1e-18   
gb|ABI96949.1|  putative polyphenol oxidase                           97.8    1e-18   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg           98.2    1e-18   
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)           98.2    2e-18   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...  97.8    2e-18   
dbj|BAP82258.1|  polyphenol oxidase                                   97.4    2e-18   
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870        97.4    3e-18   
ref|XP_010100567.1|  Polyphenol oxidase                               97.1    3e-18   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...  97.1    4e-18   
gb|AEM45933.1|  polyphenol oxidase                                    96.7    4e-18   
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...  96.7    4e-18   
gb|AEM45934.1|  polyphenol oxidase                                    96.7    4e-18   
gb|ABI96933.1|  putative polyphenol oxidase                           95.9    5e-18   
gb|ABJ90144.1|  polyphenol oxidase                                    96.3    5e-18   
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...  96.3    5e-18   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...  95.9    8e-18   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg              95.9    8e-18   
gb|ABI96950.1|  putative polyphenol oxidase                           95.1    1e-17   
ref|XP_008784903.1|  PREDICTED: polyphenol oxidase, chloroplastic...  95.5    1e-17   
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684           95.5    1e-17   
gb|EMT06707.1|  Polyphenol oxidase A1, chloroplastic                  95.5    1e-17   
gb|ACS15320.1|  polyphenol oxidase                                    94.4    1e-17   
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg              95.1    1e-17   
gb|ACS15325.1|  polyphenol oxidase                                    94.4    1e-17   
gb|AEY79825.1|  polyphenol oxidase                                    95.1    1e-17   
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...  95.1    1e-17   
gb|AII22009.1|  polyphenol oxidase-7                                  94.7    2e-17   
dbj|BAH36895.1|  polyphenol oxidase                                   94.7    2e-17   
gb|ABI96946.1|  putative polyphenol oxidase                           94.0    2e-17   
gb|ABA62017.1|  polyphenol oxidase                                    94.7    2e-17   
gb|AEM45931.1|  polyphenol oxidase                                    94.7    2e-17   
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154           94.7    2e-17   
gb|ACS15330.1|  polyphenol oxidase                                    94.4    2e-17   
gb|ABG23057.1|  polyphenol oxidase                                    94.4    3e-17   
gb|ABG23065.1|  polyphenol oxidase                                    94.4    3e-17   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...  94.4    3e-17   
gb|ACS15326.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23067.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23062.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23092.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ACS15319.1|  polyphenol oxidase                                    94.0    3e-17   
emb|CAH66802.1|  H0215F08.13                                          94.0    3e-17   
gb|ABG23042.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23098.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23097.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23077.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23075.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23066.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23059.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ACS15337.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23070.1|  polyphenol oxidase                                    94.0    3e-17   
dbj|BAM15847.1|  hypothetical protein                                 94.0    3e-17   
gb|ABG23072.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23073.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23093.1|  polyphenol oxidase                                    94.0    3e-17   
gb|ABG23061.1|  polyphenol oxidase                                    94.0    4e-17   
gb|EEE61720.1|  hypothetical protein OsJ_16225                        90.5    4e-17   
gb|ABG23087.1|  polyphenol oxidase                                    94.0    4e-17   
gb|ABG23083.1|  polyphenol oxidase                                    94.0    4e-17   
gb|ABI96936.1|  putative polyphenol oxidase                           93.2    4e-17   
gb|ABG23084.1|  polyphenol oxidase                                    93.6    4e-17   
gb|ABG23086.1|  polyphenol oxidase                                    93.6    5e-17   
gb|AHA91117.1|  polyphenol oxidase                                    88.6    5e-17   
gb|ABG23085.1|  polyphenol oxidase                                    93.2    6e-17   
gb|AFS28698.1|  putative polyphenol oxidase                           92.8    6e-17   
gb|AFS28697.1|  putative polyphenol oxidase                           92.8    6e-17   
dbj|BAM15849.1|  hypothetical protein                                 92.8    8e-17   
gb|EMT09670.1|  Polyphenol oxidase, chloroplastic                     92.0    8e-17   
gb|AHZ59731.1|  copper-containing polyphenol oxidase                  92.4    1e-16   
ref|XP_008446638.1|  PREDICTED: polyphenol oxidase, chloroplastic...  92.4    1e-16   
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...  92.4    1e-16   
gb|ABG23081.1|  polyphenol oxidase                                    92.4    1e-16   
gb|AFH00996.1|  polyphenol oxidase II                                 92.4    1e-16   
gb|AEM45935.1|  polyphenol oxidase                                    92.0    1e-16   
gb|AEM45936.1|  polyphenol oxidase                                    92.0    1e-16   
gb|AHA91116.1|  polyphenol oxidase                                    87.4    1e-16   
gb|AHN09736.1|  aurone synthase                                       92.0    1e-16   
ref|XP_009380367.1|  PREDICTED: polyphenol oxidase I, chloroplast...  92.0    1e-16   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220        92.0    2e-16   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...  91.7    2e-16   
gb|ABI96943.1|  putative polyphenol oxidase                           91.3    2e-16   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...  91.7    2e-16   
gb|ABI96945.1|  putative polyphenol oxidase                           90.9    3e-16   
gb|ACB45128.1|  polyphenol oxidase                                    89.0    3e-16   
ref|XP_003593517.1|  Polyphenol oxidase A1                            90.9    4e-16   
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...  90.5    5e-16   
gb|AGT28746.1|  aurone synthase                                       90.5    6e-16   
gb|ABI96944.1|  putative polyphenol oxidase                           89.7    6e-16   
gb|ABI96940.1|  putative polyphenol oxidase                           89.7    6e-16   
gb|ABG23047.1|  polyphenol oxidase                                    90.1    7e-16   
gb|AGT28745.1|  aurone synthase                                       90.1    7e-16   
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...  90.1    7e-16   
gb|ABG23045.1|  polyphenol oxidase                                    89.7    7e-16   
emb|CAE03510.2|  OSJNBa0053K19.18                                     89.7    7e-16   
gb|EPS59410.1|  polyphenoloxidase                                     89.7    7e-16   
gb|EEC78048.1|  hypothetical protein OsI_17489                        89.7    7e-16   
ref|NP_001053932.1|  Os04g0624500                                     89.7    7e-16   
gb|ABG23090.1|  polyphenol oxidase                                    89.7    8e-16   
gb|ABG23060.1|  polyphenol oxidase                                    89.7    8e-16   
dbj|BAK03848.1|  predicted protein                                    89.7    8e-16   
dbj|BAJ10872.1|  polyphenol oxidase                                   89.7    8e-16   
ref|XP_010254790.1|  PREDICTED: aureusidin synthase-like              89.7    9e-16   
gb|ABI96929.1|  putative polyphenol oxidase                           89.0    9e-16   
gb|EMS49817.1|  Polyphenol oxidase, chloroplastic                     89.4    9e-16   
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...  89.7    1e-15   
gb|ABI96925.1|  putative polyphenol oxidase                           88.6    1e-15   
ref|XP_010910148.1|  PREDICTED: polyphenol oxidase, chloroplastic...  89.0    2e-15   
gb|KHN07286.1|  Polyphenol oxidase, chloroplastic                     85.9    2e-15   
gb|ABI96931.1|  putative polyphenol oxidase                           88.2    2e-15   
ref|XP_002990878.1|  hypothetical protein SELMODRAFT_429255           88.2    2e-15   
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...  88.6    2e-15   
gb|AGC55012.1|  polyphenoloxidase                                     88.6    2e-15   
gb|AES87883.2|  polyphenoloxidase                                     87.8    2e-15   
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...  87.8    3e-15   
emb|CDM84541.1|  unnamed protein product                              87.8    3e-15   
ref|XP_010921586.1|  PREDICTED: polyphenol oxidase, chloroplastic...  87.4    4e-15   
dbj|BAJ90144.1|  predicted protein                                    87.4    5e-15   
gb|ACJ76786.1|  tyrosinase polyphenol oxidase                         87.0    7e-15   
ref|XP_010099507.1|  Polyphenol oxidase                               86.3    8e-15   
gb|EYU34162.1|  hypothetical protein MIMGU_mgv1a005754mg              86.3    8e-15   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg              86.3    1e-14   
gb|ABI96938.1|  putative polyphenol oxidase                           85.9    1e-14   
gb|ACL53206.1|  unknown                                               86.3    1e-14   
ref|XP_002990877.1|  hypothetical protein SELMODRAFT_132508           86.3    1e-14   
gb|ACJ70698.1|  polyphenol oxidase                                    86.3    1e-14   
ref|XP_006644832.1|  PREDICTED: polyphenol oxidase, chloroplastic...  86.3    1e-14   
ref|NP_001142971.1|  uncharacterized protein LOC100275424             86.3    1e-14   
gb|AGK88243.1|  polyphenol oxidase                                    86.3    1e-14   
gb|ABI96947.1|  putative polyphenol oxidase                           85.5    1e-14   
emb|CCD61126.1|  polyphenol oxidase precursor (chloroplast)           85.9    2e-14   
gb|KHN03178.1|  Polyphenol oxidase II, chloroplastic                  84.3    2e-14   
ref|XP_002990879.1|  hypothetical protein SELMODRAFT_11755            84.7    3e-14   
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213           85.1    3e-14   
emb|CAN76259.1|  hypothetical protein VITISV_001925                   85.1    3e-14   
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...  84.3    5e-14   
ref|XP_004170850.1|  PREDICTED: polyphenol oxidase, chloroplastic...  84.0    5e-14   
gb|EYU34165.1|  hypothetical protein MIMGU_mgv1a003246mg              84.3    5e-14   
ref|XP_002443987.1|  hypothetical protein SORBIDRAFT_07g005420        84.3    6e-14   
gb|AAM33417.1|AF507945_1  polyphenol oxidase                          84.0    6e-14   
ref|XP_008809956.1|  PREDICTED: polyphenol oxidase I, chloroplast...  84.0    6e-14   
dbj|BAH36898.1|  polyphenol oxidase                                   84.0    6e-14   
dbj|BAA08234.1|  polyphenol oxidase                                   84.0    6e-14   
dbj|BAH36896.1|  polyphenol oxidase                                   83.6    7e-14   
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...  83.6    7e-14   
dbj|BAA08235.1|  polyphenol oxidase                                   83.6    7e-14   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...  83.6    9e-14   
ref|XP_008809953.1|  PREDICTED: polyphenol oxidase, chloroplastic...  82.8    1e-13   
gb|AFI39662.1|  polyphenol oxidase 1                                  79.7    1e-13   
gb|AFI39661.1|  polyphenol oxidase 1                                  79.7    1e-13   
ref|XP_008371685.1|  PREDICTED: uncharacterized protein At4g04980...  83.2    1e-13   
ref|XP_010645091.1|  PREDICTED: aureusidin synthase-like              82.8    1e-13   
gb|AAT06524.1|  polyphenol oxidase                                    80.5    1e-13   
ref|XP_008801177.1|  PREDICTED: polyphenol oxidase, chloroplastic...  80.9    1e-13   
ref|XP_004965883.1|  PREDICTED: aureusidin synthase-like              82.8    2e-13   
ref|NP_001147867.1|  polyphenol oxidase precursor                     82.4    2e-13   



>ref|XP_009603530.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 141/227 (62%), Gaps = 9/227 (4%)
 Frame = +3

Query  435   NLSSDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSY  614
             +L ++VDR WT+ +TLGGKR  I+DP++L T F  YDE     R++V+DCLD +KLGY++
Sbjct  351   SLHANVDRMWTIWKTLGGKRKDISDPDYLDTEFFFYDEKAKPFRVRVQDCLDEKKLGYTF  410

Query  615   QDLPNPRSKKFEPFTGKNPSSTG---SSLPTATAILP-ATLDETVKFYVTRPPAttstkk  782
             Q +  P  K F+P   KN  +     +S+P A+ + P   LD+ V F V RP       K
Sbjct  411   QPMDTP-WKNFKPLLRKNTKNVKIDPNSVPPASQVFPIKKLDKIVTFSVARP--KKLRTK  467

Query  783   ketedketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSE  959
             KE ED+E +L F  VE D  K +RFD +LNE+ D  + E++  EF GSF N        +
Sbjct  468   KEKEDEEELLTFKNVELDVRKFVRFDVFLNEDNDVIANEIDRTEFVGSFANLPHIHDDPK  527

Query  960   KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             K K    +SL I ++L+DL L G++ + VTLVPK GGD+V++++V+I
Sbjct  528   KEK-FPEFSLAINELLEDLKLEGDDLVVVTLVPKIGGDNVSIEAVEI  573


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 53/118 (45%), Gaps = 12/118 (10%)
 Frame = +3

Query  39   SPILPFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLF  218
             P +P    +  Y LP  S   VR     +DDE   K+  A  ++K   LP D     + 
Sbjct  108  CPPIPDKKDVPCYDLPLVSGFRVRPAAQTVDDEYIAKYNEAYSRMKA--LPTDDPRSFMQ  165

Query  219  KSLHQAGFSPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            ++     +  GA          HF   F  FHR YL+ +E++L ++ GD T  +PYWN
Sbjct  166  QANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFHERILASLIGDPTFALPYWN  223



>gb|ABE96885.1| polyphenol oxidase [Nicotiana tabacum]
Length=502

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 136/221 (62%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+  + LGGKR  +T  +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  279   ANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPM  338

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P    N      SS+P A+ + P + LD  + F + RP ++ + ++K  ++
Sbjct  339   PTPW-RNFKPIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQE  397

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  ++YD++K IRFD +LN +K  N+ E++ AE+AGS+ +       +    T+ 
Sbjct  398   EMLTFN-NIKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV  456

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VT+VPK GG+ ++++ V+I
Sbjct  457   TFQLAITELLEDIGLEDEDTIAVTVVPKTGGEEISIEGVEI  497


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 10/106 (9%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQA-----  236
            YK P+  +  +R    A D+E   K+  A  +++E  + P D   +    ++H A     
Sbjct  39   YKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGA  98

Query  237  ----GFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                G     HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  99   YKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  144



>gb|AGK83468.1| polyphenol oxidase [Nicotiana tabacum]
Length=590

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 136/221 (62%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+  + LGGKR  +T  +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  367   ANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPM  426

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P    N      SS+P A+ + P + LD  + F + RP ++ + ++K  ++
Sbjct  427   PTPW-RNFKPIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQE  485

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  ++YD++K IRFD +LN +K  N+ E++ AE+AGS+ +       +    T+ 
Sbjct  486   EMLTFN-NIKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV  544

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VT+VPK GG+ ++++ V+I
Sbjct  545   TFQLAITELLEDIGLEDEDTIAVTVVPKTGGEEISIEGVEI  585


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 10/106 (9%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQA-----  236
            YK P+  +  +R    A D+E   K+  A  +++E  + P D   +    ++H A     
Sbjct  127  YKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGA  186

Query  237  ----GFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                G     HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  187  YKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  232



>ref|XP_009767375.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=591

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 136/221 (62%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+  + LGGKR  +T  +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  368   ANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPM  427

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P    N      SS+P A+ + P + LD  + F + RP ++ + ++K  ++
Sbjct  428   PTPW-RNFKPIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQE  486

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  ++YD++K IRFD +LN +K  N+ E++ AE+AGS+ +       +    T+ 
Sbjct  487   EMLTFN-NIKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV  545

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VT+VPK GG+ ++++ V+I
Sbjct  546   TFQLAITELLEDIGLEDEDTIAVTVVPKTGGEEISIEGVEI  586


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 56/118 (47%), Gaps = 12/118 (10%)
 Frame = +3

Query  42   PILPFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLF  218
            PI     ++  YK P+  +  +R    A D+E   K+  A  +++E  + P D   +   
Sbjct  117  PIPSDMDSVPCYKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQ  176

Query  219  KSLHQAGFSPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             ++H A +  GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  177  ANIHCA-YCNGAYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  233



>emb|CAA73103.1| polyphenol oxidase [Nicotiana tabacum]
Length=592

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 136/221 (62%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+  + LGGKR  +T  +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  369   ANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPM  428

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P    N      SS+P A+ + P + LD  + F + RP ++ + ++K  ++
Sbjct  429   PTPW-RNFKPIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQE  487

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  ++YD++K IRFD +LN +K  N+ E++ AE+AGS+ +       +    T+ 
Sbjct  488   EMLTFN-NIKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV  546

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VT+VPK GG+ ++++ V+I
Sbjct  547   TFQLAITELLEDIGLEDEDTIAVTVVPKTGGEEISIEGVEI  587


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 12/107 (11%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQAGFSPG  251
            YK P+  +  +R    A D+E   K+  A  +++E  + P D   +    ++H A +  G
Sbjct  129  YKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCA-YCNG  187

Query  252  A----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            A          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  188  AYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  234



>ref|XP_009590067.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 137/221 (62%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+  + LGGKR  +T  +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  365   ANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPM  424

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P    N      SS+P A+ + P + LD  + F + RP ++ + ++K  ++
Sbjct  425   PTPW-RNFKPIRKSNAGKVNLSSVPPASRVFPLSKLDRAISFSIDRPSSSRTQQEKNEQE  483

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  ++YD++K IRFD +LN +K  N+ E++ AE+AGS+ +       +    T+ 
Sbjct  484   EMLTFN-NIKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV  542

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VT+VPK GG+ +++++V+I
Sbjct  543   TFQLAITELLEDIGLEDEDTIAVTVVPKKGGEEISIEAVEI  583



>pir||S34786 catechol oxidase (EC 1.10.3.1) precursor - potato (fragment)
Length=588

 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 134/221 (61%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV DCLD++K+G+SY  +
Sbjct  365   ANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPM  424

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   T     +T S  P       A LD  + F +TRP ++ +T++K  ++
Sbjct  425   PTPW-RNFKPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  483

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  V YD+TK +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+ 
Sbjct  484   EILTFN-KVAYDDTKYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSV  542

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D  L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  543   TFKLAITELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVEI  583


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 18/110 (16%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQA----GF  242
            YK P  ++  +R    A D+E   K+  A  +++E    +D   +D      QA     +
Sbjct  128  YKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRE----LDKDSFDPLGFKQQANIHCAY  183

Query  243  SPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
              GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  CNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  233



>sp|Q06355.1|PPOB_SOLTU RecName: Full=Catechol oxidase B, chloroplastic; AltName: Full=Polyphenol 
oxidase; Short=PPO; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA02879.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=588

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 134/221 (61%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV DCLD++K+G+SY  +
Sbjct  365   ANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPM  424

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   T     +T S  P       A LD  + F +TRP ++ +T++K  ++
Sbjct  425   PTPW-RNFKPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  483

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  V YD+TK +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+ 
Sbjct  484   EILTFN-KVAYDDTKYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSV  542

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D  L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  543   TFKLAITELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVEI  583


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 18/110 (16%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQA----GF  242
            YK P  ++  +R    A D+E   K+  A  +++E    +D   +D      QA     +
Sbjct  128  YKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRE----LDKDSFDPLGFKQQANIHCAY  183

Query  243  SPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
              GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  CNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  233



>ref|XP_010325653.1| PREDICTED: polyphenol oxidase E, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 133/221 (60%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +TD +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  364   ANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPM  423

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   +     +T S  P +     A LD  + F +TRP ++ +T++K  ++
Sbjct  424   PTPW-RNFKPIRKSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  482

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  + YD+   +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+ 
Sbjct  483   EILTFN-KISYDDRNYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSV  541

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  542   TFKLAITELLEDIGLEDEDTIAVTLVPKAGGEEVSIESVEI  582


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 10/106 (9%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQA-----  236
            YK P+ ++  +R    A D+E   K+  A  +++E  + P D   +    ++H A     
Sbjct  127  YKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGA  186

Query  237  ----GFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                G     HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  187  YKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  232



>gb|ADG56700.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=601

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 134/224 (60%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  376   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  435

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  436   PTPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  494

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  495   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  553

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++ V+I+
Sbjct  554   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGVEIS  597


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  130  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  188

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  189  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  236



>sp|Q08307.1|PPOE_SOLLC RecName: Full=Polyphenol oxidase E, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78299.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=587

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 133/221 (60%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +TD +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  364   ANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPM  423

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   +     +T S  P +     A LD  + F +TRP ++ +T++K  ++
Sbjct  424   PTPW-RNFKPIRKSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  482

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  + YD+   +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+ 
Sbjct  483   EILTFN-KISYDDRNYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSL  541

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  542   TFKLAITELLEDIGLEDEDTIAVTLVPKAGGEEVSIESVEI  582


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 10/106 (9%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQA-----  236
            YK P+ ++  +R    A D+E   K+  A  +++E  + P D   +    ++H A     
Sbjct  127  YKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGA  186

Query  237  ----GFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                G     HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  187  YKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  232



>ref|XP_004246033.1| PREDICTED: polyphenol oxidase F, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 135/221 (61%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  364   ANVDRMWNEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPM  423

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   +     +T S  P +     A LD  + F +TRP ++ +T++K  ++
Sbjct  424   PTPW-RNFKPIRRSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  482

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  + YD+TK +RFD +LN +K  N+ E++ AEFAGS+ +       ++      
Sbjct  483   EILTFN-KMAYDDTKYVRFDVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNNDNHVKDV  541

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T++L I ++L+D+ L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  542   TFTLAITELLEDIGLEDEDTIAVTLVPKVGGEGVSIESVEI  582


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 12/107 (11%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQAGFSPG  251
            YK P  ++  +R    A D+E   K+  A  +++E  + P D   +    ++H A +  G
Sbjct  127  YKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCA-YCNG  185

Query  252  A----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            A          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  186  AYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  232



>gb|AEO00529.1| polyphenol oxidase [Nicotiana benthamiana]
Length=588

 Score =   152 bits (384),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 136/221 (62%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+  + LGGKR  +T+ +WL + F  YDEN N  R+KV DCL ++K+G+ Y  +
Sbjct  365   ANVDRMWSEWKALGGKRRDLTNKDWLNSEFFFYDENRNPFRVKVRDCLHSKKMGFDYAPM  424

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P    N      SS+P A+ + P + LD  + F + RP ++ + ++K  ++
Sbjct  425   PTPW-RNFKPTRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQE  483

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  ++YD++K IRFD +LN +K  N+ E++ AE+AGS+ +       +    T+ 
Sbjct  484   EMLTFN-NIKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNATHVTSV  542

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VT+VPK GG+ ++++ V+I
Sbjct  543   TFQLAITELLEDIGLEDEDAIAVTVVPKTGGEEISIQGVEI  583


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 12/107 (11%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQAGFSPG  251
            YK P+  +  +R    A D+E   K+  A  +++E  + P D   +    ++H A +  G
Sbjct  125  YKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCA-YCNG  183

Query  252  A----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            A          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  AYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  230



>ref|XP_009628381.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   152 bits (383),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 140/226 (62%), Gaps = 9/226 (4%)
 Frame = +3

Query  438   LSSDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             L ++VDR WT+ +TLGGKR  I+DP++L T F  YDE     R++V DCLD +KLGY++Q
Sbjct  352   LHANVDRMWTIWKTLGGKRKDISDPDYLDTEFFFYDEKAKPFRVRVRDCLDEKKLGYTFQ  411

Query  618   DLPNPRSKKFEPFTGKNPSSTG---SSLPTATAILP-ATLDETVKFYVTRPPAttstkkk  785
              +  P  K F+P   KN  +     +S+P A+ + P   LD+TV F V RP       KK
Sbjct  412   PMDIP-WKNFKPQPRKNKKNVKIDPNSVPPASQVFPIKKLDKTVTFSVARP--KRLRTKK  468

Query  786   etedketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEK  962
             E ED+E +L F  VE D  K +RFD +LNE+ D  + E++  EF GSF N        +K
Sbjct  469   EKEDEEELLTFKNVELDVRKFVRFDVFLNEDNDVIANEIDRTEFVGSFANLPHIHDDPKK  528

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              K    +SL I ++L+DL L G++ + VTLVPK GG++V++++V+I
Sbjct  529   EK-FPEFSLAINELLEDLKLEGDDLVVVTLVPKSGGENVSIEAVEI  573


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 52/118 (44%), Gaps = 12/118 (10%)
 Frame = +3

Query  39   SPILPFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLF  218
             P +P    +  Y  P  SR  VR     +DDE   K+  A  ++K   LP D     + 
Sbjct  108  CPPIPEIKDVPYYNPPPVSRFRVRPAAHTVDDEYIAKYNEAYSRMKA--LPTDDPRSFMQ  165

Query  219  KSLHQAGFSPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            ++     +  GA          HF   F  FHR Y++ YE++L ++  D T  +PYWN
Sbjct  166  QANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYIYFYERILASLIDDPTFALPYWN  223



>sp|Q08296.1|PPOF_SOLLC RecName: Full=Polyphenol oxidase F, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78300.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=585

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 134/221 (61%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV DCLD++K+G+ Y  +
Sbjct  362   ANVDRMWNEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYPPM  421

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   +     +T S  P +     A LD  + F +TRP ++ +T++K  + 
Sbjct  422   PTPW-RNFKPIRRSSSGKVNTASIAPVSKVFPLAKLDRAISFSLTRPASSRTTQEKNEQQ  480

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  + YD+TK +RFD +LN +K  N+ E++ AEFAGS+ +       ++      
Sbjct  481   EILTFN-KMAYDDTKYVRFDVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNNDNHVKDV  539

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T++L I ++L+D+ L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  540   TFTLAITELLEDIGLEDEDTIAVTLVPKVGGEGVSIESVEI  580


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 12/107 (11%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQAGFSPG  251
            YK P  ++  +R    A D+E   K+  A  +++E  + P D   +    ++H A +  G
Sbjct  127  YKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCA-YCNG  185

Query  252  A----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            A          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  186  AYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  232



>gb|AFJ79642.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=590

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 132/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  365   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  424

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  425   PTPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  483

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  484   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  542

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  543   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATIS  586


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  122  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  180

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  181  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  228



>gb|ACR61398.1| polyphenol oxidase [Solanum melongena]
Length=593

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 132/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  368   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  427

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  428   PRPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  486

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  487   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  545

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  546   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATIS  589


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  125  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  183

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  231



>gb|AFJ79643.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=595

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 132/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  370   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  429

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  430   PRPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  488

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  489   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  547

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  548   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATIS  591


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  126  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  184

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  185  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  232



>gb|AFJ79639.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=594

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 132/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  369   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  428

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  429   PTPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  487

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  488   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  546

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  547   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATIS  590


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  125  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  183

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  231



>gb|AFJ79640.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=595

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 132/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  370   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  429

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  430   PRPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  488

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  489   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  547

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  548   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATIS  591


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  126  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  184

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  185  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  232



>gb|AFJ79641.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=594

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 132/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  369   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  428

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  429   PRPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  487

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK--T  971
             +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  488   EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  546

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  547   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATIS  590


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R+   A D+E   K+  A+ ++K  +   P++   +    ++H A +  
Sbjct  125  YKFPSMTKLRIRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCA-YCN  183

Query  249  GA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            GA          H    F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  GAYKIGDKVLQVHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWN  231



>gb|AAB22610.1| polyphenoloxidase (chloroplast) [Solanum lycopersicum]
Length=587

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 132/221 (60%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +TD +WL + F  YDEN N  R+KV D LD++K+G+ Y  +
Sbjct  364   ANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDVLDSKKMGFDYAPM  423

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   +     +T S  P +     A LD  + F +TRP ++ +T++K  ++
Sbjct  424   PTPW-RNFKPIRKSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  482

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  + YD+   +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+ 
Sbjct  483   EILTFN-KISYDDRNYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSV  541

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E+ I VTL+PK GG+ V+++SV+I
Sbjct  542   TFKLAITELLEDIGLEDEDTIAVTLIPKAGGEGVSIESVEI  582


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 10/106 (9%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQA-----  236
            YK P+ ++  +R    A D+E   K+  A  +++E  + P D   +    ++H A     
Sbjct  127  YKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGA  186

Query  237  ----GFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                G     HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  187  YKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  232



>gb|AAA02877.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=583

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 137/222 (62%), Gaps = 6/222 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV D LD++K+G+SY  +
Sbjct  360   ANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPM  419

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   T     +T S  P       A LD  + F +TRP ++ +T++K  ++
Sbjct  420   PTPW-RNFKPIRKTTAGIVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  478

Query  798   ketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             +  +L F  + YD+T+ +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+
Sbjct  479   E--ILTFKKIAYDDTQYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHATS  536

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T+++ I ++L+D+ L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  537   VTFTVAITELLEDIGLEDEDTIAVTLVPKVGGEGVSIESVEI  578


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 18/110 (16%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQA----GF  242
            YK P+ ++  +R    A D+E   K+  A  +++E    +D   +D      QA     +
Sbjct  123  YKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRE----LDKDSFDPLGFKQQANIHCAY  178

Query  243  SPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
              GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  179  CNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  228



>ref|XP_004246032.1| PREDICTED: polyphenol oxidase B, chloroplastic [Solanum lycopersicum]
 sp|Q08304.1|PPOB_SOLLC RecName: Full=Polyphenol oxidase B, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78296.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=596

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 134/225 (60%), Gaps = 11/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W   + +GGKR  I++ +WL + F  YDE+ N  R+KV DCLD +K+GY Y  +
Sbjct  372   GNVDRMWNEWKAIGGKRRDISEKDWLNSEFFFYDEHKNPYRVKVRDCLDTKKMGYDYAPM  431

Query  624   PNPRSKKFEPFTGKNPSSTG----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkke  788
             P P  + F+P   K+ +S G    S+LP A  + P A +D+T+ F + RP ++ + ++K 
Sbjct  432   PTPW-RNFKP---KSKASVGKVNTSTLPPANEVFPLAKMDKTISFAINRPASSRTQQEKN  487

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKT  965
              +++    N  + YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G    
Sbjct  488   EQEEMLTFN-NIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGENDH  546

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  + L I ++L+D+ L  E+ I VTLVPK GG+ +++++V+I
Sbjct  547   IAKVNFQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIENVEI  591


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 23/131 (18%)
 Frame = +3

Query  36   DSPILPFSG----------TITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKE--  179
            D P++P+S           TI  YK P+ ++  +R    A+D+E   K+  A+ ++++  
Sbjct  105  DGPLVPYSCCPPPMPTNFDTIPYYKFPSMTKLRIRTPAHAVDEEYIAKYNLAISRMRDLD  164

Query  180  RRLPVDHADYDLFKSLHQAGFSPGA----------HFGASFVAFHRMYLFMYEKMLQNVA  329
            +  P++   +    ++H A +  GA          H    F  FHR YL+ YE++L  + 
Sbjct  165  KTEPLNPLGFKQQANIHCA-YCNGAYIIGGKELQVHNSWLFFPFHRWYLYFYERILGKLI  223

Query  330  GDSTIFVPYWN  362
             D T  +PYWN
Sbjct  224  DDPTFALPYWN  234



>ref|XP_006355239.1| PREDICTED: catechol oxidase B, chloroplastic [Solanum tuberosum]
Length=589

 Score =   145 bits (367),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 132/221 (60%), Gaps = 4/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV D LD++K+G+SY  +
Sbjct  366   ANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPM  425

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P   T     +T S  P       A LD  + F +TRP ++ +T++K  ++
Sbjct  426   PTPW-RNFKPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQE  484

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +    N  + YD+T+ +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+ 
Sbjct  485   EILTFN-KIAYDDTQYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSV  543

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              + L I ++L+D  L  E+ I VTLVPK GG+ V+++SV+I
Sbjct  544   IFKLAITELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVEI  584


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 18/110 (16%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQA----GF  242
            YK P  ++  +R    A D+E   K+  A  +++E    +D   +D      QA     +
Sbjct  129  YKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRE----LDKDSFDPLGFKQQANIHCAY  184

Query  243  SPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
              GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  185  CNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  234



>ref|XP_004246030.1| PREDICTED: polyphenol oxidase D, chloroplastic [Solanum lycopersicum]
Length=591

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 129/223 (58%), Gaps = 5/223 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  +  GGKR  IT  +WL + F  YDEN N  R+KV DCLD +K+GY Y+ +
Sbjct  367   SNVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPM  426

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
               P  + F+P T  +      SS+P  +   P A LD+ V F + RP ++ + ++K  ++
Sbjct  427   ATPW-RNFKPLTKASAGKVNTSSIPPVSQAFPLAKLDKAVSFSINRPTSSRTPQEKNAQE  485

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTT  974
             +    N  + YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G      T
Sbjct  486   EMLTFN-SIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGETNHIAT  544

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
               + L I ++L+D+ L  E+ I VTLVPK GG+ +++++  I+
Sbjct  545   VDFQLAITELLEDIGLEDEDTIAVTLVPKRGGEGISIENATIS  587



>gb|ADY18411.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=586

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  + D +WL +    YDEN N  ++KV DCLD++K+G+ Y  +
Sbjct  363   ANVDRMWNEWKAIGGKRRDLADKDWLNSESFFYDENRNPFKVKVRDCLDSKKMGFDYAPM  422

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILP-ATLDETVKFYVTRPPAttstkkkete  794
             P P  + F+P   T    ++ GS +P A+ + P A LD  + F + RP ++ +  +K  +
Sbjct  423   PTPW-RNFKPIRKTTSGKANIGS-IPPASKVFPIAKLDRAISFSINRPASSRTQAEKNEQ  480

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             ++    N  V+YD+++ +RFD +LN +K  N+ E++ AEFAGS+ +       +    T+
Sbjct  481   EEILTFN-KVKYDDSQYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGDNNTHVTS  539

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              T++L I ++L+D+ L  E+ I +TLVPK GG+ +++ + +I 
Sbjct  540   VTFNLAITELLEDIGLEDEDTIALTLVPKQGGEGISIDNAEIV  582



>sp|Q08306.2|PPOD_SOLLC RecName: Full=Polyphenol oxidase D, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78298.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=591

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 129/223 (58%), Gaps = 5/223 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  +  GGKR  IT  +WL + F  YDEN N  R+KV DCLD +K+GY Y+ +
Sbjct  367   SNVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPM  426

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
               P  + F+P T  +      SS+P  +   P A LD+ V F + RP ++ + ++K  ++
Sbjct  427   RTPW-RNFKPLTKASAGKVNTSSIPPVSQAFPLAKLDKAVSFSINRPTSSRTPQEKNAQE  485

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTT  974
             +    N  + YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G      T
Sbjct  486   EMLTFN-SIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGETNHIAT  544

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
               + L I ++L+D+ L  E+ I VTLVPK GG+ +++++  I+
Sbjct  545   VDFQLAITELLEDIGLEDEDTIAVTLVPKRGGEGISIENATIS  587



>gb|ACT22523.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=600

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 134/223 (60%), Gaps = 5/223 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W   + +GGKR  I+  +WL + F  +DEN N  R++V DCLD + +GY Y  +
Sbjct  376   SNVDRMWNEWKQIGGKRRDISQRDWLNSEFFFFDENKNPYRVRVRDCLDTKTMGYDYAPM  435

Query  624   PNPRSKKFEPFT-GKNPSSTGSSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
             P P  + F+P T   +  +  S+ P A+ + P A +D+ + F + RP ++ + ++K  ++
Sbjct  436   PTPW-RNFKPKTKASSGKANTSAFPPASQVFPLAKMDKVITFSIKRPASSRTQQEKNEKE  494

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT-T  974
             +    N  ++YD  + +RFD +LN + + N+ E++ AEFAGS+ +     + S+     T
Sbjct  495   EMLTFN-NIKYDNREYVRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRASQTDHVAT  553

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              T  L I ++L+D+ L  E+ I VTLVPK GG+ ++++ V+I+
Sbjct  554   ATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGVEIS  596


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 53/111 (48%), Gaps = 13/111 (12%)
 Frame = +3

Query  66   ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFK---SLHQA  236
            I  YK P+ ++  +R+   A+D+E   K+  A+ K++E     DH     FK   ++H A
Sbjct  128  ILYYKFPSATKLRIRQPAHAVDEELIAKYNLAISKMRELDT-TDHFSPLAFKQQANIHCA  186

Query  237  GFSPGAHFGAS---------FVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
              +     G           F  FHR YL+ YE++L  +  D T  +PYWN
Sbjct  187  YCNGAYKIGGKELQVHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWN  237



>ref|XP_009624738.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=601

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 132/226 (58%), Gaps = 11/226 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WT+ +TLGGKR  I  P++L + F  YDE  N   +KV DCLDN+K+GY +Q +
Sbjct  377   ANVDRMWTIWKTLGGKRKDINKPDYLNSEFFFYDEKKNPFLVKVRDCLDNKKMGYDFQAM  436

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILP-ATLDETVKFYVTRPPAttstkkketedk  800
             P P  + F+P           S+P  T   P A +D+ + F + R   T+   ++E + +
Sbjct  437   PTPW-RNFKPLKKSKSKVNARSVPPVTQTFPIAKIDKAITFSIKR--ETSGRTQQEKDAE  493

Query  801   etVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK---  968
             E +L F  +  D+ K+IRFD ++N + ++N  E++ AEFAGS+   A P   S+ TK   
Sbjct  494   EEMLTFLELNIDQRKHIRFDVFINADANSNWYELDRAEFAGSYT--ALPHVHSDPTKPHV  551

Query  969   -TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                  + L I ++L+++ L  E+ I VTLVPK GG+ V +KS  IT
Sbjct  552   APIAKFQLAITELLEEIGLEDEDDIVVTLVPKTGGEFVAIKSAVIT  597


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (49%), Gaps = 13/111 (12%)
 Frame = +3

Query  66   ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRL--PVDHADYDLFKSLHQAG  239
            I  Y  PT S+  +R    A+D+E   K+  A+ K+KE  +  P D   +     +H A 
Sbjct  131  IPHYTFPTGSKLRIRPASHAVDEEYMAKYNLAITKMKELDVTDPDDPRGFAAQAKIHCA-  189

Query  240  FSPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            +  GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  190  YCNGAYTVAGKELQIHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  240



>gb|ADY18412.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=584

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  + D +WL + F  YDEN N  ++KV DCLD++K+G+ Y  +
Sbjct  361   ANVDRMWNEWKAIGGKRRDLADKDWLNSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPM  420

Query  624   PNPRSKKFEPF--TGKNPSSTGSSLPTATAILP-ATLDETVKFYVTRPPAttstkkkete  794
             P P  + F+P   T    ++ G S+P A+ + P A LD  + F + R  ++ +  +K  +
Sbjct  421   PTPW-RNFKPIRKTTSGKANIG-SIPPASKVFPIAKLDRAISFSINRSASSRTQAEKNEQ  478

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             ++    N  V+YD+++ +RFD +LN +K  N+ E++  EFAGS+ +       +    T+
Sbjct  479   EEILTFN-KVQYDDSQCVRFDVFLNVDKTVNADELDKPEFAGSYTSLPHVHGDNNTHVTS  537

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              T+ L I ++L+D+ L  E+ I VTLVPK GG+ +++++ +I 
Sbjct  538   VTFKLVITELLEDIGLEDEDTIAVTLVPKEGGEGISIENAEIV  580



>gb|AAA85121.1| polyphenol oxidase [Solanum tuberosum]
Length=597

 Score =   143 bits (360),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 129/223 (58%), Gaps = 5/223 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  +  GGKR  IT  +WL + F  YDEN N  R+KV DCLD +K+GY Y+ +
Sbjct  373   SNVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPI  432

Query  624   PNPRSKKFEPFTGKNPSSTGS-SLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
               P  + F+P T  +     + SLP A+ + P A LD+ + F + RP ++ + ++K  ++
Sbjct  433   ATPW-RNFKPLTKASAGKVNTASLPPASNVFPLAKLDKAISFSINRPTSSRTQQEKNAQE  491

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTT  974
             +    +  + YD    IRFD + N + + N+ E++ AEFAGS+ +     R G      T
Sbjct  492   EMLTFS-SIRYDNRGYIRFDVFSNVDNNVNANELDKAEFAGSYTSLPHVHRAGETNHIAT  550

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
               + L I ++L+D+ L  E+ I VTLVPK GG+ ++++   I+
Sbjct  551   VDFQLAITELLEDIGLEDEDTIAVTLVPKRGGEGISIEGATIS  593



>gb|AAA85123.1| polyphenol oxidase, partial [Solanum tuberosum]
Length=223

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 124/218 (57%), Gaps = 12/218 (6%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLP  626
             +VDR W   + +GGKRA I + +WL + F  YDE+ N  ++KV DCLD +K+GY Y+ +P
Sbjct  1     NVDRMWNEWKAIGGKRADIQNKDWLNSEFFFYDESGNPFKVKVRDCLDTKKMGYDYEPMP  60

Query  627   NPRSKKFEPFTGKNPSSTG-----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkke  788
                   +  F  K  +S G     SS+P A+ + P A LD+ + F + RP ++ + ++K 
Sbjct  61    TT----WRNFKPKTKASAGKKVNTSSIPPASQVFPLAKLDKAISFSINRPASSRTQQEKN  116

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKT  965
              +++    N  ++YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G    
Sbjct  117   AQEEMLTFN-EIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDTNH  175

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSV  1079
               T T  L I ++L+D+ L  +  I VTLVPK G  S+
Sbjct  176   TATATLQLTITELLEDIGLEDDETIAVTLVPKKGNISI  213



>ref|XP_009791071.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=600

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 133/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WT+ +TLGGKR  I  P++L T F  YDE  N   +KV DCLDN+K+GY +Q +
Sbjct  376   ANVDRMWTIWKTLGGKRKDINKPDYLNTEFFFYDEKKNPYLVKVRDCLDNKKMGYDFQAM  435

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILP-ATLDETVKFYVTRPPAttstkkketedk  800
             P P  + F+P           S+ +AT   P A +D+ + F + R   T+   ++E + K
Sbjct  436   PTPW-RNFKPLKKSKSKVNARSVQSATQTFPIAKIDKPITFSIKR--ETSGRTQQEKDAK  492

Query  801   etVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK---  968
             E +L F  +  D+ K+IRFD ++N + ++N  E++ AEFAGS+   A P   S+ +K   
Sbjct  493   EEMLTFLELNIDQRKHIRFDVFINADANSNWHELDRAEFAGSYT--ALPHVHSDPSKPHV  550

Query  969   -TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                  + L I ++L+++ L  E+ I VTLVPK GG+ V +KS  IT
Sbjct  551   APVAKFQLAITELLEEIGLEDEDDIVVTLVPKTGGEFVAIKSAVIT  596


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 55/111 (50%), Gaps = 13/111 (12%)
 Frame = +3

Query  66   ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRL--PVDHADYDLFKSLHQAG  239
            I  YK PT S+  +R    A+D+E   K+  A+ K+KE  +  P D   +     +H A 
Sbjct  130  IPYYKFPTGSKLRIRPASHAVDEEYMAKYNLAITKMKELDVTDPDDPRGFTAQAKIHCA-  188

Query  240  FSPGA----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            +  GA          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  189  YCNGAYTVAGKELQIHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWN  239



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 132/229 (58%), Gaps = 16/229 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W V +TLGGKR   TDP+WL  SF+ YDEN+ LVR+KV D LD+ KLGY+YQD+
Sbjct  375   SNIDRMWNVWKTLGGKRQDFTDPDWLDASFLFYDENSQLVRVKVRDSLDSRKLGYTYQDI  434

Query  624   --------PNPRS--KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtts  773
                     P PR    K +    +   +     PTA    P TLD+ VK  V+RP  + S
Sbjct  435   ELPWLNTRPRPRRVVDKVKRAFARIGVARADEYPTAN--FPLTLDKPVKTLVSRPKKSRS  492

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              K+K+  D+  V+   +E+D    I+FD ++N+  DA +   + +EFAGSF++   P + 
Sbjct  493   KKEKDEADEVLVIQ-GIEFDRNVPIKFDVFINDEDDALT-GPDKSEFAGSFVSV--PHRH  548

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               KTK  T   L+I ++L+DL    +  + VTLVPK G   V++  + I
Sbjct  549   KSKTKMNTGLRLDITELLEDLDAEEDENVVVTLVPKVGIGHVSIGGLKI  597



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 134/231 (58%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WTV + LGGKR   TDP+WL   FV YDEN  LVR+KV DCLD  KL Y+YQ++
Sbjct  372   SNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCLDPTKLRYAYQEV  431

Query  624   --------PNPRS---KKFEPFTGKNPSSTGSSLPTATAIL-PATLDETVKFYVTRPPAt  767
                     P PR    K       K+  +  + +P++++I+ P  LD T++  V RP  +
Sbjct  432   DIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKS  491

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  V+   +E +  K ++FD ++N+  D  S   +  EFAGSF+N   P 
Sbjct  492   RSKKEKEDEEEVLVIKG-IELERDKFVKFDIFINDEDDPVS-RPDNTEFAGSFVNV--PH  547

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             Q S   K  T   + I+++L+DL    ++ + VTLVP+ G D +T+  ++I
Sbjct  548   QHSHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVITIGGIEI  598



>ref|XP_006365383.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase D, chloroplastic-like 
[Solanum tuberosum]
Length=631

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 139/250 (56%), Gaps = 16/250 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+  +  GGKR  IT  +WL + F  YDE+ N  ++KV DCLD +K+GY Y+ +
Sbjct  373   SNVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDESGNPFKVKVRDCLDTKKMGYDYEPM  432

Query  624   PNPRSKKFEPFTGKNPSSTG-----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkk  785
             P P  + F+P   K  +S G     SS+P  + + P A LD+ + F + RP ++ + ++K
Sbjct  433   PTPW-RNFKP---KTKASAGKKVNTSSIPPVSQVFPLAKLDKAISFSINRPASSRTQQEK  488

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEK  962
               +++    N  ++YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G   
Sbjct  489   NAQEEMLTFN-EIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDTN  547

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDITG*DSHCTMNSGSC  1142
                T T  L I ++L+D+ L  +  I VTLVPK GG  +++  V+I   D  C +  G  
Sbjct  548   HTATATLQLAITELLEDIGLEDDETIAVTLVPKKGG--ISIGGVEIKLAD--CXLXCGVN  603

Query  1143  VCVLRYEILY  1172
             +  L   I Y
Sbjct  604   LLRLHDMICY  613



>ref|XP_006365382.1| PREDICTED: polyphenol oxidase B, chloroplastic-like [Solanum 
tuberosum]
Length=598

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 129/221 (58%), Gaps = 5/221 (2%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLP  626
             +VDR W   + +GGKR  +++ +WL + F  YDEN    R+KV DCLD +K+GY Y  +P
Sbjct  375   NVDRMWNEWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMP  434

Query  627   NPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketedk  800
              P  + F+P T  +      SSLP    + P A +D+ + F + RP ++ + ++K  +++
Sbjct  435   TPW-RNFKPKTKVSAGKVNTSSLPPVNEVFPLAKMDKVISFSINRPASSRTQQEKNEQEE  493

Query  801   etVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTTT  977
                 +  ++YD    IRFD +LN + + N+ E++  EFAGS+ +     R G      T 
Sbjct  494   MLTFD-NIKYDNRGYIRFDVFLNVDNNVNANELDKVEFAGSYTSLPHVHRVGENDHTATV  552

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D+ L  E  I VTLVPK GG+ +++++V+I
Sbjct  553   TFQLAITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEI  593


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (50%), Gaps = 11/107 (10%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE--RRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  +R    A+D+E   K+  A+ ++K+  +  P++   +    ++H A  + 
Sbjct  130  YKFPSMTKLRIRSPAHAVDEEYIAKYNLAISRMKDLDKTEPLNPLGFKQQANIHCAYCNG  189

Query  249  GAHFGAS---------FVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
               FG           F  FHR YL+ YE++L  +  D T  +PYWN
Sbjct  190  AYVFGDKVLQVHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWN  236



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 134/231 (58%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WTV + LGGKR   TDP+WL   FV YDEN  LVR+KV DCLD  KL Y+YQ++
Sbjct  371   SNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCLDPTKLRYAYQEV  430

Query  624   --------PNPRS---KKFEPFTGKNPSSTGSSLPTATAIL-PATLDETVKFYVTRPPAt  767
                     P PR    K       K+  +  + +P++++I+ P  LD T++  V RP  +
Sbjct  431   DIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKS  490

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  V+   +E +  K ++FD ++N+  D  S   +  EFAGSF+N   P 
Sbjct  491   RSKKEKEDEEEVLVIKG-IELERDKFVKFDIFINDEDDPVS-RPDNTEFAGSFVNV--PH  546

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             Q S   K  T   + I+++L+DL    ++ + VTLVP+ G D +T+  ++I
Sbjct  547   QHSHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVITIGGIEI  597



>gb|AAA85122.1| polyphenol oxidase [Solanum tuberosum]
Length=599

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 132/224 (59%), Gaps = 11/224 (5%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLP  626
             +VDR W   + +GGKR  +++ +WL + F  YDEN    R+KV DCLD +K+GY Y  +P
Sbjct  376   NVDRMWNEWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMP  435

Query  627   NPRSKKFEPFTGKNPSSTG----SSLPTATAILPAT-LDETVKFYVTRPPAttstkkket  791
              P  + F+P   K  +S G    ++LP    + P T +D+ + F + RP ++ + ++K  
Sbjct  436   TPW-RNFKP---KTKASVGKVNTTTLPPVNKVFPLTKMDKAISFSINRPASSRTQQEKNE  491

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTK  968
             +++    +  ++YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G     
Sbjct  492   QEEMLTFD-NIKYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGENDHT  550

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T T+ L I ++L+D+ L  E  I VTLVPK GG+ +++++V+I
Sbjct  551   ATVTFQLAITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEI  594


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 23/131 (18%)
 Frame = +3

Query  36   DSPILPFSG----------TITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKE--  179
            D P++P++           TI  YK P+ ++  +R    A+D+E   K+  A+ ++K+  
Sbjct  108  DGPLVPYTCCPPPMPTNFDTIPYYKFPSMTKLRIRPPAHAVDEEYIAKYNLAISRMKDLD  167

Query  180  RRLPVDHADYDLFKSLHQAGFSPGA----------HFGASFVAFHRMYLFMYEKMLQNVA  329
            +  P++   +    ++H A +  GA          H    F  FHR YL+ YE++L  + 
Sbjct  168  KTDPLNPLGFKQQANIHCA-YCNGAYIIGGKELQVHNSWLFFPFHRWYLYFYERILGKLI  226

Query  330  GDSTIFVPYWN  362
             D T  +PYWN
Sbjct  227  DDPTFALPYWN  237



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 137/225 (61%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ +DEN  LVR+KV+D LD +KLGY +QD
Sbjct  358   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQD  417

Query  621   LPNP--RSKKFEPFTGKNPSSTG---SSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P   ++     T +  SS     S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLTTRATPKLTRQEKSSRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     +M+EFAGSF+N   P + ++K+
Sbjct  478   EDEDEVLVIE-GIEYEENQLIKFDVLVNDEPDSPG-GPDMSEFAGSFVNV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VT VP+ GGDSVTV +V I
Sbjct  534   KTTMV--LGITGLLEDLEAEGDDTLVVTFVPRTGGDSVTVANVKI  576



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 133/231 (58%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WTV + LGGKR   TDP+WL   FV YDEN  LVR+KV DCLD  KL Y+Y ++
Sbjct  371   SNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCLDPTKLRYAYHEV  430

Query  624   --------PNPRS---KKFEPFTGKNPSSTGSSLPTATAIL-PATLDETVKFYVTRPPAt  767
                     P PR    K       K+  +  + +P++++I+ P  LD T++  V RP  +
Sbjct  431   DIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKS  490

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  V+   +E +  K ++FD ++N+  D  S   +  EFAGSF+N   P 
Sbjct  491   RSKKEKEDEEEVLVIKG-IELERDKFVKFDIFINDEDDPVS-RPDNTEFAGSFVNV--PH  546

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             Q S   K  T   + I+++L+DL    ++ + VTLVP+ G D +T+  ++I
Sbjct  547   QHSHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVITIGGIEI  597



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   140 bits (352),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 135/225 (60%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ +DEN  LVR+KV+D LD +KL Y +QD
Sbjct  358   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQD  417

Query  621   LPNPRSK-----KFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  K     KF        S+  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLKARATPKFTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSFIN   P + ++K+
Sbjct  478   EDEDEVLVIEG-IEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFINV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VTLVP+ GGDSVTV +V I
Sbjct  534   KTTMV--LGITGLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKI  576



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 135/225 (60%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ +DEN  LVR+KV+D LD +KL Y +QD
Sbjct  358   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQD  417

Query  621   LPNPRSK-----KFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  K     KF        S+  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLKARATPKFTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSFIN   P + ++K+
Sbjct  478   EDEDEVLVIE-GIEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFINV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VTLVP+ GGDSVTV +V I
Sbjct  534   KTTMV--LGITGLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKI  576



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 128/230 (56%), Gaps = 14/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +++DR W++ +TLGG+R   TD +WL +SF  YDEN +LVR+KV DCLD++ LGY YQD+
Sbjct  371   ANIDRMWSIWKTLGGRRKDFTDKDWLDSSFSFYDENADLVRVKVRDCLDSKNLGYVYQDV  430

Query  624   PNP-----------RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
               P           +S++      ++ +     +P A  + PA+LD+ +K  V RP  + 
Sbjct  431   KIPWLKTKPSSKSEKSRRKAEHHKRDVARADEHIPFAKDVFPASLDKVIKVLVPRPKKSR  490

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             + K+KE E++  V+   +E      ++FD ++N+  D      +  EFAGSF+N   P  
Sbjct  491   NKKQKEEEEEILVVEG-IEVKSDLFVKFDVFVNDEDDGVRATADKTEFAGSFVNV--PHN  547

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                     T   L I+++L+DL    ++ + VTLVPK  G  V++K + I
Sbjct  548   HKHGKNVKTRLRLGISELLEDLGAEDDDNVLVTLVPKTKGGEVSIKRIKI  597



>gb|AAK53414.1|AF368291_1 polyphenol oxidase [Populus tremuloides]
Length=563

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 134/224 (60%), Gaps = 12/224 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +T+ GG R  ITDP+WL + F+ Y+EN  LVR KV DCLDN +L Y+YQ+
Sbjct  342   SNVDRMWTIWKTIPGGLRRDITDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQN  401

Query  621   LPNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
             +  P  +SK      GK  + T ++L   TA  P  LD+T+   V+RP  + S K+KE E
Sbjct  402   VEIPWLKSKPIPRRLGKKAAETKTALTPITA-FPLVLDKTIVTVVSRPKKSRSRKEKEEE  460

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             D+  V+   +EYD  K +RFD ++N++ +  S + E  EFAGSF+N +  R    KT+  
Sbjct  461   DEVLVIEG-IEYDNDKFVRFDVFINDDLEIPS-KPENTEFAGSFVNVSHKRAKKSKTRLI  518

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGG--DSVTVKSVDI  1100
                 L I ++L+DL   G++ I V LVP+  G  D V +  V I
Sbjct  519   ----LGITELLEDLETDGDDSIVVALVPRSNGVSDPVVISGVKI  558



>sp|Q08303.2|PPOA_SOLLC RecName: Full=Polyphenol oxidase A, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78295.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=630

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 140/265 (53%), Gaps = 17/265 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W   +  GGKR  I + +WL + F  YDEN N  +++V DCLD +K+GY Y   
Sbjct  371   SNVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHAT  430

Query  624   PNPRSKKFEPFTGKNPSSTGS-SLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
               P  + F+P T  +     + S+P  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  431   ATPW-RNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQE  489

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTT  974
             +    N  ++YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G  K   T
Sbjct  490   EVLTFN-AIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTAT  548

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDITG*DSHCTMNSGSCVCVL  1154
              T  L I ++L+D+ L  E+ I VTLVPK G   +++  V+I        +     VCV+
Sbjct  549   ATLRLAITELLEDIGLEDEDTIAVTLVPKKG--DISIGGVEI-------KLAIVKLVCVV  599

Query  1155  RYEILYVKQISNC---VLSCEILCL  1220
                 L + +   C   V  C  +CL
Sbjct  600   NLLTLQLNKDRFCYDSVFVCWFVCL  624



>sp|Q08305.1|PPOC_SOLLC RecName: Full=Polyphenol oxidase C, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78297.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=626

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 140/265 (53%), Gaps = 17/265 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W   +  GGKR  I + +WL + F  YDEN N  +++V DCLD +K+GY Y   
Sbjct  367   SNVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHAT  426

Query  624   PNPRSKKFEPFTGKNPSSTGS-SLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
               P  + F+P T  +     + S+P  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  427   ATPW-RNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQE  485

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTT  974
             +    N  ++YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G  K   T
Sbjct  486   EVLTFN-AIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTAT  544

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDITG*DSHCTMNSGSCVCVL  1154
              T  L I ++L+D+ L  E+ I VTLVPK G   +++  V+I        +     VCV+
Sbjct  545   ATLRLAITELLEDIGLEDEDTIAVTLVPKKG--DISIGGVEI-------KLAIVKLVCVV  595

Query  1155  RYEILYVKQISNC---VLSCEILCL  1220
                 L + +   C   V  C  +CL
Sbjct  596   NLLTLQLNKDRFCYDSVFVCWFVCL  620


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 58/126 (46%), Gaps = 15/126 (12%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE--RRLPVDHADYDLFKSLHQAGFSP  248
            YK P+ ++  VR+     D+E   K+  AV K+K+  +  P +   +    ++H A  + 
Sbjct  123  YKFPSMTKLRVRQPAHEADEEYIAKYNCAVTKMKDLDKTQPDNPIGFKQQANIHCAYCNG  182

Query  249  G---------AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNSTLDSDLPDHAAY  401
            G          H    F  FHR YL+ YE++L ++  D T  +P+WN     D P    +
Sbjct  183  GYSIDGKVLQVHNSWLFFPFHRWYLYFYERILGSLIDDPTFGLPFWN----WDHPKGMRF  238

Query  402  APFSDM  419
             P  D+
Sbjct  239  PPMFDV  244



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 127/228 (56%), Gaps = 13/228 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W++ +TLGGKR   TDP+WL   FV YDEN  LVR+KV+DCLD+ KLGY YQD+
Sbjct  368   ANVDRMWSIWKTLGGKRQDFTDPDWLNAGFVFYDENAQLVRVKVKDCLDSRKLGYVYQDV  427

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLP-TATAILPATLDETVKFYVTRPPAttst  776
                     P PR  K      K   +  +  P TA  + P  LD+ V+  V RP  + S 
Sbjct  428   DIPWLNTRPAPRVSKLSRKINKAGVAMAADTPSTAAEVFPKKLDKAVRVMVPRPKKSRSK  487

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             K+K+ E++  V+   +E D    ++FD ++N+  +   +     EFAGSF+N   P +  
Sbjct  488   KEKDDEEEILVIE-GIEVDRDVFVKFDVFINDEHEV-VIGPNDTEFAGSFVNV--PHKHK  543

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K  T   L I ++L++L    ++ + VTLVPK G  +VT+  V I
Sbjct  544   HGKKIKTILRLGITELLEELGAEDDDGVLVTLVPKNGAGAVTIGGVKI  591



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   137 bits (345),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 125/232 (54%), Gaps = 16/232 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WT+ +TLGGKR  ITDP+WL   F+ YDEN  LVR+KV DCLD +KLGY YQD+
Sbjct  362   SNVDRMWTIWKTLGGKRKDITDPDWLNAGFLFYDENKQLVRVKVRDCLDEKKLGYVYQDV  421

Query  624   --------PNPRSKKFEPFTGK-----NPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P PR  K               +  S     T   P  LD  ++  V RP  
Sbjct  422   DIPWLKTRPTPRKSKLSKVASAVRALGVAQAAVSKKTVTTTDFPVILDSVIRTVVDRPKK  481

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
                +K+++ E++E ++   +E+D    ++FD Y+N+  D  S   + +EFAGSF++   P
Sbjct  482   KRRSKQEKEEEEEVLVIDGIEFDRDLPVKFDVYVNDEDDLPS-GPDKSEFAGSFVSV--P  538

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             R+   + K  T   L +  +L+DL    ++ + VTLVP+ G   V++  + I
Sbjct  539   RKQKNQKKLKTCLRLGLTDLLEDLEAEDDDSVVVTLVPRTGKGLVSIGELKI  590



>ref|XP_004246029.2| PREDICTED: polyphenol oxidase A, chloroplastic-like [Solanum 
lycopersicum]
Length=606

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 127/225 (56%), Gaps = 13/225 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W   +  GGKR  I + +WL + F  YDEN N  +++V DCLD +K+GY YQ  
Sbjct  384   SNVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYQ--  441

Query  624   PNPRSKKFEPFTGKNPSSTG----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkke  788
               P +  +  F  K  +S G     S+P  + + P A LD+ + F + RP ++ + ++K 
Sbjct  442   --PTATPWRNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKN  499

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKT  965
              +++    N  ++YD    IRFD +LN + + N+ E++ AEFAGS+ +     R G  K 
Sbjct  500   AQEEVLTFN-AIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKH  558

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               T T  L I ++L+D+ L  E+ I VTLVPK G   +++  V+I
Sbjct  559   TATATLRLAITELLEDIGLEDEDTIAVTLVPKKG--DISIGGVEI  601



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   137 bits (344),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 129/232 (56%), Gaps = 19/232 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGGKR   TDP+WL + F+ YDEN  LVR++V DCLD++KLGY YQD+
Sbjct  363   SNIDRLWSVWKTLGGKRNDFTDPDWLNSGFLFYDENKQLVRVRVGDCLDSKKLGYVYQDV  422

Query  624   PNP-RSKKFEPFTGKNPSSTGSSLPTATAI------------LPATLDETVKFYVTRPPA  764
               P    K  P   K   +  SS     A+             P  LD+ +   V+RP  
Sbjct  423   DIPWLQTKPTPLRTKRAVARSSSTLVGAALAADTKKTTTRVKFPIKLDKVISTVVSRPKK  482

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
             + S  +K+ E++  V+   +E+D    ++FD Y+N+  ++     E +EFAGSF+N    
Sbjct  483   SRSKNEKDDEEEVLVIEG-IEFDRNNPVKFDVYVNDEDESGP---ENSEFAGSFVNVPHK  538

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             ++G  KT+T     L I  +L++L    ++ + VTLVPK G   VT+  + I
Sbjct  539   KKGDNKTRTNL--RLGITDLLEELEAEDDDSVVVTLVPKFGKGLVTISGIKI  588


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 53/117 (45%), Gaps = 15/117 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLP-VDHADYDLFKSL  227
            P S  I DYKLP  S+  VR     +D+    K+  AV+ +K+  LP  D   +     +
Sbjct  115  PISSKIIDYKLPPVSKLRVRPATHTVDEAYIAKYNRAVQLMKD--LPDSDPRSFSQQSDI  172

Query  228  H---------QAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H         Q GF       H    F  FHR YL+ YE++L  +  D T  +P+WN
Sbjct  173  HCAYCDGSYDQVGFPNLELQVHESWLFFPFHRWYLYFYERILGKLIDDPTFALPFWN  229



>gb|ACN78382.1| polyphenol oxidase [Solanum quitoense]
Length=472

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 123/212 (58%), Gaps = 7/212 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W   + +GGKR  + D +WL T F+ YDEN  L R++V DCLD++K+G+ Y  +
Sbjct  264   SNVDRMWNEWKAIGGKRRDLADKDWLNTEFLFYDENRKLFRVRVRDCLDSKKMGFDYAPM  323

Query  624   PNPRSKKFEPFTGKNPSS--TGSSLPTATAILP-ATLDETVKFYVTRPPAttstkkkete  794
             P P  + F+P   K  +     SS+P  + + P   LD  + F + RP +  S  + E  
Sbjct  324   PTP-WRNFKPSIRKTTAGKLNTSSIPPVSKVFPIPKLDRPISFSINRPAS--SRTQAEKN  380

Query  795   dketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT  971
             ++E +L F+ +++++   +RFD +LN +K  N+LE++  EFAGS+ +        +   T
Sbjct  381   EQEEMLTFHKIQHNDRLYVRFDVFLNVDKTVNALELDQPEFAGSYTSLPHVHGDDKPHAT  440

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCG  1067
             + T SL I ++L+D  L  E  I VTLVPK G
Sbjct  441   SATLSLAITELLEDNNLEDEETIVVTLVPKVG  472


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 10/110 (9%)
 Frame = +3

Query  63   TITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQA-  236
            ++  YK P+ ++  +R    A+D+E   K+  A  +++   + P D   +    ++H A 
Sbjct  24   SVPYYKFPSMTKLRIRPPAHAVDEEYIAKYQLATSRMRGLDKDPFDPLGFKQQANIHCAY  83

Query  237  --------GFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                    G     HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  84   CNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  133



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 127/234 (54%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLGG+R  +TDP+WL  SF  YDEN N VR+KV DCLD  KLGY YQD+
Sbjct  356   SNVDRMWSVWKTLGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDV  415

Query  624   --------PNPR-------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRP  758
                     P PR       S  F        +   ++  T     P  L+  +   V RP
Sbjct  416   EIPWLRSRPTPRRSAKKVASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARP  475

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+   +E+D+TK ++FD Y+N+  D+ S   +  EFAGSF+N  
Sbjct  476   KKSRSKKEKEDEEELLVIQ-GLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNV-  532

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +     K  T + L +  +L+DL + G++ + VTLVP+ G     +  + I
Sbjct  533   -PHKHKHGKKINTCFRLALTDLLEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKI  585



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 127/234 (54%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLGG+R  +TDP+WL  SF  YDEN N VR+KV DCLD  KLGY YQD+
Sbjct  356   SNVDRMWSVWKTLGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDV  415

Query  624   --------PNPR-------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRP  758
                     P PR       S  F        +   ++  T     P  L+  +   V RP
Sbjct  416   EIPWLRSRPTPRRSAKKVASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARP  475

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+   +E+D+TK ++FD Y+N+  D+ S   +  EFAGSF+N  
Sbjct  476   KKSRSKKEKEDEEELLVIQ-GLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNV-  532

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +     K  T + L +  +L+DL + G++ + VTLVP+ G     +  + I
Sbjct  533   -PHKHKHGKKINTCFRLALTDLLEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKI  585



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 137/225 (61%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ +DEN  LVR+KV+D LD +KL Y +QD
Sbjct  358   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQD  417

Query  621   LPNP--RSKKFEPFTGKNPS---STGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  +++     T +  S   +  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLKTRATPKLTRQEKSRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E ++I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  478   EDEDEVLVIEG-IEYEENQSIKFDVLVNDEPDSPG-GPDKSEFAGSFVNV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VTLVP+ GGD VTV +V I
Sbjct  534   KTTMV--LGITGLLEDLEAEGDDTLVVTLVPRTGGDFVTVANVKI  576



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +TLGG KR   TDP+WL  +F+ YDEN   +R+KV+DCL+   LGY YQD
Sbjct  368   SNVDRMWTLWKTLGGRKRTDFTDPDWLNATFLFYDENAQAMRVKVKDCLETSNLGYKYQD  427

Query  621   ----------LPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
                       +P  ++KK    +GK     G  +P      P  LD+ V  +V RP    
Sbjct  428   VDIPWRNYKPVPRKKAKKLPKSSGKIADVAG--IPRHIVHFPVKLDKVVSTWVKRPKQKR  485

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++   +   +E +    ++FD ++N+ +D+ S   +  EFAGSF+N     +
Sbjct  486   SKKEKEEEEEVLAIEG-IELESDAFVKFDVHINDKQDSLS-SPDKTEFAGSFVNVPHKHK  543

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +K KT  T  L I  +L+DL    + K+ VTL P+CGG+ V + ++ I
Sbjct  544   PGKKMKTKLT--LGITDLLEDLMREEDEKVLVTLAPRCGGEDVIISNIKI  591


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 53/119 (45%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLP-TFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            P +  + D+KLP + S   VR      D +   K+A A + +K   LP D          
Sbjct  124  PPTTKVLDFKLPPSNSPTRVRPAAHLADKDYIAKYAEATKLMKA--LPADDPRSFMQQAN  181

Query  198  -HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y      HQ GF       H    F  FHR YL+ YEK+L N+ GD T  +PYWN
Sbjct  182  VHCAY-CDGYYHQVGFPNLELQVHDSWLFFPFHRYYLYFYEKILGNLIGDPTFALPYWN  239



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 131/233 (56%), Gaps = 19/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WT+ +TLGGKR   TDP+WL  +F+LYDEN NLVR+KV DC+D++KL Y+YQ++
Sbjct  368   SNVDRMWTIWKTLGGKRTEFTDPDWLDAAFLLYDENANLVRVKVRDCIDHKKLRYAYQEV  427

Query  624   --------PNPR------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR      +K F        ++   +L T T   P  LD+ ++  V+RP 
Sbjct  428   EIPWLKSRPTPRRLIKKMAKVFHHHDQVAQAAETQNL-TPTNSFPLKLDKVIRTMVSRPK  486

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
              + S K+KE E++  V+N  +E++    ++FD Y+N+  D+ S     +EFAGSF+N   
Sbjct  487   KSRSKKEKEEEEEILVING-IEFERDAVVKFDVYVNDEHDSPS-GPNKSEFAGSFVNV--  542

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P       K  T   L I  +L+DL    ++ + V LVP+ G   V +  + I
Sbjct  543   PHAHKHGKKMKTCLRLGITDLLEDLGAEDDDNVVVALVPRIGKGQVRIGGIKI  595



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 132/234 (56%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLGG+R  +TDP+WL  SF  YDEN N VR+KV DCLD+  LGY YQD+
Sbjct  356   SNVDRMWSVWKTLGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDV  415

Query  624   --------PNPR--SKKFEPFTGKNPSSTGSSLPTATAILPAT-----LDETVKFYVTRP  758
                     P PR  +KK       +     ++     A+ P T     L++ +   V RP
Sbjct  416   EIPWLQSRPTPRRSAKKVASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARP  475

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+   +E+D+TK ++FD Y+N+  D+ S   +  EFAGSF+N  
Sbjct  476   KKSRSKKEKEDEEELLVIQ-GLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNV-  532

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +     K TT + L +  +L+DL + G++ + VTLVP+ G     +  + I
Sbjct  533   -PHKHKHGKKMTTCFRLALTDLLEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKI  585



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   134 bits (338),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 132/234 (56%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLGG+R  +TDP+WL  SF  YDEN N VR+KV DCLD+  LGY YQD+
Sbjct  356   SNVDRMWSVWKTLGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDV  415

Query  624   --------PNPR--SKKFEPFTGKNPSSTGSSLPTATAILPAT-----LDETVKFYVTRP  758
                     P PR  +KK       +     ++     A+ P T     L++ +   V RP
Sbjct  416   EIPWLQSRPTPRRSAKKVASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARP  475

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+   +E+D+TK ++FD Y+N+  D+ S   +  EFAGSF+N  
Sbjct  476   KKSRSKKEKEDEEELLVIQ-GLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNV-  532

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +     K TT + L +  +L+DL + G++ + VTLVP+ G     +  + I
Sbjct  533   -PHKHKHGKKMTTCFRLALTDLLEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKI  585



>gb|ADY18409.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=590

 Score =   134 bits (338),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 128/225 (57%), Gaps = 11/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W   + +GGKR  ++  +WL + F  YDEN N   +KV DCLD +K+GY Y   
Sbjct  366   SNVDRMWNEWKQIGGKRRDLSQKDWLDSEFFFYDENKNPYLVKVRDCLDTKKMGYDYA--  423

Query  624   PNPRSKKFEPFTGKNPSSTG----SSLPTATAILPA-TLDETVKFYVTRPPAttstkkke  788
               P S  +  F     ++ G     SLP+AT I P   LD+ + F + RP ++ + ++K 
Sbjct  424   --PSSTVWRNFKPNKKNTDGKVNTGSLPSATKIFPIFKLDKAISFSINRPASSRTQQEKN  481

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK  968
              +++    + Y++YD  + IRFD ++N +K+  + E++  E+AGS+ +     +  +K  
Sbjct  482   EQEELLTFS-YIKYDNREYIRFDVFVNVDKNVKADELDKIEYAGSYTSLPHVHKDGDKDH  540

Query  969   -TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               T T  L + ++L+D+ L  E  I VTLVPK GG+ +++  V+I
Sbjct  541   IATATLQLALTELLEDIGLENEETIAVTLVPKKGGEGLSIGCVEI  585


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 71/155 (46%), Gaps = 27/155 (17%)
 Frame = +3

Query  18   LSELGMDSPILPFS----------GTITDYKLPTFSRHIVRREYSALDDESREKFATAVR  167
            ++ +  D P +P++           TI  YKLP+ ++  +R+    +D+E   K+  A+ 
Sbjct  93   IATITADGPPVPYTCCHLPMPSNVNTIPYYKLPSMTKVRIRQPAHTVDEEFIAKYNLAIS  152

Query  168  KLKE--RRLPVDHADYDLFKSLHQAGFSPGA----------HFGASFVAFHRMYLFMYEK  311
            ++KE   + P++   +    ++H A +  GA          H    F  FHR YL+ YE+
Sbjct  153  RMKELDEKEPLNPLGFKQQANIHCA-YCNGAYKIGEKVLQVHQSWLFFPFHRWYLYFYER  211

Query  312  MLQNVAGDSTIFVPYWNSTLDSDLPDHAAYAPFSD  416
            ML  +  D T  +PYWN     DLP      P  D
Sbjct  212  MLGKLIDDPTFALPYWN----WDLPKGMRLPPMFD  242



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 126/239 (53%), Gaps = 22/239 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W + +TLGGK+   TD +WL++ F+ YDEN NLVR+ V+D LD +KLGY+YQD+
Sbjct  368   SNVDRLWYIWKTLGGKKHDFTDKDWLESGFLFYDENKNLVRVNVKDSLDIDKLGYAYQDV  427

Query  624   P--------NPRSKKFEPFTG---------KNPSS--TGSSLPTATAILPATLDETVKFY  746
             P         PR  K +             K+P+        P      P  L+  V   
Sbjct  428   PIPWEKAKPVPRRTKVQKLVEVEVNDGNLRKSPTIFLVRQQSPRKYVTFPLVLNNKVSAI  487

Query  747   VTRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSF  926
             V RP    S K+KE E++  V+   +E+     I+FD Y+N+  D   +     EFAGSF
Sbjct  488   VKRPKKLRSKKEKEEEEEVLVIEG-IEFYMNIAIKFDVYINDEDD--KVGAGNTEFAGSF  544

Query  927   INFAWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             +N      G +  K  T+  L I  +L+DL + G++ I VTLVPKCG   V + +V+I 
Sbjct  545   VNIPHSAHGHKNKKIITSLRLGITDLLEDLHVEGDDNIVVTLVPKCGSGQVKINNVEIV  603


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 56/117 (48%), Gaps = 15/117 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPV-DHADYDLFKSL  227
            P+S  ITD+K P+     VR+    +D+E  EK+  A   +K   LP  D  ++    ++
Sbjct  123  PYSTKITDFKFPSNQPLRVRQAAHLVDNEFLEKYKKATELMKA--LPSNDPRNFTQQANI  180

Query  228  H---------QAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H         Q GF       H    F  FHR YL+ YE++L ++  D T  +P+WN
Sbjct  181  HCAYCDGAYSQIGFPDLKLQVHGSWLFFPFHRWYLYFYERILGSLINDPTFALPFWN  237



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   134 bits (337),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 134/225 (60%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I D +WL + F+ +DEN  LVR+KV+D LD +KLGY +QD
Sbjct  358   SNVDRMWDLWKKIPGGKREDIEDSDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQD  417

Query  621   LPNP-----RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P      + K         ++  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLTTRATPKLTRQEKSRRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  478   EDEDEVLVIEG-IEYEENQLIKFDVLVNDEPDSPG-GPDNSEFAGSFVNV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VTLVP+ GGDSVTV +V I
Sbjct  534   KTTMV--LGITGLLEDLEAEGDDTLVVTLVPRSGGDSVTVANVKI  576



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   134 bits (338),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 127/237 (54%), Gaps = 28/237 (12%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W V +TLG KR   TDP+WL  SF+ YDEN NLVR+KV DCLDN  LGY YQD+
Sbjct  387   SNVDRMWAVWKTLGKKRKDFTDPDWLNASFLFYDENANLVRVKVRDCLDNRSLGYVYQDV  446

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAI----------LPATLDETVKFYV  749
                     P PR  +      K  +S G  +  A  I           P  LD+ V   V
Sbjct  447   DIPWLKTKPTPRKLR------KKVASGGPGIALAAEINKKKVIASNQFPIVLDKIVSVDV  500

Query  750   TRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFI  929
              RP  + S K+KE E++  V++  +E D     +FD Y+N+  D  ++  +  EFAGSF+
Sbjct  501   PRPKKSRSKKEKEDEEEILVID-QIELDGDSFAKFDVYVNDEDDL-TIGPDNTEFAGSFV  558

Query  930   NFAWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             N     +G +K +T     L +  +L+DL    ++ + VTLVPK G  +V + S+ I
Sbjct  559   NVPHKHKGGKKMRTCL--RLGLTDLLEDLGAEDDDSVVVTLVPKYGKGNVKIGSIKI  613



>gb|ADY18410.1| chloroplast polyphenol oxidase precursor, partial [Solanum melongena]
Length=584

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 122/221 (55%), Gaps = 5/221 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + +GGKR  + D +WL + F  YDEN N  ++KV DCLD++K+G+ Y  +
Sbjct  362   ANVDRMWNEWKAIGGKRRDLADKDWLNSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPM  421

Query  624   PNPRSKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAttstkkketedk  800
             P P  + F+P          + S+P A+ + P        F   R  +     K E  ++
Sbjct  422   PTP-WRNFKPVRRTTSGKANTRSIPPASKVFPTCETRQSDFIFHRQTSFVKDSKAEKNEQ  480

Query  801   etVLNF-YVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             E   N   ++YD+++ +RFD +LN +K   +LE++  EFAGS+ +   P    +K +   
Sbjct  481   EGDTNIRQIQYDDSQYVRFDVFLNVDKTVKALELDQPEFAGSYTSL--PHVHGDKDRAPV  538

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T+ L I ++L+D  L  E  I +TL+PK GGD +++++  I
Sbjct  539   TFKLAITELLEDNNLEDEESIVITLIPKAGGDGISIQNAVI  579


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 53/107 (50%), Gaps = 12/107 (11%)
 Frame = +3

Query  75   YKLPTFSRHIVRREYSALDDESREKFATAVRKLKE-RRLPVDHADYDLFKSLHQAGFSPG  251
            YK P+ ++  +R    A+D+E   K+  A  +++E  + P     +    ++H A +  G
Sbjct  125  YKFPSMTKLRIRPPAHAVDEEYIAKYQLATSQMRELDKDPFGPIGFKQQANIHCA-YCNG  183

Query  252  A----------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            A          HF   F  FHR YL+ YE++L ++  D T  +PYWN
Sbjct  184  AYKAGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWN  230



>ref|XP_010100573.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82816.1| Polyphenol oxidase [Morus notabilis]
Length=242

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 129/226 (57%), Gaps = 12/226 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGGKR    DP+WL + F+ YDEN  LVR+ V D LD +KLGY YQD+
Sbjct  18    SNIDRLWSVWKTLGGKRKDYIDPDWLNSGFLFYDENKQLVRVYVCDSLDTKKLGYVYQDV  77

Query  624   PNP-RSKKFEPFTGKNPSSTGSSLPTATAI-----LPATLDETVKFYVTRPPAttstkkk  785
               P  + K +P  GK  +S+  +             P TLD+ +   V RP  + S ++K
Sbjct  78    DLPWLTAKPKPRRGKIVTSSSKTTAVTKKTTTAINFPITLDKVISTVVPRPKKSRSKEEK  137

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSEK  962
             E E++  V+   +E+DE   ++FD ++N+  D  SL   E +EF+GSF+N    ++G  K
Sbjct  138   ENEEEVLVIE-GIEFDEDYPVKFDVHVND--DEQSLCGPENSEFSGSFVNVPHRKRGDNK  194

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +T     L I  +L+DL    ++ + VTLVPK G   VT+  + I
Sbjct  195   IRTHL--RLGITDILEDLGADDDDSVFVTLVPKSGKGLVTISGIKI  238



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 129/230 (56%), Gaps = 14/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR WT+ +TLGGKR   T+P+WL ++F+ YDEN NLVR+KV DCLD + LGY YQD+
Sbjct  360   SNIDRMWTIWRTLGGKRTNFTEPDWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDV  419

Query  624   --------PNPRS---KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
                     P+PR+   K+     G   ++          + P  LD  +   V RP  + 
Sbjct  420   EIPWQNSKPSPRNLAKKRVAKAFGVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSR  479

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V++  +E++    ++FD Y+NE++D   +  + +EFAGSF+N   P +
Sbjct  480   SKKEKEEEEEVLVVD-NIEFERDARVKFDVYINEDEDGMPIGPDNSEFAGSFVNV--PHK  536

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T+  L +  +L+DL    ++ + VTLVPK G     +  + I
Sbjct  537   HKHGKKMKTSLRLGLTDLLEDLGAEDDDSVVVTLVPKFGKGLARIGGIKI  586



>emb|CDP22269.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 133/221 (60%), Gaps = 8/221 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ--  617
             ++VDR WT+ Q LGGKR  + DP+WL +SF+ YDEN   V +KV DC  N+K+GY YQ  
Sbjct  205   ANVDRMWTIWQQLGGKRKEVPDPDWLNSSFIFYDENAQPVCVKVGDCFSNDKMGYIYQKV  264

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
             D+P  ++K     T K+  +  S  P A  + P  L++TVK  V RP  + S K+KE E+
Sbjct  265   DIPWVKNKPVARVT-KSRVAFTSGAPQADKVFPGPLNKTVKVLVKRPKLSRSKKQKEEEE  323

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
             +  V++  +E+   K ++FD ++N+ +D N  +   +E+ GSF +     +G  K KTT 
Sbjct  324   ERLVVSG-IEFSMDKYVKFDVFIND-EDDNPNDFAKSEYVGSFAHLPHKVKGDMKVKTTQ  381

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T   E+ ++L+DL +  ++ + VTLVPK    ++T+ S+ I
Sbjct  382   T--FELTEILEDLDVEEDDALLVTLVPKSKT-ALTIDSIKI  419



>ref|XP_006365391.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
tuberosum]
Length=604

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 137/229 (60%), Gaps = 16/229 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WT+ +TLGG R    D +WL ++F+ YDEN  LV++ V+DC++NEKLGY Y+++
Sbjct  375   ANVDRMWTIWKTLGGNRRDFNDRDWLDSAFLFYDENRTLVKVTVQDCINNEKLGYKYENV  434

Query  624   PNPRSKKFEPF-----TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkke  788
             P P  K ++P        KNP +   S    T I P+TL +T+ F + RP  + + + K+
Sbjct  435   PIPW-KNYKPVPRKQKLKKNPKNVKPS----TEIFPSTLKKTLSFSIKRPKISRTQQDKD  489

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF-----AWPRQG  953
              E++  V N  + +DE + IRFD ++NE++   S  ++  E+ GSF N      A    G
Sbjct  490   IEEELLVFN-NMTFDENEYIRFDVFINEDEGVKSKVLDRTEYVGSFANLPHVHAAGNNTG  548

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             S  + T    SL I+++L+DL L  E +I V +VPK GG  +T+ SV+I
Sbjct  549   SSSSGTPAVMSLAISEILEDLGLEDEEEIVVVVVPKFGGKEITIASVEI  597


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 12/120 (10%)
 Frame = +3

Query  39   SPILPFSGT-ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVD----  197
             P LP   T I  YKLP  S+  +R     +  E   K+ TA++K+K  ++  P+     
Sbjct  125  CPPLPKDLTNIPTYKLPNVSKVKIRPAAHNVTQEYITKYNTAIQKMKSLDKDDPLSFIQQ  184

Query  198  ---HADY--DLFKSLHQAGFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
               H  Y    +K L   G     HF   F  FHR YL+ +E++L ++ GD T  +P+WN
Sbjct  185  ANIHCAYCNSGYKELGFPGVPLQVHFSWLFFPFHRWYLYFFERILGSLIGDDTFALPFWN  244



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 129/230 (56%), Gaps = 14/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR WT+ +TLGGKR   T+P+WL ++F+ YDEN NLVR+KV DCLD + LGY YQD+
Sbjct  360   SNIDRMWTIWRTLGGKRTNFTEPDWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDV  419

Query  624   --------PNPRS---KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
                     P+PR+   K+     G   ++          + P  LD  +   V RP  + 
Sbjct  420   EIPWQNSKPSPRNLAKKRVAKAFGVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSR  479

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V++  +E++    ++FD Y+NE++D   +  + +EFAGSF+N   P +
Sbjct  480   SKKEKEEEEEVLVVD-NIEFERDARVKFDVYINEDEDEMPIGPDNSEFAGSFVNV--PHK  536

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T+  L +  +L+DL    ++ + VTLVPK G     +  + I
Sbjct  537   HKHGKKMKTSLRLGLTDLLEDLGAEDDDSVIVTLVPKFGKGLARIGGIKI  586



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 129/230 (56%), Gaps = 14/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR WT+ +TLGGKR   T+P+WL ++F+ YDEN NLVR+KV DCLD + LGY YQD+
Sbjct  360   SNIDRMWTIWRTLGGKRTNFTEPDWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDV  419

Query  624   --------PNPRS---KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
                     P+PR+   K+     G   ++          + P  LD  +   V RP  + 
Sbjct  420   EIPWQNSKPSPRNLAKKRVAKAFGVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSR  479

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V++  +E++    ++FD Y+NE++D   +  + +EFAGSF+N   P +
Sbjct  480   SKKEKEEEEEVLVVD-NIEFERDARVKFDVYINEDEDEMPIGPDNSEFAGSFVNV--PHK  536

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T+  L +  +L+DL    ++ + VTLVPK G     +  + I
Sbjct  537   HKHGKKMKTSLRLGLTDLLEDLGAEDDDSVIVTLVPKFGKGLARIGGIKI  586



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 133/225 (59%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR    DP+WL + F+ ++EN  LVR+KV+D LD +KL Y +QD
Sbjct  352   SNVDRMWDLWKKIPGGKRKDFKDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQD  411

Query  621   LPNPRSK-----KFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  K     K         S+  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  412   VPIPWLKTRPTPKLTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  471

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  472   EDEDEVLVIE-GIEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFVNV--PHKHAKKS  527

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VTLVP+ GGDSVTV +V I
Sbjct  528   KTTMV--LGITGLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKI  570



>ref|XP_006370117.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
 gb|ERP66686.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
Length=543

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 135/225 (60%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ +DEN  LVR+KV+D LD +KL Y +QD
Sbjct  320   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQD  379

Query  621   LPNP--RSKKFEPFTGKNPS---STGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  +++     T +  S   +  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  380   VPIPWLKTRATPKLTRQEKSRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  439

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  440   EDEDEVLVIEG-IEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFVNV--PHKHAKKS  495

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VT VP+ GGD VTV +V I
Sbjct  496   KTTMV--LGITGLLEDLEAEGDDTLVVTFVPRSGGDFVTVANVKI  538



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 136/230 (59%), Gaps = 13/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +++DR W++ +TLGG R   T+ +WL  SF+ YDEN   VR++V DCL+  +LGY+YQ++
Sbjct  372   ANIDRMWSIWKTLGGNRQDFTETDWLDASFIFYDENAQAVRVRVRDCLNTARLGYNYQNV  431

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI---------LPATLDETVKFYVTRPPAttst  776
               P  +  +P      SS  S+   A A+          P  L+++++  V RP  + S 
Sbjct  432   DLP-WRNAQPLRTSRVSSISSTPQAANAMESKTTTTVKFPRPLNKSIRTNVARPKKSRSK  490

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEM-AEFAGSFINFAW-PRQ  950
              +K+ E++E V+   V   + K  +FD Y+N+  D  S ++++ AE+AGSF+N     +Q
Sbjct  491   SEKDREEEELVIEVDVLRHD-KYAKFDVYINDEDDVPSKKMQVKAEYAGSFVNVPHRHKQ  549

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             G +K K TTT+ + + +++Q+L    ++ I V LVP+ G D+V +K+V I
Sbjct  550   GEDKHKLTTTFRVGLTELIQELGADDDDGITVNLVPRAGKDNVVIKNVKI  599



>ref|XP_003605693.1| Polyphenol oxidase A1 [Medicago truncatula]
Length=460

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 129/239 (54%), Gaps = 22/239 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLGGKR    D +WL++ F+ YDEN NLV++ V+DCLD +KLGY YQD+
Sbjct  220   SNIDRLWSIWKTLGGKRKDFDDKDWLESEFLFYDENKNLVKVNVKDCLDTQKLGYDYQDV  279

Query  624   P----NPRSKKFEPFTGKNPSSTGSSLPTATAIL----------------PATLDETVKF  743
             P    N +    +    K   + G+S  T  A L                P  LD  V  
Sbjct  280   PIPWLNAKPTPCKKIQKKVEVAQGNSFGTGKARLSEINENLTNSRNDVKFPLVLDNIVST  339

Query  744   YVTRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGS  923
              V RP  + S  +KE E++  V+   +E+D++  ++FD ++N+ +DA  ++    EFAGS
Sbjct  340   IVRRPKKSRSKTEKEEEEEVLVIE-GIEFDKSLGVKFDVFIND-EDAKEIKPVNTEFAGS  397

Query  924   FINFAWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             F+N        +K KT +   + +  +L+DL    ++ I VTLVP+     V + ++ I
Sbjct  398   FVNVPHSSHDHKKKKTNSCLRVGLTDLLKDLGAEDDDSIVVTLVPRYRKGLVKITNIKI  456



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   132 bits (332),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WTV +TLGG +R   TDP+WL  +F+ YDEN   VR+KV+DCL+   LGY YQD
Sbjct  374   SNVDRMWTVWKTLGGSRRIDFTDPDWLNAAFLFYDENAQAVRVKVKDCLETTNLGYVYQD  433

Query  621   L--------PNPR--SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
             +        P PR  +KK     GK   +  + +P      P  LD+ V+  V RP    
Sbjct  434   VDIPWLKSKPTPRKTAKKVAKAFGK--VAHAAEIPRPIVQFPVKLDKVVRTLVKRPKQKR  491

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   +E++    ++FD Y+N+  D+ S   +  EFAGSF+N   P +
Sbjct  492   SKKEKEEEEEVLVIE-GIEFERDAFVKFDVYINDEHDSLS-SPDQTEFAGSFVNV--PHK  547

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T   L I  +L+DL    +++I VTL PK  G+ VTV ++ I
Sbjct  548   HKHHKKMKTRLRLGITDLLEDLVCEDDDEILVTLAPKYAGEQVTVGNIKI  597


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 56/119 (47%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESR-EKFATAVRKLKERRLPVD----------  197
            P +  I D+KLP+ +  +  R  + L D+    K+A A+  +K   LP D          
Sbjct  128  PPTTKILDFKLPSSNSPLRVRPAAHLADKDYIAKYAKAIELMKA--LPADDPRSFMQQAN  185

Query  198  -HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y    + HQ GF       H    F  FHR YL+ YEK+L ++ GD T  +PYWN
Sbjct  186  VHCAY-CDGAHHQVGFPNLELQVHNSWLFFPFHRYYLYFYEKILGSLIGDPTFALPYWN  243



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   132 bits (332),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 127/235 (54%), Gaps = 19/235 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WTV +TLGGKR   TD +WL + F+ YDEN N+VR+KV DCLD++KLGY YQD+
Sbjct  372   SNVDRLWTVWKTLGGKREDFTDSDWLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDV  431

Query  624   --------PNPRS-----KKFE---PFTGKNPSSTGSSLPTATAILPATLDETVKFYVTR  755
                     P PR      KKF       G   ++  S+   A A  P +L   +   V R
Sbjct  432   DIPWTSHKPTPRRVKDVIKKFGHKLHGHGVAHAAETSTKVVAGAHFPISLASKISIAVAR  491

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P     ++K++  ++E ++   +E+D    ++FD Y+N+  D  S   + +EFAGSF++ 
Sbjct  492   PQQKKRSQKEKDHEEEVLVIQGIEFDRDVGVKFDVYVNDEDDLPS-GPDKSEFAGSFVSV  550

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +     K  T   L +  +L+DL    +  I VTL+P+ G + V +  + I
Sbjct  551   --PHRHKHTKKINTVLRLGLTDLLEDLDAEDDETIVVTLIPRYGAEHVKIGGIKI  603



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 136/225 (60%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ ++EN  LVR+KV+D LD +KL Y +QD
Sbjct  358   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQD  417

Query  621   LPNP--RSKKFEPFTGKNP---SSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  +++     T +     ++  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLKTRPTPKLTRQEKLRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  478   ENEDEVLVIEG-IEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFVNV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +L+DL   G++ + VT VP+ GGDSVTV +V I
Sbjct  534   KTTMV--LGITGLLEDLEAEGDDTLVVTFVPRSGGDSVTVANVKI  576



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 128/231 (55%), Gaps = 19/231 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR WT+ +TLGG+R  ITD +WL  SFV YDEN  +VR++V DCLD  KLGYSYQ +
Sbjct  354   SNIDRMWTLWKTLGGRRQDITDTDWLNASFVFYDENAQMVRVRVRDCLDTTKLGYSYQTV  413

Query  624   --------PNPR----SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAt  767
                     P PR    ++K +     N +    S    T I PA LD+ +K  V RP   
Sbjct  414   DTPWLNSRPTPRLTKVARKIKKLVVANAADHSHS---PTDIFPAKLDKIIKVMVKRPKKK  470

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+K+ +++  V+   +E +     +FD Y+N+  D  S   E  EFAGSF+N   P 
Sbjct  471   RSKKEKDEKEEILVIE-KIEVERDAFAKFDIYINDEDDPKSTP-ENTEFAGSFVNV--PH  526

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +     K  T  +L + ++L+DL    +  + VTLVP+ G D+VT+  + I
Sbjct  527   KHKHGKKIKTHLNLSLTEILEDLDAEDDEHVMVTLVPRVGCDAVTIGGIKI  577



>ref|XP_009588337.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   131 bits (330),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 133/228 (58%), Gaps = 16/228 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + LGGKR  +TD +WL + F  YDEN +  R+KV DCLD++K+GY Y+  
Sbjct  370   ANVDRMWNEWKALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYE--  427

Query  624   PNPRSKKFEPFTGKNPSSTG----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkke  788
               P S  +  F     S+ G    SS+  A+ + P + LD  + F + RP   TS  ++E
Sbjct  428   --PTSTPWRNFKPGKKSTEGKVNLSSIKPASKVFPLSNLDRAICFSIERP--ATSRSQQE  483

Query  789   tedketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW---PRQGS  956
              ++ E +L F  V+YD++K IRFD +LN +K  N+ ++   E+AGS+ +      P   +
Sbjct  484   KDELEEILTFKGVKYDDSKYIRFDVFLNADKTVNADDINKREYAGSYTSLPHVHGPNNAT  543

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              + K    + L I ++L+D  L  E+ I VT+VPK GG+ V++ +V+I
Sbjct  544   HEFK-PKEFKLAITELLEDCGLEDEDIIAVTVVPKKGGEVVSIDNVEI  590



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   131 bits (330),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 129/229 (56%), Gaps = 13/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +++DR W+V +TLGG+R   TD +WL ++F+ YDEN  LVR+KV D LD++KLGY YQD+
Sbjct  365   ANIDRMWSVWKTLGGRRNDFTDKDWLDSAFLFYDENAELVRVKVRDALDSKKLGYVYQDV  424

Query  624   --------PNPRSKKFEPFTGKN--PSSTGSSLPTATAILPATLDETVKFYVTRPPAtts  773
                     P PR K+      K    +     +P A  + PATLD+ +K  V RP  + S
Sbjct  425   GIPWLETKPEPRLKRALSKIKKKLAVARADEHIPFAKDVFPATLDKVIKVLVPRPKKSRS  484

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              K+K+ E++  V+   +E    + ++FD ++N+  D      +  EFAGSF+N   P + 
Sbjct  485   KKQKDAEEEILVIE-GIEVKRDEFVKFDVFVNDEDDGMRATADKTEFAGSFVNV--PHKH  541

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                    T   L I+++L DL    ++ + VTLVPK  GD V++K + I
Sbjct  542   KHGKSVKTRLRLGISELLDDLGADDDDNVLVTLVPKNKGDEVSIKGMKI  590



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   131 bits (329),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 126/232 (54%), Gaps = 20/232 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ--  617
             S+VDR W+V +TLGGKR   TD +WL + F+ YDEN NLVR+KV DCLD  K+GY YQ  
Sbjct  371   SNVDRMWSVWKTLGGKRTDFTDSDWLDSGFLFYDENANLVRVKVRDCLDTRKMGYDYQKV  430

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTATAI-----------LPATLDETVKFYVTRPPA  764
             D+P  R+K   P   +  S    +L  A A             P  L+  V   V+RP  
Sbjct  431   DIPWLRAK---PTPRRIASKVARALGVAHAAETKKKVLSDVQFPLVLNNVVSLEVSRPKK  487

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
             + S  +KE E++  V+   +E+D  + ++FD Y+N+ +D  ++  +  EFAGSFIN   P
Sbjct  488   SRSKAEKEEEEEVLVIE-NIEFDRDQLVKFDVYIND-EDDTTIGPDNTEFAGSFINV--P  543

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +     K TT   L +  +L++L    ++ + VTLVPK G     +  V I
Sbjct  544   HKHRHGNKMTTCLRLGLTDLLEELGAEDDDGVVVTLVPKSGKGLAKIGGVKI  595



>gb|ABF19601.1| polyphenol oxidase [Camellia ptilophylla]
Length=595

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 127/229 (55%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    DP+WL + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  367   ANVDRIWTVWKTLGGKRNDFKDPDWLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  426

Query  624   PNP-----RSKKFEPFTGKNPSSTGSSLPT-----ATAILPATLDETVKFYVTRPPAtts  773
               P      S +   F  K  +  G ++ T     A  + P  LDE VK  V RP  + S
Sbjct  427   EIPWLNTRPSPRISNFLRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  486

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  487   EREKEEEEEVVVVEGIEVERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  542

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T   L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  543   KHDKKIRTGLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  591



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 126/228 (55%), Gaps = 13/228 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +TLGG KR   T P+WL  SF+ YDEN   VR+KV+DCL+   LGY YQD
Sbjct  368   SNVDRMWTLWKTLGGPKRTDFTHPDWLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQD  427

Query  621   L--------PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttst  776
             +        P PR    +        +  + +P + A  P  LD+ V   V RP    S 
Sbjct  428   VDIPWRNSKPVPRKIAIKVTETSGGIADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSK  487

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             K+KE +++  V+   +E +    ++FD ++N+ + A+    +M EFAGSF+N     +  
Sbjct  488   KEKEEKEEVLVIEG-IELESDAFVKFDVHINDEQ-ASLSSPDMTEFAGSFVNVPHKHKPG  545

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +K KT  T  L I ++L+DL    + KI VTL P+ GG+ V + ++ I
Sbjct  546   KKMKTKLT--LGITELLEDLMCEDDEKILVTLNPRYGGEDVIISNIKI  591



>ref|XP_007025703.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28325.1| Larreatricin hydroxylase [Theobroma cacao]
Length=605

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 132/229 (58%), Gaps = 14/229 (6%)
 Frame = +3

Query  447   DVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +VDR W++ +TL G KR   +D +WL  SFV YDEN NLVR+KV DC+D++ LGY YQ +
Sbjct  375   NVDRMWSIWKTLPGTKRNDFSDTDWLDASFVFYDENANLVRVKVRDCVDSKNLGYDYQPV  434

Query  624   PN------PRSKKFEPFTGK-NPSSTGSSLPTATAI---LPATLDETVKFYVTRPPAtts  773
              N      P ++KF    GK   S+  + + +   +    P  LD+TV   + R P  + 
Sbjct  435   DNPWLKTKPTARKFAKKGGKARGSAMAAEIKSKNVVRNAFPIVLDKTVSIEIPR-PRKSR  493

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
             +K+++ ED+E ++   ++      ++FD Y+N+  D      E AEFAGSF N   P   
Sbjct  494   SKREKEEDEEVLVLEGIQLATQAAVKFDIYINDEDDEAPSGPEDAEFAGSFTNI--PHSH  551

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +   K  TT+SL I+ VL+DL + G++ I VTLVP+ G   V+V ++ +
Sbjct  552   THAKKLNTTFSLAISDVLEDLDVEGDDNIVVTLVPREGKGLVSVGNIKV  600


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (45%), Gaps = 15/123 (12%)
 Frame = +3

Query  72   DYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQAGFSPG  251
            DYK P+FS+   R     +D +   KF  A+  +KE  LP D     + ++     +  G
Sbjct  136  DYKPPSFSKLRYRPPAHLVDADYLAKFTKAMNLMKE--LPSDDPRSFMQQAYVHCAYCNG  193

Query  252  A-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNSTLDSDLPDH  392
            A             HF   F  FHR YL+ YE++L  + GD    +P+WN    + +P  
Sbjct  194  AYDQVGFPDQDLQVHFSWLFFPFHRWYLYFYERILGKLIGDPDFVMPFWNWDAPAGMPIP  253

Query  393  AAY  401
            A Y
Sbjct  254  AIY  256



>ref|XP_006370119.1| hypothetical protein POPTR_0001s39670g [Populus trichocarpa]
 gb|ERP66688.1| hypothetical protein POPTR_0001s39670g [Populus trichocarpa]
Length=416

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 132/225 (59%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ +DEN  LVR+KV+D LD +KL Y +QD
Sbjct  193   SNVDRMWDMWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQD  252

Query  621   LPNP--RSKKFEPFTGKNPSSTGSS---LPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  +++     T +  S   +    + T  +  P  LD+ V   V+RP  + S  +K
Sbjct  253   VPIPWLKTRPAPKLTRQEKSRRAAKKTVVLTPISAFPVVLDKVVSVEVSRPKKSRSATEK  312

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E ED+  V+   +EY+E + I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  313   EDEDEVLVIE-GIEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFVNV--PHKHAKKS  368

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KTT    L I  +++D    G+  + VT VP+ GGD VTV +V I
Sbjct  369   KTTMV--LGITGLMEDPEAEGDETLVVTFVPRTGGDFVTVANVKI  411



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/227 (37%), Positives = 123/227 (54%), Gaps = 12/227 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGG+R  ITDP++L  +F+ YDEN  +VR+KV DCLD  KLGY+YQD+
Sbjct  363   SNIDRMWSVWKTLGGRRQDITDPDFLDAAFLFYDENAKMVRVKVRDCLDPRKLGYAYQDV  422

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstk  779
                     P PR         K   +  +   +   + PA LD  +K  V RP    S K
Sbjct  423   EIPWANSRPTPRVSSVLRKLKKLGRAKAADAQSPREVFPAKLDRVLKVMVKRPKKKRSKK  482

Query  780   kketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSE  959
             +K+  ++  V+   +E D    ++FD Y+N+  D  +   E  EFAGSF+N   P +   
Sbjct  483   EKDELEEILVIKG-IEVDRDTYVKFDVYINDEDDEIT-TAENTEFAGSFVNV--PHKHKH  538

Query  960   KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               K  T   L I+ +L+DL    +  + VTLVP   GD++T+  + I
Sbjct  539   DKKIKTQLRLSISDILEDLDAEDDEHVLVTLVPTNAGDAITIHDIKI  585



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 126/228 (55%), Gaps = 13/228 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +TLGG KR   T P+WL  SF+ YDEN   VR+KV+DCL+   LGY YQD
Sbjct  432   SNVDRMWTLWKTLGGPKRTDFTHPDWLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQD  491

Query  621   L--------PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttst  776
             +        P PR    +        +  + +P + A  P  LD+ V   V RP    S 
Sbjct  492   VDIPWRNSKPVPRKIAIKVTETSGGIADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSK  551

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             K+KE +++  V+   +E +    ++FD ++N+ + + S   +M EFAGSF+N     +  
Sbjct  552   KEKEEKEEVLVIEG-IELESDAFVKFDVHINDEQASLS-SPDMTEFAGSFVNVPHKHKPG  609

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +K KT  T  L I ++L+DL    + KI VTL P+ GG+ V + ++ I
Sbjct  610   KKMKTKLT--LGITELLEDLMCEDDEKILVTLNPRYGGEDVIISNIKI  655



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 135/224 (60%), Gaps = 12/224 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +T+ GG R  I+DP+WL + F+ Y+EN  LVR KV DCLDN  L Y+YQ+
Sbjct  342   SNVDRMWTIWKTIPGGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCLDNTGLRYTYQN  401

Query  621   LPNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
             +  P   SK      GK  + T ++L   TA  P  LD+T+   V+RP  + S K+KE E
Sbjct  402   VEIPWLESKPIPRRLGKKAAETKTALTPITA-FPLVLDKTIVTVVSRPKKSRSRKEKEEE  460

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             D+  V+   +EYD+ K ++FD ++N++ +  S + E  EFAGSF+N +   + ++K+KT 
Sbjct  461   DEVLVIEG-IEYDKGKFVKFDVFINDDVEMPS-KPENTEFAGSFVNVS--HKHAKKSKTR  516

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCG--GDSVTVKSVDI  1100
                 L I ++L+DL   G++ I V LVP+     D V +  V I
Sbjct  517   LI--LGITELLEDLESDGDDSIVVALVPRSNSVSDPVVISGVKI  558



>ref|XP_009771442.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=596

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 131/225 (58%), Gaps = 10/225 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + LGGKR  +TD +WL + F  YDEN +  R+KV DCLD++K+GY Y+  
Sbjct  370   ANVDRMWNEWKALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPK  429

Query  624   PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
               P  + F+P     P      S+  A+ + P + LD  + F + RP   TS  +++ ++
Sbjct  430   ATPW-RNFKPGKKTTPGKVNLRSVKPASKVFPLSNLDRAICFSIERP--ATSRSQQDKDE  486

Query  798   ketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW---PRQGSEKT  965
              E VL F  ++YD++K I+FD ++N +K  N+ +++  E+AGS+ +      P  G+   
Sbjct  487   FEEVLTFKNLKYDDSKYIKFDVFVNADKTVNADDIDKKEYAGSYTSLPHVHGPNSGNHAV  546

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +    + L I ++L+D  L  E+ I VT+VPK GG+ V++ SV I
Sbjct  547   E-VQEFKLAITELLEDCGLEDEDIIAVTVVPKTGGEVVSINSVLI  590



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 135/224 (60%), Gaps = 12/224 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +T+ GG R  I+DP+WL + F+ Y+EN  LVR KV DCLDN  L Y+YQ+
Sbjct  342   SNVDRMWTIWKTIPGGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCLDNTGLRYTYQN  401

Query  621   LPNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
             +  P   SK      GK  + T ++L   TA  P  LD+T+   V+RP  + S K+KE E
Sbjct  402   VEIPWLESKPIPRRLGKKAAETKTALTPITA-FPLVLDKTIVTVVSRPKKSRSRKEKEEE  460

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             D+  V+   +EYD+ K ++FD ++N++ +  S + E  EFAGSF+N +   + ++K+KT 
Sbjct  461   DEVLVIEG-IEYDKGKFVKFDVFINDDVEMPS-KPENTEFAGSFVNVS--HKHAKKSKTR  516

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCG--GDSVTVKSVDI  1100
                 L I ++L+DL   G++ I V LVP+     D V +  V I
Sbjct  517   LI--LGITELLEDLESDGDDSIVVALVPRSNSVSDPVVISGVKI  558



>ref|XP_011014565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 134/225 (60%), Gaps = 12/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + + + GGKR  I DP+WL + F+ ++EN  LVR+KV+D LD +KL Y +QD
Sbjct  358   SNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQD  417

Query  621   LPNP--RSKKFEPFTGKNP---SSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +P P  +++     T +     ++  S + T  +  P  LD+ +   V+RP  + S  +K
Sbjct  418   VPIPWLKTRPTPKLTRQEKLRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E E +  V+   +EY+E + I+FD  +N+  D+     + +EFAGSF+N   P + ++K+
Sbjct  478   EDEAEVLVIE-GIEYEENQLIKFDVLVNDEPDSPG-GPDKSEFAGSFVNV--PHKHAKKS  533

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             KT     L I  +L+DL   G++ + VTLVP+ GGD VTV +V I
Sbjct  534   KTNLV--LGITGLLEDLEAEGDDTLVVTLVPRTGGDFVTVANVKI  576



>gb|ABR57235.1| polyphenol oxidase [Camellia sinensis]
Length=598

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 127/229 (55%), Gaps = 15/229 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TL GKR    DP+WL + F  YDEN  +V +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLEGKRNDFKDPDWLNSEFTFYDENAQVVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  +  
Sbjct  431   EIPWLNTRPSPRISNFFRKIKNKAGRAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRR  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              +++E E+   V    VE D +  ++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EREEEEEEVVVVEGIEVERDVS--VKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  545

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T   L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  546   KHDKKIRTGLRLGITELLEDLEAENDESVLVTLVPRYGSDAVTIGGVKI  594



>ref|XP_009616674.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=595

 Score =   129 bits (323),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 134/229 (59%), Gaps = 16/229 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W   + LGGKR  + D +WL + F  YDEN +  R+KV DCLD++K+GY Y+  
Sbjct  369   ANVDRLWNEWKALGGKRRDLRDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPT  428

Query  624   PNPRSKKFEPFTGKNPSSTG----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkke  788
               P  + F+P  GK  S+ G    SS+  A+ + P   LD  + F + RP   TS  ++E
Sbjct  429   ATPW-RNFKP--GKK-STAGKVNLSSVKPASKVFPLLNLDRAICFSIERP--ATSRSQQE  482

Query  789   tedketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW---PRQGS  956
              ++ E +L F  V+YD++K IRFD +LN +K  N+ ++   E+AGS+ +      P   +
Sbjct  483   KDEFEEILTFKGVKYDDSKYIRFDVFLNADKTVNADDINKREYAGSYTSLPHVHGPNNAT  542

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              + K    + L I ++L+D  L  E+ I VT+VPK GG+ V++ SV+I 
Sbjct  543   HEFK-PKEFKLAITELLEDCGLEDEDIIAVTVVPKKGGEVVSIHSVEIV  590



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   127 bits (320),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 127/224 (57%), Gaps = 9/224 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR WT+ Q LGGK  R   TD +WL  +F+ YDEN   VR++V D LDN+KLGY Y+
Sbjct  279   SNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYE  338

Query  618   --DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
               +LP   SK   P   K   +  S  P  T + P TLD+ V+  V RP  + S ++KE 
Sbjct  339   FTNLPWLNSKPL-PTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEA  397

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT  971
             E++   +   +E    +  +FD YLN+ +D      E AE+AGSF +      GS+K +T
Sbjct  398   EEEILEIQG-IEVAIDQYAKFDVYLND-EDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRT  455

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             +   SL + + L+DL    ++ + VTL PK GG  VTV+++ I 
Sbjct  456   SL--SLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKIV  497


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 54/125 (43%), Gaps = 17/125 (14%)
 Frame = +3

Query  33   MDSPILPFSGTITDYKLPTFSRHI--VRREYSALDDESREKFATAVRKLKERRLPVDHAD  206
            +D+   P +  +  YK+P  S     +R     +D E   KF  A+R +KE  LP D   
Sbjct  24   VDNCCPPLATNVIPYKVPRTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKE--LPADDPR  81

Query  207  YDLFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIF  347
                ++L    +  G              H    F  FHR YL+ YE++L  + GD T  
Sbjct  82   NFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFG  141

Query  348  VPYWN  362
            +P+WN
Sbjct  142  LPFWN  146



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   128 bits (322),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 126/230 (55%), Gaps = 15/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ-  617
             S+VDR W++ + L G KR   TD +WL  SFV YDEN NLVR +V DCLD   LGY YQ 
Sbjct  372   SNVDRMWSIWKGLPGKKRNDFTDTDWLDASFVFYDENANLVRARVRDCLDTRTLGYDYQG  431

Query  618   -DLP----NPRSKKFEPFTGKNPSSTGSSLPTATAIL----PATLDETVKFYVTRPPAtt  770
              D+P     P  +KF    GK      ++      ++    P  LD+ V   + RP  + 
Sbjct  432   VDVPWLKTKPVPRKFSKKGGKGHGQAVAAETKNKNVIRNAFPIVLDKIVSIEIPRPKKSR  491

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             +  +KE E+   + +  ++ D +  ++FD Y+N+  D      E +EFAGSF N   P  
Sbjct  492   TKLEKEEEEVLVLES--IQLDTSTPVKFDIYINDEDDEAPSGPEDSEFAGSFTNV--PHN  547

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              S   K  T++SL I++VL+DL + G++ I VTLVP+ G   V+V ++ I
Sbjct  548   HSHSKKLETSFSLAISEVLEDLDVEGDDNIVVTLVPREGKGLVSVGNIKI  597


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 78/181 (43%), Gaps = 20/181 (11%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  + D+K PT+S+   R     +D +   KF  A+  +  R LP D           
Sbjct  128  PETTKVIDFKPPTYSKIRYRSAAHLVDPDYLAKFTKAMELM--RALPDDDPRSFKQQANI  185

Query  198  HADYDLFKSLHQAGFSPG--AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNSTL  371
            H  Y    +  Q GF      HF   F  FHR+YL+ YE++L  + GD    +P+WN   
Sbjct  186  HCAY-CNGAYDQVGFDQDIQVHFSWLFFPFHRLYLYFYERILGKLIGDPDFAMPFWNWDA  244

Query  372  DSDLPDHAAYA-PFSDMVSGMGNLSSDVDRRWTVCQTLGGKRAGITDPEWLQTSF-VLYD  545
             + +P  A Y  P S +     N++    +   V     G    ITD   +Q++  V+Y 
Sbjct  245  PAGMPIPAIYVNPNSPLYDDKRNVNHQPPK--VVDLDYNGTDKDITDKAMVQSNLKVMYK  302

Query  546  E  548
            +
Sbjct  303  Q  303



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 127/224 (57%), Gaps = 9/224 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR WT+ Q LGGK  R   TD +WL  +F+ YDEN   VR++V D LDN+KLGY Y+
Sbjct  279   SNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYE  338

Query  618   --DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
               +LP   SK   P   K   +  S  P  T + P TLD+ V+  V RP  + S ++KE 
Sbjct  339   FTNLPWLNSKPL-PTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEA  397

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT  971
             E++   +   +E    +  +FD YLN+ +D      E AE+AGSF +      GS+K +T
Sbjct  398   EEEILEIQG-IEVAIDQYAKFDVYLND-EDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRT  455

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             +   SL + + L+DL    ++ + VTL PK GG  VTV+++ I 
Sbjct  456   SL--SLGLNEPLEDLGAEDDDPVLVTLAPKVGGGVVTVENIKIV  497


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 54/125 (43%), Gaps = 17/125 (14%)
 Frame = +3

Query  33   MDSPILPFSGTITDYKLPTFSRHI--VRREYSALDDESREKFATAVRKLKERRLPVDHAD  206
            +D+   P +  +  YK+P  S     +R     +D E   KF  A+R +KE  LP D   
Sbjct  24   VDNCCPPLATNVIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKE--LPADDPR  81

Query  207  YDLFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIF  347
                ++L    +  G              H    F  FHR YL+ YE++L  + GD T  
Sbjct  82   NFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFG  141

Query  348  VPYWN  362
            +P+WN
Sbjct  142  LPFWN  146



>sp|Q9FRX6.1|AS1_ANTMA RecName: Full=Aureusidin synthase; Short=AmAS1 [Antirrhinum majus]
 dbj|BAB20048.1| aureusidin synthase [Antirrhinum majus]
 gb|ABR57233.1| aureusidin synthase [Antirrhinum majus]
Length=562

 Score =   128 bits (321),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 131/226 (58%), Gaps = 10/226 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W++ +TLGG +R  +TDP++L  SFV YDEN  +VR+KV DCLD +KLGY YQD
Sbjct  336   SNVDRMWSIWKTLGGPRRTDLTDPDFLDASFVFYDENAEMVRVKVRDCLDEKKLGYVYQD  395

Query  621   LPNP-----RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             +  P      + K  P   K    T ++ P    + PA LD  +K  VTRP  T S K+K
Sbjct  396   VEIPWLNTRPTPKVSPSLLKKFHRTNTANP--RQVFPAILDRVLKVIVTRPKKTRSRKEK  453

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANS-LEVEMAEFAGSFINFAWPRQGSEK  962
             +  ++  V+       +  +++FD Y+N ++D  + +  E AEFAGSF++  W +    K
Sbjct  454   DELEEILVIEGIELERDHGHVKFDVYINADEDDLAVISPENAEFAGSFVSL-WHKPIKGK  512

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                T   +L I  +L+DL    ++ + VTLVP+  GD++ + +V I
Sbjct  513   RTKTQLLTLSICDILEDLDADEDDYVLVTLVPRNAGDAIKIHNVKI  558



>gb|ACR82078.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    DP+ L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDPDLLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNTRPSPRISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
               +KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EGEKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>gb|ACJ04908.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 127/229 (55%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    D +WL + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDWLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   PNP-----RSKKFEPFTGKNPSSTGSSLPT-----ATAILPATLDETVKFYVTRPPAtts  773
               P      S +   F  K  +  G ++ T     A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNARPSSRISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EREKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 127/224 (57%), Gaps = 9/224 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR WT+ Q LGGK  R   TD +WL  +F+ YDEN   VR++V D LDN+KLGY Y+
Sbjct  367   SNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYE  426

Query  618   --DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
               +LP   SK   P   K   +  S  P  T + P TLD+ V+  V RP  + S ++KE 
Sbjct  427   FTNLPWLNSKPL-PTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEA  485

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT  971
             E++   +   +E    +  +FD YLN+ +D      E AE+AGSF +      GS+K +T
Sbjct  486   EEEILEIQG-IEVAIDQYAKFDVYLND-EDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRT  543

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             +   SL + + L+DL    ++ + VTL PK GG  VTV+++ I 
Sbjct  544   SL--SLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKIV  585


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 54/125 (43%), Gaps = 17/125 (14%)
 Frame = +3

Query  33   MDSPILPFSGTITDYKLPTFSRHI--VRREYSALDDESREKFATAVRKLKERRLPVDHAD  206
            +D+   P +  +  YK+P  S     +R     +D E   KF  A+R +KE  LP D   
Sbjct  112  VDNCCPPLATNVIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKE--LPADDPR  169

Query  207  YDLFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIF  347
                ++L    +  G              H    F  FHR YL+ YE++L  + GD T  
Sbjct  170  NFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFG  229

Query  348  VPYWN  362
            +P+WN
Sbjct  230  LPFWN  234



>gb|ABF19602.1| polyphenol oxidase [Camellia sinensis var. assamica]
Length=599

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    DP+ L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDPDLLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNTRPSPRISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
               +KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EGEKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>gb|AHX26182.1| polyphenol oxidase [Sorghum bicolor]
Length=553

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 121/225 (54%), Gaps = 17/225 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              ++DR W+V   L       TDP+WL  SF+ YDE   LVR++V DCLD   LGY+YQD+
Sbjct  336   GNIDRLWSVWNGLRAGNTNFTDPDWLNASFLFYDEEARLVRVRVRDCLDTAALGYTYQDV  395

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          +  + TGS  P A+  LPATL++TV+  VTRP  + + ++K+ E++ 
Sbjct  396   ALPW------LNARPTTETGSPAP-ASGALPATLNQTVRVAVTRPRTSRTRQEKDDEEEV  448

Query  804   tVLNFYVEYDE-TKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWP--RQGSEKT  965
              V+      D  ++ ++FD ++NE++    +    A+ AGS     +   P  R+GS KT
Sbjct  449   LVVEGIEVADHFSRFVKFDVFVNESQSGGGMGSAAAQCAGSVAMTPHLVRPDKRRGSVKT  508

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                      I  +L D+   G+  I V+LVP+C GD VTV  V I
Sbjct  509   AA----RFGICDLLDDIGADGDKTIVVSLVPRCAGDMVTVGCVRI  549



>gb|AES87890.2| polyphenoloxidase [Medicago truncatula]
Length=606

 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 129/239 (54%), Gaps = 22/239 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD-  620
             S++DR W++ +TLGGKR    D +WL++ F+ YDEN NLV++ V+DCLD +KLGY YQD 
Sbjct  366   SNIDRLWSIWKTLGGKRKDFYDKDWLESEFLFYDENKNLVKVNVKDCLDTQKLGYVYQDV  425

Query  621   -LP--NPRSKKFEPFTGKNPSSTGSSLPTATAIL----------------PATLDETVKF  743
              +P  N +    +    K   + G+S  T  A L                P  LD  V  
Sbjct  426   FIPWLNAKPTPCKKIQKKVEVAQGNSFGTGKARLSEINENLTNSRNDVKFPLVLDNIVST  485

Query  744   YVTRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGS  923
              V RP  + S  +KE E++  V+   +E+D++  ++FD ++N+ +DA  ++    EFAGS
Sbjct  486   IVRRPKKSRSKTEKEEEEEVLVIEG-IEFDKSLGVKFDVFIND-EDAKEIKPVNTEFAGS  543

Query  924   FINFAWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             F+N        +K KT +   + +  +L+DL    ++ I VTLVP+     V + ++ I
Sbjct  544   FVNVPHSSHDHKKKKTNSCLRVGLTDLLKDLGAEDDDSIVVTLVPRYRKGLVKITNIKI  602



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 126/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLGGKR   TD +WL++ F+ YDEN NLVR+KV+DCLD  KLGY YQD+
Sbjct  370   SNIDRMWSIWKTLGGKRKDFTDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDV  429

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATA---ILPATLDETVKFYVTRPPAtt  770
                     P PR  + +          G++    T+     P  LD  V   V RP  + 
Sbjct  430   DIPWLNSRPTPRRSRVQKVALAQNFGVGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSR  489

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   +E++    ++FD ++N+ +D   +  +  EFAGSF++   P  
Sbjct  490   SKKEKEEEEEVLVIE-GIEFERNTPVKFDVFIND-EDDKQIRPDNTEFAGSFVSV--PHS  545

Query  951   GSEKTK-TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K K   T   L +  +L++L    ++ + VTLVP+ G   V ++ + I
Sbjct  546   HKHKNKDIITCLRLGLTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKI  596



>gb|EEC71623.1| hypothetical protein OsI_04042 [Oryza sativa Indica Group]
Length=551

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/346 (29%), Positives = 155/346 (45%), Gaps = 69/346 (20%)
 Frame = +3

Query  270   FVAFHRMYLFMYEKMLQNVAGDSTIFVPY--WNSTLDSDLP-------------------  386
             F+ FHR YL+ +E++L ++ GD T  +P+  W++     +P                   
Sbjct  202   FMPFHRCYLYFFERILGSLIGDPTFAIPFWNWDAPDAMSMPAMYTDQSSPLFDPRRNGRH  261

Query  387   --------DHAAYAP-FSD---------------MVSGMGNLSS------------DVDR  458
                     D+    P F+D                   MGN  S            ++DR
Sbjct  262   VPPKLIDLDYNGREPRFTDNQQVDHNLRVMYRQPAGEDMGNFYSAGRDPLFYAHHANIDR  321

Query  459   RWTVCQTLGGKR-AGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLPNPR  635
              W V + L  +R   +TDP+WL  SF+ YDE+  LVRI+V D LD ++L Y YQD+P P 
Sbjct  322   MWAVWKGLDPRRHTDLTDPDWLDASFLFYDEDPKLVRIRVRDVLDMDRLRYRYQDVPTPW  381

Query  636   SKKFEPFTGKNPSSTGSSLPTATAI---------LPATLDETVKFYVTRPPAttstkkke  788
             +      T +   S  SSL T TA           P TLD   +  V RP +   ++ + 
Sbjct  382   TSARPVVTTQRVRSATSSLLTPTARAAGAKEAARFPVTLDSPTRVTVKRPVSARRSRAES  441

Query  789   tedketVLNF-YVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
                KE VL    ++ D    ++FD ++N  +D  ++     E AGSF+N     +  ++ 
Sbjct  442   KLAKEEVLIIDGIQVDMDVAVKFDVFVNAGEDHAAVGPGGRELAGSFVNVPHRHKHDKRG  501

Query  966   KTT-TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +   TT  L + + L+DL   G++ + VTLVP+ G   V + SV I
Sbjct  502   RAIKTTLRLALNEQLEDLGAEGDDSVVVTLVPRQGKGKVKIGSVKI  547



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 125/225 (56%), Gaps = 11/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR WT+ Q LGGK  R   TD +WL  +F+ YDEN   VR++V D LDN+KLGY Y+
Sbjct  367   SNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYE  426

Query  618   --DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRP-PAttstkkke  788
               +LP   SK   P   K   +  S  P  T + P TLD+ V+  V RP  + +  +K+ 
Sbjct  427   FTNLPWLNSKPL-PTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEA  485

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK  968
              E+   +    V  D+    +FD YLN+ +D      E AE+AGSF +      GS+K +
Sbjct  486   EEEILEIEGIEVAIDQY--AKFDVYLND-EDEPEAGKEKAEYAGSFAHLPHKHTGSKKIR  542

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T+   SL + + L+DL    ++ + VTL PK GG  VTV+++ I 
Sbjct  543   TSL--SLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKIV  585


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 54/125 (43%), Gaps = 17/125 (14%)
 Frame = +3

Query  33   MDSPILPFSGTITDYKLPTFSRHI--VRREYSALDDESREKFATAVRKLKERRLPVDHAD  206
            +D+   P +  +  YK+P  S     +R     +D E   KF  A+R +KE  LP D   
Sbjct  112  VDNCCPPLATNVIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKE--LPADDPR  169

Query  207  YDLFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIF  347
                ++L    +  G              H    F  FHR YL+ YE++L  + GD T  
Sbjct  170  NFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFG  229

Query  348  VPYWN  362
            +P+WN
Sbjct  230  LPFWN  234



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 126/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLGGKR   TD +WL++ F+ YDEN NLVR+KV+DCLD  KLGY YQD+
Sbjct  370   SNIDRMWSIWKTLGGKRKDFTDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDV  429

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATA---ILPATLDETVKFYVTRPPAtt  770
                     P PR  + +          G++    T+     P  LD  V   V RP  + 
Sbjct  430   DIPWLNSRPTPRRSRVQKVALAQNFGVGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSR  489

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   +E++    ++FD ++N+ +D   +  +  EFAGSF++   P  
Sbjct  490   SRKEKEEEEEVLVIE-GIEFERNTPVKFDVFIND-EDDKQIRPDNTEFAGSFVSV--PHS  545

Query  951   GSEKTK-TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K K   T   L +  +L++L    ++ + VTLVP+ G   V ++ + I
Sbjct  546   HKHKNKDIITCLRLGLTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKI  596



>ref|XP_008663490.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Zea mays]
 gb|AFW59173.1| putative polyphenol oxidase family protein [Zea mays]
Length=546

 Score =   125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 117/221 (53%), Gaps = 10/221 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              ++DR W+V   L    +  TDP WL  SF+ YDE   LVR++V DCLD   LGY+YQD+
Sbjct  330   GNIDRMWSVWNGLRPGNSDFTDPSWLDASFLFYDEEARLVRVRVRDCLDTAALGYAYQDV  389

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          K     GS  PTA A LPATL++TV+  VTRP  + + K+K+ +++ 
Sbjct  390   ALPW------LNAKPAKEAGSPAPTAGA-LPATLNQTVRVAVTRPKTSRTRKEKDAKEEV  442

Query  804   tVLN-FYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSF-INFAWPRQGSEKTKTTT  977
              V+    +    ++ ++FD ++N+++    +    A+ AGS  +     R G  K    T
Sbjct  443   LVVQGIEIADHSSRFVKFDVFVNDSQSGGGMPAA-AQCAGSVALTPHAVRPGKGKGTVKT  501

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  I  +L D+   G+  I V+LVP+C GD VTV  V I
Sbjct  502   VARFGICDLLDDIGADGDKTIIVSLVPRCAGDMVTVGGVGI  542



>emb|CAG25740.1| polyphenol oxidase A [Solanum lycopersicum]
Length=242

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 129/246 (52%), Gaps = 17/246 (7%)
 Frame = +3

Query  501   ITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLPNPRSKKFEPFTGKNPSST  680
             I + +WL + F  YDEN N  +++V DCLD +K+GY Y     P  + F+P T  +    
Sbjct  2     IQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHATATPW-RNFKPKTKASAGKV  60

Query  681   GS-SLPTATAILP-ATLDETVKFYVTRPPAttstkkketedketVLNFYVEYDETKNIRF  854
              + S+P  + + P A LD+ + F + RP ++ + ++K  +++    N  ++YD    IRF
Sbjct  61    NTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEVLTFN-AIKYDNRDYIRF  119

Query  855   DAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTTTTWSLEIAQVLQDLALGGE  1031
             D +LN + + N+ E++ AEFAGS+ +     R G  K   T T  L I ++L+D+ L  E
Sbjct  120   DVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTATATLRLAITELLEDIGLEDE  179

Query  1032  NKIPVTLVPKCGGDSVTVKSVDITG*DSHCTMNSGSCVCVLRYEILYVKQISNC---VLS  1202
             + I VTLVPK G   +++  V+I        +     VCV+    L + +   C   V  
Sbjct  180   DTIAVTLVPKKG--DISIGGVEI-------KLAIVKLVCVVNLLTLQLNKDRFCYDSVFV  230

Query  1203  CEILCL  1220
             C  +CL
Sbjct  231   CWFVCL  236



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   125 bits (315),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 124/230 (54%), Gaps = 15/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ + LGG+R  ITDP++L  SF+ YDEN  +VR+K  DCLDN KLGY+YQD+
Sbjct  358   SNIDRLWSLWKGLGGRRQDITDPDFLDASFLFYDENGQMVRVKTRDCLDNTKLGYTYQDV  417

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPT---ATAILPATLDETVKFYVTRPPAtt  770
                     P P+         K   +  ++  T      +LPA LD+ +K  V RP    
Sbjct  418   EIPWLKSRPTPKVSSVLKKLKKLGKAKAAAAETHRPPKEVLPAKLDKVLKIMVKRPKKKR  477

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+K+  ++  ++   +E +     +FD Y+N+  D  S E E  EFAGSF+N   P +
Sbjct  478   SKKEKDELEEILIIQG-IELERDVYAKFDVYINDEDDETSTE-ENTEFAGSFVNV--PHK  533

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T   L I  +L+DL    +  + VTLVP   GDS+T+  V I
Sbjct  534   HKHGKKIKTQLRLSITDILEDLDAEDDEHVLVTLVPTNAGDSITIHGVKI  583



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   125 bits (315),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 124/230 (54%), Gaps = 15/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ-  617
             S+VDR W++ +TL G KR   TD +WL +SF+ YDEN NLVR+KV D L+ +  GY YQ 
Sbjct  368   SNVDRLWSIWRTLPGKKRTDFTDTDWLDSSFLFYDENANLVRVKVRDSLNMKTFGYDYQK  427

Query  618   -------DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttst  776
                    + PNPR        G+  ++   ++   +   P  LD+ V+  V RP  + + 
Sbjct  428   ANIPWLKNKPNPRKSGRGKSGGQAVAAETKNITPISNAFPIALDKLVRVEVPRPKKSRTK  487

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
              +KE E++  VL   ++ D    ++FD Y+N+  D    E E +EFAGSF N        
Sbjct  488   LEKEDEEEVLVLQ-NIQLDRDAAVKFDVYINDEDDETPTEPEDSEFAGSFTNLP---HNH  543

Query  957   EKT--KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              KT  K  T  +L +  +L+DL + G+  I VTLVPK G   V++ ++ I
Sbjct  544   HKTGMKLNTNLTLPLTDLLEDLNVEGDESILVTLVPKEGKGLVSIGNIKI  593


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 52/118 (44%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+K P FS   +R     +D    EKF  A+  +K   LP D           
Sbjct  124  PKTTNILDFKPPRFSTIRLRPAAHLVDANYLEKFTKAIELMKA--LPDDDPRSFKQQANV  181

Query  198  HADYDLFKSLHQAGFSPG---AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    +  Q GF       HF   F  FHR+YL+ YE++L  + GD    +P+WN
Sbjct  182  HCAY-CNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLYFYERILGKLIGDPNFAMPFWN  238



>gb|AHX26181.1| polyphenol oxidase [Sorghum bicolor]
Length=554

 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 121/223 (54%), Gaps = 13/223 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              ++DR W+V   L       TDP+WL  SF+ YDE   LVR++V DCLD   LGYSYQD+
Sbjct  337   GNIDRLWSVWNGLRAGNTNFTDPDWLNASFLFYDEEARLVRVRVRDCLDTAALGYSYQDV  396

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          +  + TGS +P A A LPATL++TV+  VTRP  + + ++K+ E++ 
Sbjct  397   ALPW------LNARPTTETGSPVPAAGA-LPATLNQTVRVAVTRPRTSRTRQEKDAEEEV  449

Query  804   tVLNFYVEYDE-TKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKT  971
              V+      D  ++ ++FD ++NE +    +   +A+ AGS     +   P +G    KT
Sbjct  450   LVVEGIEVADHFSRFVKFDVFVNECQGGGGMGAAVAQCAGSVAMTPHLVRPGKGRGSVKT  509

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                +   I  +L ++   G+  I V+LVP+C GD VTV  V I
Sbjct  510   AARFG--ICDLLDNIGADGDKTIVVSLVPRCAGDMVTVGGVRI  550



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 125/230 (54%), Gaps = 16/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLGGKR   TD +WL ++F+ YDEN NLVR+KV DCLD +KL Y YQ++
Sbjct  355   SNVDRMWSVWKTLGGKRTDFTDSDWLDSAFLFYDENANLVRVKVRDCLDTKKLRYEYQNV  414

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI-----------LPATLDETVKFYVTRPPAtt  770
               P  K  +P   +  S    +L  A A             P  LD+ V   V RP  + 
Sbjct  415   EIPWLKT-KPTPKRVISKVKRALGVANAAETKKMVVRNFKFPLVLDDIVSLEVARPKKSR  473

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K++E E++  V+   +E+D  + ++FD Y+N+ +D   +  +  EFAGSF+N   P +
Sbjct  474   SRKEEEEEEEVLVIE-NIEFDRHQVVKFDVYIND-EDDTVIGPDNTEFAGSFVNV--PHK  529

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T   L +  +L++L    ++ + VTLVPK G     +  + I
Sbjct  530   HKHGKKMATFLRLGLTYLLEELDAEDDDGVVVTLVPKFGKGLAKIGGIKI  579



>ref|XP_002446944.1| hypothetical protein SORBIDRAFT_06g025570 [Sorghum bicolor]
 gb|EES11272.1| hypothetical protein SORBIDRAFT_06g025570 [Sorghum bicolor]
Length=566

 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 121/223 (54%), Gaps = 13/223 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              ++DR W+V   L       TDP+WL  SF+ YDE   LVR++V DCLD   LGYSYQD+
Sbjct  349   GNIDRLWSVWNGLRAGNTNFTDPDWLNASFLFYDEEARLVRVRVRDCLDTAALGYSYQDV  408

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          +  + TGS +P A A LPATL++TV+  VTRP  + + ++K+ E++ 
Sbjct  409   ALPW------LNARPTTETGSPVPAAGA-LPATLNQTVRVAVTRPRTSRTRQEKDAEEEV  461

Query  804   tVLNFYVEYDE-TKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKT  971
              V+      D  ++ ++FD ++NE +    +   +A+ AGS     +   P +G    KT
Sbjct  462   LVVEGIEVADHFSRFVKFDVFVNECQGGGGMGAAVAQCAGSVAMTPHLVRPGKGRGSVKT  521

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                +   I  +L ++   G+  I V+LVP+C GD VTV  V I
Sbjct  522   AARFG--ICDLLDNIGADGDKTIVVSLVPRCAGDMVTVGGVRI  562



>ref|XP_007159290.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
 gb|ESW31284.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
Length=594

 Score =   125 bits (314),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 132/234 (56%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W++ +T+ GGKR   TDP+WL++SF+ YDEN NLVR+KV+D LD   LGY YQD
Sbjct  360   ANVDRVWSIWKTIPGGKRRDFTDPDWLESSFLFYDENKNLVRVKVKDSLDTRNLGYVYQD  419

Query  621   L--------PNPRSKKFEPFT-----GKNPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
             +        P PR  K +        G   +    +  +++   P +LD  V   V RP 
Sbjct  420   IDLPWLKKKPKPRMSKAKKVALAKSFGVTAARAAETTTSSSVRFPLSLDSKVSIVVKRPK  479

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                S ++KE E++  V++  +E+   K ++FD ++N+ +D   ++   +EFAGSF++   
Sbjct  480   LLRSKEEKEEEEEVLVIDG-IEFGRDKAVKFDVFIND-EDDEVIKASNSEFAGSFVSL--  535

Query  942   PRQGSEKT-KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P     K+ K  T + + +  +L+DL    ++ I VTLVPK G   VT++ + I
Sbjct  536   PHTHLHKSMKVKTCFRVGLTDLLEDLEAENDDSIVVTLVPKYGKGLVTIQGIKI  589


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (47%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P S TI D+K P  +   VR     +DD  R+K+  A+  +K   LP +           
Sbjct  109  PKSSTIVDFKFPPRTPLRVRPGAHLVDDIYRDKYKEALSIMKG--LPSEDPRSFIQQANI  166

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    + HQ GF       H    F  +HR YL+ YE++L ++ GD T  +P+WN
Sbjct  167  HCAY-CNGAYHQVGFPDLDLQVHNSWLFFPYHRFYLYFYERILGSLIGDPTFAIPFWN  223



>ref|XP_004293563.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 122/213 (57%), Gaps = 8/213 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W++ +  GG    IT  +WL T F+ YDEN NLVR+KV D LD  KLGY YQD+
Sbjct  370   ANVDRMWSIYKARGG--TDITKKDWLDTEFLFYDENKNLVRVKVRDSLDESKLGYKYQDV  427

Query  624   PNP-RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedk  800
               P  + K      KN      S    T+  PATL ET+   V RP A   T  ++T+++
Sbjct  428   EIPWLNSKPTARKSKNKRKAAVSSADLTSKFPATLSETISVEVARPSAAKRTTAEKTKEE  487

Query  801   etVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTTT  980
             E ++   +E+  ++ ++FD Y+N++ D  S + + AEFAGSF++   P + ++K KT   
Sbjct  488   EVLVISGIEFAGSEMLKFDVYVNDDADEVSGK-DKAEFAGSFVHV--PHRANKKIKTNL-  543

Query  981   WSLEIAQVLQDLALGGENKIPVTLVPKCGGDSV  1079
               L I  +L DL    +N + VTLVPK G  ++
Sbjct  544   -RLGITNLLTDLGAEEDNSVVVTLVPKFGKGAI  575



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 132/232 (57%), Gaps = 14/232 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLGGKR   TD +WL + F+ YDEN N+VR+KV DCLD++KLGY YQD+
Sbjct  372   SNVDRLWSVWKTLGGKREDFTDSDWLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDV  431

Query  624   --------PNPRSKKF----EPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAt  767
                     P PR  K     +       +S+G  +    +  P  LD  +   V RP   
Sbjct  432   DIPWLTSKPTPRRSKLAKAAKAIGVARAASSGPKV-VGRSDFPIKLDSKISTVVKRPKQK  490

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWP  944
               +KK++ +++E ++   +E+++   ++FD Y+N+ +D +   + + +EFAGSF+N    
Sbjct  491   KRSKKEKEDEEEILVIGGIEFEKDMAVKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHK  550

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +  +K KT +   L +  +L+DL    +  + VTLVP+ G  S+ + ++ I
Sbjct  551   HKDKKKKKTKSCLRLGLTDLLEDLGAEDDESVVVTLVPRYGTKSLKIDTIKI  602



>gb|KHN46329.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=624

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 127/232 (55%), Gaps = 16/232 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W++ +T+ GGKR   TDP+WL+++F  YDEN NLVR+KV+D LD  KLGY YQD
Sbjct  391   ANVDRMWSIWKTIPGGKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQD  450

Query  621   L--------PNPRSKKFEPFTGKNPSSTGSSLPTAT----AILPATLDETVKFYVTRPPA  764
             +        P P+  K +          G++    T       P TLD  V   V RP  
Sbjct  451   VDIPWLKNKPKPKRSKAKKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKL  510

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
               S ++KE E++  V++  +E+D  K ++FD ++N+ +D   +     EFAGSF++    
Sbjct  511   LRSKEEKEEEEEVLVID-GIEFDRNKAVKFDVFIND-EDDKVITPSNTEFAGSFVSVPHS  568

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K K  T + + +  +L+DL    ++ I VTLVPK G   VT++ + I
Sbjct  569   HVHKNK-KIKTCFRVGLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKI  619


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 16/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            P S TI D+KLP+    + VR     ++D    K+  A++++K    P D          
Sbjct  137  PISSTIIDFKLPSSGAPLRVRPAAHLVNDVYIAKYREALKRMKALS-PNDPRNFTQQANV  195

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    + HQ GF       H    F  +HR YL+ YE++L N+ GD T  +P+WN
Sbjct  196  HCAY-CDGAYHQVGFPNLDLQVHNCWLFFPYHRWYLYFYERILGNLIGDPTFALPFWN  252



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 126/232 (54%), Gaps = 17/232 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK-RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S++DR WT+ +TLGGK R   TDP+WL   F+ YDEN NLVR+KV DCLDN+KLGY YQ 
Sbjct  374   SNIDRMWTIWKTLGGKKRKEFTDPDWLDAGFLFYDENANLVRVKVRDCLDNKKLGYDYQK  433

Query  621   L--------PNPR----SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
             +        P PR    +K    F   + + T     TA +  P  LD+T+   V RP  
Sbjct  434   VDIPWLNTKPTPRKRIVNKVRSTFGVAHAAETRRIQLTARSQFPLVLDKTMSTLVPRPKK  493

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
             + S K+KE E++  V+   ++++    ++FD Y+N+  D  S   +  EFAGSF+N   P
Sbjct  494   SRSKKEKEEEEEVLVIEG-IDFERDAQVKFDVYINDEHDVPS-GPDDTEFAGSFVNV--P  549

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +     K  T   L +  +++DL    ++ + VTLVP+ G     +  + I
Sbjct  550   HKHKHGKKIKTCLRLGLTDLIEDLEAEDDDSVVVTLVPRYGKGLARIGGIKI  601



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 124/225 (55%), Gaps = 11/225 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR WT+ Q LGGK  R   TD +WL  +F+ YDEN    R++V D LDN+KLGY Y+
Sbjct  367   SNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAYRVRVGDALDNQKLGYKYE  426

Query  618   --DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRP-PAttstkkke  788
               +LP   SK   P   K   +  S  P  T + P TLD+ V+  V RP  + +  +K+ 
Sbjct  427   FTNLPWLNSKPL-PTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEA  485

Query  789   tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK  968
              E+   +    V  D+    +FD YLN+ +D      E AE+AGSF +      GS+K +
Sbjct  486   EEEILEIEGIEVAIDQY--AKFDVYLND-EDEPEAGKEKAEYAGSFAHLPHKHTGSKKIR  542

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             T+   SL + + L+DL    ++ + VTL PK GG  VTV+++ I 
Sbjct  543   TSL--SLGLNEPLEDLGAEDDDAVLVTLAPKVGGGDVTVENIKIV  585



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 126/231 (55%), Gaps = 15/231 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WT+ +TLGGKR  ITDP+WL +SF  YDEN + VR+KV+DC+DN KL Y YQD+
Sbjct  374   SNVDRMWTIWKTLGGKRKDITDPDWLNSSFFFYDENADPVRVKVKDCVDNTKLRYVYQDV  433

Query  624   --------PNPRSKKFEPFTGKNPSSTGS---SLPTATAILPATLDETVKFYVTRPPAtt  770
                     P PR  + +      P+  G    +  T++   P  LD+ +   V RP  + 
Sbjct  434   EIPWLKTKPTPRKSRVKKVAKAFPAGHGGVAQAAETSSVKFPIVLDKVISTVVARPKKSR  493

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+K+ E++  V+   +E +    ++FD ++N+  DA +      EFAGSF++     Q
Sbjct  494   SKKEKDDEEEVLVIE-GIEVERDIPVKFDVFINDEDDAPTGPGINTEFAGSFVSVP---Q  549

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
               +  K  T   + I+ +L+DL    ++ + VTLVP+ G     +  + I 
Sbjct  550   QKQTKKKKTYLRIGISDLLEDLGAEDDDSVVVTLVPRFGKGKAIIGGIKIV  600



>gb|ACN38060.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    D + L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNARPSPRISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EREKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 127/231 (55%), Gaps = 12/231 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +TLG     ITDP+WL T F+ YDEN  LVR+KV DCLD++KLGY YQD+
Sbjct  368   SNVDRMWSVWKTLGATNKDITDPDWLDTGFLFYDENAQLVRVKVRDCLDSKKLGYVYQDV  427

Query  624   --------PNPRSKKF---EPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
                     P PR  K        G   ++T           P  LD  +   V RP    
Sbjct  428   DIPWLTSKPTPRRSKLAKTAKAVGVARAATSGPKVVGRGDFPIKLDSKISTVVKRPKQKK  487

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPR  947
              +KK++ +++E ++   +E+++   ++FD Y+N+ +D +   + + +EFAGSF+N     
Sbjct  488   RSKKEKEDEEEILVIGGIEFEKDTAVKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHKH  547

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +  +K KT +   L +  +L+DL    +  + VTLVP+ G  S+ + ++ I
Sbjct  548   KDKKKKKTKSCLRLGLTDLLEDLGAEDDESVVVTLVPRYGTKSLKIDTIKI  598



>gb|ABR24120.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    D + L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNARPSPRISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EREKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>gb|ACR61399.1| polyphenol oxidase [Solanum melongena]
Length=546

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 109/187 (58%), Gaps = 4/187 (2%)
 Frame = +3

Query  444  SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
            S+VDR W+  + +GGKR  I+  +WL + F  YDEN +  R+KV DCLD +K+GY Y  +
Sbjct  357  SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  416

Query  624  PNPRSKKFEPFTGKNPSSTG-SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketed  797
            P P  + F+P T  +      SSLP  + + P A LD+ + F + RP ++ + ++K  ++
Sbjct  417  PRPW-RNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQE  475

Query  798  ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTT  977
            +    N  ++YD    +RFD +LN + + N+ E++ AEFAGS+ N     +  E T    
Sbjct  476  EMLTFN-NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVA  534

Query  978  TWSLEIA  998
            T +L++A
Sbjct  535  TATLQLA  541



>ref|XP_006594327.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=670

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 127/232 (55%), Gaps = 16/232 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W++ +T+ GGKR   TDP+WL+++F  YDEN NLVR+KV+D LD  KLGY YQD
Sbjct  437   ANVDRMWSIWKTIPGGKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQD  496

Query  621   L--------PNPRSKKFEPFTGKNPSSTGSSLPTAT----AILPATLDETVKFYVTRPPA  764
             +        P P+  K +          G++    T       P TLD  V   V RP  
Sbjct  497   VDIPWLKNKPKPKRSKAKKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKL  556

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
               S ++KE E++  V++  +E+D  K ++FD ++N+ +D   +     EFAGSF++    
Sbjct  557   LRSKEEKEEEEEVLVIDG-IEFDRNKAVKFDVFIND-EDDKVITPSNTEFAGSFVSVPHS  614

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K K  T + + +  +L+DL    ++ I VTLVPK G   VT++ + I
Sbjct  615   HVHKNK-KIKTCFRVGLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKI  665


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 16/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            P S TI D+KLP+    + VR     ++D    K+  A++++K    P D          
Sbjct  183  PISSTIIDFKLPSSGAPLRVRPAAHLVNDVYIAKYREALKRMKALS-PNDPRNFTQQANV  241

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    + HQ GF       H    F  +HR YL+ YE++L N+ GD T  +P+WN
Sbjct  242  HCAY-CDGAYHQVGFPNLDLQVHNCWLFFPYHRWYLYFYERILGNLIGDPTFALPFWN  298



>gb|ACF17425.1| polyphenol oxidase [Camellia sinensis]
 gb|ACS88249.1| polyphenol oxidase [Camellia sinensis]
 gb|AFU35561.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    D + L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNARPSPRISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EREKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>sp|P43311.1|PPO_VITVI RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Vitis vinifera]
 pir||S52629 catechol oxidase (EC 1.10.3.1) precursor - grape
 emb|CAA81798.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 127/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK-RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W + +T+GGK R   TD +WL  +FV YDEN  LV++KV DC+D  KL Y YQD
Sbjct  376   ANVDRMWNIWKTIGGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQD  435

Query  621   LPNPRSKKFEPFTGKNPS-------STGSSLPTAT----AILPATLDETVKFYVTRPPAt  767
             +P P   K      K  +       +  + LP  T       P  L+  ++  V RP  +
Sbjct  436   IPIPWLPKNTKAKAKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKS  495

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  ++   +E D    ++FD Y+N+ +D +    + +EFAGSF+N   P 
Sbjct  496   RSKKEKEDEEEVLLIKG-IELDRENFVKFDVYIND-EDYSVSRPKNSEFAGSFVNV--PH  551

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +  ++ KT T     I ++L+DL    +  + VT+VP+ GGD VT+  ++I
Sbjct  552   KHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>ref|XP_004246041.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
lycopersicum]
Length=589

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 133/224 (59%), Gaps = 6/224 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WT+ +TLGG R    D +WL ++F+ YDEN  LV++ V+DC++NEKLGY YQ++
Sbjct  362   ANVDRMWTIWKTLGGNRRDYNDRDWLDSAFLFYDENRTLVKVTVQDCINNEKLGYKYQNV  421

Query  624   PNPRSKKFEPFTGKN-PSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedk  800
             P P  K ++P   K        ++  +T I P+TL +T+ F + RP  + + + K+ E++
Sbjct  422   PIPW-KNYKPVPRKQKVKKNPKNVKPSTEIFPSTLKKTLSFSIKRPNISRTQQDKDIEEE  480

Query  801   etVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK---T  971
               V N  + +DE + IRFD ++NE++   +  ++  E+ GSF N          +    T
Sbjct  481   LLVFN-NMTFDENEYIRFDVFINEDEGVKAKVLDRTEYVGSFANLPHVHAAGSSSSSSGT  539

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                 SL I+++L+DL L  E +I V +VP+ GG  +T+ SV+I 
Sbjct  540   PAVMSLGISEILEDLGLEDEEEIVVVVVPQSGGKEITIGSVEIN  583


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 12/120 (10%)
 Frame = +3

Query  39   SPILPFSGT-ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLK--ERRLPVD----  197
             P LP   T I  YKLP  S+  +R     +  E   K+ TA++K+K  ++  P+     
Sbjct  112  CPPLPKDLTNIPTYKLPNVSKVKIRPAAHNVTQEYITKYNTAIQKMKSLDKDDPLSFIQQ  171

Query  198  ---HADY--DLFKSLHQAGFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
               H  Y    +K L   G     HF   F  FHR YL+ +E++L ++ GD T  +P+WN
Sbjct  172  ANIHCAYCNSGYKELGFPGVPLQVHFSWLFFPFHRWYLYFFERILGSLIGDDTFALPFWN  231



>ref|XP_003528444.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=578

 Score =   123 bits (309),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 6/220 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W + +T+ GG R    D +WL++SF+ YDEN NLVR+K++DCLD+ KLGY Y+ 
Sbjct  353   SNVDRIWNIWKTIPGGFRRDFNDDDWLESSFLFYDENKNLVRVKIKDCLDSRKLGYDYEY  412

Query  621   LPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedk  800
             + +       P                    P TL+   +  V RP      +     +K
Sbjct  413   VDDTPWLNVRPRPKYAVPLPLPFPLPQPLPFPLTLNSIQRTTVKRP---KKEESWSEVEK  469

Query  801   etVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTTT  980
               VL   VEYD T++++FD ++N+  D + +  E +EFAGSF+  A    G +  +TTT+
Sbjct  470   AEVLVMEVEYDMTEDVKFDVFINDQGD-DEIGPEDSEFAGSFMTLAH-SHGHQSKRTTTS  527

Query  981   WSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               L I  +L+DL    +  I VTL P+ G   VT+K + I
Sbjct  528   LRLAITDLLKDLHALDDESIAVTLAPRYGNKPVTIKGIKI  567


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 53/113 (47%), Gaps = 17/113 (15%)
 Frame = +3

Query  66   ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------HADYD  212
            I D++ P+  R   RR    +DD+   K+  AVR +  R LP+D           H  Y 
Sbjct  114  IVDFEFPSHKRLRHRRPAQWVDDDYLNKYKEAVRLM--RALPLDDPRNFMQQAKIHCAY-  170

Query  213  LFKSLHQAGF---SPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
                  Q GF   +   H    F  FHR YL+ +E++L ++ GD T  +P+WN
Sbjct  171  CHNGYRQKGFPDHNLQVHGNWLFAPFHRWYLYFHERILGSLIGDPTFALPFWN  223



>gb|ABR10907.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   123 bits (309),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    D + L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   --------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtts  773
                     P+PR S  F     K   +  + +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNARPSPRISIFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAGSF+N   PR+ 
Sbjct  491   EREKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGSFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>gb|ABM68052.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 128/229 (56%), Gaps = 11/229 (5%)
 Frame = +3

Query  438   LSSDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             L ++VDR W++ +TLGGKR   TD +WL+T F+ YDEN NLV++KV+D LD EKLGY YQ
Sbjct  376   LHANVDRLWSIWKTLGGKRKDPTDDDWLETEFLFYDENKNLVKVKVKDGLDGEKLGYVYQ  435

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSL---PTATAI--LPATLDETVKFYVTRPPAttstkk  782
             D   P  K  +P       S G  L   P+   +   P  LD  V   V RP  + S+K+
Sbjct  436   DRDLPW-KNCKPEPSSRVKSKGKLLTQRPSRKFVDKFPIVLDSVVSTIVKRPKKSRSSKE  494

Query  783   ketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF---AWPRQG  953
             KE E++  V++  +E+D    ++FD  +N+ +D   + V   EFAG+F++          
Sbjct  495   KEDEEEILVIDG-IEFDSNIEVKFDVIVND-EDDKVIGVGNTEFAGTFVSLLHGHNHENN  552

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +K  T T   L +  +L+DL    ++ I VTL+P+ GGD V +  + I
Sbjct  553   KKKKNTVTCLRLGLTDLLEDLKADDDDSIVVTLIPRYGGDGVKISGIKI  601


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 19/119 (16%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            PFS  I D+K P+F +  VR     ++D+   K+  A++ +  R LP D           
Sbjct  122  PFSADIIDFKFPSFEKLRVRPAAQLVNDDYFRKYDEALKLM--RALPDDDPRSFFQQANI  179

Query  198  HADYDLFKSLHQAGFSPG----AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y       Q G+ PG     H    F+AFHR Y++ YE++L ++  D T  +P+WN
Sbjct  180  HCAY-CVGGYTQKGY-PGLELSVHKSWLFLAFHRWYIYFYERILGSLINDPTFAIPFWN  236



>ref|XP_003522849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
 gb|KHN32510.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 133/233 (57%), Gaps = 17/233 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  +TDP+WL+++F+ YDEN NLVR+K +DCLD  KLGY YQD+
Sbjct  367   SNVDRMWSIWKTLGGKRRDLTDPDWLESAFLFYDENKNLVRVKTKDCLDTRKLGYVYQDV  426

Query  624   --------PNP---RSKKFE--PFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P P   R++K E  P  G   ++  +   +     P  LD  V   V RP  
Sbjct  427   DIPWLKSKPTPLRSRAQKVELTPLFGGVAAAHAAET-SRNVKFPLVLDSVVSTVVKRPKK  485

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
             + S K+KE +++  V+   +E++ +  ++FD ++N+ +D   ++ +  EFAGSF++    
Sbjct  486   SRSKKEKEEKEEILVVEG-IEFESSTGVKFDVFIND-EDDKLVKPDNTEFAGSFVSVPHS  543

Query  945   RQGSEKT-KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +  +   K  T   L +  +L++L    ++ + VTLVPK G   V ++ + I
Sbjct  544   HEHHKNNKKIVTCLRLGLTDLLEELGAEDDDSVLVTLVPKYGKGRVNIRGIKI  596



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 128/235 (54%), Gaps = 24/235 (10%)
 Frame = +3

Query  438   LSSDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             L ++VDR W++ +TLGGKR   TD +WL++ F+ YDEN NLV++KV+D LD +KLGY YQ
Sbjct  371   LHANVDRLWSIWKTLGGKRKDPTDDDWLESEFLFYDENKNLVKVKVKDGLDGKKLGYDYQ  430

Query  618   DL--------PNPRSKKFEPFTGKNPSSTGSSLPTATAI--LPATLDETVKFYVTRPPAt  767
              +        P P S++ +        S G  L     +   P  LD  V   V RP  +
Sbjct  431   KVDIPWINSKPKPASRRVQ--------SKGKLLTPRKFVDKFPIVLDSVVSTIVKRPKKS  482

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S+K+KE E++  V++  +E+D    ++FD  +N+ +D   + V   EFAG+F+N     
Sbjct  483   RSSKEKEDEEEILVIDG-IEFDSNIEVKFDVIVND-EDDKVIGVGNTEFAGTFVNLLHGH  540

Query  948   QG----SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                   ++K    T   L +  +L+DL    ++ I VT +P+ GGDSV +  + I
Sbjct  541   NHENSTNKKKNIVTCMRLGLTDLLEDLKADDDDSILVTFIPRYGGDSVKISGIKI  595


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 56/117 (48%), Gaps = 15/117 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            PFS  I D+K P+F +  VR     +DD+   K+  A+  +  R LP D           
Sbjct  122  PFSKDIIDFKYPSFEKLRVRPAAQLVDDDYFAKYNKALELM--RALPDDDPRSFSQQAKI  179

Query  198  HADYDL--FKSLHQAGFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y +  +K L         H    F+AFHR Y++ YE++L ++  D T  +P+WN
Sbjct  180  HCAYCVGGYKQLGYPEIELSVHNSWLFLAFHRWYIYFYERILGSLINDPTFAIPFWN  236



>ref|XP_004246037.1| PREDICTED: polyphenol oxidase B, chloroplastic-like [Solanum 
lycopersicum]
Length=599

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 127/225 (56%), Gaps = 12/225 (5%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAG-ITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +VDR W   +TLGGKR   +T+P+ + + F  YDEN     +KV DCLD +K+GY Y   
Sbjct  375   NVDRMWNEWKTLGGKRTDLVTEPDLMNSEFFFYDENKKPYLVKVGDCLDTKKMGYDYVKS  434

Query  624   PNPRSKKFEPFTGKNPSSTG---SSLPTATAILPA-TLDETVKFYVTRPPAttstkkket  791
             P P  + F+P   KN SS     SS+P A+ I P   LD    F + RP +     + E 
Sbjct  435   PTPW-RDFKP--NKNYSSGKLDTSSVPPASKIFPIFKLDVNTSFSLDRPAS--LRTQVEK  489

Query  792   edketVLNF-YVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ-GSEKT  965
             ++KE +L F Y++YD  + IRFD YLN +K+    ++   E+A S+ +     + G +  
Sbjct  490   DNKEEILTFSYIKYDSREYIRFDVYLNADKNVKPEDLNQTEYAESYTSLPHTHKPGDDDY  549

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +T T  L I ++L++  L  E+KI VTLVP+ GG+ + +  V+I
Sbjct  550   VSTATLQLAITELLKENGLEKEDKIVVTLVPRKGGEGLAIGCVEI  594



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 128/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK-RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W + +T+GGK R   TD +WL  +FV YDEN  LV++KV DC+D  KL Y YQD
Sbjct  376   ANVDRMWNIWKTIGGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQD  435

Query  621   LPNP-------RSKKFEPFTGKNPSSTGSSLPTAT----AILPATLDETVKFYVTRPPAt  767
             +P P          K    + K+  +  + LP  T       P  L+  ++  V RP  +
Sbjct  436   IPIPWLPKKTKAKAKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKS  495

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  ++   +E D    ++FD Y+N+ +D +    + +EFAGSF+N   P 
Sbjct  496   RSKKEKEDEEEVLLIKG-IELDRENFVKFDVYIND-EDYSVSRPKNSEFAGSFVNV--PH  551

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +  ++ KT T     I ++L+DL    +  + VT+VP+ GGD VT+  ++I
Sbjct  552   KHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 128/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK-RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W + +T+GGK R   TD +WL  +FV YDEN  LV++KV DC+D  KL Y YQD
Sbjct  376   ANVDRMWNIWKTIGGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQD  435

Query  621   LPNP-------RSKKFEPFTGKNPSSTGSSLPTAT----AILPATLDETVKFYVTRPPAt  767
             +P P          K    + K+  +  + LP  T       P  L+  ++  V RP  +
Sbjct  436   IPIPWLPKKTKAKAKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKS  495

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  ++   +E D    ++FD Y+N+ +D +    + +EFAGSF+N   P 
Sbjct  496   RSKKEKEDEEEVLLIKG-IELDRENFVKFDVYIND-EDYSVSRPKNSEFAGSFVNV--PH  551

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +  ++ KT T     I ++L+DL    +  + VT+VP+ GGD VT+  ++I
Sbjct  552   KHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 125/233 (54%), Gaps = 19/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKRA +TD +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRADLTDSDWLDSGFLFYNENAELVRVKVRDCLETKHLGYVYQDV  421

Query  624   --------PNPRSKK--FEPFTGK----NPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR  +    P   K    +P+   SS   A    P  L   +   V RP 
Sbjct  422   DIPWLSSKPTPRRAEVALSPIAKKLGVAHPAVASSSKVVAGTEFPINLGSKISTVVKRPK  481

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                 +KK + +++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   
Sbjct  482   QKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPS-GPDKTEFAGSFVSV--  538

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P     K K  TT  L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   PHSHKHKKKMNTTLRLGLTDLLEEIEAEDDDSVVVTLVPKFG--AVKIGGIKI  589


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 57/131 (44%), Gaps = 15/131 (11%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLH  230
            P S  I D+KLP  +   +R    A+D   R+K+  A+  +K   LP D +     +   
Sbjct  117  PPSTKIIDFKLPAPANLRIRPPAHAVDQAYRDKYYKAMELMKA--LPDDDSRSFKQQGAV  174

Query  231  QAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNSTL  371
               +  GA             H    F  FHR YL+  EK+L N+  D T  +P+WN   
Sbjct  175  HCAYCDGAYDQVGFPELELQLHNSWLFFPFHRYYLYFCEKILGNLINDPTFALPFWNWDS  234

Query  372  DSDLPDHAAYA  404
             + +P  A YA
Sbjct  235  PAGMPLPAIYA  245



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WT+ + LGG+R    DP+WL   F+LYDEN  LVR+KV DCLD +KL YSYQD+
Sbjct  372   SNVDRMWTIWKKLGGRRKDFKDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDV  431

Query  624   PNPRSKKFEPFTGKNPSST----------GSSLPTATAILPATLDETVKFYVTRPPAtts  773
               P  K   P  GK  ++               PT +   P  LD   K  V RP  + S
Sbjct  432   EIPWMKT-RPTPGKLMAAAQKLKITDRGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRS  489

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              K+KE E++  V++  VE +    ++FD Y+N   D +    + +EFAGSF+N    + G
Sbjct  490   KKEKEDEEEILVID-QVELERDTVVKFDVYIN---DEDEPSPDKSEFAGSFVNVPH-KHG  544

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              + +K  T     I+++L+DL    ++++ VT+VP+ GGD VT+  + I 
Sbjct  545   KKMSKLKTCLRFGISELLEDLEAEDDDEVVVTIVPRIGGDLVTIGGIKIV  594


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 55/119 (46%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            P S  I D+KLP+ S  + VR     +D+E   K++ A+  +K   LP D          
Sbjct  126  PASSEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKA--LPADDPRNFTQQAN  183

Query  198  -HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y    +  Q GF       H    F +FHR YL+ YE+ML  +  D T  +PYWN
Sbjct  184  VHCAY-CDGAYDQIGFPDLELQVHNSWLFFSFHRYYLYFYERMLGKLIDDPTFALPYWN  241



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 128/235 (54%), Gaps = 18/235 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLGGKR    D +WL++ F+ YDEN NLV++KV+DCLD +KLGY YQD+
Sbjct  371   SNIDRFWSIWKTLGGKRKDFKDKDWLESEFLFYDENKNLVKVKVKDCLDTKKLGYVYQDV  430

Query  624   --------PNPRSKKFEP--------FTGKNPSSTGSSLPTATAILPATLDETVKFYVTR  755
                     P P  K  +         F G   +        +    P  LD  V   V R
Sbjct  431   DIPWLNAKPKPCRKNIQKNVEVAQGNFFGIGEARASEINSRSYVTCPLVLDNVVSTIVKR  490

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P  + S K+KE E++  V+   +E+D++  ++FD ++N+ +D   ++    EFAGSF+N 
Sbjct  491   PKKSRSKKEKEEEEEVLVIEG-IEFDKSLGVKFDVFIND-EDDKVIKPINTEFAGSFVNV  548

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                    +K KT +   + +  +L+DL    ++ I VTLVP+ G   V ++++ I
Sbjct  549   PHSSHDHKKKKTNSCLRVGLTDLLEDLGAEDDDSIVVTLVPRYGKGIVKIRNIKI  603



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   122 bits (307),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WT+ + LGG+R    DP+WL   F+LYDEN  LVR+KV DCLD +KL YSYQD+
Sbjct  372   SNVDRMWTIWKKLGGRRKDFKDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDV  431

Query  624   PNPRSKKFEPFTGKNPSST----------GSSLPTATAILPATLDETVKFYVTRPPAtts  773
               P  K   P  GK  ++               PT +   P  LD   K  V RP  + S
Sbjct  432   EIPWMKT-RPTPGKLMAAAQKLKITDRGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRS  489

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              K+KE E++  V++  VE +    ++FD Y+N   D +    + +EFAGSF+N    + G
Sbjct  490   KKEKEDEEEILVID-QVELERDTVVKFDVYIN---DEDEPSPDKSEFAGSFVNVPH-KHG  544

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              + +K  T     I+++L+DL    ++++ VT+VP+ GGD VT+  + I 
Sbjct  545   KKMSKLKTCLRFGISELLEDLEAEDDDEVVVTIVPRIGGDLVTIGGIKIV  594


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 54/119 (45%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            P S  I D+KLP+ S  + VR     +D+E   K++ A+  +K   LP D          
Sbjct  126  PASSEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKA--LPADDPRNFTQQAN  183

Query  198  -HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y    +  Q GF       H    F  FHR YL+ YE+ML  +  D T  +PYWN
Sbjct  184  VHCAY-CDGAYDQIGFPDLELQVHNSWLFFPFHRYYLYFYERMLGKLIDDPTFALPYWN  241



>gb|AAW58111.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=233

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 118/222 (53%), Gaps = 16/222 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  I+  +WL + F+ Y+EN  LVR+KV D L+++ LGY YQ++
Sbjct  3     SNVDRMWSIWKTLGGKRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEV  62

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAIL-----PATLDETVKFYVTRPPA  764
                     P PR  K E    K       +  ++T I+     P  L+  +   V RP  
Sbjct  63    DIPWLQSKPTPRRAKLELSKIKKKLGVAQAAESSTKIVAGRAFPINLETKISTVVPRPKQ  122

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
                 KK++ E++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   P
Sbjct  123   KKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSV--P  179

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGG  1070
              +   K K  T   L +  +L+D+    +  + VTLVPK G 
Sbjct  180   HRHKHKKKINTILRLGLTDLLEDIEAEDDESVVVTLVPKYGA  221



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   122 bits (307),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 127/231 (55%), Gaps = 20/231 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLGG+R  ITD ++L  SFV YDEN  +VR+KV DCLD+ KLGY YQD+
Sbjct  359   SNIDRLWSIWKTLGGRRQDITDRDFLDASFVFYDENAQMVRVKVRDCLDHTKLGYVYQDV  418

Query  624   --------PNPRS----KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAt  767
                     P PR     +K +     N + T S       + PATLD+ +K  V RP   
Sbjct  419   EIPWLDSRPTPRVSSVLRKLKKLGKANAADTHS----PKDVFPATLDKVLKVMVKRPKKK  474

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+K+  ++  V+   +E D     +FD Y+N+  D  +   E  EFAGSF+N   P 
Sbjct  475   RSKKEKDELEEILVIE-GIELDRDVYAKFDVYINDEDDEITTP-ENTEFAGSFVNV--PH  530

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +     K  T   L I ++++DL    ++ + VTLVP   GD+VTV  + I
Sbjct  531   KHKHGKKIKTQLRLSITEIMEDLDADDDDHVLVTLVPTNAGDAVTVHGIKI  581



>gb|KHN07287.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=456

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 124/232 (53%), Gaps = 20/232 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQT--LGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR W + +T  L G+R      EWL++SF  YDEN+N VR+KV+DCLD++K+GY YQ
Sbjct  222   SNVDRMWNIWKTELLDGRRFDHKSDEWLESSFFFYDENSNYVRVKVKDCLDSKKMGYDYQ  281

Query  618   --DLP--------NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAt  767
               DLP         P+ K+  P   K  +ST  +L      LP  L+   +  V RP   
Sbjct  282   RVDLPWLLAGELIKPK-KEIIPLRSKPEASTFKTLQ-----LPLLLESIERTNVKRPKPR  335

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
             +  + +E E  E VL   VEYD T  +RFD ++N+  D N +  + +EFAGSF+      
Sbjct  336   SRNENEEEEGAEEVLVIDVEYDSTDGVRFDVFINDQGD-NEIGPQDSEFAGSFVTLPHSP  394

Query  948   QGSEKTKTTTTWSLEIAQVLQDLAL-GGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +    T  ++ L +   L+DL +   ++ I VTL P  G   VT+K V I
Sbjct  395   HVNHNNITRASFKLPLTYQLKDLGVTKDDDSISVTLAPIYGDKPVTIKDVRI  446



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   122 bits (307),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 119/230 (52%), Gaps = 16/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR WTV +TLGGKR   TDP+WL   F+ YDEN NLVR+KV DCLD++KLGY YQD+
Sbjct  370   SNVDRMWTVWKTLGGKRTNFTDPDWLNAGFLFYDENANLVRVKVRDCLDSKKLGYVYQDV  429

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI-----------LPATLDETVKFYVTRPPAtt  770
               P  +                 P A A             P  LD      V RP  + 
Sbjct  430   DVPWLRTKPKPKKLRKKVAKLLGPVALAAEINTKLTPSSQFPLVLDSIKSTVVPRPKKSR  489

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V++  + ++    ++FD Y+N+   A  +  E  EFAGSF+N   P +
Sbjct  490   SKKEKEEEEEILVID-NIGFEREAVVKFDVYVNDEDQA--IGPENTEFAGSFVNV--PHK  544

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T   L +  +L+DL    ++ + VTLVPK G   V++  + I
Sbjct  545   HKHGKKMKTCLRLGLTDLLEDLEAEDDDSVVVTLVPKYGKGLVSIGGIKI  594



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 120/212 (57%), Gaps = 7/212 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR WT+ Q L GK  +   TD +WL  +F+ YDEN   V++++ D LDN+K+GY Y 
Sbjct  275   SNVDRMWTIWQQLAGKPRKRDYTDSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYA  334

Query  618   DLPNP-RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
               P P    K  P   K   ++ S  P   ++ P TLD+ V+  V R P  + + +++  
Sbjct  335   KTPLPWLDSKPVPTKKKGGYASKSKAPFVASVFPVTLDKVVQVKVAR-PKKSRSAEEKEA  393

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             ++E +L   +E +  K  +FD YLN++ D +  + + AE+AGSF +     +G +K +TT
Sbjct  394   EEEILLIVGIEVEIDKYAKFDVYLNDSDDPSGGK-DKAEYAGSFAHLPHKHKGMKKIRTT  452

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGG  1070
                SL + + L+DL    ++ I VTL PK GG
Sbjct  453   L--SLGLNEPLEDLGAEDDDTILVTLAPKVGG  482


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (45%), Gaps = 15/123 (12%)
 Frame = +3

Query  33   MDSPILPFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYD  212
            +D+   P +  I DYKLP  +   VR     +D ++  KFA AV  +K   LP D     
Sbjct  24   VDNCCPPVASNIVDYKLPAVTTMKVRPAAHTMDKDAIAKFAKAVELMKA--LPADDPRNF  81

Query  213  LFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVP  353
              ++L    +  G              H    F  FHR YL+ YE++L  + GD +  +P
Sbjct  82   YQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPSFGLP  141

Query  354  YWN  362
            +WN
Sbjct  142  FWN  144



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 129/232 (56%), Gaps = 14/232 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W+V +T G     ITDP+WL T F+ YDEN  LVR+KV DCLD++KLGY YQD+
Sbjct  368   SNVDRMWSVWKTFGATNKDITDPDWLDTGFLFYDENAQLVRVKVRDCLDSKKLGYVYQDV  427

Query  624   --------PNPRSKKF----EPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAt  767
                     P PR  K     +       +S+G  +    +  P  LD  +   V RP   
Sbjct  428   DIPWLTSKPTPRRSKLAKAAKAIGVARAASSGPKV-VGRSDFPIKLDSKISTVVKRPKQK  486

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWP  944
               +KK++ +++E ++   +E+++   ++FD Y+N+ +D +   + + +EFAGSF+N    
Sbjct  487   KRSKKEKEDEEEILVIGGIEFEKDMAVKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHK  546

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +  +K KT +   L +  +L+DL    +  + VTLVP+ G  S+ + ++ I
Sbjct  547   HKDKKKKKTKSCLRLGLTDLLEDLGAEDDESVVVTLVPRYGTKSLKIDTIKI  598



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 126/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLGGKR   TD +WL+++F+ YDEN NLVR+KV+D LD  KLGY YQD+
Sbjct  371   SNIDRMWSIWKTLGGKRRDFTDSDWLESAFLFYDENKNLVRVKVKDSLDTRKLGYVYQDV  430

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATA---ILPATLDETVKFYVTRPPAtt  770
                     P PR  + +          G++    T+     P  LD  V   V RP  + 
Sbjct  431   DIPWLNSKPTPRRSRVQKVALAQNFGVGAAHAAETSRNVKFPLVLDSVVSTMVKRPNKSR  490

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   +E++    ++FD ++N+ +D   +  +  EFAGSF++   P  
Sbjct  491   SKKEKEEEEEVLVIE-GIEFERNTPVKFDVFIND-EDDKQIRPDNTEFAGSFVSV--PHS  546

Query  951   GSEKTK-TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K K   T   L +  +L++L    ++ + VTLVP+ G   V ++ + I
Sbjct  547   HMHKNKDIITCLRLGLTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKI  597



>gb|EYU26236.1| hypothetical protein MIMGU_mgv1a027162mg [Erythranthe guttata]
Length=583

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 134/227 (59%), Gaps = 17/227 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDP------EWLQTSFVLYDENNNLVRIKVEDCLDNEKLG  605
             ++VDR WT+ +    +R+G   P      +WL   ++ YDEN  LVR+K  D L+NEK+G
Sbjct  360   TNVDRLWTIWRN---QRSGPKQPKDFPDSDWLNADYLFYDENARLVRVKNSDTLENEKMG  416

Query  606   YSYQ--DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstk  779
             Y YQ  DLP  +++     T    ++T ++ P  T + P  LD+ VK  V+RP  + S K
Sbjct  417   YVYQEVDLPWLKNRPAARVTKSKVAATTAAPPPET-VFPVKLDKVVKVLVSRPKKSRSKK  475

Query  780   kketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSE  959
             +KE+E++  V+   +E D  K ++FD ++N+  D  + E++ AE+AGS+     P + S 
Sbjct  476   EKESEEELLVIEG-IEVDTAKFVKFDVFVNDEDDEAADELDKAEYAGSYSQV--PHRNST  532

Query  960   KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               KT     L + ++L+DL + G++KI VTLVPK GG+ +T+  ++I
Sbjct  533   TVKTRI--RLGLTELLEDLDVEGDDKILVTLVPKAGGEDITIGGINI  577



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/231 (37%), Positives = 127/231 (55%), Gaps = 17/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ-  617
             SDVDR W++ +TL G KR   T  +WL +SF+ YDEN NLVR+KV D L+ +  GY YQ 
Sbjct  368   SDVDRLWSIWRTLPGKKRTDFTGTDWLDSSFLFYDENANLVRVKVRDSLNMKTFGYDYQK  427

Query  618   -DLPNPRSKKFEPFTGKNPSS-------TGSSLPTATAILPATLDETVKFYVTRPPAtts  773
              ++P  ++K     +G+  S        T ++ P + A  P  LD+ V+  V RP  + +
Sbjct  428   VNIPWLKNKPIPRKSGRGKSGGQAVAAETKNTTPISIA-FPIALDKLVRVEVPRPKKSRT  486

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
               +KE E++  VL   ++ D    ++FD Y+N+  D    E E +EFAGSF N       
Sbjct  487   KLEKEDEEEVLVLQ-NIQLDRDAAVKFDVYINDEDDETPTEPEDSEFAGSFTNLP---HN  542

Query  954   SEKT--KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               KT  K  T  +L +  +L+DL + G+  I VTLVPK G   V++ ++ I
Sbjct  543   HHKTGMKLNTNLTLPLTDLLEDLNVEGDESILVTLVPKEGKGLVSIGNIKI  593


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 52/118 (44%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+K P FS   +R     +D    EKF  A+  +K   LP D           
Sbjct  124  PKTTNILDFKPPRFSTIRLRPAAHLVDANYLEKFTKAMELMKA--LPDDDPRSFKQQANV  181

Query  198  HADYDLFKSLHQAGFSPG---AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    +  Q GF       HF   F  FHR+YL+ YE++L  + GD    +P+WN
Sbjct  182  HCAY-CNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLYFYERILGKLIGDPNFAMPFWN  238



>ref|XP_011044088.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=393

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 136/224 (61%), Gaps = 12/224 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +T+ GG R  I+DP+WL + F+ Y+EN  LVR KV DCLDN +L Y+YQ+
Sbjct  172   SNVDRMWTIWKTIPGGIRRDISDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQN  231

Query  621   LPNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
             +  P  +SK      GK  + T ++L   TA  P  LD+T+   V+RP  + S K+KE E
Sbjct  232   VEIPWLKSKPIPRRLGKKAAETKTALTPITA-FPLVLDKTIVTVVSRPKKSRSRKEKEEE  290

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             D+  V+   +EYD+ K ++FD ++N++ +  S + E  EFAGSF+N +   + ++K+KT 
Sbjct  291   DEVLVIEG-IEYDKGKFVKFDVFINDDLEMPS-KPENTEFAGSFVNVS--HKHAKKSKTR  346

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCG--GDSVTVKSVDI  1100
                 L I ++L+DL    ++ I V LVP+     D V +  V I
Sbjct  347   LI--LGITELLEDLETDDDDSIVVALVPRSNSVSDPVVISGVKI  388



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 126/230 (55%), Gaps = 14/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR   TD +WL++  + YDEN NLVR+KV+DCLD  KLGY YQD+
Sbjct  365   SNVDRMWSIWKTLGGKRRDFTDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDV  424

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATA---ILPATLDETVKFYVTRPPAtt  770
                     P+PR  + +        +TG +    T+     P  LD  V   V RP  + 
Sbjct  425   EIPWLKSKPSPRRSRVQKVALGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSR  484

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   VEYD    ++FD  +N+ +D   ++ E +E+AGSF+      +
Sbjct  485   SKKEKEEEEEVLVIEG-VEYDSNIPVKFDVLIND-EDDKQIQPEDSEYAGSFVTVPHSHK  542

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K K  T   L +  +L++L    ++ + VTLVP+ G   V +  + I
Sbjct  543   HKNK-KIITCLRLGLTDLLEELEAEDDDSVVVTLVPRYGKGRVQIGGIKI  591



>emb|CAN62983.1| hypothetical protein VITISV_035472 [Vitis vinifera]
Length=607

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 127/231 (55%), Gaps = 16/231 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK-RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W + +T+GGK R   TD +WL  +FV YDEN  LV +KV DC+D  KL Y YQD
Sbjct  376   ANVDRMWNIWKTIGGKNRKDFTDTDWLDATFVFYDENKQLVXVKVSDCVDTSKLRYQYQD  435

Query  621   LPNP-------RSKKFEPFTGKNPSSTGSSLPTATAI----LPATLDETVKFYVTRPPAt  767
             +P P          K    + K+  +  + LP  T       P  L+  ++  V RP  +
Sbjct  436   IPIPWLPKXTKAKAKTTTKSSKSGVAKAAELPKTTISSIXDFPKALNSVIRVEVPRPKKS  495

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
              S K+KE E++  ++   +E D    ++FD Y+N+ +D +    + +EFAGSF+N   P 
Sbjct  496   RSKKEKEDEEEVLLIKG-IELDRENFVKFDVYIND-EDYSVSRPKNSEFAGSFVNV--PH  551

Query  948   QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +  ++ KT T     I ++L+DL    +  + VT+VP+ GGD VT+  ++I
Sbjct  552   KHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 126/230 (55%), Gaps = 14/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR   TD +WL++  + YDEN NLVR+KV+DCLD  KLGY YQD+
Sbjct  365   SNVDRMWSIWKTLGGKRRDFTDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDV  424

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATA---ILPATLDETVKFYVTRPPAtt  770
                     P+PR  + +        +TG +    T+     P  LD  V   V RP  + 
Sbjct  425   EIPWLKSKPSPRRSRVQKVALGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSR  484

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   VEYD    ++FD  +N+ +D   ++ E +E+AGSF+      +
Sbjct  485   SKKEKEEEEEVLVIEG-VEYDSNIPVKFDVLIND-EDDKQIQPEDSEYAGSFVTVPHSHK  542

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K K  T   L +  +L++L    ++ + VTLVP+ G   V +  + I
Sbjct  543   HKNK-KIITCLRLGLTDLLEELEAEDDDSVVVTLVPRYGKGRVQIGGIKI  591



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 120/209 (57%), Gaps = 5/209 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W V + LGGK     D +WL TSF+ YDEN +LVR+K++DCLD + L Y+YQD+
Sbjct  371   SNVDRMWYVWKMLGGKHKDFEDKDWLNTSFLFYDENADLVRVKIKDCLDTQWLRYTYQDV  430

Query  624   PNPRSKKFEPFTGKNPSSTGS-SLPTAT-AILPATLDETVKFYVTRPPAttstkkketed  797
               P  K      G   +  G+ SL   T A  P TL+ +V   V RP  + S+K+K+ E+
Sbjct  431   EIPWLKARPTPKGTVAAKKGARSLRAVTEAAFPVTLESSVSATVRRPKVSRSSKEKKDEE  490

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT-T  974
             +  V+   +E+D    I+FD Y+N   +   ++   +EFAGSF+N       S+K K   
Sbjct  491   EVLVVEG-IEFDRDMFIKFDVYIN-TPEEEGVDPGSSEFAGSFVNVPHKHNHSKKEKKLR  548

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPK  1061
             T   L I ++L+DL    ++ + VTLVP+
Sbjct  549   TALRLGITELLEDLGAEADDSVLVTLVPR  577


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 54/119 (45%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            PF+  I D+KLP  S  + +R     +D E   K+A AV  +K   LP D          
Sbjct  125  PFTSKIIDFKLPPRSDPLRIRPAAHLVDSEYLAKYAKAVELMKA--LPADDPRNFTQQAN  182

Query  198  -HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y    S  Q GF       H    F  +HR YL+ +EK+L  + GD T  +P+WN
Sbjct  183  VHCAY-CDGSYDQIGFPDIEIQVHNSWIFFPWHRFYLYFHEKILGKLIGDETFALPFWN  240



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 128/235 (54%), Gaps = 18/235 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGGKR    D +WL++ F+ YDEN NLV++KV+D LD +KLGY YQD+
Sbjct  371   SNIDRFWSVWKTLGGKRKDFKDKDWLESEFLFYDENKNLVKVKVKDSLDTKKLGYVYQDV  430

Query  624   --------PNPRSKKFEP--------FTGKNPSSTGSSLPTATAILPATLDETVKFYVTR  755
                     P P  KK +         F G   +        +    P  LD  V   V R
Sbjct  431   DTPWLNAKPKPCRKKIQKNVEVAQGIFFGIGEAHASEINSRSYVTCPLVLDNVVSTIVKR  490

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P  + S K+KE +++  V+   +E+D++  ++FD ++N+ +D   ++    EFAGSF+N 
Sbjct  491   PKKSRSKKEKEEKEEVLVIEG-IEFDKSLGVKFDVFIND-EDDKVIKPVNTEFAGSFVNV  548

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                    +K KT +   + +  +L+DL    ++ + VTLVP+ G   V ++++ I
Sbjct  549   PHSSHDHKKKKTNSCLRVGLTDLLEDLGAEDDDSVVVTLVPRYGKGIVKIRNIKI  603



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   120 bits (302),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 123/227 (54%), Gaps = 11/227 (5%)
 Frame = +3

Query  447   DVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +VDR W + ++L G KR   TD +WL +SF+ YDEN NLVR+KV DCL++  LGY YQ +
Sbjct  387   NVDRLWNIWKSLPGKKRTDFTDTDWLDSSFLFYDENANLVRVKVRDCLNSRTLGYDYQKV  446

Query  624   PNPRSK-KFEPFTGKNPSSTGSSLPTATAI-------LPATLDETVKFYVTRPPAttstk  779
               P  K K  P      S +GS++   T+         P  LD+ V+  V R   + +  
Sbjct  447   NIPWLKNKPTPRRPGRGSGSGSAMAAETSTKTVIRNAFPIVLDKLVRIEVPRTKKSRTKV  506

Query  780   kketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSE  959
             +KE E++  VL   +  D    ++FD Y+N+  D    E E +EFAGSF N       + 
Sbjct  507   EKENEEEVLVLQ-NIRVDRDVAVKFDVYINDEDDETPTEPEDSEFAGSFTNIPH-NHHNP  564

Query  960   KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               K  T  +L ++ +L+DL +  ++ I VTLVPK G   V++ ++ I
Sbjct  565   AVKLDTNLTLPLSDLLEDLDIERDDNIVVTLVPKEGKGLVSIGNIKI  611


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 54/119 (45%), Gaps = 19/119 (16%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFK---  221
            P +  I D+K P FS   +R     +D    EKF  A+  +K   LP D  D   FK   
Sbjct  142  PKATNIIDFKPPRFSNIRLRPAAHLVDANYLEKFTKAMELMKA--LPDD--DPRSFKQQA  197

Query  222  SLHQA---------GFSPGA---HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            ++H A         GF       HF   F  FHR YL+ YE++L  + GD    +P+WN
Sbjct  198  NVHCAYCNGVYDHVGFPDQQLQIHFSWLFFPFHRFYLYFYERILGKLIGDPNFVMPFWN  256



>gb|ABR57236.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   120 bits (300),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WTV +TLGGKR    D + L + F  YDEN  LV +KV++ LD+ KLGY YQD+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDV  430

Query  624   PNP--RSKKFEPFTG-----KNPSSTG---SSLPTATAILPATLDETVKFYVTRPPAtts  773
               P   ++   P +      KN +       +L +A  + P  LDE VK  V RP  + S
Sbjct  431   EIPWLNARPSPPISNFFRKIKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRS  490

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQG  953
              ++KE E++  V+       +  +++FD ++N+  +A S   E  EFAG F+N   PR+ 
Sbjct  491   EREKEEEEEVVVVEGIEMERDV-SVKFDVFINDEDEAAS-GPEKTEFAGCFVNV--PRKH  546

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   KHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  595



>ref|XP_010910924.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=555

 Score =   119 bits (299),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 121/222 (55%), Gaps = 5/222 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W V + LGGK     D +WL +SF+ YDEN  LVR+KV+DCLD + L Y+YQD+
Sbjct  328   SNVDRMWYVWKMLGGKHKDFEDKDWLNSSFLFYDENAGLVRVKVKDCLDTQGLRYTYQDV  387

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTAT--AILPATLDETVKFYVTRPPAttstkkketed  797
               P  K      G   +  G+  P A   A LP TLD +V   V RP  + S K+KE E+
Sbjct  388   EIPWLKTRPTPKGTAAAKKGARSPRAVTEATLPVTLDSSVSATVRRPKVSRSRKEKEDEE  447

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT-  974
             +  V+   +E+D    I+FD Y+N   + + ++    EFAGSF+N       S+K K   
Sbjct  448   EVLVVE-GIEFDRGMFIKFDVYIN-TPEEDGVDPGSTEFAGSFVNVPHKNNHSKKEKKVR  505

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T   L I  +L+DL    +  + VTLVP+    +V V  + +
Sbjct  506   TALRLGITDLLEDLGAEADGSVLVTLVPRKEKGNVKVGGLRL  547



>gb|AAC69365.1| polyphenol oxidase [Diospyros kaki]
Length=393

 Score =   117 bits (293),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = +3

Query  444  SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
            ++VDR W   + +GGKR  +++ +WL + F  YDEN N  R+KV DCLD++K+G+SY  +
Sbjct  233  ANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPM  292

Query  624  PNPRSKKFEPF--TGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
            P P  + F+P   T     +T S  P       A LD  + F +TRP ++ +T +K  ++
Sbjct  293  PTP-WRNFKPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTPEKNEQE  351

Query  798  ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSF  926
            +    N  V YD+TK +RFD +LN +K  N+ E++ AEFAGS+
Sbjct  352  EILTFN-KVAYDDTKYVRFDVFLNVDKTVNADELDKAEFAGSY  393



>ref|XP_004232833.2| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum lycopersicum]
Length=626

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 125/238 (53%), Gaps = 19/238 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR WTV +TLGG+R   TDP++L TSF+ YDE   +VRI+V D LD+ KLGY YQ++
Sbjct  387   SNIDRLWTVWKTLGGRRQDFTDPDFLNTSFLFYDEKAQMVRIRVRDVLDSSKLGYVYQNV  446

Query  624   --------PNPRSKK--------FEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTR  755
                     P PR  +         E     + ++   + P    I P  LD  +K  V R
Sbjct  447   RNQWINSRPTPRVSRALSSVRRLVEARAADDNNNNIMNFPRPKEIFPTKLDHVIKVMVKR  506

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P      KK++ E +E ++   +E +    ++FD  +N+ +D   +  + AEFAGSF+N 
Sbjct  507   PNKKKRNKKEKNEREEILIVEGLEVESDVFVKFDVLIND-EDETLISPDNAEFAGSFVNV  565

Query  936   AWPR--QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                   +G + +K  T   L I ++L+DL    ++ + VT VPK G  +V +  V I 
Sbjct  566   PHHSHGKGEKNSKRKTKLKLAITELLEDLDAENDDNVLVTFVPKNGSGAVKIGGVKIV  623


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 20/120 (17%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYS-ALDDESREKFATAVRKLKERRLPVDHADYDLFK--  221
            P SG+I D++LP+ S  +  R  + ++D    EKF  A++ +K+  LP D  D   FK  
Sbjct  142  PMSGSIIDFQLPSSSTPLRTRPAAHSVDSAYIEKFNRAIQLMKQ--LPDD--DPRSFKQQ  197

Query  222  -SLH---------QAGFSPG---AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             ++H         Q GF       H    F+ FHR YL+ +E++L ++  D T  +P+WN
Sbjct  198  ANIHCAYCDGAYDQLGFPNSELQVHSSWIFLPFHRCYLYFFERILGSLINDPTFAMPFWN  257



>gb|KCW45574.1| hypothetical protein EUGRSUZ_L00687, partial [Eucalyptus grandis]
Length=337

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/219 (37%), Positives = 119/219 (54%), Gaps = 17/219 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ + LGG KR   TDP+WL  +F+ YDEN   +R+KV+DCL+   LGY YQD
Sbjct  125   SNVDRMWTLWKALGGSKRTDFTDPDWLNAAFLFYDENTQAMRVKVKDCLETTNLGYKYQD  184

Query  621   L--------PNPR--SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAtt  770
             +        P PR  +KK    +G+   +  + +P      P  LD+ V   V RP    
Sbjct  185   VDIPWLKSKPVPRKIAKKVAKTSGE--IADVAEIPRPIVHFPVKLDKVVSTLVKRPKQKR  242

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
             S K+KE E++  V+   +E +    ++FD ++N+ +D+ S   E  EFAGSF+N   P +
Sbjct  243   SKKEKEEEEEVLVIEG-IELESDAFVKFDVHINDEQDSLSSPNE-TEFAGSFVNV--PHK  298

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCG  1067
                  K  T   L I  +L+DL    + ++ VTL P+ G
Sbjct  299   HKPGKKMNTKLKLGITDLLEDLMGEDDEEVLVTLAPRYG  337



>gb|EPS57764.1| polyphenol oxidase, partial [Genlisea aurea]
Length=536

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 122/222 (55%), Gaps = 9/222 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR W   Q L G K+    D +WL  SFV YDEN  LVR+KV D +D  +LGY+YQD
Sbjct  316   ANVDRLWCTWQDLRGSKKNYFNDSDWLDASFVFYDENARLVRVKVRDAVDIRRLGYAYQD  375

Query  621   LPNPRSKKFEPFT--GKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
             + +   KK  P     K+  +  S+ P    I P  LD+ VK  V RP  + S  +KE E
Sbjct  376   VDSTWLKK-RPLARFRKSDVAAKSNAPRPDKIFPLKLDKVVKVLVQRPKKSRSHDEKERE  434

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             ++  V+   +E D++K ++FD ++N+ +D      + AE+AGS+       Q    T+  
Sbjct  435   EELLVIEG-IEVDKSKFVKFDVFVNDEEDDPDEFDK-AEYAGSYSQVV---QKKNSTRVN  489

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T  +L + ++L+DL     + I V LVPK GG+ +T+  + I
Sbjct  490   TKITLGLTEILEDLGAEDHDDILVALVPKVGGEDITIGGIKI  531



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 124/233 (53%), Gaps = 19/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  +TD +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  273   SNVDRMWSIWKTLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDV  332

Query  624   --------PNPR------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR      SK  +     + +   SS   A    P +L   +   V RP 
Sbjct  333   DIPWLSSKPTPRRAKVALSKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQ  392

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                 +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++   
Sbjct  393   QKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV--  449

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P +   K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  450   PHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYG--AVKIGGIKI  500


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP  ++  VR    A+D   R+KF  A+  +K   LP D           
Sbjct  28   PPATKIIDFKLPAPAKLRVRPPAHAVDKAYRDKFYKAMELMKA--LPDDDPRSFKQQAAV  85

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    +  QAGF       H    F  FHR YL+ +EK+L  +  D T  +P+WN
Sbjct  86   HCAY-CDGAYDQAGFPELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWN  142



>ref|XP_006583808.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=604

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 124/232 (53%), Gaps = 20/232 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQT--LGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR W + +T  L G+R      EWL++SF  YDEN+N VR+KV+DCLD++K+GY YQ
Sbjct  370   SNVDRMWNIWKTELLDGRRFDHKSDEWLESSFFFYDENSNYVRVKVKDCLDSKKMGYDYQ  429

Query  618   --DLP--------NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAt  767
               DLP         P+ K+  P   K  +ST  +L      LP  L+   +  V RP   
Sbjct  430   RVDLPWLLAGELIKPK-KEIIPLRSKPEASTFKTL-----QLPLLLESIERTNVKRPKPR  483

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPR  947
             +  + +E E  E VL   VEYD T  +RFD ++N+  D N +  + +EFAGSF+      
Sbjct  484   SRNENEEEEGVEEVLVIDVEYDSTDGVRFDVFINDQGD-NEIGPQDSEFAGSFVTLPHSP  542

Query  948   QGSEKTKTTTTWSLEIAQVLQDLAL-GGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +    T  ++ L +   L+DL +   ++ I VTL P  G   VT+K V I
Sbjct  543   HVNHNNITRASFKLPLTYQLKDLGVTKDDDSISVTLAPIYGDKPVTIKDVRI  594



>gb|AAK29783.1| polyphenol oxidase [Ananas comosus]
Length=351

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 115/221 (52%), Gaps = 11/221 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W V + LGG     TDP+WL  SF+ YDEN  LVR+KV+DCL  + L Y+YQD+
Sbjct  136   GNVDRMWYVWRKLGGTHRDFTDPDWLNASFLFYDENAQLVRVKVKDCLSADALRYTYQDV  195

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P     +P   K P   G++  T  AI P  LD+ V   V RP        + T ++E
Sbjct  196   DIPWISA-KPTPKKTPG--GAAPSTTEAIFPVVLDKPVSSTVARP-----KTGRSTGEEE  247

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF--AWPRQGSEKTKTTT  977
              ++   +E D+   ++FD Y+N   D   +  E +EFAGSF+       +   EK +  T
Sbjct  248   VLVVEGIELDKDVAVKFDVYINA-PDNEGVGPEASEFAGSFVQVPHKHKKGKKEKARIKT  306

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T  L I  +L+D+    +  + VTLVP+ G   V V  + I
Sbjct  307   TLRLGITDLLEDIGAEDDESVLVTLVPRIGEGLVKVGGLRI  347



>dbj|BAA21677.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 123/233 (53%), Gaps = 19/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKRA +TD +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRADLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDV  421

Query  624   --------PNPR------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR      SK  +     + +   SS   A    P  L   +   V RP 
Sbjct  422   DIPWLSSKPTPRRAKVALSKIAKKLGVAHAAVASSSKVVAGTEFPINLGSKISTVVKRPK  481

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                 +KK + +++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   
Sbjct  482   QKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPS-GPDKTEFAGSFVSV--  538

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P     K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   PHSHKHKKKMNTILRLGLTDLLEEIEAEDDDSVVVTLVPKFG--AVKIGGIKI  589



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 131/235 (56%), Gaps = 20/235 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +TLGG KR   TDP+WL   F+ YDEN N VR+KV DC+D +KLGY YQD
Sbjct  354   SNVDRMWTIWKTLGGNKRTEFTDPDWLDAEFIFYDENANPVRVKVRDCIDTKKLGYIYQD  413

Query  621   L------PNPRSKKF------EPFTGKNPSSTGS---SLPTATAILPATLDETVKFYVTR  755
             +        P+S++       + F     ++  +   +LP  TA  P  LD+ +   V +
Sbjct  414   VDIPWLKSRPKSRRLIKKVANKVFHHDGQAAHAAETLNLPPITA-FPLVLDKVIS-TVAK  471

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
              P  + +KK++ E++E +L   +E++    ++FD Y+N+  D+ S   + +EFAGSF+N 
Sbjct  472   RPKKSRSKKEKEEEEEVLLIDAIEFERNALVKFDVYVNDEHDSTSARPDNSEFAGSFVNI  531

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +     K  T   L +  +L+D+    ++ + VTLVP+ G   V +  + I
Sbjct  532   --PHKHKHGKKMKTCLRLGLTDLLEDMGAEDDDTVVVTLVPRYGKGLVKIGGIMI  584



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 123/223 (55%), Gaps = 7/223 (3%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK--RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR W + Q L GK  +   TD +WL  +F+ YDEN   V++++ D LDN+K+GY Y 
Sbjct  275   SNVDRMWAIWQQLAGKPRKRDYTDSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYA  334

Query  618   DLPNP-RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
               P P    K  P   K   ++ S  P   ++ P TLD+ V+  V R P  + + +++  
Sbjct  335   KTPLPWLDSKPVPTKKKGGYASKSKAPFVASVFPVTLDKVVQVKVAR-PKKSRSAEEKEA  393

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             ++E +L   VE +  K  +FD YLN++ D +  + + AE+AGS  +     +G +K +TT
Sbjct  394   EEEILLIEGVEVEIDKYAKFDVYLNDSDDPSGGK-DKAEYAGSSAHLPHKHKGMKKIRTT  452

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                SL + + L+DL    ++ I V L PK GG  V+V ++ + 
Sbjct  453   L--SLGLNEPLEDLGAEDDDTILVALAPKVGGGVVSVDNIKVV  493


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 55/123 (45%), Gaps = 15/123 (12%)
 Frame = +3

Query  33   MDSPILPFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYD  212
            +D+   P +  I DYK+P  +   VR     +D ++  KFA AV  +  R LP D     
Sbjct  24   VDNCCPPVASNIVDYKIPVVTTMKVRPAAHTMDKDAIAKFARAVDLM--RALPGDDPRNF  81

Query  213  LFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVP  353
              ++L    +  G              H    F  FHR YL+ YE++L  + GD +  +P
Sbjct  82   YQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPSFGLP  141

Query  354  YWN  362
            +WN
Sbjct  142  FWN  144



>ref|XP_006347083.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum tuberosum]
Length=616

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 122/237 (51%), Gaps = 18/237 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR WTV +TLGG+R   TDP++L TSF+ YDE   +VRI+V D LD+ KLGY YQ++
Sbjct  378   SNIDRLWTVWKTLGGRRQDFTDPDFLNTSFLFYDEKAQMVRIRVRDVLDSSKLGYVYQNV  437

Query  624   PNP---------------RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRP  758
              NP                 ++       + +S   + P    I P  LD  +K  V RP
Sbjct  438   TNPWINSRPTPRVSRALSSVRRLVEAKAADDNSNVMNFPRPKEIFPTKLDHVIKVMVKRP  497

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
                   KK++ E +E ++   +E +    ++FD  +N+ +D   +  + AEF GSF+N  
Sbjct  498   NKKKRNKKEKNEKEEILIVEGLEVESDVFVKFDVLIND-EDETLVSPDNAEFVGSFVNVP  556

Query  939   WPR--QGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                  +G + +K  T   L I ++L+DL    +  + VT VPK G  +V +  V I 
Sbjct  557   HHSHGKGEKNSKRKTKLKLAITELLEDLDAENDENVLVTFVPKNGSGAVKIGGVKIV  613


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 55/118 (47%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P SG I D++LP+ +    R    ++D    EKF   ++ +K+  LP D           
Sbjct  134  PMSGNIIDFQLPSSTALRTRPAAHSVDSAYIEKFNRGIQLMKQ--LPDDDPRSFKQQANV  191

Query  198  HADYDLFKSLHQAGFSPG---AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    +  Q GF       H    F+ FHR YL+ +E++L ++  D T  +P+WN
Sbjct  192  HCAY-CDGAYDQLGFPNSELQVHSSWIFLPFHRCYLYFFERILGSLINDPTFAMPFWN  248



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 121/223 (54%), Gaps = 12/223 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ-  617
             S+VDR W+V +T+    R    DP+WL  SF+ YDEN NLVR+KV DCLD+  LGY YQ 
Sbjct  349   SNVDRMWSVWKTIENINRKDFDDPDWLNASFLFYDENANLVRVKVRDCLDHRNLGYVYQF  408

Query  618   -DLPNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
              DLP  + K     T +  +    + P   +     LD+ V+  V RP  + S  +KE +
Sbjct  409   VDLPWLKEKP----TPRKLTKKNKAPPPPVSSTEFVLDKPVRVNVERPRKSRSKTEKEEK  464

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANS-LEVEMAEFAGSFINFAWPRQGSEKTKT  971
             ++  V++  ++ D    ++FD Y+N+  DA S +  E  EFAGS++N   P +  +    
Sbjct  465   EEILVIDIELKGDLF--VKFDVYVNDEDDAGSNIGSENTEFAGSYVNV--PNKHKQGKTL  520

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T   L +  +L+DL    ++ I VTLVPK G  ++ +  + I
Sbjct  521   KTRLRLGLTDLLEDLGADDDDGIVVTLVPKYGKGNIKISGIKI  563



>ref|XP_011016645.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=560

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 136/224 (61%), Gaps = 12/224 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR WT+ +T+ GG R  I+DP+WL + F+ Y+EN  LVR KV DCLDN +L Y+YQ+
Sbjct  339   SNVDRMWTLWKTIPGGIRRDISDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQN  398

Query  621   LPNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
             +  P  +SK      GK  + T ++L   TA  P  LD+T+   V+RP  + S K+KE E
Sbjct  399   VEIPWLKSKPIPRRLGKKAAETKTALTPITA-FPLVLDKTIVTVVSRPKKSRSRKEKEEE  457

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             D+  V+   +EYD+ K ++FD ++N++ +  S + E  EFAGSF+N +   + ++K+KT 
Sbjct  458   DEVLVIEG-IEYDKGKFVKFDVFINDDLEMPS-KPENTEFAGSFVNVS--HKHAKKSKTR  513

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCG--GDSVTVKSVDI  1100
                 L I ++L+DL    ++ I V LVP+     D V +  V I
Sbjct  514   LI--LGITELLEDLETDDDDSIVVALVPRSNSVSDPVVISGVKI  555



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 121/229 (53%), Gaps = 11/229 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGG+R   TDP++L  SF+ YDE   +VRI+V DCLD  +LGY YQ +
Sbjct  377   SNIDRLWSVWKTLGGRRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGV  436

Query  624   PN------PRSKKFEPFTGKN---PSSTGSSLPTATAILPATLDETVKFYVTRPPAttst  776
              N      PR++     +       +    + P+A  + P  LD  ++  V RP    + 
Sbjct  437   ANPWINSRPRARVSSALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPIKKRNK  496

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             K+K+ +++  V+   +E +    ++FD  +N+ +D   +    AEFAGSF+N      G 
Sbjct  497   KEKDAKEEFLVVE-GIELETDVFVKFDVLIND-EDETVISPNNAEFAGSFVNVPHHSHGK  554

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                K  T   L I ++L+DL    ++ + VT VPK G  +V +  V I 
Sbjct  555   SDKKRKTKLKLAITELLEDLDAEDDDHVVVTFVPKNGSGAVKIGGVKIV  603



>ref|XP_008442274.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis melo]
Length=576

 Score =   117 bits (292),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 128/234 (55%), Gaps = 21/234 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ--  617
             S+VDR W+V +TLGG+R  + +PEWL  SF+ Y+E    VR+ V DCLD++ LGY+YQ  
Sbjct  345   SNVDRLWSVWKTLGGRRKDLQNPEWLNASFIFYNEKAQPVRVHVRDCLDSKSLGYTYQPV  404

Query  618   DLP----NPRSKKFEPFT---------GKNPSSTGSSLPTATAILPATLDETVKFYVTRP  758
             DLP     P  ++ +  T            PSS  S +  A    P T+   V   V RP
Sbjct  405   DLPWLQTRPTPRRAQKTTVAFGIASALAAGPSS--SRVKPANIKFPITVKSPVSVEVKRP  462

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+ + + +D    I+FD ++N+ +D   ++ +  EFAGSF+N  
Sbjct  463   KKSRSKKEKEEEEEVLVI-YGIGFDPNNGIKFDVFIND-EDDKEIKPDNTEFAGSFVNV-  519

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P + + K K  T   + I +VL+DL    ++ I VT+VPK G    ++  + I
Sbjct  520   -PHKQAHKKKVKTGLRVGITEVLEDLEADNDDSIIVTIVPKIGAGLFSIGGLKI  572



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 123/233 (53%), Gaps = 19/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  +TD +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDV  421

Query  624   --------PNPR------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR      SK  +     + +   SS   A    P +L   +   V RP 
Sbjct  422   DIPWLSSKPTPRRAKVALSKVAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPK  481

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                 +KK + +++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   
Sbjct  482   QKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPS-GPDKTEFAGSFVSV--  538

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P     K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   PHSHKHKKKMNTILRLGLTDLLEEIEAEDDDSVVVTLVPKFG--AVKIGGIKI  589


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 59/132 (45%), Gaps = 17/132 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P S  I D+KLP  ++  +R    A+D   R+K+  A+  +K   LP D           
Sbjct  117  PPSTKIIDFKLPAPAKLRIRPPAHAVDQAYRDKYYKAMELMKA--LPDDDPRSFKQQAAV  174

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNST  368
            H  Y    +  Q GF       H    F  FHR YL+ +EK+L  +  D T  +P+WN  
Sbjct  175  HCAY-CDGAYDQVGFPELELQIHNSWLFFPFHRYYLYFFEKILGKLINDPTFALPFWNWD  233

Query  369  LDSDLPDHAAYA  404
              + +P  A YA
Sbjct  234  SPAGMPLPAIYA  245



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   117 bits (292),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 123/233 (53%), Gaps = 18/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TL  K   ITD +WL + F+ YDEN N+VR+KV DCL+++ LGY YQD+
Sbjct  362   SNVDRMWSIWKTLAPKNKDITDSDWLDSGFLFYDENANMVRVKVRDCLESKNLGYVYQDV  421

Query  624   --------PNPRSKK--FEPFTGK----NPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR  K  F     K    N + + + +   T   P TL   +   V RP 
Sbjct  422   DIPWLNSKPTPRRSKVAFSNIAKKLGVANAAGSKAKVVKITD-FPLTLSRKISVAVPRPK  480

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                 +KK++ +++E ++   +E+D    ++FD Y+N+  D  S   + +EFAGSF++   
Sbjct  481   QKKRSKKEKEDEEEILVIEGIEFDRDVAVKFDVYINDEDDLPS-GPDKSEFAGSFVSV--  537

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P +     K  T   L +  +L+DL    +  + VTL+P+   D V +  + I
Sbjct  538   PHRHKHTKKINTVLRLGLTDLLEDLDAEDDETVVVTLIPRYAADKVKIGGIKI  590



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   117 bits (292),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 129/234 (55%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGG-KRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             ++VDR WT+ +TLGG KR  ITD +WL   F+ YDEN NLVR+KV+D +D +KLGY YQD
Sbjct  358   ANVDRMWTLWKTLGGSKRTEITDTDWLNAEFLFYDENANLVRVKVKDSIDYKKLGYGYQD  417

Query  621   L--------PNPRS------KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRP  758
             +        P PR       K          +    +L T  +  P  L++  +  V RP
Sbjct  418   VEVPWLKSKPTPRKVIKKIVKALHHGQEAKAAENNQNL-TPISSFPLVLEKVTRVLVKRP  476

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  +++  +E+     ++FD Y+N+  D+ S + + +EFAGSF++  
Sbjct  477   KKSRSKKEKEEEEEVLLVDG-IEFARESAVKFDVYINDEDDSTSTKPDKSEFAGSFVSV-  534

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P   S  TK  T   L +  +L+DL    ++++ VTLVP+ G   V + ++ +
Sbjct  535   -PHTHSHGTKMKTCLRLGLTDLLEDLGAEDDDEVLVTLVPRYGIGLVKIDAIKV  587



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 115/220 (52%), Gaps = 1/220 (0%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGG+R   TDP++L +SF+ YDE   +VRI+V DCLD  +LGY YQ +
Sbjct  377   SNIDRLWSVWKTLGGRRQDFTDPDFLNSSFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGV  436

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
              NP           +  S+   L  A    P  LD  ++  V RP      K+++   +E
Sbjct  437   VNPWINSRPRARVSSALSSVRRLAEAKDYFPTKLDHVIRVMVKRPNNKKRNKEEKDAKEE  496

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTTTW  983
              ++   +E +    ++FD  +N+ +D   +    AEFAGSF+N      G    K  T  
Sbjct  497   FLVVEGIELETDVFVKFDVLIND-EDETVISPNNAEFAGSFVNVPHLSHGKSDEKRKTKL  555

Query  984   SLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              L I ++L+DL    ++ + VT VPK G  +V +  V I 
Sbjct  556   KLAITELLEDLDAEDDDHVVVTFVPKNGSGAVKIGGVKIV  595



>gb|EYU34157.1| hypothetical protein MIMGU_mgv1a003435mg [Erythranthe guttata]
Length=585

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 134/222 (60%), Gaps = 8/222 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKR-AGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             +++DR W+  Q L GK+  G  D +WL  +++ YDEN NLV++ V+D LDNEK+GY+YQ 
Sbjct  365   ANIDRLWSTWQGLRGKKPKGFKDKDWLDATYLFYDENKNLVQVNVKDALDNEKMGYTYQK  424

Query  621   LPNP-RSKKFEPFTGKNPSSTGSSLPTAT-AILPATLDETVKFYVTRPPAttstkkkete  794
             + NP  + + +P   K+ ++  S  PTAT  I P  LD+ VK  V RP  + S K KE E
Sbjct  425   VDNPWVNYRPKPKVKKSKAAKNSKAPTATDTIFPVKLDKVVKVLVDRPRKSRSKKDKEDE  484

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT  974
             ++  V+   +E D +K +RF+ ++N+  D      + AEFAG++     P + S +TK+ 
Sbjct  485   EELLVIEG-IEVDNSKFVRFEVFINDEDDKPEDLRDKAEFAGAYSQV--PHKNSTRTKSK  541

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 L + ++L+DL +  +++I V LVPK GG+ +T+  + I
Sbjct  542   I--RLGLTELLEDLDVDDDDQILVALVPKAGGEDITIGGIKI  581



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 122/233 (52%), Gaps = 19/233 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W + +TLGGKR  +TD +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWNIWKTLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYGYQDV  421

Query  624   --------PNPR------SKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPP  761
                     P PR      SK  +     + +   SS   A    P +L   +   V RP 
Sbjct  422   DIPWLSSKPTPRRAKVALSKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQ  481

Query  762   AttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW  941
                 +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++   
Sbjct  482   QKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV--  538

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             P +   K K  T   L +  +L ++    ++ + VTLVPK G  +V +  + I
Sbjct  539   PHRHKHKKKINTILRLGLTDLLGEIEAEDDDSVVVTLVPKYG--AVKIGGIKI  589


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 17/132 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP  ++  +R    A+D   R+KF  A+  +K   LP D           
Sbjct  117  PPATKIIDFKLPAPAKLRIRPPAHAVDQAYRDKFYKAMELMKA--LPDDDPRSFKQQAAV  174

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNST  368
            H  Y    +  QAGF       H    F  FHR YL+ +EK+L  +  D T  +P+WN  
Sbjct  175  HCAY-CDGAYDQAGFPELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWD  233

Query  369  LDSDLPDHAAYA  404
              + +P  A YA
Sbjct  234  SPAGMPLPAIYA  245



>ref|XP_009408745.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 122/222 (55%), Gaps = 5/222 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +++DR W++ + L  K     D +WL+TSF+ YDEN +LVR+ V+DC     L Y YQD+
Sbjct  313   ANIDRMWSLWKKLSRKHRDFNDSDWLKTSFLFYDENADLVRVTVKDCFKTRWLRYKYQDV  372

Query  624   PNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
               P  +++     T    +++GS  PTA A  P TL+  V   + RP    S K+KE E+
Sbjct  373   EIPWVKARPTPKLTKARKAASGSLKPTAEAQFPVTLESPVSATLKRPKVGRSRKEKEEEE  432

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTT  974
             +  ++   +E+D  + I+FD  +N   + + +    +EFAGSF+N     R   E+ K T
Sbjct  433   EVLIVE-GIEFDRDQFIKFDVIVNAT-EGDGITPADSEFAGSFVNTPHRHRHLKEENKGT  490

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T   L I  +L+D+    ++ + VT+VPK G   V+V  + I
Sbjct  491   TRLCLGITDLLEDIGGEADDGVLVTIVPKAGKGKVSVGGLRI  532



>gb|ADF59058.2| polyphenol oxidase IV [Pyrus x bretschneideri]
Length=587

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 128/224 (57%), Gaps = 14/224 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQ-TLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSY-Q  617
             S+VDR W++ +  LGG     TD  WL T F+ YDE  NLVR+KV D LD +KLGY Y Q
Sbjct  367   SNVDRMWSIYKDKLGGTDIEKTD--WLDTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQ  424

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTA--TAILPATLDETVKFYVTRPPAttstkkket  791
              +P P   K++P   K+ +   +S+ ++  T   PA L +T+   VTRP AT  T  ++ 
Sbjct  425   KVPIPW-LKYKPTARKSTNKRKASVSSSDLTTTFPAVLSDTISVEVTRPSATKRTAAQKK  483

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLE-VEMAEFAGSFINFAWPRQGSEKTK  968
                E ++   +E+   + ++FD ++N+  DA+SL   + +EFAGSF++   P +  +  K
Sbjct  484   AQDEVLVIKGIEFAGNETVKFDVFVND--DADSLAGKDKSEFAGSFVHV--PHKHKKNIK  539

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               T   L IA +L++LA   ++ + VTLVPK G   +T+    I
Sbjct  540   --TNLRLSIASLLEELAAETDSSLVVTLVPKVGKGPITIGGFSI  581



>ref|XP_009352971.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Pyrus 
x bretschneideri]
Length=409

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 125/223 (56%), Gaps = 12/223 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQ-TLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W++ +  LGG     TD  WL T F+ YDE  NLVR+KV D LD  KLGY Y +
Sbjct  189   SNVDRMWSIYKDKLGGTDIEKTD--WLDTEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDE  246

Query  621   LPNPRSKKFEPFTGKNPSSTGSSLPTA--TAILPATLDETVKFYVTRPPAttstkkkete  794
               +    +++P   K+ +   +++ ++  TA  PATL +T+   VTRP AT  T  ++  
Sbjct  247   NVSIPWLEYKPTARKSTNKRKAAVSSSDLTATFPATLSDTISVEVTRPSATKRTAAQKKA  306

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSLE-VEMAEFAGSFINFAWPRQGSEKTKT  971
               E ++   +E+   + ++FD Y+N+  DA+SL   + +EFAGSF++   P +  +  KT
Sbjct  307   QDEVLVITGIEFAGNETVKFDVYVND--DADSLAGKDKSEFAGSFVHV--PHKHKKNIKT  362

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  L I  +L++L    ++ + VTLVPK G   +T+    I
Sbjct  363   NL--RLSITSLLEELDAETDSTVVVTLVPKVGKGPITIGGFSI  403



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (52%), Gaps = 23/235 (10%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  + D +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDV  421

Query  624   --------PNPRSKKFEPFTGKNPSSTG--------SSLPTATAILPATLDETVKFYVTR  755
                     P PR  K     GK     G        SS   A    P +L   +   V R
Sbjct  422   DIPWLSSKPTPRRAKVA--LGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKR  479

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P     +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++ 
Sbjct  480   PKQKKRSKKGQRDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV  538

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +   K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   --PHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYG--AVNIGGIKI  589


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 63/133 (47%), Gaps = 19/133 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFK---  221
            P +  I D+KLP  ++  +R    A+D   R+KF  A+  +K   LP D  D   FK   
Sbjct  117  PPATKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMELMKA--LPDD--DPRSFKQQA  172

Query  222  SLH---------QAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNS  365
            ++H         QAGF       H    F  FHR YL+ +EKML  +  D T  +P+WN 
Sbjct  173  AVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRYYLYFFEKMLGKLINDPTFAMPFWNW  232

Query  366  TLDSDLPDHAAYA  404
               + +P  A YA
Sbjct  233  DSPAGMPLPAIYA  245



>ref|XP_009334438.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=586

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 128/224 (57%), Gaps = 14/224 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQ-TLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSY-Q  617
             S+VDR W++ +  LGG     TD  WL T F+ YDE  NLVR+KV D LD +KLGY Y Q
Sbjct  366   SNVDRMWSIYKDKLGGTDIEKTD--WLDTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQ  423

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTA--TAILPATLDETVKFYVTRPPAttstkkket  791
              +P P   K++P   K+ +   +S+ ++  T   PA L +T+   VTRP AT  T  ++ 
Sbjct  424   KVPIPW-LKYKPTARKSTNKRKASVSSSDLTTTFPAVLSDTISVEVTRPSATKRTAAQKK  482

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLE-VEMAEFAGSFINFAWPRQGSEKTK  968
                E ++   +E+   + ++FD ++N+  DA+SL   + +EFAGSF++   P +  +  K
Sbjct  483   AQDEVLVIKGIEFAGNETVKFDVFVND--DADSLAGKDKSEFAGSFVHV--PHKHKKNIK  538

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T     L IA +L++LA   ++ + VTLVPK G   +T+    I
Sbjct  539   TNL--RLSIASLLEELAAETDSSLVVTLVPKVGKGPITIGGFSI  580



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 123/235 (52%), Gaps = 23/235 (10%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  + D +WL + F+ Y+EN  LVR+KV DCL+ + LGY+YQD+
Sbjct  362   SNVDRMWSIWRTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDV  421

Query  624   --------PNPRSKKFEPFTGKNPSSTG--------SSLPTATAILPATLDETVKFYVTR  755
                     P PR  K     GK     G        SS   A    P +L   +   V R
Sbjct  422   DIPWLSSKPTPRRAKVA--LGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKR  479

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P     +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++ 
Sbjct  480   PKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV  538

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +   K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   --PHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYG--AVNIGGIKI  589


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 63/133 (47%), Gaps = 19/133 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFK---  221
            P +  I D+KLP  ++  +R    A+D   R+KF  A+  +K   LP D  D   FK   
Sbjct  117  PPATKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMELMKA--LPDD--DPRSFKQQA  172

Query  222  SLH---------QAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNS  365
            ++H         QAGF       H    F  FHR YL+ +EK+L  +  D T  +P+WN 
Sbjct  173  AVHCAYCDGAYDQAGFPELELQVHDSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNW  232

Query  366  TLDSDLPDHAAYA  404
               + +P  A YA
Sbjct  233  DSPAGMPLPAIYA  245



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 123/235 (52%), Gaps = 23/235 (10%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  + D +WL + F+ Y+EN  LVR+KV DCL+ + LGY+YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDV  421

Query  624   --------PNPRSKKFEPFTGKNPSSTG--------SSLPTATAILPATLDETVKFYVTR  755
                     P PR  K     GK     G        SS   A    P +L   +   V R
Sbjct  422   DIPWLSSKPTPRRAKVA--LGKIAKKLGVAHATVASSSKVVAGTEFPISLGSKISTVVKR  479

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P     +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++ 
Sbjct  480   PKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV  538

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +   K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   --PHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYG--AVNIGGIKI  589


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 17/132 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP  ++  +R    A+D   R+KF  A+  +K   LP D           
Sbjct  117  PPATKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMELMKA--LPDDDPRSFKQQAAV  174

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNST  368
            H  Y    +  QAGF       H    F  FHR YL+ +EK+L  +  D T  +P+WN  
Sbjct  175  HCAY-CDGAYDQAGFPELELQVHDSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWD  233

Query  369  LDSDLPDHAAYA  404
              + +P  A YA
Sbjct  234  SPAGMPLPAIYA  245



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 127/220 (58%), Gaps = 8/220 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR WT+ Q LGGKR  + DP+WL +SF+ YDEN   VR+KV D   N+++GY Y+ +
Sbjct  362   ANVDRMWTIWQQLGGKRKEVPDPDWLNSSFIFYDENAQPVRVKVRDSFSNDRMGYIYEKV  421

Query  624   PNPRSK-KFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedk  800
               P  K K  P   K+  +  S  P A  + P  L++ VK  V RP  + S ++KE E++
Sbjct  422   DIPWLKNKPVPRVRKSRVAFTSGAPPADKVFPGPLNKIVKVLVKRPKLSRSKRQKEEEEE  481

Query  801   etVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTTT  980
               V+ + +E+   K ++FD ++N+ +D N  +   +E+ GSF N   P +     K  TT
Sbjct  482   RLVV-YGIEFSMDKYVKFDVFIND-EDDNPNDFAKSEYVGSFANL--PHKVKSGMKAKTT  537

Query  981   WSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              + E+ ++L+DL +  ++ + VTLVP     ++T+  + I
Sbjct  538   QTFELTEILEDLDVEDDDALLVTLVPNT---ALTIDGIKI  574



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 123/232 (53%), Gaps = 18/232 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  I+  +WL + F+ Y+EN  LVR+KV D L+++ LGY YQ++
Sbjct  359   SNVDRMWSIWKTLGGKRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEV  418

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAIL-----PATLDETVKFYVTRPPA  764
                     P PR  K E    K       +  ++T I+     P  L+  +   V RP  
Sbjct  419   DIPWLQSKPTPRRAKLELSKIKKKLGVAQAAESSTKIVAGRAFPINLETKISTVVPRPKQ  478

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
                 KK++ E++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   P
Sbjct  479   KKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPS-GPDKTEFAGSFVSV--P  535

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +   K K  T   L +  +L+D+    +  + VTLVPK G  +V +  V I
Sbjct  536   HRHKHKKKINTILRLGLTDLLEDIEAEDDESVVVTLVPKYG--AVKIGGVKI  585



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 126/230 (55%), Gaps = 13/230 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+V +TLG KR   TDP+WL++ F+ YDEN NLV++KV+D  ++ KLGY YQD+
Sbjct  376   ANVDRMWSVWKTLGKKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDV  435

Query  624   PNP----RSKKFEPFTGKNPSSTGSSLPTATAI--LPATLDETVKFYVTRPPAttstkkk  785
               P    +SK       K+ + + +  P+   +   P  LD  V   V RP  + ++K+K
Sbjct  436   DIPWIKYKSKPSRRVKSKDKNKSSAQRPSRKLVDKFPIVLDSVVSIIVKRPKKSRNSKEK  495

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS---  956
             E E++  V++  +EYD    ++FD  +N+ +D   +  E  EFAGS+++           
Sbjct  496   EDEEEILVIDG-IEYDNKTEVKFDVIVND-EDDKEIGGENTEFAGSYVSVLHVHDHGKNK  553

Query  957   --EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +     T   L +  +L+DL    ++ I VTL+P+ G   ++   +++
Sbjct  554   KKKNNNIVTCLRLGLTDLLEDLKADDDDSIVVTLIPRYGNVKISGIKIEL  603


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 19/127 (15%)
 Frame = +3

Query  30   GMDSPIL---PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-  197
             +D PI    PFS  I D+K PTF++  VR     ++D+   K+  A+  +  R LP D 
Sbjct  118  NIDPPISCCPPFSSDIIDFKFPTFNKLRVRPAAQLVNDDYFAKYNKALELM--RALPDDD  175

Query  198  ----------HADYDLFKSLHQAGFSP--GAHFGASFVAFHRMYLFMYEKMLQNVAGDST  341
                      H  Y       Q G+      H    F+ FHR YL+ YE++L ++  D T
Sbjct  176  PRSFYQQANIHCAY-CVGGYTQKGYDVELQVHNSWLFLPFHRWYLYFYERILGSLINDPT  234

Query  342  IFVPYWN  362
              +P+WN
Sbjct  235  FAIPFWN  241



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (52%), Gaps = 23/235 (10%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  + D +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDV  421

Query  624   --------PNPRSKKFEPFTGKNPSSTG--------SSLPTATAILPATLDETVKFYVTR  755
                     P PR  K     GK     G        SS   A    P +L   +   V R
Sbjct  422   DIPWLSSKPTPRRAKVA--LGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKR  479

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P     +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++ 
Sbjct  480   PKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV  538

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +   K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   --PHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYG--AVNIGGIKI  589


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 17/132 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP  ++  +R    A+D   R+KF  A+  +K   LP D           
Sbjct  117  PPATKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMGLMKA--LPDDDPRSFKQQAAV  174

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNST  368
            H  Y    +  QAGF       H    F  FHR YL+ +EK+L  +  D T  +P+WN  
Sbjct  175  HCAY-CDGAYDQAGFPELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWD  233

Query  369  LDSDLPDHAAYA  404
              + +P  A YA
Sbjct  234  SPAGMPLPAIYA  245



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 115/221 (52%), Gaps = 11/221 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W V + LGG     TDP+WL  SF+ YDEN  LVR+KV+DCL+ + L Y+YQD+
Sbjct  362   GNVDRMWYVWRKLGGTHRDFTDPDWLNASFLFYDENAQLVRVKVKDCLEADALRYTYQDV  421

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P     +P   K P   G++  T  A  P  LD+ V   V RP        + T ++E
Sbjct  422   DIPWISA-KPTPKKTPG--GAAPSTTEATFPVVLDKPVSATVARP-----KTGRSTGEEE  473

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF--AWPRQGSEKTKTTT  977
              ++   +E D+   ++FD Y+N   D   +  E +EFAGSF+       +   EK +  T
Sbjct  474   VLVVEGIELDKDVAVKFDVYINA-PDNEGVGPEASEFAGSFVQVPHKHKKGKKEKARIKT  532

Query  978   TWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T  L I  +L+D+    +  + VTLVP+ G   V V  + I
Sbjct  533   TLRLGITDLLEDIGAEDDESVLVTLVPRIGEGLVKVGGLRI  573



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (52%), Gaps = 23/235 (10%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  + D +WL + F+ Y+EN  LVR+KV DCL+ + LGY YQD+
Sbjct  362   SNVDRMWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDV  421

Query  624   --------PNPRSKKFEPFTGKNPSSTG--------SSLPTATAILPATLDETVKFYVTR  755
                     P PR  K     GK     G        SS   A    P +L   +   V R
Sbjct  422   DIPWLSSKPTPRRAKVA--LGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKR  479

Query  756   PPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINF  935
             P     +KK + +++E ++   +E+D    ++FD ++N+  D  S   +  EFAGSF++ 
Sbjct  480   PKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPS-GPDKTEFAGSFVSV  538

Query  936   AWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               P +   K K  T   L +  +L+++    ++ + VTLVPK G  +V +  + I
Sbjct  539   --PHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYG--AVNIGGIKI  589


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 17/132 (13%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP  ++  +R    A+D   R+KF  A+  +K   LP D           
Sbjct  117  PPATKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMELMKA--LPDDDPRSFKQQAAV  174

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNST  368
            H  Y    +  QAGF       H    F  FHR YL+ +EK+L  +  D T  +P+WN  
Sbjct  175  HCAY-CDGAYDQAGFPELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWD  233

Query  369  LDSDLPDHAAYA  404
              + +P  A YA
Sbjct  234  SPAGMPLPAIYA  245



>sp|Q6UIL3.1|LAHY_LARTR RecName: Full=(+)-larreatricin hydroxylase, chloroplastic; AltName: 
Full=Polyphenol oxidase; Flags: Precursor [Larrea tridentata]
 gb|AAQ67412.1| (+)-larreatricin hydroxylase [Larrea tridentata]
Length=584

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 127/230 (55%), Gaps = 18/230 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ--  617
             ++VDR W + +   G R      +WL   F+L+DEN   VR+ V D LD  KLGY+YQ  
Sbjct  354   ANVDRMWYIWKNSLG-RKDYKKKDWLNAGFLLFDENAQPVRVYVRDALDERKLGYAYQEV  412

Query  618   DLP----NPRSKKFEPFTGKNPSSTGSSLPTATAIL---PATLDETVKFYVTRPPAttst  776
             D+P     P+ +K  P+    P+   S   T T ++   P TLD TV F V RP  + S 
Sbjct  413   DIPWINSKPKPRKANPW----PNRLRSKATTTTKLINKFPLTLDSTVSFEVKRPKKSRSK  468

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA-WPRQG  953
              +KE E++  V+   ++++    ++FD Y+N+ +D +    +  EFAGSF+N   + R G
Sbjct  469   SEKEDEEEVLVIE-KIKHEPQFPLKFDVYIND-EDEDPSAADQTEFAGSFVNVPHFHRHG  526

Query  954   SEKTK-TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +K K  TT  S+ I++VL +L + G++ I VTLVP+ G   +T+    I
Sbjct  527   DKKDKRQTTNLSIGISEVLDELDVDGDDSIVVTLVPRVGSGQITIGGAKI  576



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 121/229 (53%), Gaps = 10/229 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGG+R   TDP++L  SF+ YDE   +VRI+V DCLD  +LGY+YQ++
Sbjct  379   SNIDRLWSVWKTLGGRRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYAYQNV  438

Query  624   PN------PRSKKFEPFTGKN---PSSTGSSLPTATAILPATLDETVKFYVTRPPAttst  776
              N      PR++     +       +    + P+A  + P  LD  ++  V RP      
Sbjct  439   ANPWINSRPRARVSSALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPNKKKRN  498

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             KK++   +E ++   +E +    ++FD  +N+ +D   +    AEFAGSF+N      G 
Sbjct  499   KKEKDAKEEILVVEGIELETDVFVKFDVLIND-EDETVISPNNAEFAGSFVNVPHHSHGK  557

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                K  T   L I ++L+DL    ++ + VT VPK G  +V +  V I 
Sbjct  558   SGKKRKTKLKLAITELLEDLDAEDDDHVLVTFVPKNGSGAVKIGGVKIV  606


 Score = 52.0 bits (123),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 56/119 (47%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYS-ALDDESREKFATAVRKLKERRLPVD----------  197
            P +  I D++LP  S  +  R  + A D    EKF  A++ +K+  LP D          
Sbjct  134  PTTANIIDFQLPPPSTTLRTRPAAHAADSAYIEKFNRAIQLMKQ--LPDDDPRSFKQQAN  191

Query  198  -HADYDLFKSLHQAGFSPG---AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y    +  Q GF       HF   F+ FHR YL+ +EK+L ++  D T  +P+WN
Sbjct  192  VHCAY-CDGAYDQLGFPNSELQVHFSWLFLPFHRCYLYFFEKILGSLINDPTFAIPFWN  249



>ref|XP_006574243.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=274

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 87/242 (36%), Positives = 127/242 (52%), Gaps = 22/242 (9%)
 Frame = +3

Query  375   SDLPDH----AAYAPFSDMVSGMGNLSSDVDRRWTVCQTLGGKRAGITD-PEWLQTSFVL  539
             +D P H    A Y    D++    +L+SD  R W + +TL G+R   +D P WL + F  
Sbjct  43    ADKPHHEDMGAFYTAARDLIFYAHHLNSD--RLWGLWKTLEGRRKDYSDDPNWLDSDFYF  100

Query  540   YDENNNLVRIKVEDCLDNEKLGYSYQ--DLP----NPRSKKFEPFTGKNPSSTGSSLPTA  701
             YDEN N VR+KV DCLD +KLGY Y+  DLP     P S K +       S   SS P+ 
Sbjct  101   YDENANFVRVKVRDCLDTKKLGYVYEDVDLPWLRTPPTSPKSKLLRKAKKSPLLSSKPSK  160

Query  702   TAILPATLDETVKFYVTRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKD  881
                 P  LD      V RP    S + KE E++  V+   +E+   K ++FD ++N+++D
Sbjct  161   ---FPLVLDSITSTVVKRPKKLRSKEDKEQEEEVLVIE-GIEFGSDKYVKFDIHINDDED  216

Query  882   ANSLEVEMAEFAGSFINFAWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPK  1061
              N  E +  EF G+F+N  +  QG       T++ + I++VL+ L    +N + VTLVPK
Sbjct  217   -NLNEPDQTEFVGTFVNL-FHGQGH---NINTSFKVGISKVLECLEAEEDNVVLVTLVPK  271

Query  1062  CG  1067
              G
Sbjct  272   VG  273



>ref|XP_009407067.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 118/229 (52%), Gaps = 21/229 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W V + LG +R  + DP+WL  SFV YDEN NLV+I+V DC+D++KL Y YQD+
Sbjct  357   SNIDRIWNVWKGLGSRRKDLADPDWLDASFVFYDENANLVKIRVRDCIDSDKLRYEYQDV  416

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI---------LPATLDETVKFYVTRPPAttst  776
              N       P+    P+ T    P    +          P  LD  V   V RP A  + 
Sbjct  417   GN-------PWLNTRPTVTSGVRPRVAGVAHANVVEPKFPIKLDSVVTAKVKRPKAARTK  469

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             ++KE +++  V+   +E D   +++FD ++N   D   +     E AGSF+N     +  
Sbjct  470   EEKEEKEEVLVVEG-IELDRDVHVKFDVFVNVT-DHGKVGPGGRELAGSFVNVPHRHKHD  527

Query  957   EKTKT-TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             + +K   T   L + ++L+DL   G   I VTLVP+ G   V V S+ I
Sbjct  528   KMSKQLKTRLQLGLTELLEDLKADGS--IMVTLVPRQGKGKVKVGSLKI  574



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 121/219 (55%), Gaps = 13/219 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+V +TLG KR   TDP+WL++ F+ YDEN NLV++KV+D  ++ KLGY YQD+
Sbjct  376   ANVDRMWSVWKTLGKKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDV  435

Query  624   PNP----RSKKFEPFTGKNPSSTGSSLPTATAI--LPATLDETVKFYVTRPPAttstkkk  785
               P    +SK       K+ + + +  P+   +   P  LD  V   V RP  + ++K+K
Sbjct  436   DIPWIKYKSKPSRRVKSKDKNKSSAQRPSKKLVDKFPIVLDSIVSIIVKRPKKSRNSKEK  495

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS---  956
             E E++  V++  +EYD    ++FD  +N+ +D   +  E  EFAG++++           
Sbjct  496   EDEEEILVIDG-IEYDNKTEVKFDVIVND-EDDKVIGGENTEFAGTYVSVLHVHDHGKNK  553

Query  957   --EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCG  1067
               +     T   L +  +L+DL    ++ I VTL+P+ G
Sbjct  554   KKKNNNIVTCLRLGLTDLLEDLKADDDDSIVVTLIPRYG  592


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 54/117 (46%), Gaps = 16/117 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            PFS  I D+K PTF +  VR     ++D+   K+  A+  +  R LP D           
Sbjct  128  PFSSDIIDFKFPTFKKLRVRPAAQLVNDDYFAKYNKALELM--RALPNDDPRSFYQQANI  185

Query  198  HADYDLFKSLHQAGFSP--GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y       Q G+      H    F+ FHR YL+ YE++L ++  D T  +P+WN
Sbjct  186  HCAY-CVGGYTQKGYDAELQVHNSWLFLPFHRWYLYFYERILGSLINDPTFAIPFWN  241



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 124/235 (53%), Gaps = 17/235 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGK-RAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S++DR W++ +TLGGK R   TD +WL++ F+ YDEN NLV +KV+DCLD + LGY YQD
Sbjct  366   SNIDRLWSIWKTLGGKNRKDFTDSDWLESGFLFYDENKNLVNVKVKDCLDTKNLGYVYQD  425

Query  621   L--------PNPR---SKKFEPFTGKN---PSSTGSSLPTATAILPATLDETVKFYVTRP  758
             +        P PR    KK E   G +     +            P  LD  V   V RP
Sbjct  426   VDIPWLKSKPTPRGKTQKKVEVAQGLHFGIGEAHAFESSRKYVKFPLVLDNVVSTIVKRP  485

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+   +E++    ++FD ++N+  D     V+  EFAGSF+N  
Sbjct  486   KKSRSKKEKEEEEEVLVIE-GIEFERNLAVKFDVFINDEDDKVIRPVD-TEFAGSFVNVP  543

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                +   K K  +   L +  +L+DL    ++ + VTLVP+ G   V ++S+ I 
Sbjct  544   HFNENKGKKKIISCLRLGLTDLLEDLGAEDDDSVVVTLVPRNGKGLVKIRSIKIV  598



>ref|XP_007025704.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28326.1| Larreatricin hydroxylase [Theobroma cacao]
Length=538

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 121/233 (52%), Gaps = 17/233 (7%)
 Frame = +3

Query  438   LSSDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             L ++VDR W+V +   G+     D E L  +F  YDEN NLVR KV DCLDN+ LGY Y+
Sbjct  308   LHANVDRMWSVWEKTLGQN-NFNDAERLNATFYFYDENANLVRAKVRDCLDNKTLGYDYE  366

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTATA-----------ILPATLDETVKFYVTRPPA  764
              +  P  +  +P T K     G     A A             P  LD+T+   + RP  
Sbjct  367   PVEMPW-RLTKPVTRKLGKKGGRGHGHAMAAEIKNKNIIRNAFPIVLDKTLSIEIPRPRK  425

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
             + S ++KE E+   + +  +E D +  ++FD Y+N+  D      E AEFAGSF N   P
Sbjct  426   SRSKREKEEEEVLVLESIQLERDAS--VKFDVYINDEDDEAPSGPEDAEFAGSFTNI--P  481

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                    K  T++SL I+ +L+DL + G++ I VTLVP+ G   VTV ++ I 
Sbjct  482   HNHKHAKKLETSFSLAISDLLEDLDVEGDDNIVVTLVPRRGKGLVTVGNIKIN  534


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 15/112 (13%)
 Frame = +3

Query  66   ITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQAGFS  245
            I D+KLP+FS+   RR    +D +   +F  AV  +K+  LP D     + ++     + 
Sbjct  70   IIDFKLPSFSKLRYRRPAHLVDADYVAEFTKAVNLMKD--LPPDDPRSFMQQANVYRAYC  127

Query  246  PGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             GA             HF + F  FHR+YL+ YE++L  + GD    +P+WN
Sbjct  128  NGAYDQVGFPDQDLQIHFSSLFFPFHRLYLYFYERILGKLIGDPDFAMPFWN  179



>gb|AAK13243.1| polyphenol oxidase [Trifolium pratense]
Length=623

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 125/228 (55%), Gaps = 13/228 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W+V QTL GKR   T+ +WL++SF+ YDEN NLV++KV+D +D+ KLGY YQ+L
Sbjct  396   ANVDRMWSVWQTLRGKRKDCTENDWLESSFLFYDENKNLVKVKVKDSVDDRKLGYVYQNL  455

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI------LPATLDETVKFYVTRPPAttstkkk  785
               P     +P   K   S  + L     +       P  LD  V   V RP  + S K+K
Sbjct  456   DIPWINH-KPKPSKRVQSKDNKLLAQRPLRKFVDKFPIVLDSAVSIIVKRPKKSRSLKQK  514

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEK-  962
             E E++  V++  +E+D+   + FD  +N++ D   + VE +EF GSF++           
Sbjct  515   EVEEEILVID-GIEFDDNIGVMFDVLVNDDDDK-VIGVENSEFLGSFLSLPHGHNHGNNK  572

Query  963   --TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                K  T ++  +  +L+DL    ++ I VTL+P+  GD V +  ++I
Sbjct  573   KKEKKKTCFTRGLTDLLEDLKADDDDSIVVTLIPRY-GDGVKISGIEI  619


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 22/139 (16%)
 Frame = +3

Query  12   VMLSELGMDSPILPFSGT--------ITDYKLPTFSRHIVRREYSALDDESREKFATAVR  167
             ++   G+ + I PFS          I D++ PTF +  VRR     D  S + FA   +
Sbjct  112  CVIPPTGLPNNITPFSCCPPISSNLKIIDFEFPTFKKLRVRRAAHLNDSISIDNFAKYDK  171

Query  168  KLK-ERRLPVDHADYDLFKSLHQAGFSPGA-------------HFGASFVAFHRMYLFMY  305
             L   + LP D     + ++     +  G              HF   F+ FHR YL+ Y
Sbjct  172  ALNLMKALPDDDPRSFVQQAKVHCAYCVGGYTQKGYPNTELQVHFSWLFLPFHRWYLYFY  231

Query  306  EKMLQNVAGDSTIFVPYWN  362
            E++L ++  D T  +P+WN
Sbjct  232  ERILGSLINDPTFAIPFWN  250



>ref|XP_006583806.1| PREDICTED: polyphenol oxidase II, chloroplastic-like isoform 
X2 [Glycine max]
Length=578

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 119/227 (52%), Gaps = 9/227 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQT--LGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR W + +T  L G+R      +WL++SF  YDEN N VR+KV+DCLD++K+GY YQ
Sbjct  343   SNVDRMWNIWKTELLDGRRFDHKSDDWLESSFFFYDENKNYVRVKVKDCLDSKKMGYDYQ  402

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTATAI----LPATLDETVKFYVTRP-PAttstkk  782
              +  P     E    K       S P A+      LP  L+   +  V RP P + +  +
Sbjct  403   RVDLPWLLAGELIKPKKEIILLRSKPEASTFKTLQLPLPLESIERTNVKRPKPRSRNENE  462

Query  783   ketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEK  962
             +E E  E VL   VEYD T  +RFD ++N+  D N +  + +EFAGSF+        +  
Sbjct  463   EEEEGVEEVLVIDVEYDSTDGVRFDVFINDQGD-NEIGPQDSEFAGSFVTLPHSPHVNHN  521

Query  963   TKTTTTWSLEIAQVLQDLAL-GGENKIPVTLVPKCGGDSVTVKSVDI  1100
               T  ++ L +   L+DL +   ++ I VTL P  G   VT+K V I
Sbjct  522   NITKASFKLPLTYKLKDLGVTKDDDSISVTLAPIYGDKPVTIKDVRI  568



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 119/211 (56%), Gaps = 5/211 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W V + LGGK     D +WL +SF+ YDEN +LVR+KV++CLD + L Y+YQD+
Sbjct  371   SNVDRMWNVWKMLGGKHKDFEDKDWLNSSFLFYDENADLVRVKVKNCLDTQGLRYTYQDV  430

Query  624   PNPRSKKFEPFTGKNPSSTGS-SLPTAT-AILPATLDETVKFYVTRPPAttstkkketed  797
               P  K      G   +  G+ SL   T A  P TLD +V   V R P  + ++K++ ++
Sbjct  431   EIPWLKTRPTPKGTAAAKKGARSLRAVTEATFPVTLDSSVSATVRR-PKVSRSRKEKEDE  489

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTT-  974
             +E ++   +E+D    I+F  Y+N   + + ++    EFAGSF+N       S+K K   
Sbjct  490   EEVLVVEGIEFDRDMFIKFAVYIN-TPEEDGVDPGSTEFAGSFVNVPHKNSHSKKEKKVR  548

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCG  1067
             T   L I  +L+DL    ++ + VTLVP+ G
Sbjct  549   TALRLGITDLLEDLGAEADDSVLVTLVPRKG  579



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 120/224 (54%), Gaps = 10/224 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W++ ++L G+R   TD +WL + F+ YDEN +LVR+KV DCLD++ LGY YQD+
Sbjct  371   ANVDRMWSIWKSLVGERKDYTDTDWLDSLFLFYDENADLVRVKVRDCLDSKNLGYVYQDV  430

Query  624   PNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketed  797
               P   SK + P   K   +  + L  A  + P +LD+ +K  V RP    S ++   ++
Sbjct  431   DIPWLNSKPY-PRLKKRLRAYKNVL-FAKDVFPGSLDKLIKVMVPRPKKLRSQEENGHDE  488

Query  798   ketVLNFYVEYDETKN---IRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK  968
              E      +E  E K    ++FD  +NE+ D      +  EFAGSF+N   P +      
Sbjct  489   VEEEEILVIEGIEVKMDKFVKFDVLVNED-DEKKATADKTEFAGSFVNI--PHKHKPGKN  545

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               T   L I+++L+DL    +  + VTLVPK  G  + +  + I
Sbjct  546   MKTRLRLGISELLKDLGAEDDKNVLVTLVPKTKGGEIRIDEIKI  589



>ref|XP_006583805.1| PREDICTED: polyphenol oxidase II, chloroplastic-like isoform 
X1 [Glycine max]
Length=605

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 119/227 (52%), Gaps = 9/227 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQT--LGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ  617
             S+VDR W + +T  L G+R      +WL++SF  YDEN N VR+KV+DCLD++K+GY YQ
Sbjct  370   SNVDRMWNIWKTELLDGRRFDHKSDDWLESSFFFYDENKNYVRVKVKDCLDSKKMGYDYQ  429

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTATAI----LPATLDETVKFYVTRP-PAttstkk  782
              +  P     E    K       S P A+      LP  L+   +  V RP P + +  +
Sbjct  430   RVDLPWLLAGELIKPKKEIILLRSKPEASTFKTLQLPLPLESIERTNVKRPKPRSRNENE  489

Query  783   ketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEK  962
             +E E  E VL   VEYD T  +RFD ++N+  D N +  + +EFAGSF+        +  
Sbjct  490   EEEEGVEEVLVIDVEYDSTDGVRFDVFINDQGD-NEIGPQDSEFAGSFVTLPHSPHVNHN  548

Query  963   TKTTTTWSLEIAQVLQDLAL-GGENKIPVTLVPKCGGDSVTVKSVDI  1100
               T  ++ L +   L+DL +   ++ I VTL P  G   VT+K V I
Sbjct  549   NITKASFKLPLTYKLKDLGVTKDDDSISVTLAPIYGDKPVTIKDVRI  595



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 122/232 (53%), Gaps = 18/232 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  I+  +WL + F+ Y+EN  LVR+KV D L+++ LGY YQ++
Sbjct  359   SNVDRMWSIWKTLGGKRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEV  418

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAIL-----PATLDETVKFYVTRPPA  764
                     P PR  K      K       +  ++T I+     P  L+  +   V RP  
Sbjct  419   EIPWLQSKPTPRRAKLALSKIKKKLGVAHAAESSTQIVAGRAFPINLETKISTVVPRPKQ  478

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
                 KK++ E++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   P
Sbjct  479   KKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPS-GPDKTEFAGSFVSV--P  535

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +   K K  T   L +  +L+DL    +  + VTLVPK G  +V +  V I
Sbjct  536   HRHKHKKKINTILRLGLTDLLEDLDAEDDESVVVTLVPKYG--AVKIGGVKI  585


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 53/118 (45%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP   +  VR    A+D    EK++ A+  +K   LP D           
Sbjct  114  PPATKIIDFKLPAPGKLRVRPAAHAVDQAYIEKYSKAIELMKA--LPDDDPRSFKQQANV  171

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    +  QAGF       H    F  FHR YL+ YEK+L  +  D T  +P+WN
Sbjct  172  HCAY-CDGAYDQAGFPDLELQIHNSWLFFPFHRYYLYFYEKILGKLINDPTFALPFWN  228



>ref|XP_009773174.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=621

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 119/229 (52%), Gaps = 10/229 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGG+R   TDP++L  SF+ YDE   +VRI+V DCLD  +LGY YQ +
Sbjct  391   SNIDRLWSVWKTLGGRRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGV  450

Query  624   PN------PRSKKFEPFTGKN---PSSTGSSLPTATAILPATLDETVKFYVTRPPAttst  776
              N      PR++     +       +    + P+A  + P  LD  ++  V RP      
Sbjct  451   ANPWINSRPRARVSNALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPNKKKRN  510

Query  777   kkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGS  956
             KK++   +E ++   +E +    ++FD  +N+ +D   +    AEFAGSF+N      G 
Sbjct  511   KKEKDAKEEFLVVEGIELETDVFVKFDVLIND-EDETVISSNNAEFAGSFVNVPHHSHGK  569

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                K  T   L I ++L+DL    ++ + VT VPK G  +V +  V I 
Sbjct  570   SDKKRKTRLKLAITELLEDLDAEDDDHVVVTFVPKNGSGAVKIGGVKIV  618



>gb|KHN07288.1| Polyphenol oxidase, chloroplastic [Glycine soja]
Length=504

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 106/369 (29%), Positives = 174/369 (47%), Gaps = 42/369 (11%)
 Frame = +3

Query  72    DYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSLHQAGFSPG  251
             D+KLP  +   VR     + DE  EK+  A+++++E  LP D    +L   +      P 
Sbjct  146   DFKLPKGTPLRVRPPAQFVTDEYLEKYKLALKRMRE--LPSDDPRTNLPLPV------PN  197

Query  252   AHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPY-----WNSTLDSDLPDHAAYAPFSD  416
               FGA   +      F   K  + + G +    P+     W  T D   P+      F  
Sbjct  198   IVFGAKRASLFHGKTFFAGKQPE-LGGGTVELGPHTALHRW--TGDPRQPNKEDMGRF--  252

Query  417   MVSGMGNL----SSDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVED  581
               +G   +     ++VDR W + +T+  GKR    + +WL+T+F  YDEN NLV +KV+D
Sbjct  253   YSAGRDPIFYSHHANVDRMWNIWKTIPTGKRRDFKNRDWLETTFFFYDENKNLVSVKVKD  312

Query  582   CLDNEKLGYSYQDLPNP---------RSKKF------EPFTGKNPSSTGSSLPTATAILP  716
              LD +K+GY YQD+  P         R++K       + F G   +    + P++   L 
Sbjct  313   SLDLKKMGYVYQDVDIPWLQKRTKPKRTRKAKQVAFTQQFGGIREAMAAETGPSSKFPL-  371

Query  717   ATLDETVKFYVTRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLE  896
               LD  V   V RP    S K +E +++  V++  +E+D   +++FD Y+ + +D   + 
Sbjct  372   TLLDSKVTLLVKRPKQLRSKKDREEQEEVLVID-GIEFDGDNDVKFDVYITD-EDVKEIG  429

Query  897   VEMAEFAGSFINFAWPRQG-SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGD  1073
              E  EFAGSF          +   K  T+ +L I  +L+DL    ++ I VTLVP+    
Sbjct  430   PENTEFAGSFATLGHSHSNMNMDKKIKTSLTLGITDLLEDLDAENDDSILVTLVPRSENV  489

Query  1074  SVTVKSVDI  1100
             ++T++S+ I
Sbjct  490   TITIQSIKI  498



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 126/235 (54%), Gaps = 18/235 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ + LG K   ++D +WL + F+ Y+EN  LVR+KV DCLD+ KLGY Y+D+
Sbjct  350   SNVDRMWSIWKNLGTKNKDLSDKDWLDSGFLFYNENAELVRVKVRDCLDSRKLGYVYEDV  409

Query  624   --------PNPRSKKFE-----PFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P PR  K +         K   +T       ++  P  L+  +   V+RP  
Sbjct  410   EIPWLKSRPTPRRTKQQRKAKAVGVAKAAGTTSLGKLVKSSEFPIQLESKISTVVSRPRQ  469

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSL--EVEMAEFAGSFINFA  938
                 KK++ +++E ++   +EY++   ++FD Y+N+  D + +    + +EFAGSF++  
Sbjct  470   KKRNKKEKEDEEEILVIEGIEYEKNAVVKFDVYMNDVGDDDDVLSGPDKSEFAGSFVSV-  528

Query  939   WPRQGSEK-TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P    EK  K+     L +  +L+DL    +  I VTLVP+ G  +VT+ S+ I
Sbjct  529   -PHTHKEKRNKSKGCLRLGLTDLLEDLEAEDDESIVVTLVPRFGAQTVTIGSIRI  582



>dbj|BAA85119.1| polyphenol oxidase-like protein [Solanum melongena]
Length=266

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 99/164 (60%), Gaps = 10/164 (6%)
 Frame = +3

Query  444  SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
            S+VDR W   + +GGKR  I+  +WL + F  +DEN N  R++V DCLD + +GY Y  +
Sbjct  108  SNVDRMWNEWKQIGGKRRDISQRDWLNSEFFFFDENKNPYRVRVRDCLDTKTMGYDYAPM  167

Query  624  PNPRSKKFEPFTGKNPSSTG----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkke  788
            P P  + F+P   K  +S+G    S+ P A+ + P A +D+ + F + RP ++ + ++K 
Sbjct  168  PTPW-RNFKP---KTKASSGKANTSAFPPASQVFPLAKMDKVITFSIKRPASSRTQQEKN  223

Query  789  tedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAG  920
             +++    N  ++YD  + +RFD +LN + + N+ E++ AEFAG
Sbjct  224  EKEEMLTFN-NIKYDNREYVRFDVFLNVDNNVNANELDKAEFAG  266



>dbj|BAP82256.1| polyphenol oxidase [Setaria italica]
 dbj|BAP82267.1| polyphenol oxidase [Setaria viridis]
Length=571

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 116/222 (52%), Gaps = 12/222 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W +   L     G TD +WL  +F+ YDE+  LVR++V DCLD   L ++YQD+
Sbjct  355   GNVDRMWYIWNGLRPGNTGFTDADWLDAAFLFYDEDARLVRVRVRDCLDPSALRFTYQDV  414

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          K PS TGS  P AT  LPATL +TV+  VTRP  + S ++KE E++ 
Sbjct  415   GLPW------LNAKPPSETGSPAP-ATGALPATLSQTVRVAVTRPRTSRSRREKEEEEEV  467

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKTT  974
               +      D  K ++FD ++N    + +     AE AGS     +   P +G    +T 
Sbjct  468   LCVEGIEVADHLKFVKFDVFVNVPSQSGAATPAAAECAGSVALTPHAVRPGEGGRAVRTA  527

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +   I  +L D+   GE  I V+LVP+C GD+VTV  V I
Sbjct  528   ARFG--ICDLLDDIGADGEKTIVVSLVPRCAGDTVTVGGVRI  567



>ref|XP_003605686.1| Polyphenol oxidase [Medicago truncatula]
Length=479

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 114/232 (49%), Gaps = 40/232 (17%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVDHADYDLFKSL  227
            P S  I DYK+P+ ++ + VR+  + ++DE  +K+  A+   K   LP +     + ++ 
Sbjct  130  PNSTKIIDYKIPSSNQPLRVRQAANLVNDEYLQKYKKAIELTKA--LPSNDPRSFIQQAN  187

Query  228  HQAGFSPGA-------------HFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN--  362
                +  GA             H    F  FHR YL+ +E++L ++  D    +P+WN  
Sbjct  188  IHCAYCDGAYSQVGFPNLDLQVHNSWLFFPFHRWYLYFHERILGSLINDPAFALPFWNFD  247

Query  363  ---------------STL-----DSDLPDHAAYAPFSDMVSGMGNLS--SDVDRRWTVCQ  476
                           +T+     D+  P+H     F          S  S++DR W++ +
Sbjct  248  APNGMQFPSIENVPHNTIHTWSGDNRQPNHENMGNFYSAARDPVFFSHHSNIDRLWSIWK  307

Query  477  TLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLPNP  632
            TLGGKR    D +WL++ F+ YDEN NLV++ V+DCLD +KLGY YQD+  P
Sbjct  308  TLGGKRKDFNDKDWLESEFLFYDENKNLVKVNVKDCLDTQKLGYVYQDVDIP  359



>gb|KHN08552.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=563

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/304 (30%), Positives = 150/304 (49%), Gaps = 24/304 (8%)
 Frame = +3

Query  213   LFKSLHQAGFSPGAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWNSTLDSDLPDH  392
             +++ +   G +P +  G ++ A   + L      L+NV   +   V  W  T DS+ P+ 
Sbjct  271   MYRQVVSNGRTPTSFLGDAYHAGDELSLGAGAGSLENVPHGT---VHLW--TGDSNQPNF  325

Query  393   AAYAPFSDMVSG--MGNLSSDVDRRWTVCQ-TLGGKRAGITDPEWLQTSFVLYDENNNLV  563
                  F          +  S++DR W++ + TLGG+    TD +WL++ F+ YDEN NLV
Sbjct  326   EDMGTFYSAARDPIFYSHHSNLDRIWSIWKKTLGGR--DFTDSDWLESGFLFYDENKNLV  383

Query  564   RIKVEDCLDNEKLGYSYQDLPNPRSKKFEPFTGKNPSSTGSSLPTA----TAILPATLDE  731
             R+KV+DCLD  KLGY+YQD+  P S              G+    A        P  LD 
Sbjct  384   RVKVKDCLDERKLGYAYQDVDIPWSNSRPTPQRSRVQKVGTVAHVAETSRNVKFPLMLDS  443

Query  732   TVKFYVTRPPAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAE  911
              V   V RP      K+  ++ +E ++   +E+++   ++FD  +N  +D   ++ + +E
Sbjct  444   VVTTMVKRP------KRSRSKKEEILVVEGIEFEKNTPVKFDMIIN-GEDYKLIKPDNSE  496

Query  912   FAGSFINFAWPRQGSEKTKT-TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVK  1088
             FAGSF++   P     K K   T+  L +  VLQDL    ++ + VTLVP+ G   + ++
Sbjct  497   FAGSFVSV--PHSHKHKNKNIVTSLKLGLTDVLQDLGAENDDSVMVTLVPRFGKGRIKIR  554

Query  1089  SVDI  1100
             ++ I
Sbjct  555   NIKI  558



>dbj|BAP82255.1| polyphenol oxidase [Setaria italica]
 dbj|BAP82265.1| polyphenol oxidase [Setaria viridis]
 dbj|BAP82266.1| polyphenol oxidase [Setaria viridis]
Length=571

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 116/222 (52%), Gaps = 12/222 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W +   L     G TD +WL  +F+ YDE+  LVR++V DCLD   L ++YQD+
Sbjct  355   GNVDRMWYIWNGLRPGNTGFTDADWLDAAFLFYDEDARLVRVRVRDCLDPSALRFTYQDV  414

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          K PS TGS  P AT  LPATL +TV+  VTRP  + S ++KE E++ 
Sbjct  415   GLPW------LNAKPPSETGSPAP-ATGALPATLSQTVRVAVTRPRTSRSRREKEEEEEV  467

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKTT  974
               +      D  K ++FD ++N    + +     AE AGS     +   P +G    +T 
Sbjct  468   LCVEGIEVADHLKFVKFDVFVNVPSQSGAATPAAAECAGSVALTPHAVRPGEGGRAVRTA  527

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +   I  +L D+   GE  I V+LVP+C GD+VTV  V I
Sbjct  528   ARFG--ICDLLDDIGADGEKTIVVSLVPRCAGDTVTVGGVRI  567



>dbj|BAP82254.1| polyphenol oxidase [Setaria italica]
Length=571

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 116/222 (52%), Gaps = 12/222 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W +   L     G TD +WL  +F+ YDE+  LVR++V DCLD   L ++YQD+
Sbjct  355   GNVDRMWYIWNGLRPGNTGFTDADWLDAAFLFYDEDARLVRVRVRDCLDPSALRFTYQDV  414

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          K PS TGS  P AT  LPATL +TV+  VTRP  + S ++KE E++ 
Sbjct  415   GLPW------LNAKPPSETGSPAP-ATGALPATLSQTVRVAVTRPRTSRSRREKEEEEEV  467

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKTT  974
               +      D  K ++FD ++N    + +     AE AGS     +   P +G    +T 
Sbjct  468   LCVEGIEVADHLKFVKFDVFVNVPSQSGAATPAAAECAGSVALTPHAVRPGEGGRAVRTA  527

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +   I  +L D+   GE  I V+LVP+C GD+VTV  V I
Sbjct  528   ARFG--ICDLLDDIGADGEKTIVVSLVPRCAGDTVTVGGVRI  567



>ref|XP_008345878.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=353

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 119/223 (53%), Gaps = 11/223 (5%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQDL  623
             +VDR W + +TLGGKR   TD +WL   F+ YDEN  LV  KV D +   K L Y+Y+ +
Sbjct  133   NVDRMWNIWKTLGGKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPV  192

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI---LPATLDETVKFYVTRPPAttstkkkete  794
               P    F   T + P +   +  +AT +    PAT D      V RP     TKK+++ 
Sbjct  193   SVPWL--FSKPTARKPRNKTKAKVSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSN  250

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSEKTKT  971
             ++E ++   +E++  + ++FD ++N+  DA SL   + +EFAGSF++   P      TKT
Sbjct  251   EEEVLIIKDIEFESNEAVKFDVFIND--DAESLSRKDKSEFAGSFVHV--PHNQKTGTKT  306

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T   L I  +L+DL +  ++ + VTLVP+     +TV    I
Sbjct  307   KTNLKLGITDLLEDLGVEDDSSVLVTLVPRVSNSPITVGGFKI  349



>ref|XP_004170849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cucumis 
sativus]
Length=340

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 105/228 (46%), Gaps = 24/228 (11%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             ++VDR W + Q +  +    TDP+WL +SFVLYDEN   VRIKV  CLD++ LGY YQD+
Sbjct  122   ANVDRMWNIWQKMKDQPRDHTDPDWLNSSFVLYDENRKAVRIKVSQCLDSKILGYVYQDV  181

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstk  779
                     P PR  ++E   G  P          T   P  L   +   V RP   +  +
Sbjct  182   KIPWKDNPPIPRPNRWERRLGNLP---------PTIDFPQILSSDITTMVDRPEVASPEE  232

Query  780   kketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSE  959
             +    +   + +  VE+D T  + FD  LN   D   +     EF G+F N    R    
Sbjct  233   RINKNEVLVLED--VEFDPTLPLHFDVLLNVGDDGEDVRAGDIEFVGTFTNVPHGRMTHH  290

Query  960   KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKC-GGDSVTVKSVDI  1100
             KT      + +I Q    L L G+ K+ V +VP   GGD + +  + I
Sbjct  291   KTSLHFVLTKKIVQ----LGLEGDKKVAVKIVPNVNGGDRIKIGGIKI  334



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 124/228 (54%), Gaps = 12/228 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W + ++LG K   I DP+WL   F+ YDEN  LVR++V DCLDN+KLGY+Y+D+
Sbjct  377   SNVDRMWNIWKSLGTKNKDINDPDWLDAGFLFYDENAELVRVRVRDCLDNKKLGYTYEDV  436

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstk  779
                     P PR  K      K   +T       +   P +L+  ++  V RP     +K
Sbjct  437   EIPWLKTRPTPRRTK-AAGVAKAAETTSLGKLVGSKDFPVSLETKIRTVVPRPKQKKRSK  495

Query  780   kketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEM-AEFAGSFINFAWPRQGS  956
             K++ +++E ++   +E+D+   ++FD  +N+  D  +    + +EFAGSF++   P +  
Sbjct  496   KEKEDEEEILVIDGIEFDKDVAVKFDVCVNDVDDDEAPSGPIYSEFAGSFVSV--PHKHK  553

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             E  ++     L + ++L+DL    +  + VTLVP+    +V + S+ I
Sbjct  554   ENKRSKGCLRLGLTELLEDLGAEDDESVVVTLVPRFSSQAVKIGSIKI  601



>ref|XP_010100566.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82809.1| Polyphenol oxidase [Morus notabilis]
Length=586

 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 123/227 (54%), Gaps = 16/227 (7%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAG-ITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +VDR W++ + L GK+   ITDP+WL  +F+ YDEN  LVR+KV  CLD +KLGY Y+ +
Sbjct  365   NVDRMWSLWKQLPGKKKNDITDPDWLNATFLFYDENAKLVRVKVAGCLDTKKLGYVYEQV  424

Query  624   PNPRSKKFEPFTGKNPSSTGSSLP-------TATAILPATLDETVKFYVTRPPAttstkk  782
               P  KK          + G+++        T  +  P  L + +   V R P    +K 
Sbjct  425   DLPWLKKKPKSKKVAKLAVGAAIAAESTKGLTPLSAFPIALKKAITVKVPR-PKKGRSKA  483

Query  783   ketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEK  962
             ++ E++E ++   ++YD++  ++FD Y+N+  +A     E +EFAGSF+    P     K
Sbjct  484   EKEEEEEILVIEGIDYDKSTAVKFDVYVNDEDEAGP---EKSEFAGSFVTV--PHNTKNK  538

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              KT T   L I ++L+D+    +  + VTLVPK G  +VTV  V I 
Sbjct  539   EKTYTKLKLGITELLEDVGADDDEDVLVTLVPKSG--NVTVGGVKIV  583



>dbj|BAM15848.1| hypothetical protein [Portulaca oleracea]
Length=600

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 123/233 (53%), Gaps = 16/233 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W++ +TLG  R   TD +WL  SFV YDEN   V+I+V DCLD +KLGY+YQD+
Sbjct  366   SNIDRMWSIWKTLGANRVEFTDSDWLDASFVFYDENAQAVKIRVRDCLDTKKLGYTYQDV  425

Query  624   --------PNPRSKKFEPFTGKNPSSTGSSLPTATAI----LPATLDETVKFYVTRPPAt  767
                     P P+  +      K   +  ++ P +T+      P  LD T+K  + RP  +
Sbjct  426   DLPWLNSQPTPKRSRIATLFSKLKPAKATTHPPSTSTSPVKFPKPLDSTLKIDIQRPKKS  485

Query  768   tstkkketedketVLNFYVEYDETKNIRFDAYLNENKDAN-SLEVEMAEFAGSFINF-AW  941
              S K+K+ +++  V+   ++ D    ++FD Y+N+  D      +   E+AGSF N    
Sbjct  486   RSKKEKKLQEEVLVVEVELQSDVF--VKFDVYVNDEDDVPLKKTIVKTEYAGSFANVPHK  543

Query  942   PRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +   E  K  TT  L +  +++DL    ++ + VTLVP+ G +   +K V I
Sbjct  544   HKHKKEHRKMKTTLRLGLTDLIEDLGADDDDGVMVTLVPRSGKEVTIIKDVKI  596



>gb|AAC28935.1| polyphenol oxidase precursor [Prunus armeniaca]
Length=597

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 128/227 (56%), Gaps = 17/227 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQ-  617
             ++VDR W + +TLGGKR  ITD +WL   F+ YDEN  LVR+KV D L+ EK L Y+Y+ 
Sbjct  376   ANVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVRVKVRDSLEPEKQLRYNYEP  435

Query  618   -DLP----NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkk  782
               LP     P ++K      KN +    +    T+  PATL E     V RP     +KK
Sbjct  436   VSLPWLFTKPTARK-----TKNKTKAKVAATQLTSKFPATLVEVTTVEVARPKPRKRSKK  490

Query  783   ketedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSE  959
             ++ +++E ++   +E++ T+ ++FD ++N+  DA SL   + +EFAGSF++   P+  + 
Sbjct  491   EKVDEEELLIIKDIEFEGTEAVKFDVFIND--DAESLSRRDKSEFAGSFVHV--PQGKTT  546

Query  960   KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             K KT T   L I  +L+DL    ++ + VTLVP+     +T+    I
Sbjct  547   KAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIGGFKI  593



>dbj|BAM15846.1| hypothetical protein [Portulaca oleracea]
Length=597

 Score =   111 bits (278),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 121/231 (52%), Gaps = 15/231 (6%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL-  623
             +VDR W+V +TLG K     D ++L +SFV YDEN   VRI+V D LD +KLGY YQ + 
Sbjct  366   NVDRMWSVWRTLGPKNKNFKDSDFLDSSFVFYDENAKAVRIRVRDVLDTKKLGYEYQPVD  425

Query  624   -------PNPRSKKFEPFTGKNPSSTG---SSLPTATAILPATLDETVKFYVTRPPAtts  773
                    P PR  K +    K   +     S++   T   P  LD+ ++ ++ RP  + +
Sbjct  426   LPWLKSRPTPRRAKVKAVFNKVKDAVAAEPSTMDVPTVAFPKPLDKVIRTHLMRPQKSRT  485

Query  774   tkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEM-AEFAGSFINFAWPRQ  950
              + K+ E++  V+    +  E    +FD Y+N+  +  + E  +  E+AGSF+N     +
Sbjct  486   KRAKDDEEEVLVIEVESKAHEFS--KFDVYVNDEDEYLTKENRVRTEYAGSFVNVPHKHK  543

Query  951   -GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              G ++ K  TT    +  +++DL    +  I V LVP+ G +SV +KSV I
Sbjct  544   TGGKEHKMNTTLRFGLTDLIEDLGADDDEGIDVILVPRVGTESVVIKSVKI  594



>ref|XP_009408264.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   111 bits (277),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 121/222 (55%), Gaps = 5/222 (2%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +++DR W + + L  K     D +WL+ SF+ YDEN +LVR+ V+DCL+ + L Y+YQD+
Sbjct  364   ANIDRMWYLWKKLSRKHQDFNDSDWLKASFLFYDENADLVRVTVKDCLETDWLRYTYQDV  423

Query  624   PNP-RSKKFEPFTGKNPSSTGSSL-PTATAILPATLDETVKFYVTRPPAttstkkketed  797
               P  + +  P   K   +  SSL  TA    P TL+  VK  V RP    S K+KE E+
Sbjct  424   KIPWVNARPTPKLAKARKAASSSLKATAEVQFPVTLESPVKATVKRPKVGRSGKEKEDEE  483

Query  798   ketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP-RQGSEKTKTT  974
             +  ++   +E+D    I+FD ++N   + + +    +EFAGSF+N     +   ++ K  
Sbjct  484   EILIVE-GIEFDRDYFIKFDVFVNAT-EGDGITAGASEFAGSFVNVPHKHKHRKDENKLK  541

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T   L I  +L+D+    ++ + VT+VPK G   V+V  + I
Sbjct  542   TRLCLGITDLLEDIGAEDDDSVLVTIVPKAGKGKVSVGGLRI  583



>ref|XP_006377743.1| hypothetical protein POPTR_0011s10940g [Populus trichocarpa]
 gb|ERP55540.1| hypothetical protein POPTR_0011s10940g [Populus trichocarpa]
Length=432

 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = +3

Query  444  SDVDRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
            S+VDR WT+ +T+ GG R  I+D +WL + F+ Y+EN  LVR KV DCLDN +L Y+YQ+
Sbjct  201  SNVDRMWTIWKTIPGGTRRDISDRDWLNSEFIFYNENAELVRCKVRDCLDNRRLRYTYQN  260

Query  621  LPNP--RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkkete  794
            +  P  +SK      GK  + T ++L   TA  P  LD+T+   V+RP  + S K+KE E
Sbjct  261  VEIPWLKSKPIPRRLGKKAAETKTALTPITA-FPLVLDKTIVTVVSRPKKSRSRKEKEEE  319

Query  795  dketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTK  968
            D+  V+   +EYD  K  +FD ++N++ +  S + E  EFAGSF+N +       KT+
Sbjct  320  DEVLVIEG-IEYDNGKFEKFDVFINDDVEMPS-KPENTEFAGSFVNVSHKHAKKSKTR  375



>gb|AHX26180.1| polyphenol oxidase [Sorghum bicolor]
Length=554

 Score =   110 bits (276),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 116/223 (52%), Gaps = 13/223 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              ++DR W+V   L       TDP+WL  SF+ YDE   LVR++V DCLD   LGY+YQD+
Sbjct  337   GNIDRLWSVWNGLRAGNTNFTDPDWLNASFLFYDEEARLVRVRVRDCLDTAALGYTYQDV  396

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
                      P+    P++   S   A   LPATL+ TV+  VTRP  + + ++K+ E++ 
Sbjct  397   A-------LPWLNAKPTTETGSPAPAAGALPATLNRTVRVAVTRPRTSRTRQEKDAEEEV  449

Query  804   tVLNFYVEYDE-TKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKT  971
              V+      D  ++ ++FD ++NE +    +   +A+ AGS     +   P +G    KT
Sbjct  450   LVVEGIEVADHFSRFVKFDVFVNECQGGGGMGAAVAQCAGSVAMTPHLVRPGKGRGSVKT  509

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                +   I  +L  +   G+  I V+LVP+C GD VTV  V I
Sbjct  510   AARFG--ICDLLDSIGADGDKTIVVSLVPRCAGDMVTVGGVRI  550



>emb|CAG26911.1| polyphenol oxidase, partial [Solanum lycopersicum]
Length=182

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 101/186 (54%), Gaps = 11/186 (6%)
 Frame = +3

Query  501   ITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDLPNPRSKKFEPFTGKNPSST  680
             I + +WL + F  YDEN N  +++  DCLD +K+GY Y     P    +  F GK  +S 
Sbjct  2     IQNKDWLNSEFFFYDENGNPFKVRARDCLDTKKMGYDYHATATP----WRNFNGKTKASA  57

Query  681   G----SSLPTATAILP-ATLDETVKFYVTRPPAttstkkketedketVLNFYVEYDETKN  845
             G     S+P  + + P A LD+ + F + RP ++ + ++K  +++    N  ++YD    
Sbjct  58    GKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEVLTFN-AIKYDNRDY  116

Query  846   IRFDAYLNENKDANSLEVEMAEFAGSFINFAW-PRQGSEKTKTTTTWSLEIAQVLQDLAL  1022
             IRFD +LN + + N+ E++ AEFAGS+ +     R G  K   T T  L I ++L+D+ L
Sbjct  117   IRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTATATLRLAITELLEDIGL  176

Query  1023  GGENKI  1040
               E+ I
Sbjct  177   EDEDTI  182



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 118/223 (53%), Gaps = 11/223 (5%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQDL  623
             +VDR W V +TLGGKR   TD +WL   F+ YDEN  LV  KV D L  EK L Y+Y+ +
Sbjct  380   NVDRMWNVWKTLGGKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSLKPEKDLRYTYEPV  439

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI---LPATLDETVKFYVTRPPAttstkkkete  794
               P    F   T + P S   +   AT +    PAT D      V RP     TKK++ +
Sbjct  440   SVPWL--FTKPTARKPKSKTKAKVGATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKID  497

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSEKTKT  971
             ++E ++   +E++  + ++FD ++N+  DA SL   + +EFAGSF++   P      TK 
Sbjct  498   EEEVLIIKDIEFESNEAVKFDVFIND--DAESLSRKDKSEFAGSFVHV--PHNQKTGTKK  553

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T   L I  +L+DL +  ++ + VTLVP+     +T+    I
Sbjct  554   KTNLKLGITDLLEDLGVEDDSSVLVTLVPRVSNSPITIGGFKI  596



>ref|XP_008446626.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Cucumis 
melo]
Length=732

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 101/219 (46%), Gaps = 9/219 (4%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             +++DR W + +TL G     TDP+WL +SFV YDEN N VRI+V DCLD EKLGY YQ++
Sbjct  509   TNIDRLWNIWKTLDGNPKDHTDPDWLNSSFVFYDENKNAVRIEVSDCLDTEKLGYVYQEV  568

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
             P P           NP              P TL+  +   V RP           E   
Sbjct  569   PLPW-LLLNKIPSPNPWIRTEEPEPPIINFPQTLNSDITTMVDRP----EEAGSGEEVDV  623

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKTTTTW  983
              ++   VEYD T  + FD  +N   +A        EF GSF N        +K    T+ 
Sbjct  624   VLVLEDVEYDPTTRVHFDVLVNVVDEAQDRCAAFLEFVGSFKNIPHGLHHHDK----TSL  679

Query  984   SLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                I +V+Q L L  +  + V + P  GG+ VT+  + I
Sbjct  680   RFVITEVIQGLGLERDKNLAVKIEPMVGGEGVTLGGIKI  718



>ref|XP_008225003.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=597

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 124/226 (55%), Gaps = 17/226 (8%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQDL  623
             +VDR W + +TLGGKR  ITD +WL   F+ YDEN  LV  KV D L+ EK L Y+Y+  
Sbjct  377   NVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVNCKVRDSLEPEKQLRYNYEPA  436

Query  624   P------NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             P       P ++K      KN +    +    T+  PATLD      V RP     +KK+
Sbjct  437   PLPWLFTKPTARK-----TKNKTKAKVAATQLTSKFPATLDSKTTVEVARPKPRKRSKKE  491

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSEK  962
             + +++E ++   +E++ T+ ++FD ++N+  DA SL   + +EFAGSF++   P+  + K
Sbjct  492   KVDEEELLIIKDIEFEGTEAVKFDVFIND--DAESLSRRDKSEFAGSFVHV--PQGKTTK  547

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              KT T   L I  +L+DL    ++ + VTLVP+     +T+    I
Sbjct  548   AKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIGGFKI  593



>ref|XP_004171833.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis sativus]
Length=251

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 127/237 (54%), Gaps = 25/237 (11%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W+V +TLGG+R  + +PEWL  SF+ YDE    +R++V DCLD++ LGY YQ +
Sbjct  18    SNIDRLWSVWKTLGGRRQNLQNPEWLNASFIFYDEKAQPIRVRVRDCLDSKSLGYIYQPV  77

Query  624   --------PNP-RSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVT-RPPAtts  773
                     P P R++K          +  +  P+++ + PA     +KF +T + P +  
Sbjct  78    DLPWLQTRPTPRRAQKTSTVAFGIAPALAAGGPSSSRVKPA----NIKFPITVKSPVSVE  133

Query  774   t-------kkketedketVLNFY-VEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFI  929
                      KKE E++E VL  Y + +D    I+FD ++N+ +D   ++ +  EFAGSF+
Sbjct  134   VKRPKKSRSKKEKEEEEEVLVIYGIGFDPNNGIKFDVFIND-EDDKEIKPDNTEFAGSFV  192

Query  930   NFAWPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             N   P +   K K  T   + I + L+DL    ++ I VT++P+ G    ++  + I
Sbjct  193   NV--PHKHGHKKKVKTGLRVGITEELEDLEADNDDSIIVTILPRIGAGLFSIDGLKI  247



>gb|AAW58109.2| polyphenol oxidase [Prunus salicina var. cordata]
Length=597

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 125/226 (55%), Gaps = 17/226 (8%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQDL  623
             +VDR W + +TLGGKR  ITD +WL   F+ YDEN  LV  KV D L+ EK L Y+Y+  
Sbjct  377   NVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVNCKVRDSLEPEKQLRYNYEPA  436

Query  624   P------NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
             P       P ++K      KN +    +    T+  PATLD      V RP     +KK+
Sbjct  437   PLPWLFTKPTARK-----TKNKTKAKVAATQLTSKFPATLDSKTTVEVARPKPRKRSKKE  491

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSEK  962
             + +++E ++   +E++ T+ ++FD ++N+  DA SL   + +EFAGSF++   P+  ++K
Sbjct  492   KVDEEELLIIKDIEFEGTEAVKFDVFIND--DAESLSRRDKSEFAGSFVHV--PQGKTKK  547

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              KT T   L I  +L+DL    ++ + VTLVP+     +T+    I
Sbjct  548   AKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRISNSPITIGGFKI  593



>gb|ACJ04909.1| polyphenol oxidase [synthetic construct]
Length=600

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 126/230 (55%), Gaps = 15/230 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQD  620
             ++VDR WTV +TLGGKR    D +WL + F  YDEN  LV +KV+    + K    S Q+
Sbjct  371   ANVDRIWTVWKTLGGKRNDFKDSDWLNSEFTFYDENAQLVTVKVKREFGSSKNSATSTQN  430

Query  621   L--------PNPR-SKKFEPFTGKNPSSTGS-SLPTATAILPATLDETVKFYVTRPPAtt  770
             +        P+PR S  F     +   +  + +L +A  + P  LDE VK  V R P  +
Sbjct  431   VEIPWLNARPSPRISNFFRKIKNRAGIAMATETLDSAAIVFPRKLDEVVKVVVKR-PTKS  489

Query  771   stkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQ  950
              +++++ E++  V+   +E +   +++FD ++N++ +A S   E  EFAGSF+N   PR+
Sbjct  490   RSEREKEEEEGVVVVEGIEMERDVSVKFDVFINDDDEAAS-GPEKTEFAGSFVNV--PRK  546

Query  951   GSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                  K  T+  L I ++L+DL    +  + VTLVP+ G D+VT+  V I
Sbjct  547   HKHDKKIRTSLRLGITELLEDLEAEDDESVLVTLVPRYGSDAVTIGGVKI  596



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 126/234 (54%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W + +++G K   I D +WL T F+ YDEN  LVR+ V D LDN+KLGY+Y+D+
Sbjct  309   SNIDRMWNIWKSIGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDV  368

Query  624   --------PNPRSKKF-----EPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P PR  K           K   +T S    A    P  L+  +   V+RP  
Sbjct  369   EIPWLXSRPTPRRTKLARKAKAAGVAKAXETTSSGKVVAGKDFPINLETKIXTVVSRPKP  428

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLN--ENKDANSLEVEMAEFAGSFINFA  938
                +KK++ +++E ++   +E D+   ++FD Y+N  +++DA     + +EFAGSF++  
Sbjct  429   KKRSKKEKEDEEEILVIXGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSV-  487

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +  EK+K+     L +  +L+DL    +  + VTLVP+ G  +V + S+ I
Sbjct  488   -PHKQKEKSKSCL--RLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKI  538



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 121/232 (52%), Gaps = 18/232 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S+VDR W++ +TLGGKR  I+  +WL + F+ Y+EN  LVR+KV D L+++ LGY YQ++
Sbjct  359   SNVDRMWSIWKTLGGKRTDISHSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEV  418

Query  624   --------PNPRS-----KKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P PR       K     G   ++  S+   A    P  L+  +   V RP  
Sbjct  419   DIPWLQSKPTPRRAKLAVSKIAKKLGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQ  478

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWP  944
                 KK++ E++E ++   +E+D    ++FD Y+N+  D  S   +  EFAGSF++   P
Sbjct  479   KKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPS-GPDKTEFAGSFVSV--P  535

Query  945   RQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              +   K K  T   L +  +L+D+    +  + VTLVPK G  +V +  V I
Sbjct  536   HRHKHKKKINTILRLGLTDLLEDIDAEDDESVVVTLVPKYG--AVKIGGVKI  585


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 53/118 (45%), Gaps = 17/118 (14%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHIVRREYSALDDESREKFATAVRKLKERRLPVD-----------  197
            P +  I D+KLP   +  +R    A+D    EK++ A+  +K   LP D           
Sbjct  114  PPATKIIDFKLPAPGKLRIRPAAHAVDQAYIEKYSKAIELMKA--LPDDDPRSFKQQANV  171

Query  198  HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
            H  Y    +  QAGF       H    F  FHR YL+ YEK+L  +  D T  +P+WN
Sbjct  172  HCAY-CDGAYDQAGFPDLELQIHNSWLFFPFHRYYLYFYEKILGKLINDPTFALPFWN  228



>gb|ADG85002.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 117/229 (51%), Gaps = 18/229 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD-  620
              ++DR W V + L    A  TDP+WL  +F+ YDE    VR++V DCLD   L Y+YQD 
Sbjct  355   GNIDRLWHVWRGLRPSNADFTDPDWLDAAFLFYDEEARPVRVRVRDCLDTAALRYTYQDV  414

Query  621   -LP--NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
              LP  N R  K         +S G+  P  T+ LPATLD T++  VTRP  + S ++KE 
Sbjct  415   GLPWLNARPAK---------ASGGTPAPATTSTLPATLDRTIRVTVTRPRVSRSRREKED  465

Query  792   edketVLNFYVEYDE-TKNIRFDAYLNENKD--ANSLEVEMAEFAGSFINFAWPRQGSE-  959
             E++  V+      D   K I+FD  +NE +    ++        AGSF +     +  E 
Sbjct  466   EEEVVVVEGIEIADHFNKFIKFDVLVNEPEGGVGSTPATATGYCAGSFAHTPHMVRPEEM  525

Query  960   -KTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
              K    T     +  ++ D+   G+  + V+LVP+CGG+ VTV  V I+
Sbjct  526   RKGPVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSIS  574



>gb|ACB12083.1| polyphenol oxidase [Triticum monococcum]
Length=577

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 115/230 (50%), Gaps = 20/230 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD-  620
              ++DR W V + L       TDP+WL  +F+ YDE    VR++V DCLD   L Y+YQD 
Sbjct  355   GNIDRLWHVWRGLRPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDV  414

Query  621   -LP--NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
              LP  N R  K         +S G+  P  T  LPATLD T++  VTRP  + S ++K+ 
Sbjct  415   GLPWLNARPAK---------ASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDD  465

Query  792   edketVLNFYVEYDE-TKNIRFDAYLNENKDA--NSLEVEMAEFAGSFI---NFAWPRQG  953
             E++  V+      D   K I+FD  +NE +     +        AGSF    +   P + 
Sbjct  466   EEEVLVVEGIEIADHFNKFIKFDVLVNEPEGGVDGTPATATGYCAGSFAHTPHMVRPEE-  524

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             + K    T     +  ++ D+   G+  + V+LVP+CGG+ VTV  V I+
Sbjct  525   TRKGSVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSIS  574



>gb|ACB12082.1| polyphenol oxidase [Triticum monococcum subsp. aegilopoides]
Length=577

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 115/230 (50%), Gaps = 20/230 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD-  620
              ++DR W V + L       TDP+WL  +F+ YDE    VR++V DCLD   L Y+YQD 
Sbjct  355   GNIDRLWHVWRGLRPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDV  414

Query  621   -LP--NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
              LP  N R  K         +S G+  P  T  LPATLD T++  VTRP  + S ++K+ 
Sbjct  415   GLPWLNARPAK---------ASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDD  465

Query  792   edketVLNFYVEYDE-TKNIRFDAYLNENKDA--NSLEVEMAEFAGSFI---NFAWPRQG  953
             E++  V+      D   K I+FD  +NE +     +        AGSF    +   P + 
Sbjct  466   EEEVLVVEGIEIADHFNKFIKFDVLVNEPEGGVDGTPATATGYCAGSFAHTPHMVRPEE-  524

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             + K    T     +  ++ D+   G+  + V+LVP+CGG+ VTV  V I+
Sbjct  525   TRKGSVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSIS  574



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 127/235 (54%), Gaps = 19/235 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ--  617
             ++VDR WT+ +TLGGKR   TDP+WL ++F+ YDEN  LV++KV DCLD +KL Y+YQ  
Sbjct  377   ANVDRMWTIWKTLGGKRRDFTDPDWLDSAFLFYDENAELVKVKVRDCLDEKKLRYTYQSV  436

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSL-------------PTATAILPATLDETVKFYVTRP  758
             D+P  ++K       K        L               A +  P  LD   K  V RP
Sbjct  437   DIPWLKTKPTPVRKMKEALKEEEGLKDKIKERVLKLEKKIAVSEFPKQLDTAFKTVVKRP  496

Query  759   PAttstkkketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFA  938
               + S K+KE E++  V+   +E +    ++FD Y+N N+D  S   + +EFAGSF+N  
Sbjct  497   RKSRSKKEKEDEEEILVIE-KIELERDSVVKFDVYIN-NEDEPS--PDKSEFAGSFVNVP  552

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
                   +K +  T   L I ++L+DL    ++++ VT+VP+ GGD V +  + I 
Sbjct  553   HKHGKKKKKRVKTFLRLSITELLEDLETEDDDEVVVTIVPRLGGDLVIIGGIKIV  607


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 55/119 (46%), Gaps = 18/119 (15%)
 Frame = +3

Query  51   PFSGTITDYKLPTFSRHI-VRREYSALDDESREKFATAVRKLKERRLPVD----------  197
            P S  + D+KLP  +  + VR+    +DDE   K+  A+ ++K   LP D          
Sbjct  131  PTSSKVVDFKLPPQNEDMRVRQAAHLVDDEYVAKYQDAIARMKA--LPTDDPRNFTQQAN  188

Query  198  -HADYDLFKSLHQAGFSP---GAHFGASFVAFHRMYLFMYEKMLQNVAGDSTIFVPYWN  362
             H  Y    +  Q GF       H    F  FHR YL+ YE++L  + GD T  +P+WN
Sbjct  189  VHCAY-CDGAYDQVGFPDLELQVHNSWLFFPFHRYYLYFYERILGKLIGDPTFALPFWN  246



>gb|ACB12081.1| polyphenol oxidase [Triticum urartu]
Length=577

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 115/230 (50%), Gaps = 20/230 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD-  620
              ++DR W V + L       TDP+WL  +F+ YDE    VR++V DCLD   L Y+YQD 
Sbjct  355   GNIDRLWHVWRGLRPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDV  414

Query  621   -LP--NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
              LP  N R  K         +S G+  P  T  LPATLD T++  VTRP  + S ++K+ 
Sbjct  415   GLPWLNARPAK---------ASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDD  465

Query  792   edketVLNFYVEYDE-TKNIRFDAYLNENKDA--NSLEVEMAEFAGSFI---NFAWPRQG  953
             E++  V+      D   K I+FD  +NE +     +        AGSF    +   P + 
Sbjct  466   EEEVLVVEGIKIADHFNKFIKFDVLVNEPEGGVDGTPATATGYCAGSFAHTPHMVRPEE-  524

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             + K    T     +  ++ D+   G+  + V+LVP+CGG+ VTV  V I+
Sbjct  525   TRKGSVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSIS  574



>gb|AFO55218.1| chloroplast polyphenol oxidase II [Eriobotrya japonica]
Length=576

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 124/228 (54%), Gaps = 22/228 (10%)
 Frame = +3

Query  444   SDVDRRWTVCQ-TLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD  620
             S+VDR W++ +  LGG     TD  WL T F+ YDE  NLVR+KV D LD  KLGY Y +
Sbjct  356   SNVDRMWSIYKDKLGGTDIEKTD--WLDTEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDE  413

Query  621   ---LP----NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstk  779
                +P     P ++K    T K  ++  SS  T T   PATL +T+   VTRP AT  T 
Sbjct  414   NVSIPWLESKPTARK---STNKRKAAVSSSDLTTT--FPATLSDTISVEVTRPSATKRTA  468

Query  780   kketedketVLNFYVEYDETKNIRFDAYLNENKDANSLE-VEMAEFAGSFINFAWPRQGS  956
              ++    E ++   +E+   + ++FD Y+N+  DA+SL   + +EFAGSF++   P +  
Sbjct  469   AQKKAQDEVLVIKGIEFAGNETVKFDVYVND--DADSLAGKDKSEFAGSFVHV--PHKHK  524

Query  957   EKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             +  K  T   L I  +L++L    ++ + VTLVPK G   +T+    I
Sbjct  525   KNIK--TNLRLSITSLLEELGAETDSSLVVTLVPKVGKGPITIGGFSI  570



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 126/234 (54%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W + +++G K   I D +WL T F+ YDEN  LVR+ V D LDN+KLGY+Y+D+
Sbjct  377   SNIDRMWNIWKSIGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDV  436

Query  624   --------PNPRSKKF-----EPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P PR  K           K   +T S    A    P  L+  +   V+RP  
Sbjct  437   EIPWLKSRPTPRRTKLARKAKAAGVAKAAETTSSGKVVAGKDFPINLETKISTVVSRPKP  496

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLN--ENKDANSLEVEMAEFAGSFINFA  938
                +KK++ +++E ++   +E D+   ++FD Y+N  +++DA     + +EFAGSF++  
Sbjct  497   KKRSKKEKEDEEEILVIQGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSV-  555

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +  EK+K+     L +  +L+DL    +  + VTLVP+ G  +V + S+ I
Sbjct  556   -PHKQKEKSKSCL--RLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKI  606



>ref|XP_008371328.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=587

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 126/224 (56%), Gaps = 14/224 (6%)
 Frame = +3

Query  444   SDVDRRWTVCQ-TLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSY-Q  617
             S+VDR W++ +  LGG     TD  WL T F+ YDE  NLVR+KV D LD +KLGY Y +
Sbjct  367   SNVDRMWSIYKDKLGGTDIEKTD--WLDTEFLFYDEKKNLVRVKVCDSLDTKKLGYVYDE  424

Query  618   DLPNPRSKKFEPFTGKNPSSTGSSLPTA--TAILPATLDETVKFYVTRPPAttstkkket  791
              +P P  K  +P   K+ +   +++ ++  T   PATL +T+   VTRP AT  T  ++ 
Sbjct  425   KVPIPWLKS-KPTXRKSTNKRKAAVSSSDLTTTFPATLSBTISVEVTRPSATKRTTAQKK  483

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLE-VEMAEFAGSFINFAWPRQGSEKTK  968
                E ++   +E+   + ++FD Y+N+  DA+SL   + +EFAGSF++   P +  +  K
Sbjct  484   AQDEVLVIKGIEFAGNETVKFDVYVND--DADSLAGKDKSEFAGSFVHV--PHKHKKNIK  539

Query  969   TTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             T     L I  +L++L    ++ + VTLVPK G   +T+    I
Sbjct  540   TNL--RLSITSLLEELDAETDSSLVVTLVPKVGKGPITIGGFSI  581



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 119/223 (53%), Gaps = 11/223 (5%)
 Frame = +3

Query  447   DVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEK-LGYSYQDL  623
             +VDR W + +TLGGKR   TD +WL   F+ YDEN  LV  KV D +   K L Y+Y+ +
Sbjct  380   NVDRMWNIWKTLGGKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPV  439

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAI---LPATLDETVKFYVTRPPAttstkkkete  794
               P    F   T + P +   +  +AT +    PAT D      V RP     TKK+++ 
Sbjct  440   SVPWL--FSKPTARKPRNKTKAKVSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSN  497

Query  795   dketVLNFYVEYDETKNIRFDAYLNENKDANSL-EVEMAEFAGSFINFAWPRQGSEKTKT  971
             ++E ++   +E++  + ++FD ++N+  DA SL   + +EFAGSF++   P      TKT
Sbjct  498   EEEVLIIKDIEFESNEAVKFDVFIND--DAESLSRKDKSEFAGSFVHV--PHNQKTGTKT  553

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T   L I  +L+DL +  ++ + VTLVP+     +TV    I
Sbjct  554   KTNLKLGITDLLEDLGVEDDSSVLVTLVPRVSNSPITVGGFKI  596



>emb|CBZ41491.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=609

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 116/226 (51%), Gaps = 12/226 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDP---EWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSY  614
             ++VDR W + + +   R G  DP   +WL  S+V YDEN NLVR+   DC+D  K+GY Y
Sbjct  383   ANVDRMWKIWKDV--DRKGHKDPTAGDWLNASYVFYDENENLVRVYNRDCVDVRKMGYDY  440

Query  615   Q--DLPNPRSKKFEPFTGKN--PSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkk  782
             +  ++P  RS+      G N    S G        I P  L++ VK  V RP    + + 
Sbjct  441   ERSEIPWIRSRPTAHAKGANVAAKSVGIVQKVEDVIFPLKLNKIVKVLVKRPATNRTKED  500

Query  783   ketedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEK  962
             KE E++   +N  +++D  + ++F+ ++N+  D        +EFAGSF     P    +K
Sbjct  501   KEKENELLFVN-GIQFDGERFVKFNVFVNDVDDGVETTAASSEFAGSFAQL--PHNHGDK  557

Query  963   TKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
                 +  +  I ++L+D+   G+  I VTLVPK G D +T+  + I
Sbjct  558   MLMRSGVAFGITELLEDIEAEGDESILVTLVPKTGCDELTISEITI  603



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 126/234 (54%), Gaps = 19/234 (8%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W + +++G K   I D +WL T F+ YDEN  LVR+ V D LDN+KLGY+Y+D+
Sbjct  309   SNIDRMWNIWKSIGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDV  368

Query  624   --------PNPRSKKF-----EPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPA  764
                     P PR  K           K   +T S    A    P  L+  +   V+RP  
Sbjct  369   EIPWLKSRPTPRRTKLARKAKAAGVAKAXETTSSGKVVAGKDFPINLETKISTVVSRPKP  428

Query  765   ttstkkketedketVLNFYVEYDETKNIRFDAYLN--ENKDANSLEVEMAEFAGSFINFA  938
                +KK++ +++E ++   +E D+   ++FD Y+N  +++DA     + +EFAGSF++  
Sbjct  429   KKRSKKEKEDEEEILVIQGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSV-  487

Query  939   WPRQGSEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              P +  EK+K+     L +  +L+DL    +  + VTLVP+ G  +V + S+ I
Sbjct  488   -PHKQKEKSKSCL--RLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKI  538



>gb|AAT06525.1| polyphenol oxidase, partial [Triticum aestivum]
Length=416

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 115/230 (50%), Gaps = 20/230 (9%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQD-  620
              ++DR W V + L       TDP+WL  +F+ YDE    VR++V DCLD   L Y+YQD 
Sbjct  194   GNIDRLWHVWRGLRPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDV  253

Query  621   -LP--NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
              LP  N R  K         +S G+  P  T  LPATLD T++  VTRP  + S ++K+ 
Sbjct  254   GLPWLNARPAK---------ASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDE  304

Query  792   edketVLNFYVEYDE-TKNIRFDAYLNENKDA--NSLEVEMAEFAGSFI---NFAWPRQG  953
             E++  V+      D   K I+FD  +NE +     +        AGSF    +   P + 
Sbjct  305   EEEVLVVEGIEIADHFNKFIKFDVLVNEPEGGVDGTPATATGYCAGSFAHTPHMVRPEE-  363

Query  954   SEKTKTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDIT  1103
             + K    T     +  ++ D+   G+  + V+LVP+CGG+ VTV  V I+
Sbjct  364   TRKGSVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSIS  413



>ref|XP_007139960.1| hypothetical protein PHAVU_008G073200g [Phaseolus vulgaris]
 gb|ESW11954.1| hypothetical protein PHAVU_008G073200g [Phaseolus vulgaris]
Length=582

 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 120/225 (53%), Gaps = 15/225 (7%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
             S++DR W + +TLG  R   +D +WL + F  YDEN N VR+KV DC+D + LGY YQD+
Sbjct  361   SNLDRMWAIWKTLGEGRKDYSDEDWLDSEFFFYDENANFVRVKVRDCVDTKSLGYVYQDV  420

Query  624   ------PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkk  785
                     P S+K +    +  +   SS P      P  LD      V R     S ++K
Sbjct  421   DLAWLRTPPTSRKSKLLRQRKKAKVWSSKPRK---FPLVLDSVTSVIVKRAKKWRSKEEK  477

Query  786   etedketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKT  965
             E E++  V+   +E+   K ++FD ++++++D  S   E  EF GSF++    R      
Sbjct  478   EEEEEVLVIE-GIEFGSDKFVKFDIHVDDDEDRLSNPDE-TEFVGSFVSLYHGR----GH  531

Query  966   KTTTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
             K +T++ + I++VL++L    ++ + VTLVPK G   V + S+ I
Sbjct  532   KISTSFKVGISKVLENLEAEEDDDLLVTLVPKLGKGDVIIGSIKI  576



>dbj|BAP82257.1| polyphenol oxidase [Setaria italica]
Length=571

 Score =   108 bits (271),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 115/222 (52%), Gaps = 12/222 (5%)
 Frame = +3

Query  444   SDVDRRWTVCQTLGGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQDL  623
              +VDR W +   L     G TD +WL  +F+ YDE+  LVR++V DCLD   L ++YQD+
Sbjct  355   GNVDRMWYIWNGLRPGNTGFTDADWLDAAFLFYDEDARLVRVRVRDCLDPSALRFTYQDV  414

Query  624   PNPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkketedke  803
               P          K PS TGS  P AT  LPATL +TV+  VTRP  + S ++KE E++ 
Sbjct  415   GLPW------LNAKPPSETGSPAP-ATGALPATLSQTVRVAVTRPRTSRSRREKEEEEEV  467

Query  804   tVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFI---NFAWPRQGSEKTKTT  974
               +      D  K ++FD ++N    + +     AE AGS     +   P +G    +T 
Sbjct  468   LCVEGIEVADHLKFVKFDVFVNVPSQSGAATPAAAECAGSVALTPHAVRPGEGGRAVRTA  527

Query  975   TTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
               +   I  +L D+   GE  I V+LVP+C  D+VTV  V I
Sbjct  528   ARFG--ICDLLDDIGADGEKTIVVSLVPRCAVDTVTVGGVRI  567



>ref|XP_003552355.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=584

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 121/223 (54%), Gaps = 16/223 (7%)
 Frame = +3

Query  453   DRRWTVCQTL-GGKRAGITDPEWLQTSFVLYDENNNLVRIKVEDCLDNEKLGYSYQ--DL  623
             DR W + +TL GG++    DP+WL + F  YDEN N VR+KV DCLD +KLGY Y+  DL
Sbjct  366   DRLWGLWKTLEGGRKDYSDDPDWLDSEFYFYDENANFVRVKVRDCLDTKKLGYVYEDVDL  425

Query  624   P----NPRSKKFEPFTGKNPSSTGSSLPTATAILPATLDETVKFYVTRPPAttstkkket  791
             P     P S K +     N S   SS P+     P  LD      V RP    S ++KE 
Sbjct  426   PWLRTPPTSPKSKLLREANKSPLLSSKPSK---FPLVLDSITSTVVKRPKKLRSKEEKEQ  482

Query  792   edketVLNFYVEYDETKNIRFDAYLNENKDANSLEVEMAEFAGSFINFAWPRQGSEKTKT  971
             E++  V+   +E+   K ++FD ++++++D N  E +  EF G+F+N  +  QG      
Sbjct  483   EEEVLVIE-GIEFGSDKYVKFDVHIDDDED-NLSEPDQTEFVGTFVNL-FHGQGH---NI  536

Query  972   TTTWSLEIAQVLQDLALGGENKIPVTLVPKCGGDSVTVKSVDI  1100
              T++ + I++VL+ L    ++ + VTLVPK G   V +  + I
Sbjct  537   NTSFKVGISKVLECLEAEEDDVVLVTLVPKVGKGDVIIGGIKI  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3607125423950