BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86742_g1_i1 len=844 path=[822:0-843]

Length=844
                                                                      Score     E

ref|XP_009783358.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    374   2e-125   
ref|XP_011092647.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    373   4e-125   
ref|XP_009626848.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    371   3e-124   
emb|CAN62383.1|  hypothetical protein VITISV_028023                     369   2e-123   Vitis vinifera
ref|XP_002276013.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    369   2e-123   Vitis vinifera
gb|EYU32144.1|  hypothetical protein MIMGU_mgv1a008503mg                367   2e-122   
dbj|BAP47505.1|  O-acetylserine (thiol)lyase                            365   1e-121   
gb|KHG16843.1|  Cysteine synthase, chloroplastic/chromoplastic          361   3e-120   
gb|KHM99361.1|  Cysteine synthase, chloroplastic/chromoplastic          361   3e-120   
ref|NP_001235117.1|  OAS-TL3 cysteine synthase                          361   3e-120   
gb|AAN86822.1|  beta-cyanoalanine synthase                              358   1e-119   Betula pendula [white birch]
ref|NP_001280949.1|  L-3-cyanoalanine synthase 1, mitochondrial         359   2e-119   
ref|XP_007051769.1|  Cysteine synthase C1                               359   2e-119   
ref|XP_006364148.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    357   5e-119   
ref|XP_003534555.1|  PREDICTED: l-3-cyanoalanine synthase 1, mito...    357   8e-119   
ref|XP_011036588.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    357   1e-118   
sp|Q76MX2.1|CAS1_SOLTU  RecName: Full=Bifunctional L-3-cyanoalani...    356   2e-118   Solanum tuberosum [potatoes]
ref|XP_007139815.1|  hypothetical protein PHAVU_008G061100g             357   2e-118   
ref|XP_008244657.1|  PREDICTED: L-3-cyanoalanine synthase 1, mito...    356   2e-118   
ref|XP_004306760.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    356   3e-118   
gb|KHN29341.1|  Cysteine synthase, chloroplastic/chromoplastic          355   4e-118   
ref|XP_010326974.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    355   4e-118   
ref|XP_010087942.1|  Cysteine synthase                                  355   5e-118   
gb|AAP41851.1|  beta-cyanoalanine synthase                              355   5e-118   Hevea brasiliensis [jebe]
gb|AAP41852.1|  beta-cyanoalanine synthase                              355   6e-118   Hevea brasiliensis [jebe]
gb|ADO78230.1|  mitochondrial beta-cyanoalanine synthase                355   8e-118   
ref|XP_010055111.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    355   1e-117   
ref|NP_001280751.1|  L-3-cyanoalanine synthase 2, mitochondrial         354   1e-117   
ref|XP_007218145.1|  hypothetical protein PRUPE_ppa007292mg             354   2e-117   
gb|AIA22208.1|  beta-cyanoalanine synthase                              354   2e-117   
ref|XP_008343406.1|  PREDICTED: LOW QUALITY PROTEIN: L-3-cyanoala...    351   2e-117   
ref|XP_003623996.1|  Cysteine synthase                                  353   3e-117   
ref|XP_004138495.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    352   7e-117   
ref|XP_002518986.1|  cysteine synthase, putative                        352   1e-116   Ricinus communis
ref|XP_009367811.1|  PREDICTED: L-3-cyanoalanine synthase 2, mito...    352   1e-116   
ref|XP_004492762.1|  PREDICTED: l-3-cyanoalanine synthase 1, mito...    351   3e-116   
ref|XP_002301363.2|  hypothetical protein POPTR_0002s16220g             347   5e-116   Populus trichocarpa [western balsam poplar]
gb|AFK37031.1|  unknown                                                 350   6e-116   
emb|CDP08794.1|  unnamed protein product                                350   9e-116   
gb|KDP28610.1|  hypothetical protein JCGZ_14381                         348   2e-115   
gb|KDO86225.1|  hypothetical protein CISIN_1g021775mg                   346   2e-115   
ref|XP_006445004.1|  hypothetical protein CICLE_v10020662mg             348   3e-115   
ref|XP_011023311.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    348   5e-115   
ref|XP_002301362.1|  beta-cyanoalanine synthase family protein          347   7e-115   Populus trichocarpa [western balsam poplar]
ref|XP_008458207.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    347   7e-115   
ref|XP_009797225.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    346   1e-114   
gb|ABY64889.1|  beta-cyanoalanine synthase                              345   5e-114   Manihot esculenta [manioc]
ref|XP_010544747.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    340   4e-112   
ref|XP_010275651.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    339   1e-111   
ref|NP_001275044.1|  bifunctional L-3-cyanoalanine synthase/cyste...    336   6e-111   
ref|XP_010523763.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    337   8e-111   
ref|XP_002320141.2|  hypothetical protein POPTR_0014s08210g             337   8e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009628115.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    337   9e-111   
ref|XP_004229909.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    335   3e-110   
gb|KHG16844.1|  Cysteine synthase, chloroplastic/chromoplastic          334   1e-109   
ref|XP_009116808.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    332   6e-109   
ref|XP_010512491.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    332   6e-109   
ref|XP_010413402.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    332   7e-109   
emb|CDX71737.1|  BnaC08g31370D                                          331   1e-108   
ref|XP_010413401.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    331   1e-108   
gb|AEA86281.1|  chloroplast cysteine synthase                           326   5e-108   
ref|NP_191703.1|  cysteine synthase C1                                  329   9e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511880.1|  cysteine synthase, putative                        328   1e-107   Ricinus communis
ref|XP_002876613.1|  beta-substituted ala synthase 3_1                  328   3e-107   
emb|CDY43932.1|  BnaC04g21780D                                          325   5e-106   
ref|XP_009138771.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    323   1e-105   
pdb|3VBE|A  Chain A, Crystal Structure Of Beta-Cyanoalanine Synth...    322   2e-105   
gb|KFK42134.1|  hypothetical protein AALP_AA2G215500                    323   2e-105   
gb|ABF58693.1|  beta-cyanoalinine synthase                              316   4e-105   Fagus sylvatica
ref|XP_006402480.1|  hypothetical protein EUTSA_v10006044mg             322   5e-105   
pdb|3VC3|A  Chain A, Crystal Structure Of Beta-Cyanoalanine Synth...    320   1e-104   
gb|EPS57758.1|  cysteine synthase                                       314   1e-103   
ref|XP_010670142.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    318   1e-103   
ref|XP_010467018.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    317   3e-103   
sp|Q43153.1|CYSC_SPIOL  RecName: Full=Bifunctional L-3-cyanoalani...    314   4e-102   Spinacia oleracea
ref|XP_011034251.1|  PREDICTED: L-3-cyanoalanine synthase 1, mito...    304   3e-100   
gb|KEH23373.1|  cysteine synthase/L-3-cyanoalanine synthase             308   4e-100   
ref|XP_002883653.1|  beta-substituted ala synthase 3_1                  306   3e-99    
ref|XP_009401845.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    294   3e-94    
gb|AAV48542.1|  beta-cyanoalanine synthase                              291   7e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_010918745.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    291   7e-93    
ref|NP_001052135.1|  Os04g0165700                                       291   7e-93    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ29717.1|  hypothetical protein OsJ_13780                          291   1e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975070.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    290   1e-92    
gb|ABR17848.1|  unknown                                                 288   9e-92    Picea sitchensis
ref|XP_006827554.1|  hypothetical protein AMTR_s00009p00219590          287   2e-91    
ref|XP_002447473.1|  hypothetical protein SORBIDRAFT_06g001610          287   2e-91    Sorghum bicolor [broomcorn]
ref|NP_001136599.1|  cysteine synthase                                  285   3e-91    Zea mays [maize]
gb|ACG34624.1|  cysteine synthase                                       286   9e-91    Zea mays [maize]
ref|XP_008667338.1|  PREDICTED: cysteine synthase isoform X1            286   1e-90    
ref|XP_006653160.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    285   1e-90    
gb|ADG60234.1|  beta-cyanoalanine synthase                              284   4e-90    
dbj|BAJ98194.1|  predicted protein                                      284   5e-90    
gb|EMT13011.1|  Cysteine synthase, chloroplastic/chromoplastic          283   8e-90    
ref|XP_008801328.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    283   1e-89    
ref|XP_003579777.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    281   7e-89    
gb|EMS53577.1|  Cysteine synthase, chloroplastic/chromoplastic          278   3e-88    
gb|ABK23130.1|  unknown                                                 271   7e-86    Picea sitchensis
gb|ADG60235.1|  beta-cyanoalanine synthase                              273   9e-86    
gb|KCW71586.1|  hypothetical protein EUGRSUZ_E00118                     263   4e-83    
ref|XP_004138496.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    258   2e-81    
gb|ACH58417.1|  beta-cyanoalanine synthase 1                            253   3e-81    Prunus dulcis [sweet almond]
ref|XP_003623997.1|  Cysteine synthase                                  257   8e-81    
ref|XP_008244658.1|  PREDICTED: L-3-cyanoalanine synthase 1, mito...    253   2e-79    
ref|XP_009401140.1|  PREDICTED: cysteine synthase-like                  254   2e-78    
ref|XP_007153729.1|  hypothetical protein PHAVU_003G060200g             248   1e-76    
ref|XP_010242705.1|  PREDICTED: cysteine synthase-like                  248   5e-76    
ref|XP_010524184.1|  PREDICTED: cysteine synthase, chloroplastic/...    248   6e-76    
dbj|BAP47504.1|  O-acetylserine (thiol)lyase                            246   2e-75    
gb|KDP35151.1|  hypothetical protein JCGZ_10685                         246   3e-75    
ref|XP_010512249.1|  PREDICTED: cysteine synthase, mitochondrial        247   4e-75    
gb|KFK35189.1|  hypothetical protein AALP_AA5G251700                    247   4e-75    
gb|KHN32353.1|  Cysteine synthase, chloroplastic/chromoplastic          244   5e-75    
ref|XP_008800744.1|  PREDICTED: cysteine synthase-like                  246   6e-75    
ref|XP_003518876.1|  PREDICTED: cysteine synthase, chloroplastic/...    245   7e-75    
ref|XP_010930274.1|  PREDICTED: cysteine synthase                       245   7e-75    
gb|ABK23255.1|  unknown                                                 243   1e-74    Picea sitchensis
sp|Q9LJA0.2|CYSK2_ARATH  RecName: Full=Putative inactive cysteine...    238   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138900.1|  PREDICTED: cysteine synthase, mitochondrial        245   1e-74    
ref|XP_006290351.1|  hypothetical protein CARUB_v10017296mg             245   2e-74    
emb|CDY45790.1|  BnaC04g22760D                                          245   2e-74    
ref|XP_002878288.1|  O-acetylserine (thiol) lyase isoform C             245   2e-74    
emb|CDX89032.1|  BnaA04g01540D                                          245   3e-74    
ref|XP_010025067.1|  PREDICTED: cysteine synthase-like                  238   4e-74    
gb|KCW46035.1|  hypothetical protein EUGRSUZ_L00009                     243   4e-74    
ref|NP_001235131.1|  OAS-TL4 cysteine synthase                          243   4e-74    
ref|XP_002949438.1|  hypothetical protein VOLCADRAFT_89892              242   6e-74    
ref|XP_006442163.1|  hypothetical protein CICLE_v10020519mg             240   6e-74    
ref|XP_010526597.1|  PREDICTED: cysteine synthase, chloroplastic/...    243   6e-74    
ref|NP_001275189.1|  cysteine synthase, chloroplastic/chromoplastic     242   6e-74    
gb|KDO41593.1|  hypothetical protein CISIN_1g021570mg                   240   8e-74    
sp|O81155.1|CYSKP_SOLTU  RecName: Full=Cysteine synthase, chlorop...    242   1e-73    Solanum tuberosum [potatoes]
ref|XP_004244764.1|  PREDICTED: cysteine synthase, chloroplastic/...    242   1e-73    
emb|CAA47329.1|  cysteine synthase                                      242   1e-73    Spinacia oleracea
ref|XP_006351051.1|  PREDICTED: cysteine synthase isoform X1            242   1e-73    
sp|P31300.1|CYSKP_CAPAN  RecName: Full=Cysteine synthase, chlorop...    242   1e-73    Capsicum annuum
dbj|BAB20862.1|  plastidic cysteine synthase 1                          242   1e-73    Solanum tuberosum [potatoes]
dbj|BAG72098.1|  chloroplast cysteine synthase                          242   1e-73    Spinacia oleracea
ref|XP_010089187.1|  putative cysteine synthase                         241   1e-73    
gb|AIL49301.1|  cysteine synthase isoform 1                             242   1e-73    
gb|EPS66884.1|  cysteine synthase                                       238   2e-73    
sp|P32260.2|CYSKP_SPIOL  RecName: Full=Cysteine synthase, chlorop...    241   2e-73    Spinacia oleracea
ref|NP_851023.1|  cysteine synthase C                                   243   2e-73    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA03542.1|  cysteine synthase                                      241   2e-73    Spinacia oleracea
ref|XP_009768645.1|  PREDICTED: cysteine synthase, chloroplastic/...    241   2e-73    
ref|XP_006402661.1|  hypothetical protein EUTSA_v10005989mg             243   2e-73    
dbj|BAK38374.1|  cysteine synthase                                      239   2e-73    
ref|XP_010039322.1|  PREDICTED: cysteine synthase                       242   2e-73    
ref|XP_006442165.1|  hypothetical protein CICLE_v10020519mg             240   2e-73    
ref|XP_010534505.1|  PREDICTED: cysteine synthase, mitochondrial-...    241   2e-73    
emb|CAB71290.1|  O-acetylserine (thiol) lyase                           241   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191535.2|  cysteine synthase C                                   243   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007227711.1|  hypothetical protein PRUPE_ppa006674mg             241   2e-73    
ref|NP_851022.1|  cysteine synthase C                                   243   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416025.1|  PREDICTED: cysteine synthase-like                  241   3e-73    
gb|ABK23421.1|  unknown                                                 241   3e-73    Picea sitchensis
emb|CAB75795.1|  cysteine synthase                                      243   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KCW61659.1|  hypothetical protein EUGRSUZ_H04391                     238   4e-73    
ref|XP_002277485.1|  PREDICTED: cysteine synthase, chloroplastic/...    241   4e-73    Vitis vinifera
ref|XP_004309642.1|  PREDICTED: cysteine synthase, chloroplastic/...    241   4e-73    
emb|CAJ32461.1|  putative chloroplast cysteine synthase 1 precursor     240   4e-73    Nicotiana tabacum [American tobacco]
ref|XP_010469279.1|  PREDICTED: cysteine synthase, mitochondrial-...    242   5e-73    
gb|AGT40331.1|  O-acetylserine thiol-lyase                              240   5e-73    
ref|XP_009592252.1|  PREDICTED: cysteine synthase, chloroplastic/...    240   5e-73    
ref|XP_010413649.1|  PREDICTED: cysteine synthase, mitochondrial-...    241   5e-73    
ref|XP_008353283.1|  PREDICTED: cysteine synthase                       238   6e-73    
gb|KHN43214.1|  Cysteine synthase                                       237   6e-73    
gb|AHL84159.1|  cysteine synthase                                       240   7e-73    
ref|XP_004299115.1|  PREDICTED: cysteine synthase-like                  238   7e-73    
ref|XP_006858785.1|  hypothetical protein AMTR_s00066p00160090          239   7e-73    
ref|XP_010469278.1|  PREDICTED: cysteine synthase, mitochondrial-...    241   8e-73    
gb|AGV54667.1|  cysteine synthase                                       238   8e-73    
ref|XP_008373398.1|  PREDICTED: cysteine synthase-like                  240   8e-73    
ref|XP_009369846.1|  PREDICTED: cysteine synthase-like                  238   9e-73    
gb|EYU36680.1|  hypothetical protein MIMGU_mgv1a007743mg                239   1e-72    
ref|XP_006604835.1|  PREDICTED: cysteine synthase-like isoform X2       238   1e-72    
ref|XP_006492781.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   1e-72    
ref|XP_006442164.1|  hypothetical protein CICLE_v10020519mg             239   1e-72    
ref|XP_011073981.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   1e-72    
ref|XP_010922898.1|  PREDICTED: putative inactive cysteine syntha...    237   1e-72    
ref|XP_010101369.1|  Cysteine synthase                                  240   1e-72    
emb|CDY23400.1|  BnaC04g49280D                                          239   1e-72    
ref|XP_010672447.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   2e-72    
ref|XP_009372595.1|  PREDICTED: cysteine synthase-like                  239   2e-72    
gb|EYU36679.1|  hypothetical protein MIMGU_mgv1a007743mg                239   2e-72    
ref|NP_001276178.1|  cysteine synthase-like                             237   2e-72    
ref|XP_010508379.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   2e-72    
ref|XP_009394263.1|  PREDICTED: cysteine synthase                       237   2e-72    
ref|XP_010506279.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   2e-72    
ref|XP_011073980.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   2e-72    
ref|XP_008390894.1|  PREDICTED: cysteine synthase-like                  237   2e-72    
ref|XP_010517954.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   2e-72    
ref|XP_002881929.1|  hypothetical protein ARALYDRAFT_903778             239   2e-72    
ref|XP_006397550.1|  hypothetical protein EUTSA_v10001481mg             239   2e-72    
ref|XP_001755364.1|  predicted protein                                  238   2e-72    
gb|ABC86746.1|  cysteine synthase                                       234   2e-72    Vitis pseudoreticulata
ref|XP_008446019.1|  PREDICTED: cysteine synthase                       239   3e-72    
ref|XP_004167180.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   3e-72    
ref|XP_004135335.1|  PREDICTED: cysteine synthase, chloroplastic/...    239   3e-72    
gb|AFK39569.1|  unknown                                                 236   3e-72    
ref|NP_181903.1|  O-acetylserine (thiol) lyase (OAS-TL) isoform oasB    239   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002275990.1|  PREDICTED: cysteine synthase                       236   3e-72    Vitis vinifera
ref|XP_001764851.1|  predicted protein                                  239   3e-72    
ref|XP_007147139.1|  hypothetical protein PHAVU_006G099100g             236   3e-72    
ref|XP_003610723.1|  Cysteine synthase                                  236   3e-72    
ref|XP_004511361.1|  PREDICTED: cysteine synthase-like isoform X1       236   3e-72    
ref|XP_006295957.1|  hypothetical protein CARUB_v10025099mg             238   4e-72    
ref|XP_003608087.1|  Cysteine synthase                                  237   4e-72    
gb|KHN31018.1|  Cysteine synthase, chloroplastic/chromoplastic          238   4e-72    
gb|ACU19896.1|  unknown                                                 238   4e-72    Glycine max [soybeans]
ref|XP_010922897.1|  PREDICTED: cysteine synthase-like isoform X1       238   5e-72    
emb|CDY30438.1|  BnaA04g25390D                                          238   5e-72    
ref|XP_010256041.1|  PREDICTED: cysteine synthase                       236   5e-72    
dbj|BAJ91393.1|  predicted protein                                      238   5e-72    
gb|KHG11750.1|  Cysteine synthase, chloroplastic/chromoplastic          238   6e-72    
gb|AAX07221.1|  chloroplast cysteine synthase GCS2                      238   6e-72    Allium sativum
ref|XP_002524867.1|  cysteine synthase, putative                        238   6e-72    Ricinus communis
gb|EMT06609.1|  Cysteine synthase, chloroplastic/chromoplastic          238   7e-72    
ref|XP_008797336.1|  PREDICTED: cysteine synthase                       236   7e-72    
ref|XP_009412799.1|  PREDICTED: cysteine synthase-like isoform X1       236   8e-72    
ref|XP_009412800.1|  PREDICTED: probable S-sulfocysteine synthase...    236   1e-71    
ref|XP_009142225.1|  PREDICTED: cysteine synthase, chloroplastic/...    237   1e-71    
ref|XP_010695544.1|  PREDICTED: cysteine synthase                       237   1e-71    
emb|CDY17914.1|  BnaC04g03050D                                          237   1e-71    
gb|ACU21178.1|  unknown                                                 233   1e-71    Glycine max [soybeans]
ref|XP_009142968.1|  PREDICTED: cysteine synthase, chloroplastic/...    237   1e-71    
emb|CDX79804.1|  BnaA05g03520D                                          237   1e-71    
gb|KHN31439.1|  Cysteine synthase                                       234   2e-71    
ref|XP_007033724.1|  O-acetylserine lyase B isoform 2                   237   2e-71    
ref|XP_006826284.1|  hypothetical protein AMTR_s00004p00055080          234   2e-71    
emb|CDP08001.1|  unnamed protein product                                237   2e-71    
ref|XP_008223611.1|  PREDICTED: cysteine synthase-like                  237   2e-71    
ref|XP_003591034.1|  Cysteine synthase                                  234   2e-71    
emb|CAA57344.1|  cysteine synthase                                      236   2e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CAA57498.1|  cysteine synthase                                      237   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009348268.1|  PREDICTED: probable S-sulfocysteine synthase...    236   2e-71    
gb|AAA16973.1|  O-acetylserine-(thiol)-lyase                            236   3e-71    Spinacia oleracea
ref|XP_007033723.1|  O-acetylserine lyase B isoform 1                   236   3e-71    
gb|KDD74825.1|  pyridoxal-phosphate dependent enzyme                    233   3e-71    
ref|XP_011071587.1|  PREDICTED: cysteine synthase                       234   3e-71    
ref|XP_002512253.1|  cysteine synthase, putative                        234   3e-71    Ricinus communis
ref|XP_010277228.1|  PREDICTED: cysteine synthase                       234   3e-71    
ref|XP_009353050.1|  PREDICTED: probable S-sulfocysteine synthase...    235   4e-71    
emb|CDM84690.1|  unnamed protein product                                235   4e-71    
gb|KHN15751.1|  Cysteine synthase                                       233   4e-71    
gb|AFK41873.1|  unknown                                                 229   4e-71    
gb|KDO74574.1|  hypothetical protein CISIN_1g020501mg                   229   4e-71    
ref|XP_010466525.1|  PREDICTED: putative inactive cysteine syntha...    233   4e-71    
ref|NP_001045577.1|  Os01g0978100                                       235   5e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967885.1|  PREDICTED: cysteine synthase, chloroplastic/...    236   5e-71    
gb|KDP23623.1|  hypothetical protein JCGZ_23456                         233   6e-71    
ref|XP_006576133.1|  PREDICTED: cysteine synthase isoform X1            233   6e-71    
ref|NP_001238392.1|  cysteine synthase                                  233   6e-71    
ref|XP_006655669.1|  PREDICTED: cysteine synthase, chloroplastic/...    235   7e-71    
ref|XP_011032482.1|  PREDICTED: cysteine synthase-like                  233   7e-71    
ref|NP_001235628.1|  cysteine synthase                                  233   9e-71    
ref|XP_004505148.1|  PREDICTED: cysteine synthase, mitochondrial-...    235   9e-71    
dbj|BAJ90237.1|  predicted protein                                      234   1e-70    
ref|XP_008388647.1|  PREDICTED: cysteine synthase                       233   1e-70    
ref|XP_008443187.1|  PREDICTED: probable S-sulfocysteine synthase...    234   1e-70    
ref|XP_003608090.1|  Cysteine synthase                                  234   1e-70    
ref|XP_010906464.1|  PREDICTED: cysteine synthase                       232   1e-70    
ref|XP_006376449.1|  hypothetical protein POPTR_0013s13150g             234   1e-70    
ref|XP_010917723.1|  PREDICTED: cysteine synthase                       232   1e-70    
gb|KDO74573.1|  hypothetical protein CISIN_1g020501mg                   229   1e-70    
gb|KCW60735.1|  hypothetical protein EUGRSUZ_H03464                     228   2e-70    
ref|XP_003082455.1|  plastidic cysteine synthase 1 (ISS)                233   2e-70    
ref|XP_007034764.1|  Cysteine synthase                                  232   2e-70    
gb|ACC86121.1|  O-acetylserine(thiol)lyase                              233   2e-70    Knorringia sibirica
gb|KFK37199.1|  hypothetical protein AALP_AA4G226800                    234   2e-70    
ref|XP_004136612.1|  PREDICTED: probable cysteine synthase, chlor...    233   2e-70    
ref|XP_007029929.1|  Cysteine synthase 26 isoform 1                     233   2e-70    
gb|EPS66048.1|  cysteine synthase                                       231   2e-70    
ref|XP_007222677.1|  hypothetical protein PRUPE_ppa008606mg             231   3e-70    
ref|XP_011037378.1|  PREDICTED: cysteine synthase                       234   3e-70    
gb|ABQ02253.1|  O-acetylserine (thiol)lyase                             231   3e-70    Glycine soja [wild soybean]
emb|CEF99986.1|  Cysteine synthase K/M                                  232   3e-70    
ref|XP_001696139.1|  cysteine synthase                                  234   3e-70    Chlamydomonas reinhardtii
emb|CDM81371.1|  unnamed protein product                                233   3e-70    
ref|XP_008224312.1|  PREDICTED: cysteine synthase-like                  231   3e-70    
ref|XP_006382750.1|  hypothetical protein POPTR_0005s05040g             231   4e-70    
ref|XP_003568980.1|  PREDICTED: cysteine synthase-like                  233   4e-70    
sp|Q00834.1|CYSK_SPIOL  RecName: Full=Cysteine synthase; AltName:...    231   4e-70    
gb|KDO74572.1|  hypothetical protein CISIN_1g020501mg                   229   5e-70    
ref|XP_008391729.1|  PREDICTED: probable S-sulfocysteine synthase...    232   5e-70    
gb|KDP40178.1|  hypothetical protein JCGZ_02176                         231   5e-70    
ref|NP_001140754.1|  uncharacterized protein LOC100272829               233   6e-70    
ref|XP_011090729.1|  PREDICTED: cysteine synthase                       230   6e-70    
ref|XP_009383903.1|  PREDICTED: cysteine synthase                       230   7e-70    
ref|XP_008779837.1|  PREDICTED: cysteine synthase-like                  227   7e-70    
ref|XP_010532551.1|  PREDICTED: cysteine synthase                       230   8e-70    
ref|XP_006437261.1|  hypothetical protein CICLE_v10031768mg             231   8e-70    
ref|XP_007143261.1|  hypothetical protein PHAVU_007G057600g             230   8e-70    
gb|KFM23526.1|  Cysteine synthase, chloroplastic/chromoplastic          230   9e-70    
ref|XP_006291669.1|  hypothetical protein CARUB_v10017827mg             228   9e-70    
gb|ABF98863.1|  Cysteine synthase, putative, expressed                  228   1e-69    
ref|XP_007030649.1|  Cysteine synthase isoform 1                        230   1e-69    
ref|XP_011032479.1|  PREDICTED: cysteine synthase-like                  230   1e-69    
gb|EYU41484.1|  hypothetical protein MIMGU_mgv1a010001mg                230   1e-69    
ref|NP_001242884.1|  uncharacterized protein LOC100775420               229   1e-69    
ref|XP_004302011.1|  PREDICTED: cysteine synthase-like                  229   1e-69    
ref|XP_006588424.1|  PREDICTED: uncharacterized protein LOC100775...    229   1e-69    
ref|XP_002517133.1|  cysteine synthase, putative                        229   1e-69    
ref|XP_010243903.1|  PREDICTED: putative inactive cysteine syntha...    230   1e-69    
ref|XP_006484796.1|  PREDICTED: probable S-sulfocysteine synthase...    231   1e-69    
gb|AAR87660.1|  beta-cyanoalanine synthase                              223   1e-69    
ref|XP_001691935.1|  cysteine synthase                                  231   1e-69    
gb|KDO53281.1|  hypothetical protein CISIN_1g020528mg                   226   1e-69    
ref|XP_004302010.1|  PREDICTED: cysteine synthase-like                  229   1e-69    
ref|XP_006829807.1|  hypothetical protein AMTR_s00119p00070790          230   1e-69    
ref|XP_006605279.1|  PREDICTED: cysteine synthase isoform X1            229   1e-69    
ref|XP_001691936.1|  cysteine synthase                                  230   1e-69    
gb|KDO46619.1|  hypothetical protein CISIN_1g0157782mg                  228   2e-69    
ref|XP_010488274.1|  PREDICTED: putative inactive cysteine syntha...    229   2e-69    
ref|XP_008370676.1|  PREDICTED: cysteine synthase-like                  229   2e-69    
gb|AAC27794.1|  putative O-acetylserine(thiol)lyase precursor           230   2e-69    
ref|XP_002457554.1|  hypothetical protein SORBIDRAFT_03g009260          232   2e-69    
ref|XP_010024285.1|  PREDICTED: cysteine synthase                       229   2e-69    
ref|XP_006650579.1|  PREDICTED: cysteine synthase-like isoform X1       229   2e-69    
gb|KDO46618.1|  hypothetical protein CISIN_1g0157782mg                  228   2e-69    
gb|KHG07476.1|  Cysteine synthase                                       229   2e-69    
ref|XP_010041625.1|  PREDICTED: cysteine synthase-like isoform X2       229   2e-69    
ref|NP_001238411.1|  cysteine synthase                                  229   2e-69    
ref|XP_006419940.1|  hypothetical protein CICLE_v10005422mg             229   2e-69    
gb|KDO74567.1|  hypothetical protein CISIN_1g020501mg                   229   2e-69    
ref|XP_011003785.1|  PREDICTED: cysteine synthase-like isoform X1       229   2e-69    
ref|XP_002868245.1|  O-acetylserine (thiol) lyase (oas-tl) isofor...    229   2e-69    
ref|XP_010435053.1|  PREDICTED: cysteine synthase 1-like                229   2e-69    
ref|XP_010511384.1|  PREDICTED: putative inactive cysteine syntha...    229   2e-69    
gb|KDO74571.1|  hypothetical protein CISIN_1g020501mg                   229   2e-69    
ref|XP_004496722.1|  PREDICTED: cysteine synthase-like                  229   2e-69    
ref|XP_010041618.1|  PREDICTED: cysteine synthase-like isoform X1       229   3e-69    
ref|XP_010036270.1|  PREDICTED: probable S-sulfocysteine synthase...    232   3e-69    
ref|XP_010243902.1|  PREDICTED: probable S-sulfocysteine synthase...    230   3e-69    
gb|ACX70136.1|  O-acetylserine(thiol)lyase isoform A6                   229   3e-69    
gb|ABW24494.1|  O-acetylserine(thiol)-lyase                             229   3e-69    
ref|XP_010413403.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    227   4e-69    
dbj|BAP47503.1|  O-acetylserine (thiol)lyase                            228   4e-69    
gb|ACU18650.1|  unknown                                                 226   4e-69    
gb|AFK33382.1|  unknown                                                 228   4e-69    
ref|XP_006437262.1|  hypothetical protein CICLE_v10031768mg             230   5e-69    
ref|XP_006284124.1|  hypothetical protein CARUB_v10005256mg             228   5e-69    
emb|CDY42795.1|  BnaC01g22710D                                          228   5e-69    
ref|XP_005650235.1|  cysteine synthase                                  229   6e-69    
gb|ABH11017.1|  cysteine synthase                                       224   6e-69    
ref|NP_001051262.1|  Os03g0747800                                       228   6e-69    
ref|XP_010449974.1|  PREDICTED: cysteine synthase 1-like                228   6e-69    
ref|XP_006414628.1|  hypothetical protein EUTSA_v10025734mg             228   7e-69    
sp|O23735.1|CYSK2_BRAJU  RecName: Full=Cysteine synthase; Short=C...    228   7e-69    
gb|KDP23621.1|  hypothetical protein JCGZ_23454                         227   7e-69    
ref|XP_004247562.1|  PREDICTED: cysteine synthase                       228   7e-69    
emb|CDY09039.1|  BnaC08g09930D                                          227   8e-69    
gb|KEH43875.1|  O-acetylserine (thiol) lyase                            228   8e-69    
ref|XP_010440376.1|  PREDICTED: cysteine synthase 1                     228   8e-69    
ref|XP_006382748.1|  O-acetylserine (thiol)lyase family protein         228   9e-69    
ref|XP_010512773.1|  PREDICTED: probable S-sulfocysteine synthase...    230   1e-68    
ref|XP_008796758.1|  PREDICTED: cysteine synthase                       228   1e-68    
sp|O23733.1|CYSK1_BRAJU  RecName: Full=Cysteine synthase; Short=C...    227   1e-68    
emb|CDY50768.1|  BnaAnng10750D                                          227   1e-68    
ref|XP_009124216.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    228   1e-68    
ref|XP_009107806.1|  PREDICTED: cysteine synthase                       227   1e-68    
ref|XP_011032502.1|  PREDICTED: cysteine synthase-like isoform X2       227   1e-68    
ref|XP_011032499.1|  PREDICTED: cysteine synthase-like isoform X1       227   1e-68    
gb|AAR18402.1|  cysteine synthase                                       227   1e-68    
ref|XP_004287207.1|  PREDICTED: probable cysteine synthase, chlor...    227   1e-68    
gb|AGI97002.1|  O-acetylserine (thiol)-lyase                            229   1e-68    
ref|XP_006664222.1|  PREDICTED: cysteine synthase-like                  227   1e-68    
ref|XP_010906459.1|  PREDICTED: cysteine synthase isoform X1            227   2e-68    
ref|XP_006389314.1|  hypothetical protein POPTR_0030s00360g             226   2e-68    
ref|XP_009784384.1|  PREDICTED: cysteine synthase isoform X2            227   2e-68    
pdb|2ISQ|A  Chain A, Crystal Structure Of O-Acetylserine Sulfhydr...    227   2e-68    
ref|XP_009148046.1|  PREDICTED: cysteine synthase                       227   2e-68    
ref|NP_193224.1|  O-acetylserine (thiol) lyase (OAS-TL) isoform A1      226   2e-68    
emb|CAA58893.1|  cysteine synthase                                      226   2e-68    
gb|KDO53280.1|  hypothetical protein CISIN_1g020528mg                   226   2e-68    
ref|XP_006433058.1|  hypothetical protein CICLE_v10001835mg             226   2e-68    
emb|CDY41911.1|  BnaC05g46930D                                          226   2e-68    
gb|ABG22098.1|  Cysteine synthase, putative, expressed                  226   2e-68    
ref|XP_007157127.1|  hypothetical protein PHAVU_002G045200g             226   2e-68    
ref|XP_002271966.2|  PREDICTED: cysteine synthase                       228   2e-68    
ref|XP_008674910.1|  PREDICTED: cysteine synthase-like isoform X1       228   2e-68    
ref|XP_010550178.1|  PREDICTED: cysteine synthase isoform X2            225   2e-68    
ref|XP_006360789.1|  PREDICTED: cysteine synthase isoform X1            226   2e-68    
ref|XP_010025073.1|  PREDICTED: cysteine synthase-like isoform X2       226   2e-68    
ref|XP_004302008.1|  PREDICTED: cysteine synthase-like                  226   3e-68    
ref|XP_007205548.1|  hypothetical protein PRUPE_ppa008600mg             226   3e-68    
ref|XP_008218185.1|  PREDICTED: cysteine synthase                       226   3e-68    
ref|NP_001146719.1|  cysteine synthase1                                 228   3e-68    
ref|XP_010025069.1|  PREDICTED: cysteine synthase-like isoform X2       226   3e-68    
ref|XP_010025068.1|  PREDICTED: cysteine synthase-like isoform X1       226   3e-68    
dbj|BAA93051.1|  cysteine synthase                                      226   3e-68    
ref|XP_008805650.1|  PREDICTED: putative inactive cysteine syntha...    223   3e-68    
ref|XP_009124213.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    228   4e-68    
ref|XP_010090277.1|  Cysteine synthase                                  226   4e-68    
ref|XP_010659934.1|  PREDICTED: cysteine synthase                       226   4e-68    
ref|XP_009610466.1|  PREDICTED: cysteine synthase                       226   5e-68    
ref|XP_010485711.1|  PREDICTED: probable S-sulfocysteine synthase...    228   5e-68    
ref|XP_004495780.1|  PREDICTED: cysteine synthase-like                  226   5e-68    
ref|XP_008218181.1|  PREDICTED: cysteine synthase-like isoform X2       226   5e-68    
ref|XP_008218180.1|  PREDICTED: cysteine synthase-like isoform X1       226   6e-68    
ref|XP_010550162.1|  PREDICTED: cysteine synthase isoform X1            225   6e-68    
ref|XP_004287206.1|  PREDICTED: probable cysteine synthase, chlor...    227   6e-68    
ref|XP_010463817.1|  PREDICTED: probable S-sulfocysteine synthase...    228   6e-68    
ref|XP_008455731.1|  PREDICTED: cysteine synthase isoform X2            225   7e-68    
ref|XP_002499947.1|  predicted protein                                  226   7e-68    
ref|NP_001235267.1|  cysteine synthase                                  225   7e-68    
ref|XP_010041577.1|  PREDICTED: cysteine synthase-like isoform X2       225   7e-68    
ref|XP_004495779.1|  PREDICTED: cysteine synthase-like                  225   8e-68    
ref|XP_003591038.1|  Cysteine synthase                                  225   8e-68    
ref|XP_002982693.1|  hypothetical protein SELMODRAFT_234035             224   8e-68    
ref|XP_008779550.1|  PREDICTED: cysteine synthase-like                  224   8e-68    
emb|CBI34221.3|  unnamed protein product                                225   8e-68    
ref|XP_007161905.1|  hypothetical protein PHAVU_001G1075001g            225   9e-68    
ref|XP_010558690.1|  PREDICTED: probable S-sulfocysteine synthase...    229   1e-67    
ref|XP_010025075.1|  PREDICTED: cysteine synthase                       224   1e-67    
ref|XP_010041572.1|  PREDICTED: cysteine synthase-like isoform X1       225   1e-67    
gb|EAY83966.1|  hypothetical protein OsI_39190                          227   1e-67    
ref|XP_003554061.1|  PREDICTED: probable S-sulfocysteine synthase...    226   1e-67    
ref|XP_002948674.1|  hypothetical protein VOLCADRAFT_58530              226   1e-67    
ref|XP_010025072.1|  PREDICTED: cysteine synthase-like isoform X1       226   1e-67    
ref|XP_009398530.1|  PREDICTED: cysteine synthase                       224   1e-67    
pdb|1Z7Y|A  Chain A, Crystal Structure Of The Arabidopsis Thalian...    224   1e-67    
ref|XP_010463893.1|  PREDICTED: probable S-sulfocysteine synthase...    227   1e-67    
gb|KHN34626.1|  Putative cysteine synthase, chloroplastic               226   1e-67    
ref|XP_001703301.1|  cysteine synthase                                  226   1e-67    
gb|KHG02272.1|  Cysteine synthase                                       224   2e-67    
gb|ABA99438.2|  Cysteine synthase, putative, expressed                  227   2e-67    
ref|XP_011003782.1|  PREDICTED: cysteine synthase                       224   2e-67    
ref|XP_007204360.1|  hypothetical protein PRUPE_ppa007201mg             226   2e-67    
gb|AES90286.2|  O-acetylserine (thiol) lyase                            225   2e-67    
gb|ACL54626.1|  unknown                                                 224   2e-67    
ref|XP_004970340.1|  PREDICTED: probable cysteine synthase, chlor...    226   2e-67    
ref|XP_003546824.1|  PREDICTED: cysteine synthase-like isoform X1       224   2e-67    
ref|XP_002512256.1|  cysteine synthase, putative                        224   3e-67    
ref|XP_009784383.1|  PREDICTED: cysteine synthase isoform X1            226   3e-67    
ref|XP_004963252.1|  PREDICTED: cysteine synthase-like isoform X3       224   3e-67    
ref|XP_003608089.1|  Cysteine synthase                                  226   3e-67    
ref|XP_008455725.1|  PREDICTED: cysteine synthase isoform X1            225   3e-67    
ref|XP_011015113.1|  PREDICTED: probable S-sulfocysteine synthase...    226   3e-67    
ref|NP_001078324.1|  cysteine synthase C1                               222   3e-67    
ref|NP_001274978.1|  cysteine synthase                                  223   4e-67    
ref|XP_007511301.1|  cysteine synthase                                  224   4e-67    
gb|EAZ21283.1|  hypothetical protein OsJ_36936                          223   4e-67    
ref|XP_005649760.1|  cysteine synthase A                                225   4e-67    
ref|XP_004963250.1|  PREDICTED: cysteine synthase-like isoform X1       224   4e-67    
tpg|DAA47605.1|  TPA: hypothetical protein ZEAMMB73_019937              223   4e-67    
ref|XP_003521872.2|  PREDICTED: probable S-sulfocysteine synthase...    224   5e-67    
gb|KCW84894.1|  hypothetical protein EUGRSUZ_B01722                     226   6e-67    
ref|NP_187013.1|  cysteine synthase 26                                  225   6e-67    
ref|XP_006408284.1|  hypothetical protein EUTSA_v10020845mg             225   7e-67    
ref|XP_006389317.1|  O-acetylserine (thiol)lyase family protein         223   7e-67    
ref|XP_010090922.1|  Cysteine synthase                                  223   7e-67    
emb|CDY29778.1|  BnaA01g18880D                                          222   9e-67    
ref|XP_002981222.1|  hypothetical protein SELMODRAFT_233668             222   9e-67    
gb|AAD23907.1|AF073695_1  cysteine synthase                             222   9e-67    
ref|NP_001067319.1|  Os12g0625000                                       222   9e-67    
sp|Q43317.1|CYSK_CITLA  RecName: Full=Cysteine synthase; Short=CS...    222   9e-67    
emb|CDY29946.1|  BnaC01g40620D                                          224   1e-66    
ref|XP_002311629.1|  O-acetylserine (thiol)lyase family protein         222   1e-66    
emb|CDO99063.1|  unnamed protein product                                222   1e-66    
gb|EEC71697.1|  hypothetical protein OsI_04195                          224   1e-66    
ref|XP_006644896.1|  PREDICTED: probable S-sulfocysteine synthase...    224   1e-66    
ref|XP_004302009.1|  PREDICTED: cysteine synthase-like                  222   1e-66    
ref|XP_010674891.1|  PREDICTED: cysteine synthase                       222   2e-66    
dbj|BAF02052.1|  cytosolic O-acetylserine(thiol)lyase                   226   2e-66    
ref|XP_009102062.1|  PREDICTED: probable S-sulfocysteine synthase...    223   2e-66    
gb|KCW61661.1|  hypothetical protein EUGRSUZ_H04394                     221   2e-66    
ref|XP_004493247.1|  PREDICTED: probable cysteine synthase, chlor...    223   2e-66    
ref|XP_003624755.1|  Cysteine synthase                                  223   2e-66    
ref|XP_010551723.1|  PREDICTED: cysteine synthase-like                  221   2e-66    
ref|XP_003564468.2|  PREDICTED: cysteine synthase-like                  223   3e-66    
ref|XP_006297802.1|  hypothetical protein CARUB_v10013838mg             223   3e-66    
ref|XP_002884400.1|  hypothetical protein ARALYDRAFT_896375             223   3e-66    
ref|XP_002946965.1|  hypothetical protein VOLCADRAFT_79370              223   4e-66    
gb|KDP39629.1|  hypothetical protein JCGZ_02649                         223   4e-66    
ref|XP_006288111.1|  hypothetical protein CARUB_v10001344mg             221   5e-66    
ref|XP_007030660.1|  Cysteine synthase D1 isoform 4                     218   5e-66    
ref|XP_011016617.1|  PREDICTED: cysteine synthase-like isoform X2       219   5e-66    
ref|XP_004230129.1|  PREDICTED: cysteine synthase                       220   6e-66    
ref|XP_010494068.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    219   6e-66    
gb|AES61290.2|  O-acetylserine (thiol) lyase                            220   7e-66    
ref|XP_007030661.1|  O-acetylserine lyase isoform 5                     218   7e-66    
gb|AAX07222.1|  cysteine synthase GCS3                                  219   9e-66    
ref|XP_010494067.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    219   1e-65    
ref|NP_001105469.1|  cysteine synthase precursor                        219   1e-65    
ref|XP_009418947.1|  PREDICTED: cysteine synthase-like                  219   1e-65    
sp|O81154.1|CYSK_SOLTU  RecName: Full=Cysteine synthase; AltName:...    219   1e-65    
gb|AAK76499.1|  putative cytosolic O-acetylserine(thiol)lyase           219   1e-65    
ref|XP_002512255.1|  cysteine synthase, putative                        217   1e-65    
gb|EMT25722.1|  Cysteine synthase                                       219   1e-65    
ref|XP_011026557.1|  PREDICTED: cysteine synthase                       219   2e-65    
ref|XP_011016616.1|  PREDICTED: cysteine synthase-like isoform X1       219   2e-65    
ref|XP_008669424.1|  PREDICTED: cysteine synthase-like                  219   2e-65    
gb|AGI97003.1|  O-acetylserine (thiol)-lyase                            219   2e-65    
ref|XP_006347804.1|  PREDICTED: cysteine synthase-like isoform X1       219   2e-65    
ref|XP_003591039.1|  Cysteine synthase                                  220   2e-65    
ref|XP_010236985.1|  PREDICTED: cysteine synthase                       219   2e-65    
sp|P38076.1|CYSK_WHEAT  RecName: Full=Cysteine synthase; AltName:...    219   2e-65    
ref|XP_007030659.1|  Cysteine synthase D1 isoform 3                     218   2e-65    
ref|XP_007030657.1|  Cysteine synthase D1 isoform 1                     218   3e-65    



>ref|XP_009783358.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nicotiana sylvestris]
Length=368

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = +2

Query  167  FIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLV  346
            F+K R   +++ + + F+T+ L   +  SF QR+RDLPR+ PGTN+K EVSQLIGKTPLV
Sbjct  4    FLKRRSIDVMKANNRLFSTEALATDSQSSFVQRLRDLPRHLPGTNIKSEVSQLIGKTPLV  63

Query  347  YLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMG  526
            YLNKV+EGCGAY+A KQEMMQPT+SIKDRPA AMI DAEKKGLISP +TTLIEPTSGNMG
Sbjct  64   YLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLISPGKTTLIEPTSGNMG  123

Query  527  ISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLEST  706
            ISMAFMAA+KGYKMVLTMPSYTS+ERRV MR FGADLV+TDPTKGMGGTVKKAY LLEST
Sbjct  124  ISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGADLVITDPTKGMGGTVKKAYDLLEST  183

Query  707  PNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            PNA MLQQFSNP NTQ+H+ETTGPEIWEDTQGNVDIFVMGI
Sbjct  184  PNAFMLQQFSNPANTQVHFETTGPEIWEDTQGNVDIFVMGI  224



>ref|XP_011092647.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Sesamum indicum]
Length=372

 Score =   373 bits (958),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 199/229 (87%), Gaps = 3/229 (1%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTT--QPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MAAL N +K R S    +  KFF+T     P   SPSFAQR+RDLP++ PGTN+K EVSQ
Sbjct  1    MAALSNLMKKR-SHFSIFKEKFFSTTASASPLVDSPSFAQRLRDLPKDLPGTNIKKEVSQ  59

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAEKKGLI+P +TTLI
Sbjct  60   LIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEKKGLITPGKTTLI  119

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGTVKK
Sbjct  120  EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKK  179

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            AY LLESTP+A MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIF+MGI
Sbjct  180  AYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTNGKVDIFIMGI  228



>ref|XP_009626848.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nicotiana tomentosiformis]
Length=368

 Score =   371 bits (952),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKT  337
            + +F+K R   +++ + + F+T+ L   +  SFAQR+RDLP+  PGTN+K EVSQLIGKT
Sbjct  1    MASFLKRRYIHVMKANNRLFSTETLATDSESSFAQRLRDLPKYLPGTNIKTEVSQLIGKT  60

Query  338  PLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSG  517
            PLVYLNKV+EGCGAY+A KQEMMQPT+SIKDRPA AMI DAEKKGLISP +TTLIEPTSG
Sbjct  61   PLVYLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLISPGETTLIEPTSG  120

Query  518  NMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALL  697
            NMGISMAFMAA+KGYKMVLTMPSYTS+ERRV MR FGADLV+TDPTKGMGGTVKKAY LL
Sbjct  121  NMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGADLVITDPTKGMGGTVKKAYDLL  180

Query  698  ESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            ESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDT+GNVDIFVMGI
Sbjct  181  ESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTRGNVDIFVMGI  224



>emb|CAN62383.1| hypothetical protein VITISV_028023 [Vitis vinifera]
Length=371

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 203/230 (88%), Gaps = 6/230 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC---KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVS  319
            MAAL +F K RKSS+   S    ++F+TQP+    SPSF+QRIRDLP++ PGTN+K EVS
Sbjct  1    MAALSSFFK-RKSSIPFTSLAIRRWFSTQPI--LDSPSFSQRIRDLPKDLPGTNIKKEVS  57

Query  320  QLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTL  499
            QLIGKTPLV+LNKVTEGCGAYVA KQEMMQPTASIKDRPALAMI DAE K LI+P +T L
Sbjct  58   QLIGKTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAEBKQLITPGKTVL  117

Query  500  IEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVK  679
            IEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGTVK
Sbjct  118  IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVK  177

Query  680  KAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KAY LLESTP+A MLQQFSNP NTQ+H+ETTGPEIWEDT+G VDIF+MGI
Sbjct  178  KAYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMGI  227



>ref|XP_002276013.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Vitis vinifera]
 emb|CBI40395.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 203/230 (88%), Gaps = 6/230 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC---KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVS  319
            MAAL +F K RKSS+   S    ++F+TQP+    SPSF+QRIRDLP++ PGTN+K EVS
Sbjct  1    MAALSSFFK-RKSSIPFTSLAIRRWFSTQPI--LDSPSFSQRIRDLPKDLPGTNIKKEVS  57

Query  320  QLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTL  499
            QLIGKTPLV+LNKVTEGCGAYVA KQEMMQPTASIKDRPALAMI DAE K LI+P +T L
Sbjct  58   QLIGKTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAEDKQLITPGKTVL  117

Query  500  IEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVK  679
            IEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGTVK
Sbjct  118  IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVK  177

Query  680  KAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KAY LLESTP+A MLQQFSNP NTQ+H+ETTGPEIWEDT+G VDIF+MGI
Sbjct  178  KAYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMGI  227



>gb|EYU32144.1| hypothetical protein MIMGU_mgv1a008503mg [Erythranthe guttata]
Length=371

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 199/232 (86%), Gaps = 10/232 (4%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQ--YSCKFF---TTQPLPGSASPSFAQRIRDLPRNTPGTNVKPE  313
            MAALM     ++S  L   Y C FF   T   +P   SPSFAQR+RDLP++ PGT +K E
Sbjct  1    MAALM-----KRSCKLSSVYKCNFFSSTTAGTIPLVDSPSFAQRLRDLPKDLPGTKIKKE  55

Query  314  VSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQT  493
            VSQLIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAE+KGLI+P +T
Sbjct  56   VSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAFAMITDAEEKGLITPGKT  115

Query  494  TLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGT  673
            TLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGT
Sbjct  116  TLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGT  175

Query  674  VKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            VKKAY LLE+TP++ MLQQFSNPVNTQ+H+ETTGPEIWEDT G VDIF+MGI
Sbjct  176  VKKAYQLLEATPDSFMLQQFSNPVNTQVHFETTGPEIWEDTNGKVDIFIMGI  227



>dbj|BAP47505.1| O-acetylserine (thiol)lyase [Gentiana triflora]
Length=372

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = +2

Query  152  AALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIG  331
            AAL N  K   S+   +  + F++QPL  + SPSF QR+RDLP++ PGTN+K E S LIG
Sbjct  4    AALANLCKRNSSNNSIFKTRLFSSQPLVEN-SPSFIQRLRDLPKDLPGTNIKKEASLLIG  62

Query  332  KTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPT  511
            KTPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPALAM  DAEKKGLI+P +T LIEPT
Sbjct  63   KTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMFNDAEKKGLITPGKTILIEPT  122

Query  512  SGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYA  691
            SGNMGISMAF+AA+KGYKMVLTMPSYTS+ERRV+MR FGADL+LTDPTKGMGGTVKKAY 
Sbjct  123  SGNMGISMAFIAAMKGYKMVLTMPSYTSLERRVSMRAFGADLILTDPTKGMGGTVKKAYD  182

Query  692  LLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            LLESTPNA MLQQFSNP NTQ H+ETTGPEIWEDT G VDIFVMGI
Sbjct  183  LLESTPNAFMLQQFSNPANTQAHFETTGPEIWEDTNGKVDIFVMGI  228



>gb|KHG16843.1| Cysteine synthase, chloroplastic/chromoplastic [Gossypium arboreum]
Length=371

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 198/229 (86%), Gaps = 4/229 (2%)
 Frame = +2

Query  149  MAALMNFIKAR--KSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MAAL +F++ R    + L  + +  +T+P+  S+S  F QR+RDLP++ PGT +K EVSQ
Sbjct  1    MAALRSFLRKRCLTCNELMMTRRLISTEPIIDSSS--FVQRLRDLPKDLPGTKIKREVSQ  58

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLV+LNKVTEGCGAY+A KQEMMQPT+SIKDRPA AMI DAEKK LISP +TTLI
Sbjct  59   LIGRTPLVFLNKVTEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKNLISPGKTTLI  118

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMAA+KGYKMVLTMPSYTSIERRVTMR FGADL+LTDPTKGMGGTVKK
Sbjct  119  EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSIERRVTMRAFGADLILTDPTKGMGGTVKK  178

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            AY LLESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  179  AYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTLGKVDIFVMGI  227



>gb|KHM99361.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=372

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC-KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQL  325
            MA+LM+ I  ++SS    +  + F+T       SPS AQRIRDLP++ PGTN+K  VSQL
Sbjct  1    MASLMSTILMQRSSSTSLAAGRLFSTTTATIIDSPSLAQRIRDLPKDLPGTNIKKHVSQL  60

Query  326  IGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIE  505
            IG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAE+K LI+P +TTLIE
Sbjct  61   IGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTLIE  120

Query  506  PTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKA  685
            PTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMRVFGA+L+LTDP KGMGGTVKKA
Sbjct  121  PTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRVFGAELILTDPAKGMGGTVKKA  180

Query  686  YALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            Y LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  181  YELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  228



>ref|NP_001235117.1| OAS-TL3 cysteine synthase [Glycine max]
 gb|ABQ88337.1| OAS-TL3 cysteine synthase [Glycine max]
 gb|ABQ88338.1| OAS-TL3 cysteine synthase [Glycine max]
Length=372

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC-KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQL  325
            MA+LM+ I  ++SS    +  + F+T       SPS AQRIRDLP++ PGTN+K  VSQL
Sbjct  1    MASLMSTILMQRSSSTSLAAGRLFSTTTATIIDSPSLAQRIRDLPKDLPGTNIKKHVSQL  60

Query  326  IGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIE  505
            IG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAE+K LI+P +TTLIE
Sbjct  61   IGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTLIE  120

Query  506  PTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKA  685
            PTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMRVFGA+L+LTDP KGMGGTVKKA
Sbjct  121  PTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRVFGAELILTDPAKGMGGTVKKA  180

Query  686  YALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            Y LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  181  YELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  228



>gb|AAN86822.1| beta-cyanoalanine synthase [Betula pendula]
Length=352

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            +  +TQPL  S  PSFAQRIRDLP++ PGTN+K EVSQLIG+TPLVYLNKVTEGCGAY+A
Sbjct  3    RMLSTQPLADS-DPSFAQRIRDLPKHVPGTNIKNEVSQLIGRTPLVYLNKVTEGCGAYIA  61

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
             KQEMMQPTASIKDRPA AM++DAEK+ LI+P +TTLIEPTSGNMGIS+AFMAA+KGYKM
Sbjct  62   VKQEMMQPTASIKDRPAYAMMMDAEKRNLITPGKTTLIEPTSGNMGISLAFMAAMKGYKM  121

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            VLTMPSYTS+ERRVTMR FGADLVLTDPTKGMGGTVKKAY LLESTPNA MLQQFSNPVN
Sbjct  122  VLTMPSYTSLERRVTMRAFGADLVLTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPVN  181

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQ  +ETTGPEIWEDT G VDIFVMGI
Sbjct  182  TQGAFETTGPEIWEDTNGQVDIFVMGI  208



>ref|NP_001280949.1| L-3-cyanoalanine synthase 1, mitochondrial [Malus domestica]
 sp|Q1KLZ2.1|CAS1_MALDO RecName: Full=L-3-cyanoalanine synthase 1, mitochondrial; Short=MdCAS1; 
Flags: Precursor [Malus domestica]
 gb|ABF13209.1| beta-cyanoalanine synthase 1 [Malus domestica]
Length=376

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/232 (75%), Positives = 200/232 (86%), Gaps = 7/232 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC--KFFTT---QPLPGSASPSFAQRIRDLPRNTPGTNVKPE  313
            MAAL +F+K R S +   +   K F+T   QPL  + SPSFAQRIR+LP++ PGT +K +
Sbjct  1    MAALRSFLKKRSSVLCNGAMRRKLFSTEVSQPL--TDSPSFAQRIRNLPKDLPGTQIKTQ  58

Query  314  VSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQT  493
            VSQLIG+TP+VYLNKVTEGCGAY+A KQEM QPTASIKDRPAL+MI DAE+KGLI+P +T
Sbjct  59   VSQLIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGET  118

Query  494  TLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGT  673
             LIEPTSGNMGISMAFMAA++GYKMVLTMPSYTS+ERRV MR FGADL+LTDPTKGMGGT
Sbjct  119  ILIEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGGT  178

Query  674  VKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            VKKAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  179  VKKAYDLLESTPNAYMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGI  230



>ref|XP_007051769.1| Cysteine synthase C1 [Theobroma cacao]
 gb|EOX95926.1| Cysteine synthase C1 [Theobroma cacao]
Length=384

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 197/229 (86%), Gaps = 5/229 (2%)
 Frame = +2

Query  149  MAALMNFIKARK--SSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MAAL +F+K R    + L  + +  +T+P+  S    FAQR+RDLP++ PGT +K EVSQ
Sbjct  1    MAALRSFLKKRSLTCNELMMARRLVSTEPIIESP---FAQRLRDLPKDLPGTKIKREVSQ  57

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLV+LNKVTEGCGAY+A KQEMMQPTASIKDRPA+AMI DAEKK LI+P +TTLI
Sbjct  58   LIGRTPLVFLNKVTEGCGAYIAVKQEMMQPTASIKDRPAMAMIADAEKKNLIAPGKTTLI  117

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMA +KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGTVKK
Sbjct  118  EPTSGNMGISMAFMATMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKK  177

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            AY LLESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  178  AYELLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTLGKVDIFVMGI  226



>ref|XP_006364148.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial-like [Solanum tuberosum]
Length=351

 Score =   357 bits (916),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +2

Query  239  SASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTA  418
            S+  SFAQR+RDLP+  PGTN+K +VSQLIGKTPLVYLNKV+EGCGAY+A KQEMMQPT+
Sbjct  11   SSESSFAQRLRDLPKYLPGTNIKTQVSQLIGKTPLVYLNKVSEGCGAYIAVKQEMMQPTS  70

Query  419  SIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSI  598
            SIKDRPA AMI DAEKKGLI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+
Sbjct  71   SIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSL  130

Query  599  ERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGP  778
            ERRVTMR FGADLV+TDPTKGMGGT+KKAY LLESTPNA MLQQFSNP NTQ H+ETTGP
Sbjct  131  ERRVTMRAFGADLVITDPTKGMGGTIKKAYNLLESTPNAYMLQQFSNPANTQAHFETTGP  190

Query  779  EIWEDTQGNVDIFVMGI  829
            EIWEDTQGNVDIFVMGI
Sbjct  191  EIWEDTQGNVDIFVMGI  207



>ref|XP_003534555.1| PREDICTED: l-3-cyanoalanine synthase 1, mitochondrial-like [Glycine 
max]
Length=373

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 195/229 (85%), Gaps = 2/229 (1%)
 Frame = +2

Query  149  MAALMNFI-KARKSSMLQYSCKF-FTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MA+LM+ I K R  S   ++ +  F+T       SPS AQRIRDLP++ PGTN+K  VSQ
Sbjct  1    MASLMSTILKQRSCSSSSHAGRLLFSTTTAAIVDSPSLAQRIRDLPKDLPGTNIKKHVSQ  60

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAE+K LI+P +TTLI
Sbjct  61   LIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTLI  120

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKK
Sbjct  121  EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKK  180

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            AY LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  181  AYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  229



>ref|XP_011036588.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Populus euphratica]
Length=373

 Score =   357 bits (915),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 198/232 (85%), Gaps = 8/232 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSM-----LQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPE  313
            MAAL + +K   SS+     L    + F+++    +ASPSFAQR+RDLP++ PGT +K +
Sbjct  1    MAALRSLLKKNSSSIPTCNELVRIRRLFSSE---AAASPSFAQRLRDLPKDLPGTKIKTQ  57

Query  314  VSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQT  493
            VSQLIGKTP+VYLNKVTEGCGAY+AAKQEM QPT+SIKDRPALAMI DAEKK LI+P +T
Sbjct  58   VSQLIGKTPIVYLNKVTEGCGAYIAAKQEMFQPTSSIKDRPALAMIEDAEKKNLIAPGKT  117

Query  494  TLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGT  673
            TLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGT
Sbjct  118  TLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMRAFGAELILTDPAKGMGGT  177

Query  674  VKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            VKKAY LLESTP A MLQQFSNP NTQIH+ETTGPEIWED+ G VDIFVMGI
Sbjct  178  VKKAYELLESTPGAFMLQQFSNPANTQIHFETTGPEIWEDSLGKVDIFVMGI  229



>sp|Q76MX2.1|CAS1_SOLTU RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase 1, mitochondrial; Flags: Precursor [Solanum tuberosum]
 dbj|BAB18760.1| beta-cyanoalanine synthase [Solanum tuberosum]
Length=351

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +2

Query  239  SASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTA  418
            S+  SFAQR+RDLP+  PGTN+K +VSQLIGKTPLVYLNKV+EGCGAY+A KQEMMQPT+
Sbjct  11   SSESSFAQRLRDLPKYLPGTNIKTQVSQLIGKTPLVYLNKVSEGCGAYIAVKQEMMQPTS  70

Query  419  SIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSI  598
            SIKDRPA AMI DAEKKGLI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+
Sbjct  71   SIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSL  130

Query  599  ERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGP  778
            ERRVTMR FGADLV TDPTKGMGGT+KKAY LLESTPNA MLQQFSNP NTQ H+ETTGP
Sbjct  131  ERRVTMRAFGADLVTTDPTKGMGGTIKKAYDLLESTPNAYMLQQFSNPANTQAHFETTGP  190

Query  779  EIWEDTQGNVDIFVMGI  829
            EIWEDTQGNVDIFVMGI
Sbjct  191  EIWEDTQGNVDIFVMGI  207



>ref|XP_007139815.1| hypothetical protein PHAVU_008G061100g [Phaseolus vulgaris]
 gb|ESW11809.1| hypothetical protein PHAVU_008G061100g [Phaseolus vulgaris]
Length=380

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 196/234 (84%), Gaps = 9/234 (4%)
 Frame = +2

Query  152  AALMNFI-KARKSSMLQYSC-------KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVK  307
            ++LM+ I K R SS    +        +FF+T       SPS AQRIR+LP++ PGTN+K
Sbjct  4    SSLMSIILKQRSSSHAAVAACYHPIMGRFFSTTATIVD-SPSLAQRIRELPKDLPGTNIK  62

Query  308  PEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPE  487
              VSQLIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAEKK LISP 
Sbjct  63   KHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAFAMITDAEKKNLISPG  122

Query  488  QTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMG  667
            +TTLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPTKGMG
Sbjct  123  KTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMG  182

Query  668  GTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            GTVKKAY LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  183  GTVKKAYELLENTPNAFMLQQFSNPANTQVHFETTGPEIWEDTNGEVDIFVMGI  236



>ref|XP_008244657.1| PREDICTED: L-3-cyanoalanine synthase 1, mitochondrial isoform 
X1 [Prunus mume]
Length=374

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 199/230 (87%), Gaps = 3/230 (1%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCK--FFTTQ-PLPGSASPSFAQRIRDLPRNTPGTNVKPEVS  319
            MAAL +F+K R + +   + +   F+TQ   P + SPSFAQR+R+LP++ PGT+VK EVS
Sbjct  1    MAALRSFLKKRSTLLCNEAVRKRLFSTQVSQPINDSPSFAQRVRNLPKDLPGTHVKTEVS  60

Query  320  QLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTL  499
            QLIG+TP+VYLNKVTEGCGAY+A KQEM QPT+SIKDRPAL+MI DAEK+GLI+P +T L
Sbjct  61   QLIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTSSIKDRPALSMINDAEKRGLITPGKTVL  120

Query  500  IEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVK  679
            +EPTSGNMGISMAFMAA++GYKMVLTMPSYTS+ERRV MR FGA+L+LTDP +GMGGTVK
Sbjct  121  VEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRAFGAELILTDPARGMGGTVK  180

Query  680  KAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KAY LLESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  181  KAYDLLESTPNAHMLQQFSNPANTQVHFETTGPEIWEDTDGQVDIFVMGI  230



>ref|XP_004306760.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=375

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 195/231 (84%), Gaps = 4/231 (2%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC----KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEV  316
            MA+L +F+K R +  +        + F+T   P + S SF +RIR+LP+  PGT++K EV
Sbjct  1    MASLTSFLKKRSTLSVCNEALRMKRLFSTTAQPIADSSSFVERIRNLPKALPGTHIKTEV  60

Query  317  SQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTT  496
            SQLIG+TPLVYLNKVTEGCGAY+A KQEM QPTASIKDRPALAM  DAEKKGLI+P  TT
Sbjct  61   SQLIGRTPLVYLNKVTEGCGAYIAVKQEMFQPTASIKDRPALAMFNDAEKKGLITPGVTT  120

Query  497  LIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTV  676
            LIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRV MR FGA+L+LTDPTKGMGGTV
Sbjct  121  LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGAELILTDPTKGMGGTV  180

Query  677  KKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KKAY LLESTPNA+MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  181  KKAYDLLESTPNALMLQQFSNPANTQVHFETTGPEIWEDTDGKVDIFVMGI  231



>gb|KHN29341.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=373

 Score =   355 bits (912),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 196/231 (85%), Gaps = 6/231 (3%)
 Frame = +2

Query  149  MAALMNFI-KARKSSMLQYSCKFFTTQPLPGSA---SPSFAQRIRDLPRNTPGTNVKPEV  316
            MA+LM+ I K R  S   ++ +  +  P   +A   SPS AQRIRDLP++ PGTN+K  V
Sbjct  1    MASLMSTILKQRSCSSSSHAGRLLS--PAATAAIVDSPSLAQRIRDLPKDLPGTNIKKHV  58

Query  317  SQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTT  496
            SQLIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAE+K LI+P +TT
Sbjct  59   SQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTT  118

Query  497  LIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTV  676
            LIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTV
Sbjct  119  LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTV  178

Query  677  KKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KKAY LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  179  KKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  229



>ref|XP_010326974.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Solanum lycopersicum]
Length=351

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +2

Query  239  SASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTA  418
            S+  SF QR+RDLP+  PGT +K +VSQLIGKTPLVYLNKV+EGCGAY+A KQEMMQPT+
Sbjct  11   SSEASFVQRLRDLPKYLPGTKIKTQVSQLIGKTPLVYLNKVSEGCGAYIAVKQEMMQPTS  70

Query  419  SIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSI  598
            SIKDRPA AMI DAEKKGLI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+
Sbjct  71   SIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSL  130

Query  599  ERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGP  778
            ERRVTMR FGADLV+TDPTKGMGGT+KKAY LLESTPNA MLQQFSNP NTQ+H+ETTGP
Sbjct  131  ERRVTMRAFGADLVITDPTKGMGGTIKKAYDLLESTPNAYMLQQFSNPANTQVHFETTGP  190

Query  779  EIWEDTQGNVDIFVMGI  829
            EIWEDTQGNVDIFVMGI
Sbjct  191  EIWEDTQGNVDIFVMGI  207



>ref|XP_010087942.1| Cysteine synthase [Morus notabilis]
 gb|EXB30864.1| Cysteine synthase [Morus notabilis]
Length=372

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 197/234 (84%), Gaps = 10/234 (4%)
 Frame = +2

Query  149  MAALMNFIK-------ARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVK  307
            MAAL +F++        R  SML    K F+ Q +  S S SF QR+RDLP++ PGT ++
Sbjct  1    MAALRSFLRRKPAITACRGDSMLLK--KLFSAQAVVDSPS-SFTQRLRDLPKDLPGTRIR  57

Query  308  PEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPE  487
             EVSQLIGKTP+VYLNKVTEGCGAYVA KQEM QPT+SIKDRPALAM+ DAEKK LI+P 
Sbjct  58   KEVSQLIGKTPIVYLNKVTEGCGAYVAVKQEMFQPTSSIKDRPALAMLNDAEKKNLITPG  117

Query  488  QTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMG  667
            +TTLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMG
Sbjct  118  KTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMG  177

Query  668  GTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            GTVKKAY LLESTP+A MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  178  GTVKKAYDLLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  231



>gb|AAP41851.1| beta-cyanoalanine synthase [Hevea brasiliensis]
Length=370

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MA L N +K +  +  + + + F +     + SPSFAQRIRDLP+N PGT +K EVSQLI
Sbjct  1    MATLRNLLKKKSLTSNELAIRRFVSSE-AAAESPSFAQRIRDLPKNLPGTKIKTEVSQLI  59

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            G+TPLVYLNK++EGCGAY+A KQEMMQPTASIKDRPA +MI DAEKK LI+P +T LIEP
Sbjct  60   GRTPLVYLNKMSEGCGAYIAVKQEMMQPTASIKDRPAFSMINDAEKKNLITPGKTVLIEP  119

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTM+ FGA+L++TDPTKGMGGTVKKAY
Sbjct  120  TSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMKAFGAELIVTDPTKGMGGTVKKAY  179

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLESTPNA MLQQFSNP N++IH+ETTGPEIWEDT G+VDIFVMGI
Sbjct  180  DLLESTPNAFMLQQFSNPANSKIHFETTGPEIWEDTLGHVDIFVMGI  226



>gb|AAP41852.1| beta-cyanoalanine synthase [Hevea brasiliensis]
Length=370

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MA L N +K +  +  + + + F +     + SPSFAQRIRDLP+N PGT +K EVSQLI
Sbjct  1    MATLRNLLKKKSLTSNELAIRRFVSSE-AAAESPSFAQRIRDLPKNLPGTKIKTEVSQLI  59

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            G+TPLVYLNK++EGCGAY+A KQEMMQPTASIKDRPA +MI DAEKK LI+P +T LIEP
Sbjct  60   GRTPLVYLNKMSEGCGAYIAVKQEMMQPTASIKDRPAFSMINDAEKKNLITPGKTVLIEP  119

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTM+ FGA+L++TDPTKGMGGTVKKAY
Sbjct  120  TSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMKAFGAELIVTDPTKGMGGTVKKAY  179

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLESTPNA MLQQFSNP N++IH+ETTGPEIWEDT G+VDIFVMGI
Sbjct  180  DLLESTPNAFMLQQFSNPANSKIHFETTGPEIWEDTLGHVDIFVMGI  226



>gb|ADO78230.1| mitochondrial beta-cyanoalanine synthase [Manihot esculenta]
Length=370

 Score =   355 bits (910),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 196/230 (85%), Gaps = 7/230 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSC---KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVS  319
            MA+L N +K  K+S+   +    +FF+++      SPSFA +IRDLP N P   +KPEVS
Sbjct  1    MASLRNLLK--KNSLTSNNLPIRRFFSSEA--ALESPSFAHKIRDLPNNRPQAKIKPEVS  56

Query  320  QLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTL  499
            QLIGKTPLVYLNKVTEGCGA++A KQEM+QPTASIKDRPA AMI DAEKK LISP +TTL
Sbjct  57   QLIGKTPLVYLNKVTEGCGAFIAVKQEMVQPTASIKDRPAFAMINDAEKKNLISPGKTTL  116

Query  500  IEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVK  679
            IEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVK
Sbjct  117  IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVK  176

Query  680  KAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KA+ LLESTPNA MLQQFSNP NT+IH+ETTGPEIWEDT G VDIFVMGI
Sbjct  177  KAFELLESTPNAFMLQQFSNPANTKIHFETTGPEIWEDTLGQVDIFVMGI  226



>ref|XP_010055111.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Eucalyptus grandis]
 gb|KCW71585.1| hypothetical protein EUGRSUZ_E00118 [Eucalyptus grandis]
Length=375

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +2

Query  212  FFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAA  391
             F+T+ +  S SPSF QR+RDLP++ PGT +K  VSQL+G+TPLV+LNKVTEGCGAYVA 
Sbjct  27   LFSTEAV-SSDSPSFTQRVRDLPKDLPGTKIKAHVSQLVGRTPLVFLNKVTEGCGAYVAV  85

Query  392  KQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMV  571
            KQEMMQPT+SIKDRPALAMI DAEKK LISP +TTLIEPTSGNMGISMAFMAA+KGYKM+
Sbjct  86   KQEMMQPTSSIKDRPALAMINDAEKKNLISPGKTTLIEPTSGNMGISMAFMAAMKGYKMI  145

Query  572  LTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNT  751
            LTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVKKAY LLESTPNA MLQQFSNP N+
Sbjct  146  LTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAHMLQQFSNPANS  205

Query  752  QIHYETTGPEIWEDTQGNVDIFVMGI  829
            Q+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  206  QVHFETTGPEIWEDTNGQVDIFVMGI  231



>ref|NP_001280751.1| L-3-cyanoalanine synthase 2, mitochondrial [Malus domestica]
 sp|Q1KLZ1.1|CAS2_MALDO RecName: Full=L-3-cyanoalanine synthase 2, mitochondrial; Short=MdCAS2; 
Flags: Precursor [Malus domestica]
 gb|ABF13210.1| beta-cyanoalanine synthase 2 [Malus domestica]
Length=375

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 198/233 (85%), Gaps = 8/233 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQ---YSCKFFT---TQPLPGSASPSFAQRIRDLPRNTPGTNVKP  310
            MAAL +F+K R S +        + F+   +QP+P S  PSFAQRI +LP++ P T +K 
Sbjct  1    MAALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIPDS--PSFAQRIGNLPKDLPATQIKT  58

Query  311  EVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQ  490
            +VSQLIG+TP+VYLNKVTEGCGA++A KQEM QPTASIKDRPAL+MI DAE+KGLI+P +
Sbjct  59   QVSQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGE  118

Query  491  TTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGG  670
            TTLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRV MR FGADL+LTDPTKGMGG
Sbjct  119  TTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGG  178

Query  671  TVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TVKKAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  179  TVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGI  231



>ref|XP_007218145.1| hypothetical protein PRUPE_ppa007292mg [Prunus persica]
 gb|EMJ19344.1| hypothetical protein PRUPE_ppa007292mg [Prunus persica]
Length=374

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 198/230 (86%), Gaps = 3/230 (1%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCK--FFTTQ-PLPGSASPSFAQRIRDLPRNTPGTNVKPEVS  319
            MAAL +F+K R + +   + +   F+TQ   P   SPSFAQR+R+LP++ PGT+VK EVS
Sbjct  1    MAALRSFLKKRSTLLCNEAVRKRLFSTQVSQPIIDSPSFAQRVRNLPKDLPGTHVKTEVS  60

Query  320  QLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTL  499
            QLIG+TP+VYLNKVTEGCGAY+A KQEM QPT+SIKDRPAL+MI DAEKKGLI+P +T L
Sbjct  61   QLIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTSSIKDRPALSMINDAEKKGLITPGKTVL  120

Query  500  IEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVK  679
            +EPTSGNMGISMAFMAA++GYKMVLTMPSYTS+ERRV MR FGA+L+LTDP +GMGGTVK
Sbjct  121  VEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRAFGAELILTDPARGMGGTVK  180

Query  680  KAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIF+MGI
Sbjct  181  KAYDLLESTPNAHMLQQFSNPANTRVHFETTGPEIWEDTDGQVDIFIMGI  230



>gb|AIA22208.1| beta-cyanoalanine synthase [Lathyrus sativus]
Length=381

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            +F TT       S SFAQRIRDLP++ PGTN+K  VSQLIG+TPLVYLNKVTEGCGAY+A
Sbjct  31   RFLTTTTATSVDSSSFAQRIRDLPKDLPGTNIKKHVSQLIGRTPLVYLNKVTEGCGAYIA  90

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
             KQEMMQPTASIKDRPALAM+ DAEKK LI+P +T LIEPTSGNMGIS+AFMAA+KGYKM
Sbjct  91   VKQEMMQPTASIKDRPALAMMEDAEKKNLITPGKTVLIEPTSGNMGISLAFMAAMKGYKM  150

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            VLTMPSYTS+ERRV MR FGA+LVLTDPTKGMGGTVKKAY LLESTP+A MLQQFSNP N
Sbjct  151  VLTMPSYTSLERRVCMRAFGAELVLTDPTKGMGGTVKKAYDLLESTPDAFMLQQFSNPAN  210

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  211  TQVHFETTGPEIWEDTNGQVDIFVMGI  237



>ref|XP_008343406.1| PREDICTED: LOW QUALITY PROTEIN: L-3-cyanoalanine synthase 2, 
mitochondrial-like, partial [Malus domestica]
Length=292

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 198/233 (85%), Gaps = 8/233 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQ---YSCKFFT---TQPLPGSASPSFAQRIRDLPRNTPGTNVKP  310
            MAAL +F+K R S +        + F+   +QP+P S  PSFAQRI +LP++ P T +K 
Sbjct  1    MAALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIPDS--PSFAQRIGNLPKDLPATQIKT  58

Query  311  EVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQ  490
            +VSQLIG+TP+VYLNKVTEGCGA++A KQEM QPTASIKDRPAL+MI DAE+KGLI+P +
Sbjct  59   QVSQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGE  118

Query  491  TTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGG  670
            TTLIEPTSGNMGISMAFMAA+KGYKMVLT+PSYTS+ERRV MR FGADL+LTDPTKGMGG
Sbjct  119  TTLIEPTSGNMGISMAFMAAMKGYKMVLTLPSYTSLERRVCMRCFGADLILTDPTKGMGG  178

Query  671  TVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TVKKAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  179  TVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGI  231



>ref|XP_003623996.1| Cysteine synthase [Medicago truncatula]
 gb|AES80214.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula]
Length=380

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 197/236 (83%), Gaps = 9/236 (4%)
 Frame = +2

Query  149  MAALMNFIK---ARKSSMLQYSCKF------FTTQPLPGSASPSFAQRIRDLPRNTPGTN  301
            MA+LM+F+K   +  SS L  +C+         T     + S SFAQRIRDLP++ PGTN
Sbjct  1    MASLMSFLKRTSSSSSSSLAVACQHPMMMRRLMTTTATSADSSSFAQRIRDLPKDLPGTN  60

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +K  VSQLIG+TPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPALAM+ DAEKK LI+
Sbjct  61   IKKHVSQLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASIKDRPALAMMEDAEKKNLIT  120

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P +T LIEPTSGNMGIS+AFMAA+KGYKMVLTMPSYTS+ERRV MR FGA+L+LTDPTKG
Sbjct  121  PGKTILIEPTSGNMGISLAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGAELILTDPTKG  180

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            MGGTVKKAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  181  MGGTVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGI  236



>ref|XP_004138495.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like isoform 
1 [Cucumis sativus]
 gb|KGN45669.1| hypothetical protein Csa_6G004600 [Cucumis sativus]
Length=375

 Score =   352 bits (904),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 197/230 (86%), Gaps = 6/230 (3%)
 Frame = +2

Query  152  AALMNFIKARKSSMLQYSC----KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVS  319
            AAL   +K +K+ +    C    KFF+TQ +  S+S SFAQR+RDLP++ PGT+V+ + +
Sbjct  4    AALRTLVK-QKAGISSDGCSTVRKFFSTQTVFESSS-SFAQRLRDLPKDLPGTSVRRDAA  61

Query  320  QLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTL  499
             LIGKTPLVYLNKVTEGCGAY+A KQEMMQPT+SIKDRPA AMI DAEKKGLI+P +TTL
Sbjct  62   HLIGKTPLVYLNKVTEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGKTTL  121

Query  500  IEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVK  679
            IEPTSGNMGISMAFMA +KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVK
Sbjct  122  IEPTSGNMGISMAFMATLKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVK  181

Query  680  KAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KAY LLESTP+  MLQQF+NP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  182  KAYDLLESTPDGFMLQQFANPANTQVHFETTGPEIWEDTNGQVDIFVMGI  231



>ref|XP_002518986.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF43519.1| cysteine synthase, putative [Ricinus communis]
Length=364

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 7/227 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MA   +F+K R    L     FF+T+    S   S AQRIRDLP+N PGT +K +VSQLI
Sbjct  1    MATSRSFLKKRSLKDLA----FFSTEV---SVDSSLAQRIRDLPKNLPGTKIKTQVSQLI  53

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            G+TPLVYLN+VTEGCGAY+A KQEM+QPT+SIKDRPALAMI DAE+K LI+P +TTLIEP
Sbjct  54   GRTPLVYLNRVTEGCGAYIAVKQEMVQPTSSIKDRPALAMINDAEQKNLITPGKTTLIEP  113

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTD TKGMGGTVKKAY
Sbjct  114  TSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDHTKGMGGTVKKAY  173

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLESTPNA MLQQFSNP NT+IH+ETTGPEIWEDT G VDIFVMGI
Sbjct  174  ELLESTPNAFMLQQFSNPANTKIHFETTGPEIWEDTLGGVDIFVMGI  220



>ref|XP_009367811.1| PREDICTED: L-3-cyanoalanine synthase 2, mitochondrial [Pyrus 
x bretschneideri]
Length=375

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 200/234 (85%), Gaps = 10/234 (4%)
 Frame = +2

Query  149  MAALMNFIKARKSSML----QYSCKFFTTQ---PLPGSASPSFAQRIRDLPRNTPGTNVK  307
            MAAL +F+K +KSS+L        + F+ Q   P+P S  PSFAQRI +LP++ P T +K
Sbjct  1    MAALRSFLK-KKSSVLCNGGAVRHRLFSAQVAQPIPDS--PSFAQRIGNLPKDLPATQIK  57

Query  308  PEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPE  487
             +VSQLIG+TP+VYLNKVTEGCGA++A KQEM QPTASIKDRPAL+MI DAE+KGLI+P 
Sbjct  58   TQVSQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPG  117

Query  488  QTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMG  667
            +TTLIEPTSGNMGISMAFMAA++GYKMVLTMPSYTS+ERRV MR FGADL+LTDPTKGMG
Sbjct  118  ETTLIEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMG  177

Query  668  GTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            GTVKKAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  178  GTVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGI  231



>ref|XP_004492762.1| PREDICTED: l-3-cyanoalanine synthase 1, mitochondrial-like [Cicer 
arietinum]
Length=386

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  245  SPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASI  424
            S SFAQRIRDLP++ PGTN+K  VS LIG+TPLVYLNKVTEGCGAY+A KQEMMQPTASI
Sbjct  48   SLSFAQRIRDLPKDLPGTNIKKHVSHLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASI  107

Query  425  KDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIER  604
            KDRPALAM+ DAEKK LISP +T LIEPTSGNMGISMAF+AA+KGYKMVLTMPSYTS+ER
Sbjct  108  KDRPALAMMEDAEKKNLISPGKTILIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSLER  167

Query  605  RVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEI  784
            RVTMR FGA+L+LTDPTKGMGGTVKKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPEI
Sbjct  168  RVTMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEI  227

Query  785  WEDTQGNVDIFVMGI  829
            WEDT G VDIFVMGI
Sbjct  228  WEDTNGQVDIFVMGI  242



>ref|XP_002301363.2| hypothetical protein POPTR_0002s16220g [Populus trichocarpa]
 gb|EEE80636.2| hypothetical protein POPTR_0002s16220g [Populus trichocarpa]
Length=276

 Score =   347 bits (889),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  242  ASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTAS  421
            AS SFAQR+RDLP++ PGT +K  VSQLIGKTPLVYLNKVTEGCGAY+A KQEM QPT+S
Sbjct  36   ASASFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCGAYIAVKQEMFQPTSS  95

Query  422  IKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIE  601
            IKDRPALAM+ +AEKK LI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+E
Sbjct  96   IKDRPALAMVEEAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLE  155

Query  602  RRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPE  781
            RRVTMR FGA+L+LTDP KGMGGTVKKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPE
Sbjct  156  RRVTMRAFGAELILTDPAKGMGGTVKKAYELLESTPNAFMLQQFSNPANTQVHFETTGPE  215

Query  782  IWEDTQGNVDIFVMGI  829
            IWEDT G VDIFVMGI
Sbjct  216  IWEDTVGKVDIFVMGI  231



>gb|AFK37031.1| unknown [Lotus japonicus]
Length=374

 Score =   350 bits (898),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 193/231 (84%), Gaps = 5/231 (2%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSA----SPSFAQRIRDLPRNTPGTNVKPEV  316
            MA+L +F+K R SS    +C     + L  +A    SPS AQ+IRDLP++ PG N+K  V
Sbjct  1    MASLSSFLKQRPSS-YAVACHHTLLRRLFSTATSADSPSLAQKIRDLPKDLPGNNIKKHV  59

Query  317  SQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTT  496
            S+LIG+TPLVYLNKVTEGCGAY+A KQEMMQPT S+KDRPALAMI DAEKK LI+P +T 
Sbjct  60   SELIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTTSVKDRPALAMIADAEKKNLITPGKTI  119

Query  497  LIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTV  676
            LIEPTSGNMGISMAF+ A+KGYK+VLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTV
Sbjct  120  LIEPTSGNMGISMAFIGALKGYKVVLTMPSYTSMERRVTMRAFGAELILTDPAKGMGGTV  179

Query  677  KKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  180  KKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  230



>emb|CDP08794.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   350 bits (897),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 176/233 (76%), Positives = 198/233 (85%), Gaps = 8/233 (3%)
 Frame = +2

Query  149  MAALMNFIKARKSSM----LQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEV  316
            MAAL +  K RKSS+    L  S + F+T+ L  +  PSFAQR+RDLP++ PGTN++ E 
Sbjct  1    MAALSSLFK-RKSSIPFNGLIRSSRLFSTETLLDNC-PSFAQRLRDLPKDFPGTNIRKEA  58

Query  317  SQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDR-PA-LAMILDAEKKGLISPEQ  490
            SQLIG+TP+VYLN+VTEGCGAY+AAKQEM QPTASIKDR PA  AMI DAEKKGLISP +
Sbjct  59   SQLIGRTPIVYLNRVTEGCGAYIAAKQEMFQPTASIKDRQPATFAMIADAEKKGLISPGE  118

Query  491  TTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGG  670
            TTLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGG
Sbjct  119  TTLIEPTSGNMGISMAFMAALKGYKMVLTMPSYTSLERRVTMRTFGAELILTDPTKGMGG  178

Query  671  TVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TVKKA  LLE TPN  MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  179  TVKKADQLLEKTPNGFMLQQFSNPANTQVHFETTGPEIWEDTNGKVDIFVMGI  231



>gb|KDP28610.1| hypothetical protein JCGZ_14381 [Jatropha curcas]
Length=370

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 193/231 (84%), Gaps = 9/231 (4%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPL-PGSA---SPSFAQRIRDLPRNTPGTNVKPEV  316
            MAA  NF+K +       +C     + L  G A   S SFAQR+RDLP+  PGT +K EV
Sbjct  1    MAAFRNFLKKKA-----LTCNELPLRRLFSGEAAVDSSSFAQRVRDLPKKLPGTKIKTEV  55

Query  317  SQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTT  496
            SQLIG+TPLVYLN+VT+GCGAY+A KQEMMQPTASIKDRPA +MI DAE+K LI+P +TT
Sbjct  56   SQLIGRTPLVYLNRVTDGCGAYIAVKQEMMQPTASIKDRPAFSMINDAEQKNLITPGKTT  115

Query  497  LIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTV  676
            LIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGGTV
Sbjct  116  LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTV  175

Query  677  KKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KKAY LLESTPNA MLQQF+NP NT+IH+ETTGPEIWEDT G VDIFVMGI
Sbjct  176  KKAYDLLESTPNAFMLQQFANPANTKIHFETTGPEIWEDTLGQVDIFVMGI  226



>gb|KDO86225.1| hypothetical protein CISIN_1g021775mg [Citrus sinensis]
Length=307

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 193/228 (85%), Gaps = 3/228 (1%)
 Frame = +2

Query  152  AALMNFIKARK--SSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQL  325
            AAL +F+K R    S      +  ++QP P  +S SFAQR+RDLP++ P TN+K +VSQL
Sbjct  3    AALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSS-SFAQRLRDLPKDLPATNIKRDVSQL  61

Query  326  IGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIE  505
            IG+TPLV+LNKV+EGCGAY+A KQEM QPTASIKDRPA+AM+ DAE K LISP +TT+IE
Sbjct  62   IGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIE  121

Query  506  PTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKA  685
            PTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKA
Sbjct  122  PTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKA  181

Query  686  YALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
              LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  182  QELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGI  229



>ref|XP_006445004.1| hypothetical protein CICLE_v10020662mg [Citrus clementina]
 ref|XP_006491140.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR58244.1| hypothetical protein CICLE_v10020662mg [Citrus clementina]
Length=373

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 193/228 (85%), Gaps = 3/228 (1%)
 Frame = +2

Query  152  AALMNFIKARK--SSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQL  325
            AAL +F+K R    S      +  ++QP P  +S SFAQR+RDLP++ P TN+K +VSQL
Sbjct  3    AALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSS-SFAQRLRDLPKDLPATNIKRDVSQL  61

Query  326  IGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIE  505
            IG+TPLV+LNKV+EGCGAY+A KQEM QPTASIKDRPA+AM+ DAE K LISP +TT+IE
Sbjct  62   IGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIE  121

Query  506  PTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKA  685
            PTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKA
Sbjct  122  PTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKA  181

Query  686  YALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
              LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  182  QELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGI  229



>ref|XP_011023311.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial-like [Populus euphratica]
Length=375

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  242  ASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTAS  421
            AS SFAQR+RDLP++ PGT +K  VSQLIGKTPLVYLNKVTEGC AY+A KQEM QPT+S
Sbjct  36   ASSSFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCRAYIAVKQEMFQPTSS  95

Query  422  IKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIE  601
            IKDRPALAM+ DAEKK LI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+E
Sbjct  96   IKDRPALAMVEDAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLE  155

Query  602  RRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPE  781
            RRVTMR FGA+L+LTDPTKGMGGTVKKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPE
Sbjct  156  RRVTMRAFGAELILTDPTKGMGGTVKKAYELLESTPNAFMLQQFSNPANTQVHFETTGPE  215

Query  782  IWEDTQGNVDIFVMGI  829
            IWEDT G VDIFVMGI
Sbjct  216  IWEDTLGKVDIFVMGI  231



>ref|XP_002301362.1| beta-cyanoalanine synthase family protein [Populus trichocarpa]
 gb|EEE80635.1| beta-cyanoalanine synthase family protein [Populus trichocarpa]
Length=375

 Score =   347 bits (891),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  242  ASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTAS  421
            AS SFAQR+RDLP++ PGT +K  VSQLIGKTPLVYLNKVTEGCGAY+A KQEM QPT+S
Sbjct  36   ASASFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCGAYIAVKQEMFQPTSS  95

Query  422  IKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIE  601
            IKDRPALAM+ +AEKK LI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+E
Sbjct  96   IKDRPALAMVEEAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLE  155

Query  602  RRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPE  781
            RRVTMR FGA+L+LTDP KGMGGTVKKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPE
Sbjct  156  RRVTMRAFGAELILTDPAKGMGGTVKKAYELLESTPNAFMLQQFSNPANTQVHFETTGPE  215

Query  782  IWEDTQGNVDIFVMGI  829
            IWEDT G VDIFVMGI
Sbjct  216  IWEDTVGKVDIFVMGI  231



>ref|XP_008458207.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Cucumis melo]
Length=379

 Score =   347 bits (891),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 197/233 (85%), Gaps = 8/233 (3%)
 Frame = +2

Query  152  AALMNFIKARKSSMLQYSC-----KFFTTQPL--PGSASPSFAQRIRDLPRNTPGTNVKP  310
            AAL + +K +K+ +    C     K F+TQ +    S+S SFAQR+RDLP++ PGT+V+ 
Sbjct  4    AALRSLVK-QKAGISSDGCSTTVRKLFSTQTVLDSSSSSSSFAQRLRDLPKDLPGTSVRR  62

Query  311  EVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQ  490
            + + LIGKTPLVYLNKVTEGCGAY+A KQEMMQPT+SIKDRPA AMI DAEKKGLI+P Q
Sbjct  63   DAAHLIGKTPLVYLNKVTEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGQ  122

Query  491  TTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGG  670
            TTLIEPTSGNMGISMAFMA +KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGG
Sbjct  123  TTLIEPTSGNMGISMAFMATLKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGG  182

Query  671  TVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TVKKAY LLESTPN  MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  183  TVKKAYDLLESTPNGFMLQQFSNPANTQVHFETTGPEIWEDTNGLVDIFVMGI  235



>ref|XP_009797225.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Nicotiana sylvestris]
Length=362

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 191/229 (83%), Gaps = 13/229 (6%)
 Frame = +2

Query  149  MAALMNFIKARK--SSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MAAL   +K  +  +S + +  + F+TQPL    +P             P TN+K EVSQ
Sbjct  1    MAALSRLLKRSRYCNSNVDFITRLFSTQPL--VHTPKL---------QLPVTNIKTEVSQ  49

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIGKTP+VYLNKVTEGCGA++A KQEM QPT+SIKDRPALAMI DAEKKGLISPE+TTLI
Sbjct  50   LIGKTPMVYLNKVTEGCGAHIAVKQEMFQPTSSIKDRPALAMIDDAEKKGLISPEKTTLI  109

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADLVLTDPTKGMGGTVKK
Sbjct  110  EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLVLTDPTKGMGGTVKK  169

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            AY LLESTPNA MLQQFSNP NTQIH+ETTGPEIWE+TQGNVDIFVMGI
Sbjct  170  AYDLLESTPNAFMLQQFSNPANTQIHFETTGPEIWEETQGNVDIFVMGI  218



>gb|ABY64889.1| beta-cyanoalanine synthase [Manihot esculenta]
Length=377

 Score =   345 bits (885),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MA L N    +  +  + + + F T     + +PSFAQR+RDLP+N P T ++ EVS LI
Sbjct  7    MATLRNLFTKKSFASNELAMRRFFTPQAAAAEAPSFAQRVRDLPKNLPATKIRTEVSHLI  66

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            G+TPLV+LNKV EGCGAY+A KQEMMQPTASIKDRPA +M  DAEKK LISP +T LIEP
Sbjct  67   GRTPLVFLNKVNEGCGAYIAVKQEMMQPTASIKDRPAFSMFNDAEKKNLISPGKTVLIEP  126

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKM+LTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVKKAY
Sbjct  127  TSGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAY  186

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLE+TPNA MLQQFSNP N++IH+ETTGPEIWEDT G VDIFVMGI
Sbjct  187  DLLETTPNAYMLQQFSNPANSKIHFETTGPEIWEDTLGQVDIFVMGI  233



>ref|XP_010544747.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Tarenaya hassleriana]
Length=368

 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 186/224 (83%), Gaps = 11/224 (5%)
 Frame = +2

Query  191  MLQYSCKFFTTQPLPGSA-----------SPSFAQRIRDLPRNTPGTNVKPEVSQLIGKT  337
            M   S +F   + +PG A           SPSFAQR+RDLP++ P TN K + S L+GKT
Sbjct  1    MAAASRRFLRRETIPGGANTVRKLFSTVGSPSFAQRLRDLPKDFPSTNAKRDASLLVGKT  60

Query  338  PLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSG  517
            PLV+LNKVTEGCGAY+AAKQEM QPT+S+KDRPALAMI DAE+K LI P +TTLIEPTSG
Sbjct  61   PLVFLNKVTEGCGAYIAAKQEMFQPTSSVKDRPALAMIADAEQKNLIIPGKTTLIEPTSG  120

Query  518  NMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALL  697
            NMGISMAF+AA+KGY+M+LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAY LL
Sbjct  121  NMGISMAFIAAMKGYRMILTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELL  180

Query  698  ESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            E+TP+A MLQQFSNP NTQ H+ETTGPEIWEDT GNVDIFVMGI
Sbjct  181  ENTPDAHMLQQFSNPANTQSHFETTGPEIWEDTLGNVDIFVMGI  224



>ref|XP_010275651.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nelumbo nucifera]
 ref|XP_010275652.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nelumbo nucifera]
Length=371

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = +2

Query  254  FAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDR  433
            F ++IRDLP+  PGTNVK +VSQLIG+TPLVYLNKVTEGCGAY+AAKQEMMQPT+SIKDR
Sbjct  36   FVEKIRDLPKEFPGTNVKKDVSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTSSIKDR  95

Query  434  PALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVT  613
            PA AMI DAE K LI+P +T LIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVT
Sbjct  96   PAFAMITDAENKQLIAPGKTVLIEPTSGNMGISMAFMAALKGYKMVLTMPSYTSLERRVT  155

Query  614  MRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWED  793
            M+ FGA+L+LTDPTKGMGGTVKKAY LLESTP+A MLQQF NP NTQ+H+ETTGPEIWED
Sbjct  156  MKAFGAELILTDPTKGMGGTVKKAYELLESTPDAFMLQQFDNPANTQVHFETTGPEIWED  215

Query  794  TQGNVDIFVMGI  829
            T G VDIFVMGI
Sbjct  216  TFGQVDIFVMGI  227



>ref|NP_001275044.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial 
[Solanum tuberosum]
 sp|Q9FS29.1|CAS2_SOLTU RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase 2, mitochondrial; Flags: Precursor [Solanum tuberosum]
 dbj|BAB20032.1| beta-cyanoalanine synthase like protein [Solanum tuberosum]
Length=347

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 183/227 (81%), Gaps = 24/227 (11%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MA L  F+K R  +    S + F+TQ                     P TN+K EVSQLI
Sbjct  1    MATLSRFLKKRSLA----SNRLFSTQ--------------------LPHTNIKSEVSQLI  36

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            GKTP+VYL KVTEGCGAY+A KQEM QPT+SIKDRPALAMI DAEKKGLISPE+TTLIEP
Sbjct  37   GKTPMVYLKKVTEGCGAYIAVKQEMFQPTSSIKDRPALAMINDAEKKGLISPEKTTLIEP  96

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGTVKKAY
Sbjct  97   TSGNMGISMAFMAAMKGYKMVLTMPSYTSMERRVTMRAFGADLILTDPTKGMGGTVKKAY  156

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLESTPNA MLQQFSNP NTQ+H++TTGPEIWE+T GNVDIFVMGI
Sbjct  157  ELLESTPNAFMLQQFSNPANTQVHFDTTGPEIWEETLGNVDIFVMGI  203



>ref|XP_010523763.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Tarenaya hassleriana]
Length=368

 Score =   337 bits (863),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 181/207 (87%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSFAQR+RDLP++ P TN K + S LIGKTPLV+LNKVTEGCGAY+A
Sbjct  23   KLFST-----VGSPSFAQRLRDLPKDFPSTNAKRDASLLIGKTPLVFLNKVTEGCGAYIA  77

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQEM QPT+S+KDRPALAM+ DAE K LI+P +TTLIEPTSGNMGISMAFMAA+KGY+M
Sbjct  78   AKQEMFQPTSSVKDRPALAMVADAEAKNLITPGKTTLIEPTSGNMGISMAFMAAMKGYRM  137

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            +LTMPSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVKKAY LLE+TP++ MLQQFSN  N
Sbjct  138  ILTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYELLENTPDSYMLQQFSNQAN  197

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQ H+ETTGPEIWEDT GNVDIFVMGI
Sbjct  198  TQSHFETTGPEIWEDTLGNVDIFVMGI  224



>ref|XP_002320141.2| hypothetical protein POPTR_0014s08210g [Populus trichocarpa]
 gb|ABK95519.1| unknown [Populus trichocarpa]
 gb|EEE98456.2| hypothetical protein POPTR_0014s08210g [Populus trichocarpa]
Length=374

 Score =   337 bits (864),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  260  QRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPA  439
            QR+RDLP++ PGT +K +VSQLIGKTP+VYL+KVTEGCGAY+AAKQEM QPT+SIKDRPA
Sbjct  41   QRLRDLPKDLPGTKIKTQVSQLIGKTPIVYLSKVTEGCGAYIAAKQEMFQPTSSIKDRPA  100

Query  440  LAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMR  619
            LAMI DAEKK LI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+ERRVTMR
Sbjct  101  LAMIEDAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMR  160

Query  620  VFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQ  799
             FGA+L+LTDP KGMGGTVKKAY LLESTP A MLQQFSNP NTQIH+ETTGPEIWED+ 
Sbjct  161  AFGAELILTDPAKGMGGTVKKAYELLESTPGAFMLQQFSNPANTQIHFETTGPEIWEDSL  220

Query  800  GNVDIFVMGI  829
            G VDIFVMGI
Sbjct  221  GKVDIFVMGI  230



>ref|XP_009628115.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Nicotiana tomentosiformis]
Length=366

 Score =   337 bits (863),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 179/209 (86%), Gaps = 11/209 (5%)
 Frame = +2

Query  203  SCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAY  382
            S + F+T+PL    +P             P TN+K EVSQLIGKTP+VYLNKVTEGCGA+
Sbjct  25   STRLFSTEPL--LHTPKL---------QLPVTNIKTEVSQLIGKTPMVYLNKVTEGCGAH  73

Query  383  VAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGY  562
            +A KQEM QPT+SIKDRPALAMI DAE KGLISPE+TTLIEPTSGNMGISMAFMAA+KGY
Sbjct  74   IAVKQEMFQPTSSIKDRPALAMINDAENKGLISPEKTTLIEPTSGNMGISMAFMAAMKGY  133

Query  563  KMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNP  742
            KMVLTMPSYTS+ERRVTMR FGADLVLTDPTKGMGGTV KAY LLESTPNA MLQQFSNP
Sbjct  134  KMVLTMPSYTSLERRVTMRAFGADLVLTDPTKGMGGTVNKAYDLLESTPNAFMLQQFSNP  193

Query  743  VNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             NTQIH+ETTGPEIWE+TQGNVDIFVMGI
Sbjct  194  ANTQIHFETTGPEIWEETQGNVDIFVMGI  222



>ref|XP_004229909.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Solanum lycopersicum]
Length=357

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 187/227 (82%), Gaps = 14/227 (6%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MA+L  F+K R       S  +     +  +++  F+ ++       P TN+K EVSQLI
Sbjct  1    MASLSRFLKKR-------SLDYNNVDLMRAASNRLFSTQL-------PHTNIKSEVSQLI  46

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            GKTP+VYL KVTEGCGAY+A KQEM QPT+SIKDRPALAMI DAEKKGLISPE+TTLIEP
Sbjct  47   GKTPMVYLKKVTEGCGAYIAVKQEMFQPTSSIKDRPALAMINDAEKKGLISPEKTTLIEP  106

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPTKGMGGTVKKAY
Sbjct  107  TSGNMGISMAFMAAMKGYKMVLTMPSYTSMERRVTMRAFGADLILTDPTKGMGGTVKKAY  166

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLESTPNA MLQQFSNP NTQ+H++TTGPEIWE++ GNVDIFVMGI
Sbjct  167  DLLESTPNAFMLQQFSNPANTQVHFDTTGPEIWEESLGNVDIFVMGI  213



>gb|KHG16844.1| Cysteine synthase, chloroplastic/chromoplastic [Gossypium arboreum]
Length=371

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 187/229 (82%), Gaps = 4/229 (2%)
 Frame = +2

Query  149  MAALMNFIKAR--KSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MAALM+F+  R    + L  + +  +T+P+    SPSFAQR+ DLP +   T +K EV Q
Sbjct  1    MAALMSFLTKRCLTYNELMMTRRLVSTEPI--IDSPSFAQRLGDLPTDLLDTKIKSEVYQ  58

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLV+LNKVTEGCGAY+A KQEMM PTASIKDRPA +MI DAEKK LISP +TTLI
Sbjct  59   LIGRTPLVFLNKVTEGCGAYIAVKQEMMMPTASIKDRPAFSMITDAEKKNLISPGKTTLI  118

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMAA KGYKMVLTMPSYTS+ERRVTMR FGA LVLTDPTKGM GTVKK
Sbjct  119  EPTSGNMGISMAFMAATKGYKMVLTMPSYTSLERRVTMRAFGAGLVLTDPTKGMEGTVKK  178

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            A  LLESTPNA MLQQFSNP NTQ H+ETTGP+IWEDT G VDIFV GI
Sbjct  179  ANELLESTPNAFMLQQFSNPANTQAHFETTGPKIWEDTLGKVDIFVTGI  227



>ref|XP_009116808.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Brassica rapa]
Length=368

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 181/211 (86%), Gaps = 5/211 (2%)
 Frame = +2

Query  197  QYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCG  376
            Q + K F+T       S SFA+R+R+LP+  P T  K + S LIG+TPLV+LN+VTEGCG
Sbjct  19   QSTRKLFSTD-----GSSSFAERLRNLPKEFPATQAKGDASLLIGRTPLVFLNRVTEGCG  73

Query  377  AYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVK  556
            AY+AAKQE  QPT S+KDRPALAM+ DAEKK LI+P +TTLIEPTSGNMGISMAFMAA+K
Sbjct  74   AYIAAKQEHFQPTCSVKDRPALAMVADAEKKNLITPGKTTLIEPTSGNMGISMAFMAALK  133

Query  557  GYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFS  736
            GYK+++TMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKKAY LLESTP+A MLQQF+
Sbjct  134  GYKIIMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYDLLESTPDAHMLQQFA  193

Query  737  NPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            NP NTQIHY+TTGPEIWEDT GNVDIFVMGI
Sbjct  194  NPANTQIHYDTTGPEIWEDTLGNVDIFVMGI  224



>ref|XP_010512491.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial-like [Camelina sativa]
Length=369

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSFAQR+RDLP++ P TN K + S LIG+TPLV+LN+VTEGC AY+A
Sbjct  24   KLFST-----VGSPSFAQRLRDLPKDFPSTNAKRDASLLIGRTPLVFLNRVTEGCEAYIA  78

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQE  QPT SIKDRPA+AMI DAEKK LI P +TTLIEPTSGNMGIS+AFMAA+KGYK+
Sbjct  79   AKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAALKGYKI  138

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            V+TMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKKAY LL+STP+A M QQF+NP N
Sbjct  139  VMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYDLLDSTPDAFMCQQFANPAN  198

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQIHY+TTGPEIWEDT GNVDIFVMGI
Sbjct  199  TQIHYDTTGPEIWEDTLGNVDIFVMGI  225



>ref|XP_010413402.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X2 [Camelina sativa]
 ref|XP_010469079.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X2 [Camelina sativa]
Length=368

 Score =   332 bits (851),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSFAQR+RDLP++ P TN K + S LIG+TPLV+LN+VTEGC AY+A
Sbjct  23   KLFST-----VGSPSFAQRLRDLPKDFPSTNAKRDASLLIGRTPLVFLNRVTEGCEAYIA  77

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQE  QPT SIKDRPA+AMI DAEKK LI P +TTLIEPTSGNMGIS+AFMAA+KGYK+
Sbjct  78   AKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAALKGYKI  137

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            V+TMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKKAY LL+STP+A M QQF+NP N
Sbjct  138  VMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYDLLDSTPDAFMCQQFANPAN  197

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQIHY+TTGPEIWEDT GNVDIFVMGI
Sbjct  198  TQIHYDTTGPEIWEDTLGNVDIFVMGI  224



>emb|CDX71737.1| BnaC08g31370D [Brassica napus]
Length=368

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 180/211 (85%), Gaps = 5/211 (2%)
 Frame = +2

Query  197  QYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCG  376
            Q + K F+T       S SFA R+R+LP+  P T  K + S LIG+TPLV+LN+VTEGCG
Sbjct  19   QSTRKLFSTD-----GSSSFADRLRNLPKEFPATQAKRDASLLIGRTPLVFLNRVTEGCG  73

Query  377  AYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVK  556
            AY+AAKQE  QPT S+KDRPALAM+ DAEKK LI+P +TTLIEPTSGNMGISMAFMAA+K
Sbjct  74   AYIAAKQEHFQPTCSVKDRPALAMVADAEKKNLITPGKTTLIEPTSGNMGISMAFMAALK  133

Query  557  GYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFS  736
            GYK+++TMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKKAY LLESTP+A MLQQF+
Sbjct  134  GYKIIMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYDLLESTPDAHMLQQFA  193

Query  737  NPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            NP NTQIHY+TTGPEIWEDT GNVDIFVMGI
Sbjct  194  NPANTQIHYDTTGPEIWEDTLGNVDIFVMGI  224



>ref|XP_010413401.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X1 [Camelina sativa]
Length=377

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSFAQR+RDLP++ P TN K + S LIG+TPLV+LN+VTEGC AY+A
Sbjct  23   KLFST-----VGSPSFAQRLRDLPKDFPSTNAKRDASLLIGRTPLVFLNRVTEGCEAYIA  77

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQE  QPT SIKDRPA+AMI DAEKK LI P +TTLIEPTSGNMGIS+AFMAA+KGYK+
Sbjct  78   AKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAALKGYKI  137

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            V+TMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKKAY LL+STP+A M QQF+NP N
Sbjct  138  VMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYDLLDSTPDAFMCQQFANPAN  197

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQIHY+TTGPEIWEDT GNVDIFVMGI
Sbjct  198  TQIHYDTTGPEIWEDTLGNVDIFVMGI  224



>gb|AEA86281.1| chloroplast cysteine synthase [Solanum nigrum]
Length=275

 Score =   326 bits (836),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+K +VSQLIGKTPLVYLNKV+EGCGAY+A KQEMMQPT+SIKDRPA AMI DAEKKGLI
Sbjct  1    NIKTQVSQLIGKTPLVYLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLI  60

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P +TTLIEPTSGNMGISMAFMAA+KGYK++LTMPSYTS+ERRVTMR FGADLV+TDPTK
Sbjct  61   TPGKTTLIEPTSGNMGISMAFMAAMKGYKIILTMPSYTSLERRVTMRAFGADLVITDPTK  120

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            GM GTVKKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDTQGNVDIFVMGI
Sbjct  121  GMEGTVKKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTQGNVDIFVMGI  177



>ref|NP_191703.1| cysteine synthase C1 [Arabidopsis thaliana]
 sp|Q9S757.1|CYSC1_ARATH RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase C1, mitochondrial; AltName: Full=Beta-substituted 
Ala synthase 3;1; Short=ARAth-Bsas3;1; AltName: Full=Cysteine 
synthase C1; Short=AtCYSC1; AltName: Full=O-acetylserine (thiol)-lyase 
5; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA78560.1| cysteine synthase [Arabidopsis thaliana]
 emb|CAB54830.1| cysteine synthase [Arabidopsis thaliana]
 emb|CAB71074.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 gb|AAM13093.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 gb|AAM64764.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 gb|AAM91182.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 dbj|BAE98719.1| cysteine synthase [Arabidopsis thaliana]
 gb|AEE80203.1| cysteine synthase C1 [Arabidopsis thaliana]
Length=368

 Score =   329 bits (843),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 178/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSFAQR+RDLP++ P TN K + S LIGKTPLV+LNKVTEGC AYVA
Sbjct  23   KLFST-----VGSPSFAQRLRDLPKDFPSTNAKRDASLLIGKTPLVFLNKVTEGCEAYVA  77

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQE  QPT SIKDRPA+AMI DAEKK LI P +TTLIEPTSGNMGIS+AFMAA+KGY++
Sbjct  78   AKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAAMKGYRI  137

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            ++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAY LL+STP+A M QQF+NP N
Sbjct  138  IMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLDSTPDAFMCQQFANPAN  197

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQIH++TTGPEIWEDT GNVDIFVMGI
Sbjct  198  TQIHFDTTGPEIWEDTLGNVDIFVMGI  224



>ref|XP_002511880.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF50549.1| cysteine synthase, putative [Ricinus communis]
Length=355

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 182/227 (80%), Gaps = 16/227 (7%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            MAAL +F+K R  S+   S   F+T+                L +N P T +K EV+QLI
Sbjct  1    MAALRSFLKKR--SLTCNSLASFSTEAA--------------LAKNLPATKIKTEVAQLI  44

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            GKTP+VYLNKVTEGCG YVA KQEM QPT+SIKDRPA AMI DAE+K LISP +TTLIEP
Sbjct  45   GKTPIVYLNKVTEGCGGYVAVKQEMFQPTSSIKDRPAFAMITDAEQKNLISPGKTTLIEP  104

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRV MR FGADL+LTDPTKGMGGTVKKAY
Sbjct  105  TSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGADLILTDPTKGMGGTVKKAY  164

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             LLESTP+A MLQQFSNP NT+IH+ETTGPEIWEDT G VDIFVMGI
Sbjct  165  ELLESTPDAFMLQQFSNPANTKIHFETTGPEIWEDTLGQVDIFVMGI  211



>ref|XP_002876613.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52872.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 178/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSFAQR+RDLP++ P TN K + S LIGKTPLV+LNKVTEGC AY+A
Sbjct  23   KLFST-----VGSPSFAQRLRDLPKDFPSTNAKRDASLLIGKTPLVFLNKVTEGCEAYIA  77

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQE  QPT SIKDRPA+AMI DAEKK LI P ++TLIEPTSGNMGIS+AFMAA+KGY++
Sbjct  78   AKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKSTLIEPTSGNMGISLAFMAALKGYRI  137

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            ++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAY LLE+TP+A M QQF+NP N
Sbjct  138  IMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLENTPDAFMCQQFANPAN  197

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQIH++TTGPEIWEDT GNVDIFVMGI
Sbjct  198  TQIHFDTTGPEIWEDTLGNVDIFVMGI  224



>emb|CDY43932.1| BnaC04g21780D [Brassica napus]
Length=368

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 180/211 (85%), Gaps = 5/211 (2%)
 Frame = +2

Query  197  QYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCG  376
            Q + K F+T      AS SFA R+R+LP++ P T  K + S LIG+TPLV+LN+VTEGC 
Sbjct  19   QSTRKLFSTD-----ASSSFADRLRNLPKDFPSTQAKRDASLLIGRTPLVFLNRVTEGCE  73

Query  377  AYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVK  556
            AY+AAKQE  QPT S+KDRPALAM+ DAEKK LI+P +TTLIEPTSGNMGISMAF+AA+K
Sbjct  74   AYIAAKQEHFQPTCSVKDRPALAMVEDAEKKNLITPGKTTLIEPTSGNMGISMAFIAALK  133

Query  557  GYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFS  736
            GY++++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAY LLESTP+A MLQQF+
Sbjct  134  GYRIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLESTPDAHMLQQFA  193

Query  737  NPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            NP NTQIH++TTGPEIWEDT GNVDIFVMGI
Sbjct  194  NPANTQIHFDTTGPEIWEDTLGNVDIFVMGI  224



>ref|XP_009138771.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Brassica rapa]
 emb|CDX89116.1| BnaA04g00700D [Brassica napus]
Length=368

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 179/211 (85%), Gaps = 5/211 (2%)
 Frame = +2

Query  197  QYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCG  376
            Q + K F+T      A  SFA R+R+LP++ P T  K + S LIG+TPLV+LN+VTEGC 
Sbjct  19   QSTRKLFSTD-----APSSFADRLRNLPKDFPSTQAKRDASLLIGRTPLVFLNRVTEGCE  73

Query  377  AYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVK  556
            AY+AAKQE  QPT S+KDRPALAM+ DAEKK LI+P +TTLIEPTSGNMGISMAF+AA+K
Sbjct  74   AYIAAKQEHFQPTCSVKDRPALAMVADAEKKNLITPGKTTLIEPTSGNMGISMAFIAALK  133

Query  557  GYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFS  736
            GYK+++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAY LLESTP+A MLQQF+
Sbjct  134  GYKIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLESTPDAHMLQQFA  193

Query  737  NPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            NP NTQIH++TTGPEIWEDT GNVDIFVMGI
Sbjct  194  NPANTQIHFDTTGPEIWEDTLGNVDIFVMGI  224



>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
 pdb|3VBE|B Chain B, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
 pdb|3VBE|C Chain C, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
 pdb|3VBE|D Chain D, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
Length=344

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            TN+K  VSQLIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASIKDRPA AMI DAE+K L
Sbjct  23   TNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNL  82

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P +TTLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP 
Sbjct  83   ITPGKTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPA  142

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KGMGGTVKKAY LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  143  KGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  200



>gb|KFK42134.1| hypothetical protein AALP_AA2G215500 [Arabis alpina]
Length=368

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 178/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  209  KFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVA  388
            K F+T       SPSF +R+R+LP++ P TN K + S LIG+TPLV+LNKV+EGC AY+A
Sbjct  23   KLFST-----VGSPSFVERLRNLPKDFPSTNAKRDASLLIGRTPLVFLNKVSEGCEAYIA  77

Query  389  AKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKM  568
            AKQE  QPT SIKDRPALAM+ DAEKK LI+P +T LIEPTSGNMGISMAF+AA+KGY++
Sbjct  78   AKQEHFQPTCSIKDRPALAMVADAEKKKLITPGKTVLIEPTSGNMGISMAFIAAMKGYRI  137

Query  569  VLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVN  748
            ++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAY LLE+TP+A MLQQF+NP N
Sbjct  138  IMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLENTPDAFMLQQFANPAN  197

Query  749  TQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TQIH++TTGPEIWEDT GNVDIFVMGI
Sbjct  198  TQIHFDTTGPEIWEDTLGNVDIFVMGI  224



>gb|ABF58693.1| beta-cyanoalinine synthase [Fagus sylvatica]
Length=191

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = +2

Query  317  SQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTT  496
            SQLIGKTPLVYLNKVTEGCG Y+A KQEMMQPTASIKDRPA AMI+DAEKK LISP +TT
Sbjct  1    SQLIGKTPLVYLNKVTEGCGGYIAVKQEMMQPTASIKDRPAYAMIMDAEKKNLISPGKTT  60

Query  497  LIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTV  676
            LIEPTSGNMGISMAFMAA++GYKMVLTMPSYTS+ERRV MR FGADL++TDPTKGMGGTV
Sbjct  61   LIEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRAFGADLIVTDPTKGMGGTV  120

Query  677  KKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KKAY LLESTPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  121  KKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  171



>ref|XP_006402480.1| hypothetical protein EUTSA_v10006044mg [Eutrema salsugineum]
 gb|ESQ43933.1| hypothetical protein EUTSA_v10006044mg [Eutrema salsugineum]
Length=368

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 182/211 (86%), Gaps = 5/211 (2%)
 Frame = +2

Query  197  QYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCG  376
            Q + K F+T    G AS  F +R+R+LP++ P T  K + S LIG+TPLV+LN+VTEGC 
Sbjct  19   QSTRKLFSTD---GPAS--FLERLRNLPKDFPATYAKRDASLLIGRTPLVFLNRVTEGCE  73

Query  377  AYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVK  556
            AY+AAKQE  QPT SIKDRPALAM++DAEK+GLI+P +TTLIEPTSGNMGISMAFMAA++
Sbjct  74   AYIAAKQEHFQPTCSIKDRPALAMVVDAEKRGLIAPGKTTLIEPTSGNMGISMAFMAAMR  133

Query  557  GYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFS  736
            GYK+++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAY LLE+TP+A MLQQF+
Sbjct  134  GYKIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLENTPDAHMLQQFA  193

Query  737  NPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            NP NTQIH++TTGPEIWEDT GNVDIFVMGI
Sbjct  194  NPANTQIHFDTTGPEIWEDTLGNVDIFVMGI  224



>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|B Chain B, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|C Chain C, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|D Chain D, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|E Chain E, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|F Chain F, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
Length=344

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            TN+K  VSQLIG+TPLVYLNKVTEGCGAYVA KQEMMQPTASI DRPA AMI DAE+K L
Sbjct  23   TNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNL  82

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P +TTLIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP 
Sbjct  83   ITPGKTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPA  142

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KGMGGTVKKAY LLE+TPNA MLQQFSNP NTQ+H+ETTGPEIWEDT G VDIFVMGI
Sbjct  143  KGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGI  200



>gb|EPS57758.1| cysteine synthase, partial [Genlisea aurea]
Length=232

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +2

Query  251  SFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKD  430
            SF+QRIRDL ++ P T +  + SQLIG+TPLVYLN+V+EGCGAYVA KQEM QPTASIKD
Sbjct  1    SFSQRIRDLAKHFPATRINADASQLIGRTPLVYLNRVSEGCGAYVAVKQEMFQPTASIKD  60

Query  431  RPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRV  610
            RPA+AMI DAE+ GLI+P +TTLIEPTSGNMGIS+AFMAA++GY+MVLTMPSYTS+ERRV
Sbjct  61   RPAVAMIDDAERNGLITPGKTTLIEPTSGNMGISLAFMAAIRGYRMVLTMPSYTSLERRV  120

Query  611  TMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWE  790
            TM+ FGA+L+LTDPTKGM GTV+KA  LL+S  ++ MLQQFSNP NT+ H+ETTGPEIWE
Sbjct  121  TMKAFGAELILTDPTKGMEGTVRKADQLLDSVADSFMLQQFSNPANTRAHFETTGPEIWE  180

Query  791  DTQGNVDIFVMGI  829
            DT G VD+FVMGI
Sbjct  181  DTDGKVDVFVMGI  193



>ref|XP_010670142.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=368

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = +2

Query  239  SASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTA  418
            S+S   +Q + D   ++    +K  VSQL+G+TPLV+LNKVTEGCGAY+A KQEMMQPT+
Sbjct  28   SSSSDASQTVADSAFSSFPPTIKTHVSQLVGRTPLVFLNKVTEGCGAYIAVKQEMMQPTS  87

Query  419  SIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSI  598
            S+KDRPALAM+ DAEKKGLISP +T LIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+
Sbjct  88   SVKDRPALAMLEDAEKKGLISPGKTVLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSM  147

Query  599  ERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGP  778
            ERRVTMR FGA+L+LTDP KGMGGTVKKAY LL+STP+  MLQQFSNP NTQ+H+ETTGP
Sbjct  148  ERRVTMRAFGAELILTDPDKGMGGTVKKAYQLLDSTPDGFMLQQFSNPANTQVHFETTGP  207

Query  779  EIWEDTQGNVDIFVMGI  829
            EIWEDTQG VDIFVMGI
Sbjct  208  EIWEDTQGKVDIFVMGI  224



>ref|XP_010467018.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial-like [Camelina sativa]
Length=349

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = +2

Query  248  PSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIK  427
            PS AQR++D P+    TNVK + S LIG+TPLV+LNKVTEGCGAY+AAKQE  Q T SIK
Sbjct  12   PSSAQRLKDHPKAFASTNVKGDASMLIGRTPLVFLNKVTEGCGAYIAAKQEHFQSTCSIK  71

Query  428  DRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERR  607
            DRPALAMI DAEKK LI+P +TTLIEPTSGNMGIS+AFMAA++GYK+++TMPSYTS+ERR
Sbjct  72   DRPALAMIEDAEKKNLITPGKTTLIEPTSGNMGISLAFMAAMEGYKIIITMPSYTSLERR  131

Query  608  VTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIW  787
            VTMR FGA+LVLTDPTKGMGG VKKA  LLE+TPNA MLQQF+NP NTQ+HY+TTGPEIW
Sbjct  132  VTMRSFGAELVLTDPTKGMGGAVKKANQLLETTPNAFMLQQFNNPANTQVHYDTTGPEIW  191

Query  788  EDTQGNVDIFVM  823
            EDT GNVDIFVM
Sbjct  192  EDTHGNVDIFVM  203



>sp|Q43153.1|CYSC_SPIOL RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase, mitochondrial; AltName: Full=Beta-cyanoalanine synthase; 
Short=SoCAS; AltName: Full=Beta-substituted Ala synthase 
3-1; Short=SPIol-Bsas3-1; AltName: Full=Cysteine synthase 
C; Flags: Precursor [Spinacia oleracea]
 dbj|BAA07177.1| cysteine synthase [Spinacia oleracea]
 dbj|BAG72099.1| mitochondrial cysteine synthase [Spinacia oleracea]
Length=368

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            GTN+K  VSQLIG+TPLVYL+K++EG GAY+A KQEMMQPTAS+KDRPALAMI DAEKKG
Sbjct  46   GTNIKTNVSQLIGRTPLVYLSKISEGSGAYIAVKQEMMQPTASVKDRPALAMIEDAEKKG  105

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP +T LIEPTSGNMGISMAFMAA+KGYKMVLTMPSYTS+ERRV MR FGADL+LTDP
Sbjct  106  LISPGKTVLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSMERRVVMRAFGADLILTDP  165

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             KGMGGTVKKA  LL+STP+  MLQQF+NP NTQ+H+ETTGPEIWEDTQG VDIFVMGI
Sbjct  166  DKGMGGTVKKANQLLDSTPDGFMLQQFNNPANTQVHFETTGPEIWEDTQGKVDIFVMGI  224



>ref|XP_011034251.1| PREDICTED: L-3-cyanoalanine synthase 1, mitochondrial-like, partial 
[Populus euphratica]
Length=209

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = +2

Query  242  ASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTAS  421
            AS SFAQR+RDLP++ PGT +K  VSQLIGKTPLVYLNKVTEGC AY+A KQEM QPT+S
Sbjct  36   ASSSFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCRAYIAVKQEMFQPTSS  95

Query  422  IKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIE  601
            IKDRPALAM+ DAEKK LI+P +TTLIEPTSGNMGISMAFMAA+KGYKM+LTMPSYTS+E
Sbjct  96   IKDRPALAMVEDAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLE  155

Query  602  RRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIH  760
            RRVTMR FGA+L+LTDPTKGMGGTVKKAY LLESTPNA MLQQFSNP NTQ+H
Sbjct  156  RRVTMRAFGAELILTDPTKGMGGTVKKAYELLESTPNAFMLQQFSNPANTQVH  208



>gb|KEH23373.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula]
Length=320

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = +2

Query  311  EVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQ  490
            E   LIG+TPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPALAM+ DAEKK LI+P +
Sbjct  4    ESLDLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASIKDRPALAMMEDAEKKNLITPGK  63

Query  491  TTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGG  670
            T LIEPTSGNMGIS+AFMAA+KGYKMVLTMPSYTS+ERRV MR FGA+L+LTDPTKGMGG
Sbjct  64   TILIEPTSGNMGISLAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGAELILTDPTKGMGG  123

Query  671  TVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            TVKKAY LLESTPNA MLQQFSNP NT++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  124  TVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGI  176



>ref|XP_002883653.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59912.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  272  DLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMI  451
            + P+  P T  K + S LIG+TPLV+LNKVTEGC AY+AAKQE  QPT SIKDRPALAMI
Sbjct  9    EYPKAFPSTKAKGDASMLIGRTPLVFLNKVTEGCEAYIAAKQEHFQPTCSIKDRPALAMI  68

Query  452  LDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGA  631
            +DAEKK LI+P +TTLIEPTSGNMGIS+AFMAA+KGYK+++TMPSYTS+ERRVTMR FGA
Sbjct  69   VDAEKKNLITPGKTTLIEPTSGNMGISLAFMAAMKGYKIIITMPSYTSLERRVTMRSFGA  128

Query  632  DLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
            +LVLTDPTKGMGG VKKAY LLE+TP+A MLQQF+NP NTQ+HY+TTGPEIWEDT GNVD
Sbjct  129  ELVLTDPTKGMGGAVKKAYELLETTPDAFMLQQFNNPANTQVHYDTTGPEIWEDTHGNVD  188

Query  812  IFVM  823
            IFVM
Sbjct  189  IFVM  192



>ref|XP_009401845.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Musa acuminata subsp. malaccensis]
Length=367

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 179/227 (79%), Gaps = 11/227 (5%)
 Frame = +2

Query  158  LMNFIKARKS--SMLQYSCKFFTTQPL-PGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            +M  ++  +S   +L+ +  F T Q + P  ASP+    ++DL     G  +  E +QLI
Sbjct  5    MMELVRRGRSGLHLLRMASPFSTQQAVDPAVASPN----LKDLS----GLRINKEATQLI  56

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            G+TP+VYLNKVTEGC A +AAK E +QP+ S+KDRPA+AMI DAEK GLI+P +TTLIEP
Sbjct  57   GRTPMVYLNKVTEGCHAQIAAKLEYLQPSFSVKDRPAVAMIEDAEKNGLITPGKTTLIEP  116

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGNMGI ++FMAA+KGYK+VLTMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKKAY
Sbjct  117  TSGNMGIGLSFMAALKGYKLVLTMPSYTSLERRVTMRAFGANLVLTDPTKGMGGTVKKAY  176

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             L+ES P+A MLQQF NP N ++H+ETTGPEIW+DT G VDIFVMGI
Sbjct  177  QLMESYPDAFMLQQFENPANVKVHFETTGPEIWDDTLGQVDIFVMGI  223



>gb|AAV48542.1| beta-cyanoalanine synthase [Oryza sativa Indica Group]
 emb|CAC09478.2| H0806H05.11 [Oryza sativa Indica Group]
 gb|EAY93009.1| hypothetical protein OsI_14808 [Oryza sativa Indica Group]
Length=377

 Score =   291 bits (745),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 177/238 (74%), Gaps = 21/238 (9%)
 Frame = +2

Query  155  ALMNFIKARKSSMLQYSCK-------------FFTTQPLPGSASPSFAQRIRDLPRNTPG  295
            ALM+ +  R+ S+LQ   +             FF+T     +A P  +      P   PG
Sbjct  4    ALMSLM--RRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQS------PGILPG  55

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
              ++   SQLIG+TP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEKKGL
Sbjct  56   LKIRDSASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGL  115

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P +TTLIEPTSGNMGI +AFMAA+KGY+++LTMPSYTS+ERRVTMR FGA LVLTDPT
Sbjct  116  ITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPT  175

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KGMGGTV+KA  L E+ P+A MLQQF NP N ++HYETTGPEIWEDT G VDIFVMGI
Sbjct  176  KGMGGTVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGI  233



>ref|XP_010918745.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Elaeis guineensis]
Length=366

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 174/229 (76%), Gaps = 9/229 (4%)
 Frame = +2

Query  149  MAALMNFIKARKS--SMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQ  322
            MA  M  ++   S  S+L+ S  F T Q L    +   + +I DL     G  +K + SQ
Sbjct  1    MARFMELMRKGSSRLSLLKQSFSFSTRQALDSQVT---SPKIGDLS----GIKIKKDASQ  53

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLVYLNKV EGC A VAAK E +Q + S+KDRPA AM+ DAEKKGLI+P +TTLI
Sbjct  54   LIGRTPLVYLNKVCEGCEARVAAKLEFLQSSFSVKDRPAYAMLEDAEKKGLITPGKTTLI  113

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGI +A MA +KGYK+VLTMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTVKK
Sbjct  114  EPTSGNMGIGLACMATLKGYKLVLTMPSYTSLERRVTMRAFGANLVLTDPTKGMGGTVKK  173

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            AY L++S P+A MLQQF NP N ++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  174  AYELMDSYPDAFMLQQFENPANVKVHFETTGPEIWEDTLGQVDIFVMGI  222



>ref|NP_001052135.1| Os04g0165700 [Oryza sativa Japonica Group]
 emb|CAE02117.2| OSJNBa0019G23.9 [Oryza sativa Japonica Group]
 dbj|BAF14049.1| Os04g0165700 [Oryza sativa Japonica Group]
 dbj|BAG95590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   291 bits (745),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 177/238 (74%), Gaps = 21/238 (9%)
 Frame = +2

Query  155  ALMNFIKARKSSMLQYSCK-------------FFTTQPLPGSASPSFAQRIRDLPRNTPG  295
            ALM+ +  R+ S+LQ   +             FF+T     +A P  +      P   PG
Sbjct  4    ALMSLM--RRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQS------PGILPG  55

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
              ++   SQLIG+TP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEKKGL
Sbjct  56   LKIRDSASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGL  115

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P +TTLIEPTSGNMGI +AFMAA+KGY+++LTMPSYTS+ERRVTMR FGA LVLTDPT
Sbjct  116  ITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPT  175

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KGMGGTV+KA  L E+ P+A MLQQF NP N ++HYETTGPEIWEDT G VDIFVMGI
Sbjct  176  KGMGGTVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGI  233



>gb|EAZ29717.1| hypothetical protein OsJ_13780 [Oryza sativa Japonica Group]
Length=386

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 177/238 (74%), Gaps = 21/238 (9%)
 Frame = +2

Query  155  ALMNFIKARKSSMLQYSCK-------------FFTTQPLPGSASPSFAQRIRDLPRNTPG  295
            ALM+ +  R+ S+LQ   +             FF+T     +A P  +      P   PG
Sbjct  4    ALMSLM--RRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQS------PGILPG  55

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
              ++   SQLIG+TP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEKKGL
Sbjct  56   LKIRDSASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGL  115

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P +TTLIEPTSGNMGI +AFMAA+KGY+++LTMPSYTS+ERRVTMR FGA LVLTDPT
Sbjct  116  ITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPT  175

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KGMGGTV+KA  L E+ P+A MLQQF NP N ++HYETTGPEIWEDT G VDIFVMGI
Sbjct  176  KGMGGTVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGI  233



>ref|XP_004975070.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Setaria 
italica]
Length=376

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 171/223 (77%), Gaps = 6/223 (3%)
 Frame = +2

Query  179  RKSSMLQYSCKFFTTQPLPGSASPS-FAQRIRDLPRNTPGT-----NVKPEVSQLIGKTP  340
            R+ S+L       + +      SPS F+ + +      PG      N++   SQLIG+TP
Sbjct  10   RRRSLLHQGAAAASMELASAGGSPSLFSTQQQQAAAADPGVLPAGLNIRDSASQLIGRTP  69

Query  341  LVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGN  520
            +VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEKKGLI+P +TTLIEPTSGN
Sbjct  70   MVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGLITPGKTTLIEPTSGN  129

Query  521  MGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLE  700
            MGI +AFMAA+KGY++VLTMPSYTS+ERRVTMR FGA+LVLTDPTKGMGGTV+KA  L E
Sbjct  130  MGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGANLVLTDPTKGMGGTVRKATELYE  189

Query  701  STPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
              P+A MLQQF NP N +IHYETTGPEIWEDT G VDIFVMGI
Sbjct  190  KHPSAYMLQQFQNPANVKIHYETTGPEIWEDTLGQVDIFVMGI  232



>gb|ABR17848.1| unknown [Picea sitchensis]
Length=383

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+K +VSQL+ +TP+VYLNKVTEGCGAYVAAK EMMQP  SIKDR   AMILDAE+KG
Sbjct  61   GLNLKKDVSQLMARTPIVYLNKVTEGCGAYVAAKLEMMQPCCSIKDRVGYAMILDAEEKG  120

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISPE++ L+EPTSGNMGIS+A++AA +GYK+VLTMPSYTS+ERRVTMR FG++LVLTDP
Sbjct  121  LISPEKSVLVEPTSGNMGISLAYIAASRGYKLVLTMPSYTSLERRVTMRAFGSELVLTDP  180

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             KGMGG +KKA  LL++ PNA MLQQF NP N + H+E+TGPEIWEDT G VDIFVMGI
Sbjct  181  VKGMGGAIKKAADLLQTIPNAFMLQQFDNPANVKAHFESTGPEIWEDTAGQVDIFVMGI  239



>ref|XP_006827554.1| hypothetical protein AMTR_s00009p00219590 [Amborella trichopoda]
 gb|ERM94970.1| hypothetical protein AMTR_s00009p00219590 [Amborella trichopoda]
Length=367

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            NVK  VSQ+IG+TPLVYLNKV+EGCGA++AAK EMMQP  SIKDR  +AMI DAEKK LI
Sbjct  47   NVKKNVSQVIGRTPLVYLNKVSEGCGAHIAAKLEMMQPCCSIKDRVGIAMIEDAEKKKLI  106

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            SP++T LIEPTSGNMGI ++F+AA KGYK++LTMPSYTS+ERRVTMRVFG++LVLTDPTK
Sbjct  107  SPDKTILIEPTSGNMGIGLSFIAASKGYKLILTMPSYTSLERRVTMRVFGSELVLTDPTK  166

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            GMGG VKKA  L ESTPN+ MLQQF NP N ++H+ETTGPEIWEDT G VDIFVM I
Sbjct  167  GMGGAVKKATQLHESTPNSFMLQQFENPSNVKVHFETTGPEIWEDTLGQVDIFVMAI  223



>ref|XP_002447473.1| hypothetical protein SORBIDRAFT_06g001610 [Sorghum bicolor]
 gb|EES11801.1| hypothetical protein SORBIDRAFT_06g001610 [Sorghum bicolor]
Length=386

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  290  PGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKK  469
            PG  ++   SQLIG+TP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEK+
Sbjct  63   PGLKIRDSASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKR  122

Query  470  GLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTD  649
            GLI+P +TTLIEPTSGNMGI +AFMAA+KGY+++LTMPSYTS+ERRVTMR FGA+LVLTD
Sbjct  123  GLITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGANLVLTD  182

Query  650  PTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            PTKGMGGTV+KA  L E  P+A MLQQF NP N ++HYETTGPEIWEDT G VDIFVMGI
Sbjct  183  PTKGMGGTVRKAAELYEKHPSAYMLQQFQNPANVKVHYETTGPEIWEDTLGQVDIFVMGI  242



>ref|NP_001136599.1| cysteine synthase [Zea mays]
 gb|ACF82244.1| unknown [Zea mays]
 tpg|DAA38629.1| TPA: cysteine synthase [Zea mays]
Length=309

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  290  PGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKK  469
            PG  ++   SQLIG+TP+VYLNKVTEGCGA VAAK E +QP+ S+KDRPA++M+ DAEK+
Sbjct  59   PGLKIRDSASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMLEDAEKR  118

Query  470  GLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTD  649
            GLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRVTMR FGA+LVLTD
Sbjct  119  GLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGANLVLTD  178

Query  650  PTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            P KGMGGTV+KA  L E  P+A MLQQF NP N ++HY+TTGPEIWEDT G VDIFVMGI
Sbjct  179  PAKGMGGTVRKATELYERHPSAHMLQQFQNPANVKVHYDTTGPEIWEDTLGQVDIFVMGI  238



>gb|ACG34624.1| cysteine synthase [Zea mays]
Length=382

 Score =   286 bits (732),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  290  PGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKK  469
            PG  ++   SQLIG+TP+VYLNKVTEGCGA VAAK E +QP+ S+KDRPA++M+ DAEK+
Sbjct  59   PGLKIRDSASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMLEDAEKR  118

Query  470  GLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTD  649
            GLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRVTMR FGA+LVLTD
Sbjct  119  GLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGANLVLTD  178

Query  650  PTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            P KGMGGTV+KA  L E  P+A MLQQF NP N ++HY+TTGPEIWEDT G VDIFVMGI
Sbjct  179  PAKGMGGTVRKATELYERHPSAHMLQQFQNPANVKVHYDTTGPEIWEDTLGQVDIFVMGI  238



>ref|XP_008667338.1| PREDICTED: cysteine synthase isoform X1 [Zea mays]
 gb|ACN32017.1| unknown [Zea mays]
 gb|ADG60236.1| beta-cyanoalanine synthase [Zea mays]
 tpg|DAA38628.1| TPA: cysteine synthase [Zea mays]
Length=382

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  290  PGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKK  469
            PG  ++   SQLIG+TP+VYLNKVTEGCGA VAAK E +QP+ S+KDRPA++M+ DAEK+
Sbjct  59   PGLKIRDSASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMLEDAEKR  118

Query  470  GLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTD  649
            GLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRVTMR FGA+LVLTD
Sbjct  119  GLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGANLVLTD  178

Query  650  PTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            P KGMGGTV+KA  L E  P+A MLQQF NP N ++HY+TTGPEIWEDT G VDIFVMGI
Sbjct  179  PAKGMGGTVRKATELYERHPSAHMLQQFQNPANVKVHYDTTGPEIWEDTLGQVDIFVMGI  238



>ref|XP_006653160.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase, 
mitochondrial-like [Oryza brachyantha]
Length=365

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +2

Query  278  PRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILD  457
            P   PG  ++   SQLIG+TP+VYLNKVTEGCGA VAAK E +QP+ S+KDRPAL+M+ D
Sbjct  38   PGVLPGIRIRDTASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPALSMLED  97

Query  458  AEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADL  637
            AE+K LI+P +TTLIEPTSGNMGI +AFMAA+KGY+++LTMPSYTS+ERRVTMR FGA L
Sbjct  98   AERKRLITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKL  157

Query  638  VLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            VLTDPTKGMGGTV+KA  L E+ P+A MLQQF NP N ++HYETTGPEIWEDT G VDIF
Sbjct  158  VLTDPTKGMGGTVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGEVDIF  217

Query  818  VMGI  829
            VMGI
Sbjct  218  VMGI  221



>gb|ADG60234.1| beta-cyanoalanine synthase [Triticum aestivum]
Length=378

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = +2

Query  281  RNTPGT-NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILD  457
             + PG  N++   + LIG+TPLVYLNKVTEGCGA VAAK E +QP+ S+KDRPA++MI D
Sbjct  51   EDHPGVLNIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIED  110

Query  458  AEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADL  637
            AEKKGLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRV M+ FGA L
Sbjct  111  AEKKGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQL  170

Query  638  VLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            VLTDP KGMGGTV+KA  L E+ P+A MLQQF NP N Q+HYETTGPEIWEDT G VDIF
Sbjct  171  VLTDPAKGMGGTVRKATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIF  230

Query  818  VMGI  829
            VMGI
Sbjct  231  VMGI  234



>dbj|BAJ98194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = +2

Query  290  PGT-NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEK  466
            PG  N++   + LIG+TPLVYLNKVTEGCGA VAAK E +QP+ S+KDRPA++MI DAEK
Sbjct  49   PGVLNIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIEDAEK  108

Query  467  KGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  646
            KGLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRV M+ FGA LVLT
Sbjct  109  KGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQLVLT  168

Query  647  DPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMG  826
            DP KGMGGTV+KA  L E+ P+A MLQQF NP N Q+HYETTGPEIWEDT G VDIFVMG
Sbjct  169  DPAKGMGGTVRKATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIFVMG  228

Query  827  I  829
            I
Sbjct  229  I  229



>gb|EMT13011.1| Cysteine synthase, chloroplastic/chromoplastic [Aegilops tauschii]
Length=378

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = +2

Query  281  RNTPGT-NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILD  457
             + PG  N++   + LIG+TPLVYLNKVTEGCGA VAAK E +QP+ S+KDRPA++MI D
Sbjct  51   EDHPGVLNIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIED  110

Query  458  AEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADL  637
            AEKKGLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRV M+ FGA L
Sbjct  111  AEKKGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQL  170

Query  638  VLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            VLTDP KGMGGTV+KA  L E+ P+A MLQQF NP N Q+HYETTGPEIWEDT G VDIF
Sbjct  171  VLTDPAKGMGGTVRKATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIF  230

Query  818  VMGI  829
            VMGI
Sbjct  231  VMGI  234



>ref|XP_008801328.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Phoenix dactylifera]
Length=364

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +K + SQLIG+TPLVYLNK+ EGC A VAAK E +QP+ S+KDRPA AM+ DAEKKGL
Sbjct  43   SGIKKDASQLIGRTPLVYLNKICEGCEARVAAKLEFLQPSFSVKDRPAYAMLEDAEKKGL  102

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P +TTLIEPTSGNMGI +A MA +KGYK+VLTMPSYTS+ERRVTMR FGA+LVLTDP 
Sbjct  103  ITPGKTTLIEPTSGNMGIGLACMATLKGYKLVLTMPSYTSLERRVTMRAFGANLVLTDPA  162

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KGMGGTVKKAY L++S P+A MLQQF NP N ++H+ETTGPEIWEDT G VDIFVMGI
Sbjct  163  KGMGGTVKKAYELMDSYPDAFMLQQFENPANVKVHFETTGPEIWEDTLGKVDIFVMGI  220



>ref|XP_003579777.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Brachypodium distachyon]
Length=378

 Score =   281 bits (719),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +2

Query  290  PGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKK  469
            P   ++   + LIG+TPLVYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEKK
Sbjct  55   PALKIRDTAAHLIGRTPLVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMMEDAEKK  114

Query  470  GLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTD  649
            GLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRV MR FGA LVLTD
Sbjct  115  GLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMRAFGAQLVLTD  174

Query  650  PTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            P KGMGGTV+KA  L E+ P+A MLQQF NP N ++HYETTGPEIWEDT G VDIFVMGI
Sbjct  175  PAKGMGGTVRKATQLYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGI  234



>gb|EMS53577.1| Cysteine synthase, chloroplastic/chromoplastic [Triticum urartu]
Length=339

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TPLVYLN+VTEGCGA VAAK E +QP+ S+KDRPA++MI DAEKKGLI+P +TTLI
Sbjct  27   LIGRTPLVYLNRVTEGCGARVAAKLEFLQPSFSVKDRPAISMIEDAEKKGLITPGKTTLI  86

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRV M+ FGA LVLTDP KGMGGTV+K
Sbjct  87   EPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQLVLTDPAKGMGGTVRK  146

Query  683  AYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            A  L E+ P+A MLQQF NP N Q+HYETTGPEIWEDT G VDIFVMGI
Sbjct  147  ATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIFVMGI  195



>gb|ABK23130.1| unknown [Picea sitchensis]
Length=307

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  341  LVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGN  520
            +VYLNKVTEGCGAYVAAK EMMQP  SIKDR   AMILDAE+KGLISPE++ L+EPTSGN
Sbjct  1    MVYLNKVTEGCGAYVAAKLEMMQPCCSIKDRVGYAMILDAEEKGLISPEKSVLVEPTSGN  60

Query  521  MGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLE  700
            MGI+++++AA +GYK+VLTMPSYTS+ERRVTMR FG++LVLTDP KGMGG VKKA  LL+
Sbjct  61   MGIALSYIAASRGYKLVLTMPSYTSLERRVTMRAFGSELVLTDPVKGMGGAVKKAADLLQ  120

Query  701  STPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            STPNA MLQQF NP N + H+ETTGPEIWEDT G VDIFVMGI
Sbjct  121  STPNAFMLQQFDNPANVKAHFETTGPEIWEDTAGQVDIFVMGI  163



>gb|ADG60235.1| beta-cyanoalanine synthase [Hordeum vulgare]
Length=372

 Score =   273 bits (697),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = +2

Query  281  RNTPGT-NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILD  457
            +  PG  N++   + LIG+TPLVYLNKVTEGCGA VAAK E +QP+ S+KDRPA++MI D
Sbjct  45   QEDPGVLNIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIED  104

Query  458  AEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADL  637
            AEKKGLI+P +TTLIEPTSGNMGI +AFMAA+KGY++VLTMPSYTS+ERRV M+ FGA L
Sbjct  105  AEKKGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQL  164

Query  638  VLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            VLTDP  G  GT +KA  L ++ P+A MLQQF NP N Q+HYETTGPEIWEDT G VDIF
Sbjct  165  VLTDPXXGXXGTXRKATQLYDNHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIF  224

Query  818  VMGI  829
            VMGI
Sbjct  225  VMGI  228



>gb|KCW71586.1| hypothetical protein EUGRSUZ_E00118 [Eucalyptus grandis]
 gb|KCW71587.1| hypothetical protein EUGRSUZ_E00118 [Eucalyptus grandis]
Length=287

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  401  MMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTM  580
            MMQPT+SIKDRPALAMI DAEKK LISP +TTLIEPTSGNMGISMAFMAA+KGYKM+LTM
Sbjct  1    MMQPTSSIKDRPALAMINDAEKKNLISPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTM  60

Query  581  PSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIH  760
            PSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVKKAY LLESTPNA MLQQFSNP N+Q+H
Sbjct  61   PSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAHMLQQFSNPANSQVH  120

Query  761  YETTGPEIWEDTQGNVDIFVMGI  829
            +ETTGPEIWEDT G VDIFVMGI
Sbjct  121  FETTGPEIWEDTNGQVDIFVMGI  143



>ref|XP_004138496.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like isoform 
2 [Cucumis sativus]
 ref|XP_004171007.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Cucumis 
sativus]
Length=287

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  401  MMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTM  580
            MMQPT+SIKDRPA AMI DAEKKGLI+P +TTLIEPTSGNMGISMAFMA +KGYKMVLTM
Sbjct  1    MMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMATLKGYKMVLTM  60

Query  581  PSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIH  760
            PSYTS+ERRVTMR FGA+L+LTDPTKGMGGTVKKAY LLESTP+  MLQQF+NP NTQ+H
Sbjct  61   PSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYDLLESTPDGFMLQQFANPANTQVH  120

Query  761  YETTGPEIWEDTQGNVDIFVMGI  829
            +ETTGPEIWEDT G VDIFVMGI
Sbjct  121  FETTGPEIWEDTNGQVDIFVMGI  143



>gb|ACH58417.1| beta-cyanoalanine synthase 1, partial [Prunus dulcis]
Length=144

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  323  LIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLI  502
            LIG+TP+VYLNKVTEGCGAY+A KQEM QPT+SIKDRPAL+MI DAEKKGLI+P +T L+
Sbjct  1    LIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTSSIKDRPALSMINDAEKKGLITPGKTVLV  60

Query  503  EPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKK  682
            EPTSGNMGISMAFMAA++GYKMVLTMPSYTS+ERRV MR FGA+L+LTDP +GMGGTVKK
Sbjct  61   EPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRAFGAELILTDPARGMGGTVKK  120

Query  683  AYALLESTPNAVMLQQFSNPVNTQ  754
            AY LLESTPNA MLQQFSNP NTQ
Sbjct  121  AYDLLESTPNAHMLQQFSNPANTQ  144



>ref|XP_003623997.1| Cysteine synthase [Medicago truncatula]
 gb|AES80215.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula]
Length=287

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  401  MMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTM  580
            MMQPTASIKDRPALAM+ DAEKK LI+P +T LIEPTSGNMGIS+AFMAA+KGYKMVLTM
Sbjct  1    MMQPTASIKDRPALAMMEDAEKKNLITPGKTILIEPTSGNMGISLAFMAAMKGYKMVLTM  60

Query  581  PSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIH  760
            PSYTS+ERRV MR FGA+L+LTDPTKGMGGTVKKAY LLESTPNA MLQQFSNP NT++H
Sbjct  61   PSYTSLERRVCMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPANTKVH  120

Query  761  YETTGPEIWEDTQGNVDIFVMGI  829
            +ETTGPEIWEDT G VDIFVMGI
Sbjct  121  FETTGPEIWEDTNGQVDIFVMGI  143



>ref|XP_008244658.1| PREDICTED: L-3-cyanoalanine synthase 1, mitochondrial isoform 
X2 [Prunus mume]
Length=287

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  401  MMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTM  580
            M QPT+SIKDRPAL+MI DAEK+GLI+P +T L+EPTSGNMGISMAFMAA++GYKMVLTM
Sbjct  1    MFQPTSSIKDRPALSMINDAEKRGLITPGKTVLVEPTSGNMGISMAFMAAMRGYKMVLTM  60

Query  581  PSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIH  760
            PSYTS+ERRV MR FGA+L+LTDP +GMGGTVKKAY LLESTPNA MLQQFSNP NTQ+H
Sbjct  61   PSYTSLERRVCMRAFGAELILTDPARGMGGTVKKAYDLLESTPNAHMLQQFSNPANTQVH  120

Query  761  YETTGPEIWEDTQGNVDIFVMGI  829
            +ETTGPEIWEDT G VDIFVMGI
Sbjct  121  FETTGPEIWEDTDGQVDIFVMGI  143



>ref|XP_009401140.1| PREDICTED: cysteine synthase-like [Musa acuminata subsp. malaccensis]
Length=384

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE++G+I
Sbjct  66   NIAEDVSQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEQRGVI  125

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  SIERRV ++ FGA+LVLTD  K
Sbjct  126  TPGESILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLLKAFGAELVLTDSAK  185

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGIGSG  838
            GM G V+KA  +L +TPNA MLQQF NP N +IHYE+TGPEIWEDT+G VDIFV G+G+G
Sbjct  186  GMKGAVQKAEEILNNTPNAYMLQQFDNPANPKIHYESTGPEIWEDTRGKVDIFVAGVGTG  245

Query  839  GT  844
            GT
Sbjct  246  GT  247



>ref|XP_007153729.1| hypothetical protein PHAVU_003G060200g [Phaseolus vulgaris]
 gb|ESW25723.1| hypothetical protein PHAVU_003G060200g [Phaseolus vulgaris]
Length=326

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  239  SASPSFAQRIRDLPR-NTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPT  415
            S SP F + +   P+    G N+  +V+QLIGKTP+VYLN +T+G  A +AAK E+M+P 
Sbjct  48   SPSPVFCKAVSVKPQTEIEGLNIAEDVTQLIGKTPMVYLNNITKGSVANIAAKLEIMEPC  107

Query  416  ASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTS  595
             S+KDR  L+MI DAE++G I+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S
Sbjct  108  CSVKDRIGLSMINDAEQRGAITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMS  167

Query  596  IERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTG  775
            +ERRV ++ FGA+LVLTD  KGM G V+KA  +L++TPNA +LQQF NP N ++H+ETTG
Sbjct  168  LERRVLLKAFGAELVLTDAAKGMNGAVQKAEEILKNTPNAYILQQFDNPSNPKVHFETTG  227

Query  776  PEIWEDTQGNVDIFVMGIGSGGT  844
            PEIWEDT+G +DI V GIG+GGT
Sbjct  228  PEIWEDTRGKIDILVAGIGTGGT  250



>ref|XP_010242705.1| PREDICTED: cysteine synthase-like [Nelumbo nucifera]
Length=385

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  65   GLNIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEQKG  124

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            +I+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  125  VITPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRVLLKAFGAELVLTDP  184

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            TKGM G V+KA  +L+S PNA MLQQF NP N +IHYETTGPEIWEDT G VDIFV
Sbjct  185  TKGMKGAVQKAEEILKSIPNAYMLQQFDNPANPKIHYETTGPEIWEDTSGKVDIFV  240



>ref|XP_010524184.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Tarenaya hassleriana]
Length=398

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +VSQLIG+TP+VYLN +  GC A VA K E+M+P  S+KDR   +MI DAE+KG
Sbjct  78   GLNIADDVSQLIGRTPMVYLNNIVNGCVANVAVKLEIMEPCCSVKDRIGYSMITDAEQKG  137

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI++AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  138  LITPGKSVLVEPTSGNTGIALAFIAAAKGYKLILTMPASMSLERRVLLKAFGAELVLTDP  197

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L+STPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  AKGMTGAIQKAEQILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFV  253



>dbj|BAP47504.1| O-acetylserine (thiol)lyase [Gentiana triflora]
Length=393

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +2

Query  251  SFAQRIRDLPRNT-PGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIK  427
            SF Q+   LP+    G N+  +V+QLIGKTP+VYLN + +G  A++AAK E+M+P  S+K
Sbjct  61   SFEQK---LPKTAIDGVNIAEDVTQLIGKTPMVYLNSIVKGSLAHIAAKLEIMEPCCSVK  117

Query  428  DRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERR  607
            DR   +MI DAE+KGLISP ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERR
Sbjct  118  DRIGYSMITDAEQKGLISPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERR  177

Query  608  VTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIW  787
            V ++ FGADLVLTDP KGM G V+KA  +L STPNA MLQQF NP N ++HYETTGPEIW
Sbjct  178  VLLKAFGADLVLTDPAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKVHYETTGPEIW  237

Query  788  EDTQGNVDIFV  820
            EDT G VDI V
Sbjct  238  EDTSGTVDILV  248



>gb|KDP35151.1| hypothetical protein JCGZ_10685 [Jatropha curcas]
Length=395

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI+DAEK+G
Sbjct  75   GLNIAEDVTQLIGKTPMVYLNNIAKGSVANIAAKLEIMEPCCSVKDRIGYSMIIDAEKRG  134

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            +I+PE++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  135  VITPEKSILVEPTSGNTGIGLAFIAASRGYRLILTMPASMSLERRVLLKAFGAELVLTDP  194

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIF+
Sbjct  195  AKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFI  250



>ref|XP_010512249.1| PREDICTED: cysteine synthase, mitochondrial [Camelina sativa]
Length=431

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLNK+ +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  111  GLNIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  170

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  171  LIAPGKSVLVEPTSGNTGIGLAFIAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDP  230

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIWEDT G VDIFV
Sbjct  231  AKGMTGAVQKAEEILKTTPDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFV  286



>gb|KFK35189.1| hypothetical protein AALP_AA5G251700 [Arabis alpina]
Length=425

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +2

Query  287  TPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEK  466
            T G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+
Sbjct  103  TDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQ  162

Query  467  KGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  646
            KGLISP ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLT
Sbjct  163  KGLISPGKSVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSMERRVLLKAFGAELVLT  222

Query  647  DPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            DP KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  223  DPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  280



>gb|KHN32353.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=351

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  287  TPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEK  466
            T G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE+
Sbjct  29   TEGLNIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQ  88

Query  467  KGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  646
            +G I+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLT
Sbjct  89   RGAITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLT  148

Query  647  DPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMG  826
            D  KGM G V+KA  +L+STPN+ MLQQF NP N ++HYETTGPEIWEDT+G +DI V G
Sbjct  149  DAAKGMNGAVQKAEEILKSTPNSYMLQQFDNPSNPKVHYETTGPEIWEDTRGKIDILVAG  208

Query  827  IGSGGT  844
            IG+GGT
Sbjct  209  IGTGGT  214



>ref|XP_008800744.1| PREDICTED: cysteine synthase-like [Phoenix dactylifera]
Length=397

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G NV  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  77   GLNVAEDVTQLIGKTPMVYLNNILKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEEKG  136

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  SIERRV ++ FGA+LVLTD 
Sbjct  137  LITPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLLKAFGAELVLTDS  196

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TPNA MLQQF NP N ++HYETTGPEIWEDT+G VDIFV
Sbjct  197  AKGMKGAVQKAEEILKNTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFV  252



>ref|XP_003518876.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 
1 [Glycine max]
Length=394

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  287  TPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEK  466
            T G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE+
Sbjct  72   TEGLNIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQ  131

Query  467  KGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  646
            +G I+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLT
Sbjct  132  RGAITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLT  191

Query  647  DPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMG  826
            D  KGM G V+KA  +L+STPN+ MLQQF NP N ++HYETTGPEIWEDT+G +DI V G
Sbjct  192  DAAKGMNGAVQKAEEILKSTPNSYMLQQFDNPSNPKVHYETTGPEIWEDTRGKIDILVAG  251

Query  827  IGSGGT  844
            IG+GGT
Sbjct  252  IGTGGT  257



>ref|XP_010930274.1| PREDICTED: cysteine synthase [Elaeis guineensis]
Length=397

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  77   GLNIAEDVSQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGNSMIADAEEKG  136

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  SIERRV  + FGA+LVLTD 
Sbjct  137  LITPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLFKAFGAELVLTDS  196

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIF+
Sbjct  197  AKGMKGAVQKAEEILKNTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFI  252



>gb|ABK23255.1| unknown [Picea sitchensis]
 gb|ACN40960.1| unknown [Picea sitchensis]
Length=325

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+ LIGKTP+VYLNKV +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  5    GINIAKDVTDLIGKTPMVYLNKVADGCVAKIAAKLEIMEPCCSVKDRIGYSMISDAEEKG  64

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI P ++ L+EPTSGN GI +AF+AA KGYK++LTMPS  SIERRV +R FGA+L+LTDP
Sbjct  65   LIIPGRSILVEPTSGNTGIGLAFIAAAKGYKLILTMPSSMSIERRVLLRAFGAELILTDP  124

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             +GM G V+KA  ++E TPNA MLQQF NP N +IHYE+TGPEIW+DT G +D FV
Sbjct  125  ARGMKGAVQKAEEIVEKTPNAYMLQQFENPSNPKIHYESTGPEIWQDTAGQIDAFV  180



>sp|Q9LJA0.2|CYSK2_ARATH RecName: Full=Putative inactive cysteine synthase 2; AltName: 
Full=Beta-substituted Ala synthase 1;2; Short=ARAth-Bsas1;2; 
AltName: Full=O-acetylserine (thiol)-lyase 4 [Arabidopsis 
thaliana]
 gb|ACB88823.1| At3g22460 [Arabidopsis thaliana]
Length=188

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIG TPLVYLNKV + C  +VAAK EMM+P +S+KDR   +MI DAE KGLI 
Sbjct  8    IAKDVTELIGNTPLVYLNKVAKDCVGHVAAKLEMMEPCSSVKDRIGYSMIADAEAKGLIK  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN G+ +AF AA KGYK+V+TMP+  SIERR+ +  FGA+L+LTDP KG
Sbjct  68   PGESVLIEPTSGNTGVGLAFTAAAKGYKLVITMPASMSIERRIILLAFGAELILTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGIGSGG  841
            M G V KA  +L  TPN  MLQQF NP N +IHYETTGPEIW+ + G VD FV GIG+GG
Sbjct  128  MKGAVAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGSGGKVDGFVSGIGTGG  187

Query  842  T  844
            T
Sbjct  188  T  188



>ref|XP_009138900.1| PREDICTED: cysteine synthase, mitochondrial [Brassica rapa]
Length=422

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  102  GLNIAENVSQLIGKTPMVYLNSMAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  161

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDP
Sbjct  162  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDP  221

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  222  AKGMTGAVQKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  277



>ref|XP_006290351.1| hypothetical protein CARUB_v10017296mg [Capsella rubella]
 gb|EOA23249.1| hypothetical protein CARUB_v10017296mg [Capsella rubella]
Length=432

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  112  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  171

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP ++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  172  LISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDP  231

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  232  AKGMTGAVQKAEEVLKTTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  287



>emb|CDY45790.1| BnaC04g22760D [Brassica napus]
Length=427

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  107  GLNIAQNVSQLIGKTPMVYLNSMAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  166

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDP
Sbjct  167  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDP  226

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  227  AKGMTGAVQKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  282



>ref|XP_002878288.1| O-acetylserine (thiol) lyase isoform C [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54547.1| O-acetylserine (thiol) lyase isoform C [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+ G
Sbjct  115  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQNG  174

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP ++ L+EPTSGN GI +AF+AA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDP
Sbjct  175  LISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDP  234

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L++TP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  235  AKGMTGAVHKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  290



>emb|CDX89032.1| BnaA04g01540D [Brassica napus]
Length=429

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  109  GLNIAENVSQLIGKTPMVYLNSMAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  168

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDP
Sbjct  169  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDP  228

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  229  AKGMTGAVQKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  284



>ref|XP_010025067.1| PREDICTED: cysteine synthase-like [Eucalyptus grandis]
Length=228

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V+++IGKTPLVYLN V EGC A +AAK EMM+P +S+KDR   +MI DAE+KGLI 
Sbjct  12   IAKDVTEIIGKTPLVYLNHVVEGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIK  71

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN GI +AFMAA KGYK+V+TMP+  S+ERR  +R FGA+LVLTDP +G
Sbjct  72   PGESVLIEPTSGNTGIGLAFMAAAKGYKLVITMPASMSLERRTILRAFGAELVLTDPARG  131

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G VKKA  +LE TPNA MLQQF NP N +IHYETTGPEIW+ + G VD  V
Sbjct  132  MKGAVKKAEEILERTPNAYMLQQFENPANPKIHYETTGPEIWKGSGGKVDALV  184



>gb|KCW46035.1| hypothetical protein EUGRSUZ_L00009 [Eucalyptus grandis]
Length=362

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG+TP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  90   GLNIAEDVTQLIGRTPMVYLNNLVKGCVANVAAKLEIMEPCCSVKDRIGHSMIADAERKG  149

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV  + FGA+LVLTD 
Sbjct  150  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLFKAFGAELVLTDA  209

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L STPNA MLQQF NP N ++HYETTGPEIWEDT+G VDIF+
Sbjct  210  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFI  265



>ref|NP_001235131.1| OAS-TL4 cysteine synthase [Glycine max]
 gb|ABQ88339.1| OAS-TL4 cysteine synthase [Glycine max]
 gb|ABQ88340.1| OAS-TL4 cysteine synthase [Glycine max]
Length=389

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  69   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRG  128

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  129  AITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDA  188

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGIG  832
             KGM G V+KA  +L+STPN+ MLQQF NP + ++HYETTGPEIWEDT+G +DI V GIG
Sbjct  189  AKGMNGAVQKAEEILKSTPNSYMLQQFDNPSDPKVHYETTGPEIWEDTKGKIDILVAGIG  248

Query  833  SGGT  844
            +GGT
Sbjct  249  TGGT  252



>ref|XP_002949438.1| hypothetical protein VOLCADRAFT_89892 [Volvox carteri f. nagariensis]
 gb|EFJ49457.1| hypothetical protein VOLCADRAFT_89892 [Volvox carteri f. nagariensis]
Length=361

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +V+QLIGKTP+VYLNKVT+GC A +AAK E+M+P  S+KDR   +MI  AEK GLI
Sbjct  42   NIASDVTQLIGKTPMVYLNKVTDGCVAKIAAKLEIMEPCCSVKDRIGYSMISAAEKDGLI  101

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P +TTL+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERR+ +R FGA+LVLTDP K
Sbjct  102  TPGKTTLVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSMERRILLRAFGAELVLTDPAK  161

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V KA  +L STP+A MLQQF NP N ++HYETTGPEIW+ T+G VDI V
Sbjct  162  GMKGAVAKAEEILASTPDAFMLQQFQNPNNPKVHYETTGPEIWDATEGAVDILV  215



>ref|XP_006442163.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
 gb|ESR55403.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
Length=309

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  71   GLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKG  130

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  131  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDS  190

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
             KGM G V+KA  +L STPNA MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  191  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVD  243



>ref|XP_010526597.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Tarenaya hassleriana]
Length=402

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +VSQLIG+TP+VYLN + +GC A VA K E+M+P  S+KDR   +M+ DAE+KGLI
Sbjct  84   NIAEDVSQLIGRTPMVYLNNIVKGCVANVAVKLEIMEPCCSVKDRIGYSMVTDAEQKGLI  143

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+EPTSGN GI++AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDP K
Sbjct  144  TPGKSVLVEPTSGNTGIALAFIAAAKGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  203

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM   ++KA  +L+STPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  204  GMTAAIQKAEQILKSTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFV  257



>ref|NP_001275189.1| cysteine synthase, chloroplastic/chromoplastic [Solanum tuberosum]
 dbj|BAB20863.1| plastidic cysteine synthase 2 [Solanum tuberosum]
Length=376

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI+DAE+KG
Sbjct  66   GLNIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKG  125

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  126  LISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDP  185

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  186  AKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  241



>gb|KDO41593.1| hypothetical protein CISIN_1g021570mg [Citrus sinensis]
 gb|KDO41594.1| hypothetical protein CISIN_1g021570mg [Citrus sinensis]
Length=311

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  71   GLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKG  130

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  131  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDS  190

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
             KGM G V+KA  +L STPNA MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  191  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVD  243



>sp|O81155.1|CYSKP_SOLTU RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=CSase B; Short=CS-B; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL B; Flags: Precursor [Solanum tuberosum]
 gb|AAC25636.1| cysteine synthase [Solanum tuberosum]
Length=386

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI+DAE+KG
Sbjct  66   GLNIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKG  125

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  126  LISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDP  185

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  186  AKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  241



>ref|XP_004244764.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Solanum 
lycopersicum]
Length=386

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI+DAE+KG
Sbjct  66   GLNIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKG  125

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  126  LISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDP  185

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  186  AKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  241



>emb|CAA47329.1| cysteine synthase [Spinacia oleracea]
Length=383

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 8/222 (4%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNT-PGTNVKPEVSQLIGK  334
            L NF     SS+   SC  F       S+SP   + +   P +T  G N+  +VSQLIGK
Sbjct  25   LANFRVGPPSSL---SCNNFKKV----SSSPITCKAVSLSPPSTIEGLNIAEDVSQLIGK  77

Query  335  TPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTS  514
            TP+VYLN V++G  A +AAK E M+P  S+KDR   +MI DAE+KG+I+P +TTL+EPTS
Sbjct  78   TPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTS  137

Query  515  GNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYAL  694
            GN GI +AF+AA +GYK+ LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V+KA  +
Sbjct  138  GNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAELVLTDPAKGMKGAVEKAEEI  197

Query  695  LESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            L+ TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  LKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  239



>ref|XP_006351051.1| PREDICTED: cysteine synthase isoform X1 [Solanum tuberosum]
Length=386

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI+DAE+KG
Sbjct  66   GLNIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKG  125

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  126  LISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDP  185

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  186  VKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  241



>sp|P31300.1|CYSKP_CAPAN RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=CSase B; Short=CS-B; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL B; Flags: Precursor [Capsicum annuum]
 emb|CAA46086.1| O-acetylserine (thiol)-lyase [Capsicum annuum]
Length=374

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +2

Query  278  PRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILD  457
            P    G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI D
Sbjct  59   PTEIEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISD  118

Query  458  AEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADL  637
            AE+KGLISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+L
Sbjct  119  AEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAEL  178

Query  638  VLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            VLTDP KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI 
Sbjct  179  VLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDIL  238

Query  818  V  820
            V
Sbjct  239  V  239



>dbj|BAB20862.1| plastidic cysteine synthase 1 [Solanum tuberosum]
Length=386

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI+DAE+KG
Sbjct  66   GLNIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKG  125

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  126  LISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDP  185

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  186  AKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  241



>dbj|BAG72098.1| chloroplast cysteine synthase [Spinacia oleracea]
Length=384

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 8/222 (4%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNT-PGTNVKPEVSQLIGK  334
            L NF     SS+   SC  F       S+SP   + +   P +T  G N+  +VSQLIGK
Sbjct  25   LANFRVGPPSSL---SCNNFKKV----SSSPITCKAVSLSPPSTIEGLNIAEDVSQLIGK  77

Query  335  TPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTS  514
            TP+VYLN V++G  A +AAK E M+P  S+KDR   +MI DAE+KG+I+P +TTL+EPTS
Sbjct  78   TPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTS  137

Query  515  GNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYAL  694
            GN GI +AF+AA +GYK+ LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V+KA  +
Sbjct  138  GNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAELVLTDPAKGMKGAVEKAEEI  197

Query  695  LESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            L+ TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  LKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  239



>ref|XP_010089187.1| putative cysteine synthase [Morus notabilis]
 gb|EXC36158.1| putative cysteine synthase [Morus notabilis]
Length=373

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 152/218 (70%), Gaps = 3/218 (1%)
 Frame = +2

Query  164  NFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPL  343
            +F   R    + +S   F+ + L    SP FA R  DL  +    N+  +V+QLIG+TP+
Sbjct  24   HFAILRPQISVLFSNGGFSRRNLRVRRSPVFATR-EDL--DFDAVNIAEDVTQLIGRTPM  80

Query  344  VYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNM  523
            +YLN VTEGC A VAAK E M+P  S+KDR   +MI  AE  G ISP +T L+EPTSGN 
Sbjct  81   IYLNNVTEGCVANVAAKLESMEPCRSVKDRIGYSMITSAEDSGAISPGKTILVEPTSGNT  140

Query  524  GISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLES  703
            G+ +AF+AA KGYK+++TMP+  S+ERRV +R FGAD+VLTDP KG+ G V KA  ++ S
Sbjct  141  GLGIAFIAATKGYKLIVTMPASISLERRVLLRAFGADIVLTDPDKGLKGAVDKAKEIILS  200

Query  704  TPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            TPN+ MLQQF N  NTQIH+ETTGPEIWEDT GNVDI 
Sbjct  201  TPNSYMLQQFDNIANTQIHFETTGPEIWEDTMGNVDIL  238



>gb|AIL49301.1| cysteine synthase isoform 1 [Capsicum annuum]
Length=384

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +2

Query  278  PRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILD  457
            P    G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI D
Sbjct  59   PTEIEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISD  118

Query  458  AEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADL  637
            AE+KGLISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+L
Sbjct  119  AEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAEL  178

Query  638  VLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            VLTDP KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPEIWEDT+G +DI 
Sbjct  179  VLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDIL  238

Query  818  V  820
            V
Sbjct  239  V  239



>gb|EPS66884.1| cysteine synthase, partial [Genlisea aurea]
Length=257

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  DLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMI  451
            D      G N+  +V+QLIG+TP+VYLN+V +GC A +AAK E M+P  S+KDR   +MI
Sbjct  6    DAETQVEGLNIAEDVTQLIGRTPMVYLNRVVKGCVANIAAKLESMEPCCSVKDRIGYSMI  65

Query  452  LDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGA  631
             DAE+KGLISP +TTL+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA
Sbjct  66   ADAEEKGLISPGKTTLVETTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGA  125

Query  632  DLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
            +L +TDP KG+ G ++KA  +L  TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  126  ELFITDPAKGVAGALEKAEEILRKTPNSYMLQQFENPANPKIHYETTGPEIWEDTKGKVD  185

Query  812  IFV  820
            I V
Sbjct  186  ILV  188



>sp|P32260.2|CYSKP_SPIOL RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=CSase B; Short=CS-B; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL B; Flags: Precursor [Spinacia oleracea]
Length=383

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 8/222 (4%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNT-PGTNVKPEVSQLIGK  334
            L NF     SS+   SC  F       S+SP   + +   P +T  G N+  +VSQLIGK
Sbjct  25   LANFRVGPPSSL---SCNNFKKV----SSSPITCKAVSLSPPSTIEGLNIAEDVSQLIGK  77

Query  335  TPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTS  514
            TP+VYLN V++G  A +AAK E M+P  S+KDR   +MI DAE+KG+I+P +TTL+EPTS
Sbjct  78   TPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTS  137

Query  515  GNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYAL  694
            GN GI +AF+AA +GYK+ LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V+KA  +
Sbjct  138  GNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAELVLTDPAKGMKGAVEKAEEI  197

Query  695  LESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            L+ TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  LKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  239



>ref|NP_851023.1| cysteine synthase C [Arabidopsis thaliana]
 gb|AEE79964.1| cysteine synthase C [Arabidopsis thaliana]
Length=432

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  110  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  169

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  170  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDP  229

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIW+DT+G VDIFV
Sbjct  230  AKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFV  285



>dbj|BAA03542.1| cysteine synthase [Spinacia oleracea]
Length=383

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 8/222 (4%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNT-PGTNVKPEVSQLIGK  334
            L NF     SS+   SC  F       S+SP   + +   P +T  G N+  +VSQLIGK
Sbjct  25   LANFRVGPPSSL---SCNNFKKV----SSSPITCKAVSLSPPSTIEGLNIAEDVSQLIGK  77

Query  335  TPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTS  514
            TP+VYLN V++G  A +AAK E M+P  S+KDR   +MI DAE+KG+I+P +TTL+EPTS
Sbjct  78   TPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTS  137

Query  515  GNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYAL  694
            GN GI +AF+AA +GYK+ LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V+KA  +
Sbjct  138  GNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAELVLTDPAKGMKGAVEKAEEI  197

Query  695  LESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            L+ TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  LKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  239



>ref|XP_009768645.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Nicotiana 
sylvestris]
Length=387

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 150/218 (69%), Gaps = 14/218 (6%)
 Frame = +2

Query  167  FIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLV  346
            F   RK++     CK  + QP   +                 G N+  +V+QLIG TP+V
Sbjct  39   FNPNRKATFPSIVCKAVSVQPKSAT--------------EVEGLNIAEDVTQLIGNTPMV  84

Query  347  YLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMG  526
            YLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLISP +T L+EPTSGN G
Sbjct  85   YLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTG  144

Query  527  ISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLEST  706
            I +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V KA  +L +T
Sbjct  145  IGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAKGMKGAVSKAEEILNNT  204

Query  707  PNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            P+A +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  205  PDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  242



>ref|XP_006402661.1| hypothetical protein EUTSA_v10005989mg [Eutrema salsugineum]
 gb|ESQ44114.1| hypothetical protein EUTSA_v10005989mg [Eutrema salsugineum]
Length=434

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + + C A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  114  GLNIAENVSQLIGKTPMVYLNSIAKDCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  173

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDP
Sbjct  174  LIAPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDP  233

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V KA  +L+STP+A MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  234  AKGMTGAVLKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  289



>dbj|BAK38374.1| cysteine synthase [Mimosa pudica]
Length=329

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +VS+L+GKTPLVYLN + +GC A VAAK EMM+P +S+KDR   +MI DAE+KGLI+
Sbjct  8    IAKDVSELVGKTPLVYLNHIVDGCVARVAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGADLVLTDP KG
Sbjct  68   PGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGADLVLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  ++  TPNA MLQQF NP N +IHYETTGPEIW+ + G VD FV
Sbjct  128  MKGAVQKAEEIVAKTPNAYMLQQFENPANPKIHYETTGPEIWKGSGGKVDAFV  180



>ref|XP_010039322.1| PREDICTED: cysteine synthase [Eucalyptus grandis]
 gb|KCW46034.1| hypothetical protein EUGRSUZ_L00009 [Eucalyptus grandis]
Length=410

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIG+TP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  90   GLNIAEDVTQLIGRTPMVYLNNLVKGCVANVAAKLEIMEPCCSVKDRIGHSMIADAERKG  149

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV  + FGA+LVLTD 
Sbjct  150  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLFKAFGAELVLTDA  209

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L STPNA MLQQF NP N ++HYETTGPEIWEDT+G VDIF+
Sbjct  210  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFI  265



>ref|XP_006442165.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
 gb|ESR55405.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
Length=339

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  71   GLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKG  130

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  131  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDS  190

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
             KGM G V+KA  +L STPNA MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  191  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVD  243



>ref|XP_010534505.1| PREDICTED: cysteine synthase, mitochondrial-like [Tarenaya hassleriana]
Length=396

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  ++SQLIG+TP++YLN + +GC A VA K E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  78   NIAEDISQLIGRTPMMYLNNIVKGCVANVAVKLEIMEPCCSVKDRIGYSMINDAEQKGLI  137

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+EPTSGN GI++AF+AA +GYK++LTMPS  S+ERRV ++ FGA+LVLTDP K
Sbjct  138  TPGKSVLVEPTSGNTGIALAFIAAARGYKLILTMPSSMSLERRVLLKAFGAELVLTDPAK  197

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G ++KA  +L+ TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  GMTGAIQKAEQILKDTPNSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  251



>emb|CAB71290.1| O-acetylserine (thiol) lyase [Arabidopsis thaliana]
Length=387

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  67   GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  126

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  127  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDP  186

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIW+DT+G VDIFV
Sbjct  187  AKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFV  242



>ref|NP_191535.2| cysteine synthase C [Arabidopsis thaliana]
 sp|Q43725.3|CYSKM_ARATH RecName: Full=Cysteine synthase, mitochondrial; AltName: Full=Beta-substituted 
Ala synthase 2;2; Short=ARAth-Bsas2;2; AltName: 
Full=CSase C; Short=AtCS-C; Short=CS-C; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL C; Flags: Precursor [Arabidopsis 
thaliana]
 pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- 
Serine-(Thiol)-Lyase C
 pdb|4AEC|B Chain B, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- 
Serine-(Thiol)-Lyase C
 gb|AAM20572.1| cysteine synthase [Arabidopsis thaliana]
 gb|AAM91285.1| cysteine synthase [Arabidopsis thaliana]
 dbj|BAE98443.1| cysteine synthase [Arabidopsis thaliana]
 gb|AEE79963.1| cysteine synthase C [Arabidopsis thaliana]
Length=430

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  110  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  169

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  170  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDP  229

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIW+DT+G VDIFV
Sbjct  230  AKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFV  285



>ref|XP_007227711.1| hypothetical protein PRUPE_ppa006674mg [Prunus persica]
 gb|EMJ28910.1| hypothetical protein PRUPE_ppa006674mg [Prunus persica]
Length=400

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = +2

Query  233  PGSASPSFAQRIRDLPRN-TPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQ  409
            P S S    + +   P+    G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+
Sbjct  59   PSSVSSVVCKAVSVTPQTAVEGLNIAEDVTQLIGKTPMVYLNNMVKGSVANIAAKLEIME  118

Query  410  PTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSY  589
            P  S+KDR   +MI+DAE++GLI P Q+ L+EPTSGN GI +AF+AA KGYK++LTMP+ 
Sbjct  119  PCCSVKDRIGYSMIIDAEQRGLIKPGQSVLVEPTSGNTGIGLAFIAATKGYKLILTMPAS  178

Query  590  TSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYET  769
             S+ERRV ++ FGA+LVLTD  KGM G V+KA  + +STPNA MLQQF NP N +IHYET
Sbjct  179  MSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEIFKSTPNAYMLQQFDNPANPKIHYET  238

Query  770  TGPEIWEDTQGNVDIFV  820
            TGPEIWEDT+G VDIFV
Sbjct  239  TGPEIWEDTRGKVDIFV  255



>ref|NP_851022.1| cysteine synthase C [Arabidopsis thaliana]
 dbj|BAH19583.1| AT3G59760 [Arabidopsis thaliana]
 gb|AEE79962.1| cysteine synthase C [Arabidopsis thaliana]
Length=433

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  110  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  169

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  170  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDP  229

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIW+DT+G VDIFV
Sbjct  230  AKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFV  285



>ref|XP_009416025.1| PREDICTED: cysteine synthase-like [Musa acuminata subsp. malaccensis]
Length=397

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  77   GLNIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEQKG  136

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            +I+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  SIERRV ++ FGA+LVLTD 
Sbjct  137  VITPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLLKAFGAELVLTDS  196

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+ T NA MLQQF NP N +IHYETTGPEIWEDT G VDIFV
Sbjct  197  AKGMKGAVQKAEEILKKTTNAYMLQQFDNPANPKIHYETTGPEIWEDTSGKVDIFV  252



>gb|ABK23421.1| unknown [Picea sitchensis]
Length=401

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 141/182 (77%), Gaps = 5/182 (3%)
 Frame = +2

Query  290  PGTNVKP-----EVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMIL  454
            P TNV+P     +V+QLIGKTP+VYLN V +GC A +AAK E+M+P  S+KDR   +MI 
Sbjct  75   PQTNVQPLNIAEDVTQLIGKTPMVYLNNVVKGCVANIAAKLEIMEPCCSVKDRIGYSMIT  134

Query  455  DAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGAD  634
            DAE KG I+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+
Sbjct  135  DAEAKGAITPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRVLLRAFGAE  194

Query  635  LVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDI  814
            LVLT+  KGM G V+KA  +L  TPNA MLQQF NP N ++HYETTGPEIWEDT+G VDI
Sbjct  195  LVLTEAAKGMKGAVQKAEEILNKTPNAYMLQQFDNPANPKVHYETTGPEIWEDTEGKVDI  254

Query  815  FV  820
            FV
Sbjct  255  FV  256



>emb|CAB75795.1| cysteine synthase [Arabidopsis thaliana]
Length=442

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  110  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  169

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  170  FISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDP  229

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIW+DT+G VDIFV
Sbjct  230  AKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFV  285



>gb|KCW61659.1| hypothetical protein EUGRSUZ_H04391 [Eucalyptus grandis]
Length=302

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V+++IGKTPLVYLN V EGC A +AAK EMM+P +S+KDR   +MI DAE+KGLI 
Sbjct  12   IAKDVTEIIGKTPLVYLNHVVEGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIK  71

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN GI +AFMAA KGYK+V+TMP+  S+ERR  +R FGA+LVLTDP +G
Sbjct  72   PGESVLIEPTSGNTGIGLAFMAAAKGYKLVITMPASMSLERRTILRAFGAELVLTDPARG  131

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G VKKA  +LE TPNA MLQQF NP N +IHYETTGPEIW+ + G VD  V
Sbjct  132  MKGAVKKAEEILERTPNAYMLQQFENPANPKIHYETTGPEIWKGSGGKVDALV  184



>ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Vitis 
vinifera]
 emb|CBI24697.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +2

Query  284  NTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAE  463
            +  G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE
Sbjct  59   DVEGLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAE  118

Query  464  KKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVL  643
            ++G I+P ++TL+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVL
Sbjct  119  QRGAITPGKSTLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVL  178

Query  644  TDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            TDP KGM G V+KA  +L+STPNA MLQQF NP N ++HY+TTGPEIWEDT+G VDIF+
Sbjct  179  TDPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYQTTGPEIWEDTRGKVDIFI  237



>ref|XP_004309642.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Fragaria vesca subsp. vesca]
Length=397

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLNK+ +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  77   GLNIAEDVTQLIGKTPMVYLNKIIKGSVANIAAKLEIMEPCCSVKDRIGYSMITDAEQRG  136

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI P Q+ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLT+ 
Sbjct  137  LIKPGQSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTNS  196

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STPNA MLQQF NP N ++HYETTGPEIWEDT+G VDIFV
Sbjct  197  AKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTKGKVDIFV  252



>emb|CAJ32461.1| putative chloroplast cysteine synthase 1 precursor [Nicotiana 
tabacum]
Length=364

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = +2

Query  269  RDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAM  448
            ++ P    G N+  +V+QLIG TP+VYLN + +GC A +AAK E+M+P  S+KDR   +M
Sbjct  36   QNQPLKVEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSM  95

Query  449  ILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFG  628
            I DAE+KGLISP +T L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FG
Sbjct  96   ISDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFG  155

Query  629  ADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNV  808
            A+LVLTDP KGM G V KA  +L +TP+A +LQQF NP N +IHYETTGPE+WEDT+G +
Sbjct  156  AELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEMWEDTKGKI  215

Query  809  DIFV  820
            DI V
Sbjct  216  DILV  219



>ref|XP_010469279.1| PREDICTED: cysteine synthase, mitochondrial-like isoform X2 [Camelina 
sativa]
Length=445

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLNK+ +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  110  GLNIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  169

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  170  RIAPGKSVLVEPTSGNTGIGLAFIAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDP  229

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++T +A MLQQF NP N +IHYETTGPEIWEDT G VDIFV
Sbjct  230  AKGMTGAVQKAEEILKTTHDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFV  285



>gb|AGT40331.1| O-acetylserine thiol-lyase [Nicotiana attenuata]
Length=387

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 148/214 (69%), Gaps = 14/214 (7%)
 Frame = +2

Query  179  RKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNK  358
            RK +     CK  + QP   +                 G N+  +V+QLIG TP+VYLN 
Sbjct  43   RKVTFPSIVCKAVSVQPKSAT--------------EVEGLNIAEDVTQLIGNTPMVYLNT  88

Query  359  VTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMA  538
            + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLISP +T L+EPTSGN GI +A
Sbjct  89   IVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTGIGLA  148

Query  539  FMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAV  718
            F+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V KA  +L +TP+A 
Sbjct  149  FIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAY  208

Query  719  MLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  209  ILQQFDNPANPKIHYETTGPEIWEDTKGKIDILV  242



>ref|XP_009592252.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Nicotiana 
tomentosiformis]
Length=387

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 150/218 (69%), Gaps = 14/218 (6%)
 Frame = +2

Query  167  FIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLV  346
            F   RK++     CK  + QP   +                 G N+  +V+QLIG TP+V
Sbjct  39   FNPNRKATFPSIVCKAVSVQPKSAT--------------EVEGLNIAEDVTQLIGNTPMV  84

Query  347  YLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMG  526
            YLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLISP +T L+EPTSGN G
Sbjct  85   YLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTG  144

Query  527  ISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLEST  706
            I +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V KA  +L +T
Sbjct  145  IGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAKGMKGAVSKAEEILHNT  204

Query  707  PNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            P+A +LQQF NP N +IHYETTGPE+WEDT+G +DI V
Sbjct  205  PDAYILQQFDNPANPKIHYETTGPEMWEDTKGKIDILV  242



>ref|XP_010413649.1| PREDICTED: cysteine synthase, mitochondrial-like [Camelina sativa]
Length=431

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLNK+ +GC A +AAK E+++P  S+KDR   +M+ DAE+KG
Sbjct  111  GLNIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIIEPCCSVKDRIGYSMVTDAEQKG  170

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+  ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  171  LIARGKSVLVEPTSGNTGIGLAFVAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDP  230

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIWEDT G VDIFV
Sbjct  231  AKGMTGAVQKAEEILKTTPDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFV  286



>ref|XP_008353283.1| PREDICTED: cysteine synthase [Malus domestica]
Length=325

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIGKTPLVYLN+V EGC A +AAK EMM+P +S+KDR   +MI DAE KGLI+
Sbjct  8    IAKDVTELIGKTPLVYLNQVVEGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P Q+ LIEPTSGN GI +AFMAA K YK+++TMP+  S+ERR+ +R FGA+LVLTDP KG
Sbjct  68   PGQSVLIEPTSGNTGIGLAFMAAAKHYKLIITMPASMSLERRIILRAFGAELVLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  +L  TPNA +LQQF NP N +IHYETTGPEIWE + G VD FV
Sbjct  128  MKGAVQKAEEILAKTPNAYILQQFENPANPKIHYETTGPEIWEGSGGKVDAFV  180



>gb|KHN43214.1| Cysteine synthase [Glycine soja]
Length=302

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            +N+  +V++LIGKTPLVYLN + +GC A VAAK EMM+P +S+KDR   +MI+DAE+KGL
Sbjct  6    SNIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGA+LVLTDP 
Sbjct  66   ITPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  + + TPN+ MLQQF NP N ++HYETTGPEIW+ + G VD  V
Sbjct  126  KGMKGAVQKAEEIRDKTPNSYMLQQFENPANPKVHYETTGPEIWKGSSGKVDALV  180



>gb|AHL84159.1| cysteine synthase [Nicotiana tabacum]
Length=387

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 149/214 (70%), Gaps = 14/214 (7%)
 Frame = +2

Query  179  RKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNK  358
            RK++     CK  + QP   +                 G N+  +V+QLIG TP+VYLN 
Sbjct  43   RKATFPSIVCKAVSVQPKSAT--------------EVEGLNIAEDVTQLIGNTPMVYLNT  88

Query  359  VTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMA  538
            + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLISP +T L+EPTSGN GI +A
Sbjct  89   IVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTGIGLA  148

Query  539  FMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAV  718
            F+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP KGM G V KA  +L +TP+A 
Sbjct  149  FIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAY  208

Query  719  MLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            +LQQF NP N +IHYETTGPE+WEDT+G +DI V
Sbjct  209  ILQQFDNPANPKIHYETTGPEMWEDTKGKIDILV  242



>ref|XP_004299115.1| PREDICTED: cysteine synthase-like [Fragaria vesca subsp. vesca]
Length=325

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTPLVYLN + +GC A +AAK EMM+P +S+KDR   +MI DAE KGL
Sbjct  6    SGIAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P Q+ LIEPTSGN GI +AFMAA K Y++++TMP+  SIERR+ +R FGA+LVLTDP 
Sbjct  66   ITPGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  +L  TPNA MLQQF NP N ++HYETTGPEIWE T G +D FV
Sbjct  126  KGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFV  180



>ref|XP_006858785.1| hypothetical protein AMTR_s00066p00160090 [Amborella trichopoda]
 gb|ERN20252.1| hypothetical protein AMTR_s00066p00160090 [Amborella trichopoda]
Length=369

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN V EGC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  73   GLNIAEDVTQLIGKTPMVYLNGVVEGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEQKG  132

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+L+LTDP
Sbjct  133  LITPGKSILVEPTSGNTGIGLAFIAASKGYQLILTMPASMSMERRVLLKAFGAELILTDP  192

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM   V+KA  +L+ TP A MLQQF NP N +IH+ETTGPEIWEDT G VDIFV
Sbjct  193  AKGMKAAVQKAEEILKKTPGAYMLQQFDNPANPKIHFETTGPEIWEDTNGKVDIFV  248



>ref|XP_010469278.1| PREDICTED: cysteine synthase, mitochondrial-like isoform X1 [Camelina 
sativa]
Length=430

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLNK+ +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  110  GLNIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  169

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  170  RIAPGKSVLVEPTSGNTGIGLAFIAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDP  229

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++T +A MLQQF NP N +IHYETTGPEIWEDT G VDIFV
Sbjct  230  AKGMTGAVQKAEEILKTTHDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFV  285



>gb|AGV54667.1| cysteine synthase [Phaseolus vulgaris]
Length=325

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            +++  +V++LIGKTPLVYLN + +GC A VAAK EMM+P +S+KDR   +MI+DAE++GL
Sbjct  6    SSIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEQQGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGADLVLTDP 
Sbjct  66   IKPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGADLVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  + E TPN+ MLQQF NP N +IHYETTGPEIW+ ++G VD  V
Sbjct  126  KGMKGAVQKAEEIREKTPNSYMLQQFENPANPKIHYETTGPEIWKGSRGKVDALV  180



>ref|XP_008373398.1| PREDICTED: cysteine synthase-like [Malus domestica]
Length=397

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  77   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMITDAEQRG  136

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI P Q+ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  137  LIKPGQSVLVEPTSGNTGIGLAFIAATKGYKLILTMPASMSLERRVLLKAFGAELVLTDS  196

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +  STPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  197  AKGMKGAVQKAEEICNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  252



>ref|XP_009369846.1| PREDICTED: cysteine synthase-like [Pyrus x bretschneideri]
Length=325

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIGKTPLVYLN++ EGC A +AAK EMM+P +S+KDR   +MI DAE KGLI+
Sbjct  8    IAKDVTELIGKTPLVYLNQIVEGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P Q+ LIEPTSGN GI +AFMAA K YK+++TMP+  S+ERR+ +R FGA+LVLTDP KG
Sbjct  68   PGQSVLIEPTSGNTGIGLAFMAAAKHYKLIITMPASMSLERRIILRAFGAELVLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  +L  TPNA +LQQF NP N +IHYETTGPEIWE + G VD FV
Sbjct  128  MKGAVQKAEEILAKTPNAYILQQFENPANPKIHYETTGPEIWEGSGGKVDAFV  180



>gb|EYU36680.1| hypothetical protein MIMGU_mgv1a007743mg [Erythranthe guttata]
Length=386

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  76   GLNIAEDVTQLIGKTPMVYLNSIVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEEKG  135

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLT+ 
Sbjct  136  QISPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTEA  195

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  ++ +TPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  196  AKGMKGAVQKAEEIVNNTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  251



>ref|XP_006604835.1| PREDICTED: cysteine synthase-like isoform X2 [Glycine max]
 ref|XP_006604836.1| PREDICTED: cysteine synthase-like isoform X3 [Glycine max]
Length=325

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            +N+  +V++LIGKTPLVYLN + +GC A VAAK EMM+P +S+KDR   +MI+DAE+KGL
Sbjct  6    SNIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGA+LVLTDP 
Sbjct  66   ITPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  + + TPN+ MLQQF NP N ++HYETTGPEIW+ + G VD  V
Sbjct  126  KGMKGAVQKAEEIRDKTPNSYMLQQFENPANPKVHYETTGPEIWKGSSGKVDALV  180



>ref|XP_006492781.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Citrus sinensis]
Length=391

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  71   GLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKG  130

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  131  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDS  190

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
             KGM G V+KA  +L STPNA MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  191  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVD  243



>ref|XP_006442164.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
 gb|ESR55404.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
Length=391

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  71   GLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKG  130

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  131  LITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDS  190

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
             KGM G V+KA  +L STPNA MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  191  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVD  243



>ref|XP_011073981.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 
X2 [Sesamum indicum]
Length=386

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  76   GLNIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEQKG  135

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  136  LITPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDA  195

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  ++ ST NA MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  196  AKGMKGAVQKAEEIVNSTQNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDILV  251



>ref|XP_010922898.1| PREDICTED: putative inactive cysteine synthase 2 isoform X2 [Elaeis 
guineensis]
Length=302

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
             N+  +V+QLIGKTP++YLNKV EGC A +AAK E ++P  S+KDR   +MI DAE+KG 
Sbjct  64   VNIAEDVTQLIGKTPMIYLNKVVEGCVANIAAKLESVEPCRSVKDRIGYSMITDAEEKGF  123

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            ISP ++TL+EPTSGN G+ +AF+AA +GYK+++TMP+  ++ERR+ +R  GA++VLTDP 
Sbjct  124  ISPRKSTLVEPTSGNTGVGIAFVAAARGYKLIVTMPASINLERRILLRALGAEIVLTDPA  183

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KG+ G V KA  ++  TPNA M QQF NP NT+IH+ETTGPEIWEDT G+VDIFV
Sbjct  184  KGIKGAVDKAEEIVHRTPNAYMFQQFDNPANTKIHFETTGPEIWEDTVGSVDIFV  238



>ref|XP_010101369.1| Cysteine synthase [Morus notabilis]
 gb|EXB88316.1| Cysteine synthase [Morus notabilis]
Length=414

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR  L+MI DAE+KG
Sbjct  78   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGLSMINDAEQKG  137

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGADLVLTD 
Sbjct  138  LITPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGADLVLTDS  197

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVD  811
             KGM G V+KA  +L STPNA MLQQF NP N +IHYETTGPEIWEDT+G VD
Sbjct  198  AKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVD  250



>emb|CDY23400.1| BnaC04g49280D [Brassica napus]
Length=389

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  69   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  128

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  129  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  188

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  189  AKGMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  244



>ref|XP_010672447.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Beta 
vulgaris subsp. vulgaris]
Length=385

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +VSQLIGKTPLVYLN V  G  A +AAK E M+P  S+KDR   +M+ DAE+KG
Sbjct  66   GLNIAEDVSQLIGKTPLVYLNNVVNGSVASIAAKLESMEPCCSVKDRIGYSMVDDAEQKG  125

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P +TTL+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+L+LTDP
Sbjct  126  AITPGKTTLVEPTSGNTGIGLAFIAAARGYKLILTMPASMSMERRVILKAFGAELILTDP  185

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+ A  +L  TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  186  AKGMKGAVEIAEEILRKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  241



>ref|XP_009372595.1| PREDICTED: cysteine synthase-like [Pyrus x bretschneideri]
Length=397

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  77   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMITDAEQRG  136

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI P Q+ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  137  LIKPGQSVLVEPTSGNTGIGLAFIAATKGYRLILTMPASMSLERRVLLKAFGAELVLTDS  196

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +  STPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  197  AKGMKGAVQKAEEICNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  252



>gb|EYU36679.1| hypothetical protein MIMGU_mgv1a007743mg [Erythranthe guttata]
Length=396

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  76   GLNIAEDVTQLIGKTPMVYLNSIVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEEKG  135

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLT+ 
Sbjct  136  QISPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTEA  195

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  ++ +TPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  196  AKGMKGAVQKAEEIVNNTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  251



>ref|NP_001276178.1| cysteine synthase-like [Glycine max]
 gb|ACU22789.1| unknown [Glycine max]
Length=325

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            +N+  +V++LIGKTPLVYLN + +GC A VAAK EMM+P +S+KDR   +MI+DAE+KGL
Sbjct  6    SNIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGHSMIVDAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGA+LVLTDP 
Sbjct  66   ITPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  + + TPN+ MLQQF NP N ++HYETTGPEIW+ + G VD  V
Sbjct  126  KGMKGAVQKAEEIRDKTPNSYMLQQFENPTNPKVHYETTGPEIWKGSSGKVDALV  180



>ref|XP_010508379.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=395

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  75   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  134

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  135  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  194

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  195  AKGMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  250



>ref|XP_009394263.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis]
 ref|XP_009394264.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis]
Length=325

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIG+TPLVYLNKV  GCGA +AAK EMM+P +S+KDR   +MI DAE+KGLI+
Sbjct  8    IAKDVTELIGRTPLVYLNKVVNGCGARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN GI +AFMAA KGYK+VLTMP+  SIERR+ ++ FGA+LVLTDP  G
Sbjct  68   PGKSVLIEPTSGNTGIGLAFMAAAKGYKLVLTMPASMSIERRIILKAFGAELVLTDPVLG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  L   TPN+ +LQQF NP N +IHYETTGPEIW+ T G VDI V
Sbjct  128  MKGAVEKAEELAAKTPNSYILQQFENPSNPKIHYETTGPEIWKGTAGRVDILV  180



>ref|XP_010506279.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=395

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  75   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  134

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  135  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  194

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  195  AKGMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  250



>ref|XP_011073980.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 
X1 [Sesamum indicum]
Length=396

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  76   GLNIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEQKG  135

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  136  LITPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDA  195

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  ++ ST NA MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  196  AKGMKGAVQKAEEIVNSTQNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDILV  251



>ref|XP_008390894.1| PREDICTED: cysteine synthase-like [Malus domestica]
Length=325

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIGKTPLVYLN V EGC A +AAK EMM+P +S+KDR   +MI DAE KGLI+
Sbjct  8    IAKDVTELIGKTPLVYLNHVVEGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P Q+ LIEPTSGN GI +AFMAA K Y++++TMP+  S+ERR+ +R FGA+LVLTDP KG
Sbjct  68   PGQSVLIEPTSGNTGIGLAFMAAAKHYRLIITMPASMSLERRIILRAFGAELVLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  +L  TPNA +LQQF NP N +IHYETTGPEIWE + G VD FV
Sbjct  128  MKGAVQKAEEILAKTPNAYILQQFENPANPKIHYETTGPEIWEGSGGKVDAFV  180



>ref|XP_010517954.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Camelina 
sativa]
Length=395

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  75   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  134

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  135  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  194

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  195  AKGMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  250



>ref|XP_002881929.1| hypothetical protein ARALYDRAFT_903778 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58188.1| hypothetical protein ARALYDRAFT_903778 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN V +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  72   GLNIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  131

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  132  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  191

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L+ TPN+ MLQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  192  AKGMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKIDILV  247



>ref|XP_006397550.1| hypothetical protein EUTSA_v10001481mg [Eutrema salsugineum]
 gb|ESQ39003.1| hypothetical protein EUTSA_v10001481mg [Eutrema salsugineum]
Length=394

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  74   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEQKG  133

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  134  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  193

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  194  AKGMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  249



>ref|XP_001755364.1| predicted protein [Physcomitrella patens]
 gb|EDQ79844.1| predicted protein [Physcomitrella patens]
Length=348

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +V+QLIGKTP+VYLN V EGC A +AAK E+M+P  S+KDR   +MI DAE KG I
Sbjct  30   NIADDVTQLIGKTPMVYLNTVVEGCTANIAAKLEIMEPCCSVKDRIGFSMITDAENKGAI  89

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERR+ ++ FGA+LVLTDP K
Sbjct  90   TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRILLKAFGAELVLTDPAK  149

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V+KA  +++ TPN+ MLQQF NP N ++H+ETTGPEIWEDT G +DI V
Sbjct  150  GMKGAVQKAEEIVKKTPNSYMLQQFENPANPKVHFETTGPEIWEDTAGKIDILV  203



>gb|ABC86746.1| cysteine synthase [Vitis pseudoreticulata]
Length=251

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIGKTPLVYLN V +GC A +A K EMM+P +S+KDR   +MI DAE+KGLI+
Sbjct  8    IAKDVTELIGKTPLVYLNNVVDGCVARIAGKLEMMEPCSSVKDRIGYSMITDAEEKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +R FGA+LVLTDP KG
Sbjct  68   PGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILRAFGAELVLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  +L  TPN+ +LQQF NP N +IHYETTGPEIW  T G VD FV
Sbjct  128  MKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETTGPEIWRGTGGKVDAFV  180



>ref|XP_008446019.1| PREDICTED: cysteine synthase [Cucumis melo]
Length=389

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 150/216 (69%), Gaps = 16/216 (7%)
 Frame = +2

Query  173  KARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYL  352
            K+     L  +CK  + +P            I DL       N+  +V+QL+GKTP+VYL
Sbjct  45   KSNLHGTLSVTCKAVSVKP---------QTEIEDL-------NIASDVTQLVGKTPMVYL  88

Query  353  NKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGIS  532
            N + +GC A VAAK EMM+P  S+KDR   +MI DAE+KGLISP ++ L+EPTSGN GI 
Sbjct  89   NNIVKGCVANVAAKLEMMEPCCSVKDRIGYSMITDAEQKGLISPGKSVLVEPTSGNTGIG  148

Query  533  MAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPN  712
            +AF+AA KGYK++L MP+  S+ERRV ++ FGA +VLT+P KGM G V+KA  +L++TPN
Sbjct  149  LAFIAASKGYKLILAMPASMSLERRVLLKAFGAKVVLTNPAKGMKGAVEKAEEILKNTPN  208

Query  713  AVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            A ML QF NP N ++HYETTGPEIWEDT+G +DI V
Sbjct  209  AYMLHQFDNPANPKVHYETTGPEIWEDTKGKLDILV  244



>ref|XP_004167180.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
Length=390

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 154/224 (69%), Gaps = 16/224 (7%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            + +L++  K+   + L  +CK  + +P            I DL       N+  +V+QL+
Sbjct  38   LPSLLHSSKSNLHATLSVTCKAVSIKP---------QTEIEDL-------NIASDVTQLV  81

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            GKTP+VYLN + +GC A VAAK EMM+P  S+KDR   +MI DAEKKGLISP ++ L+EP
Sbjct  82   GKTPMVYLNNIVKGCVANVAAKLEMMEPCCSVKDRIGYSMISDAEKKGLISPGKSILVEP  141

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGN GI +AF+AA KGYK++L MP+  S+ERRV ++ FGA +VLT+P KGM G V+KA 
Sbjct  142  TSGNTGIGLAFIAASKGYKLILAMPASMSLERRVLLKAFGATVVLTNPAKGMKGAVEKAE  201

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             +L+ TPNA  L QF NP N ++HYETTGPEIWEDT+G +DI V
Sbjct  202  EILQKTPNAYKLNQFDNPANPKVHYETTGPEIWEDTKGKLDILV  245



>ref|XP_004135335.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
 gb|KGN51658.1| Cysteine synthase [Cucumis sativus]
Length=390

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 154/224 (69%), Gaps = 16/224 (7%)
 Frame = +2

Query  149  MAALMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLI  328
            + +L++  K+   + L  +CK  + +P            I DL       N+  +V+QL+
Sbjct  38   LPSLLHSSKSNLHATLSVTCKAVSIKP---------QTEIEDL-------NIASDVTQLV  81

Query  329  GKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEP  508
            GKTP+VYLN + +GC A VAAK EMM+P  S+KDR   +MI DAEKKGLISP ++ L+EP
Sbjct  82   GKTPMVYLNNIVKGCVANVAAKLEMMEPCCSVKDRIGYSMISDAEKKGLISPGKSILVEP  141

Query  509  TSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAY  688
            TSGN GI +AF+AA KGYK++L MP+  S+ERRV ++ FGA +VLT+P KGM G V+KA 
Sbjct  142  TSGNTGIGLAFIAASKGYKLILAMPASMSLERRVLLKAFGATVVLTNPAKGMKGAVEKAE  201

Query  689  ALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             +L+ TPNA  L QF NP N ++HYETTGPEIWEDT+G +DI V
Sbjct  202  EILQKTPNAYKLNQFDNPANPKVHYETTGPEIWEDTKGKLDILV  245



>gb|AFK39569.1| unknown [Medicago truncatula]
Length=325

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTPLVYLN++ +GC A VAAK E+M+P +S+KDR   +MI DAE+KGL
Sbjct  6    SGIAKDVTELIGKTPLVYLNRLADGCVARVAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P Q+ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +  FGA+LVLTDP 
Sbjct  66   ITPGQSVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  LL  TPNA +LQQF NP N ++HYETTGPEIW+ T G +D FV
Sbjct  126  KGMKGAVQKAEELLAKTPNAYILQQFENPANPKVHYETTGPEIWKGTDGKIDAFV  180



>ref|NP_181903.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
 ref|NP_001189745.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
 sp|P47999.2|CYSKP_ARATH RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=At.OAS.7-4; AltName: Full=Beta-substituted Ala 
synthase 2;1; Short=ARAth-Bsas2;1; AltName: Full=CSase B; 
Short=AtCS-B; Short=CS-B; AltName: Full=O-acetylserine (thiol)-lyase; 
AltName: Full=O-acetylserine sulfhydrylase; AltName: 
Full=OAS-TL B; AltName: Full=cpACS1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB64031.1| cysteine synthase (cpACS1) [Arabidopsis thaliana]
 emb|CAB71292.1| O-acetylserine (thiol) lyase B [Arabidopsis thaliana]
 emb|CAA56594.2| O-acetylserine (thiol) lyase [Arabidopsis thaliana]
 gb|AAL38816.1| cysteine synthase cpACS1 [Arabidopsis thaliana]
 gb|AAM20315.1| putative cysteine synthase cpACS1 [Arabidopsis thaliana]
 gb|AAM63361.1| cysteine synthase cpACS1 [Arabidopsis thaliana]
 dbj|BAE98603.1| cysteine synthase [Arabidopsis thaliana]
 gb|AEC10317.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
 gb|AEC10318.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
Length=392

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN V +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  72   GLNIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  131

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  132  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  191

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L+ TPN+ MLQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  192  AKGMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKIDILV  247



>ref|XP_002275990.1| PREDICTED: cysteine synthase [Vitis vinifera]
 ref|XP_002275940.1| PREDICTED: cysteine synthase [Vitis vinifera]
 ref|XP_003633658.1| PREDICTED: cysteine synthase [Vitis vinifera]
 emb|CAN75607.1| hypothetical protein VITISV_033255 [Vitis vinifera]
 emb|CBI34216.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIGKTPLVYLN V +GC A +AAK EMM+P +S+KDR   +MI DAE+KGLI+
Sbjct  8    IAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLIT  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P ++ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +R FGA+LVLTDP KG
Sbjct  68   PGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILRAFGAELVLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            M G V+KA  +L  TPN+ +LQQF NP N +IHYETTGPEIW  T G VD FV
Sbjct  128  MKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETTGPEIWRGTGGKVDAFV  180



>ref|XP_001764851.1| predicted protein [Physcomitrella patens]
 gb|EDQ70293.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +V+QLIGKTP+VYLN V +GC A +AAK E+M+P  S+KDR   +MI DAE KG I
Sbjct  78   NIADDVTQLIGKTPMVYLNTVVDGCVANIAAKLEIMEPCCSVKDRIGFSMITDAESKGAI  137

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERR+ +R FGA+L+LTDP K
Sbjct  138  TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRILLRAFGAELILTDPAK  197

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V+KA  +++ TPN+ MLQQF NP N ++H+ETTGPEIWEDT G VDI V
Sbjct  198  GMKGAVQKAEEIVKKTPNSYMLQQFENPANPKVHFETTGPEIWEDTAGKVDILV  251



>ref|XP_007147139.1| hypothetical protein PHAVU_006G099100g [Phaseolus vulgaris]
 gb|ESW19133.1| hypothetical protein PHAVU_006G099100g [Phaseolus vulgaris]
Length=325

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            +++  +V++LIGKTPLVYLN + +GC A VAAK EMM+P +S+KDR   +MI+DAE++GL
Sbjct  6    SSIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEQQGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGADLVLTDP 
Sbjct  66   IKPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGADLVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  + E TPN+ MLQQF NP N ++HYETTGPEIW+ + G VD  V
Sbjct  126  KGMKGAVQKAEEIREKTPNSYMLQQFENPANPKVHYETTGPEIWKGSSGKVDALV  180



>ref|XP_003610723.1| Cysteine synthase [Medicago truncatula]
 gb|ACJ85381.1| unknown [Medicago truncatula]
 gb|AES93681.1| O-acetylserine (thiol) lyase [Medicago truncatula]
Length=325

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTPLVYLN++ +GC A VAAK E+M+P +S+KDR   +MI DAE+KGL
Sbjct  6    SGIAKDVTELIGKTPLVYLNRLADGCVARVAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P Q+ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +  FGA+LVLTDP 
Sbjct  66   ITPGQSVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  LL  TPNA +LQQF NP N ++HYETTGPEIW+ T G +D FV
Sbjct  126  KGMKGAVQKAEELLAKTPNAYILQQFENPANPKVHYETTGPEIWKGTDGKIDAFV  180



>ref|XP_004511361.1| PREDICTED: cysteine synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004511362.1| PREDICTED: cysteine synthase-like isoform X2 [Cicer arietinum]
Length=325

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTPLVYLN++ +GC A +AAK E+M+P +S+KDR   +MI DAE+KGL
Sbjct  6    SGIAKDVTELIGKTPLVYLNRLADGCVARIAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P Q+ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +  FGA+LVLTDP 
Sbjct  66   ITPGQSVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  +L  TPNA +LQQF NP N ++HYETTGPEIW+ T+G VD FV
Sbjct  126  KGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGTEGKVDAFV  180



>ref|XP_006295957.1| hypothetical protein CARUB_v10025099mg [Capsella rubella]
 gb|EOA28855.1| hypothetical protein CARUB_v10025099mg [Capsella rubella]
Length=392

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  72   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  131

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ LIE TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  132  LITPGKSVLIESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  191

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TPN+ +LQQF NP N +IHYETTGPEIWEDT+G +DI V
Sbjct  192  AKGMTGAIQKAEEILKNTPNSYILQQFDNPANPKIHYETTGPEIWEDTRGKIDILV  247



>ref|XP_003608087.1| Cysteine synthase [Medicago truncatula]
 gb|AES90284.1| O-acetylserine (thiol) lyase [Medicago truncatula]
Length=364

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +++QLIGKTP+VYL  +T+G  A +AAK E+M+P  S+KDR   +MILDAE+KGLI
Sbjct  46   NIADDITQLIGKTPMVYLKSITKGSVANIAAKLELMEPCCSVKDRIGYSMILDAEQKGLI  105

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+EPT GN GI +AF+AA KGYK++LTMP   S+ERRV M+ FGA+LVLT+ +K
Sbjct  106  TPGKSILVEPTGGNTGIGLAFIAATKGYKLILTMPVSMSLERRVLMKAFGAELVLTEYSK  165

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGIGSG  838
             M G V+KA  ++++TPNA MLQQF NP N ++H+E TGPEIW+DT+G VDI V GIG+G
Sbjct  166  AMSGAVQKAEEIVKNTPNAYMLQQFDNPSNPKVHFENTGPEIWKDTKGKVDILVAGIGTG  225

Query  839  GT  844
            GT
Sbjct  226  GT  227



>gb|KHN31018.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=389

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  69   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRG  128

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  129  AITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDA  188

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             KGM G V+KA  +L+STPNA MLQQF NP N +IHYETTGPEIWEDT+G +DI V GI
Sbjct  189  AKGMNGAVQKAEEILKSTPNAYMLQQFDNPSNPKIHYETTGPEIWEDTRGKIDILVAGI  247



>gb|ACU19896.1| unknown [Glycine max]
Length=389

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  69   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRG  128

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  129  AITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDA  188

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
             KGM G V+KA  +L+STPNA MLQQF NP N +IHYETTGPEIWEDT+G +DI V GI
Sbjct  189  AKGMNGAVQKAEEILKSTPNAYMLQQFDNPSNPKIHYETTGPEIWEDTRGKIDILVAGI  247



>ref|XP_010922897.1| PREDICTED: cysteine synthase-like isoform X1 [Elaeis guineensis]
Length=373

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
             N+  +V+QLIGKTP++YLNKV EGC A +AAK E ++P  S+KDR   +MI DAE+KG 
Sbjct  64   VNIAEDVTQLIGKTPMIYLNKVVEGCVANIAAKLESVEPCRSVKDRIGYSMITDAEEKGF  123

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            ISP ++TL+EPTSGN G+ +AF+AA +GYK+++TMP+  ++ERR+ +R  GA++VLTDP 
Sbjct  124  ISPRKSTLVEPTSGNTGVGIAFVAAARGYKLIVTMPASINLERRILLRALGAEIVLTDPA  183

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KG+ G V KA  ++  TPNA M QQF NP NT+IH+ETTGPEIWEDT G+VDIFV
Sbjct  184  KGIKGAVDKAEEIVHRTPNAYMFQQFDNPANTKIHFETTGPEIWEDTVGSVDIFV  238



>emb|CDY30438.1| BnaA04g25390D [Brassica napus]
Length=389

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  71   NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGFSMITDAEEKGLI  130

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P K
Sbjct  131  TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  190

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  191  GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  244



>ref|XP_010256041.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
 ref|XP_010256042.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
 ref|XP_010256043.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
Length=325

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
             +  ++++LIGKTPLVYLN +  GC A VAAK EMM+P +S+KDR   +MI DAE+KGLI
Sbjct  7    KIAKDITELIGKTPLVYLNNIVHGCVARVAAKLEMMEPCSSVKDRIGYSMIADAEEKGLI  66

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ LIEPTSGN GI +AFMAA KGY++++TMP+  S+ERR+ +R FGA+LVLTDP +
Sbjct  67   TPGKSVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRIILRAFGAELVLTDPAR  126

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V+KA  +L  TPNA +LQQF NP N +IHYETTGPEIW+ T G VD FV
Sbjct  127  GMKGAVQKAEEILAKTPNAYILQQFENPANPRIHYETTGPEIWKGTAGKVDAFV  180



>dbj|BAJ91393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = +2

Query  239  SASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTA  418
            +ASPS+  R   L     G N+  +V+QLIGKTP+VYLN++ +GC A VAAK E+M+P  
Sbjct  53   AASPSW--RRHALATEVEGLNIADDVTQLIGKTPMVYLNRIVKGCVANVAAKLEIMEPCC  110

Query  419  SIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSI  598
            S+KDR  ++MI DAE+KGLI+P ++ L+E TSGN GI +AF+AA +GYK++LTMP+  S+
Sbjct  111  SVKDRIGISMISDAEEKGLITPGKSVLVEATSGNTGIGLAFIAASRGYKLILTMPTSMSM  170

Query  599  ERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGP  778
            ERRV ++ FGA+LVLTD  KGM G + KA  +L  TPN+ ML+QF NP N ++HYETTGP
Sbjct  171  ERRVLLKAFGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGP  230

Query  779  EIWEDTQGNVDIF  817
            EIWED++G VDIF
Sbjct  231  EIWEDSKGKVDIF  243



>gb|KHG11750.1| Cysteine synthase, chloroplastic/chromoplastic [Gossypium arboreum]
Length=402

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  82   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMISDAEQRG  141

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  142  LITPGKSILVEPTSGNTGIGLAFIAASKGYRLILTMPASMSLERRVLLKAFGAELVLTDS  201

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +++STPNA MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  202  AKGMKGAVQKAEEIVKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFV  257



>gb|AAX07221.1| chloroplast cysteine synthase GCS2 [Allium sativum]
Length=383

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 158/224 (71%), Gaps = 4/224 (2%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTT--QPLPGSASPSFAQRIRDLPRNTP--GTNVKPEVSQL  325
            L   IK +  S   +SC  ++T  +  P ++S     +   +  +T   G N+  +V+QL
Sbjct  14   LSQSIKPKSRSSAFFSCNQYSTAIKITPCASSSRILCKAVSIKPDTEIEGLNIAEDVTQL  73

Query  326  IGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIE  505
            IGKTP+VYLN + +GC A VAAK E M+P +S+KDR   +MI DAE+KGLI+P ++ L+E
Sbjct  74   IGKTPMVYLNSIAKGCVANVAAKLESMEPCSSVKDRIGYSMISDAEQKGLITPGKSVLVE  133

Query  506  PTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKA  685
            PTSGN GI++AF+AA KGYK++LTMP+  S+ERRV  + FGA+LVLTD  KGM G ++KA
Sbjct  134  PTSGNTGIALAFVAASKGYKLILTMPASMSMERRVLFKAFGAELVLTDAAKGMKGAIQKA  193

Query  686  YALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
              +++ TPN  MLQQF NP N +IH+ETTGPEIWEDT G +DIF
Sbjct  194  EDIVKKTPNGYMLQQFDNPANPKIHFETTGPEIWEDTNGKIDIF  237



>ref|XP_002524867.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF37491.1| cysteine synthase, putative [Ricinus communis]
Length=408

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAEK+G
Sbjct  88   GLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMIDDAEKRG  147

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             I+P ++ L+EPTSGN GI +AF+AA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  148  AITPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVLTDS  207

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STPNA MLQQF NP N ++HYETTGPEIWEDT+G VDIFV
Sbjct  208  AKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFV  263



>gb|EMT06609.1| Cysteine synthase, chloroplastic/chromoplastic [Aegilops tauschii]
Length=392

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 150/207 (72%), Gaps = 7/207 (3%)
 Frame = +2

Query  212  FFTTQPLPGSA-------SPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEG  370
            FF  +  PGS+       +PS + R   L     G N+  +V+QLIGKTP+VYLNK+ +G
Sbjct  38   FFVLKMFPGSSLLAVNAPAPSPSWRRHALATEVEGLNIADDVTQLIGKTPMVYLNKIVKG  97

Query  371  CGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAA  550
            C A VAAK E+M+P  S+KDR  ++MI DAE+KGLI+P ++ L+E TSGN GI +AF+AA
Sbjct  98   CVANVAAKLEIMEPCCSVKDRIGISMISDAEEKGLITPGKSVLVEATSGNTGIGLAFIAA  157

Query  551  VKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQ  730
             +GYK++LTMP+  S+ERRV ++ FGA+LVLTD  KGM G + KA  +L  TPN+ ML+Q
Sbjct  158  SRGYKLILTMPTSMSMERRVLLKAFGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQ  217

Query  731  FSNPVNTQIHYETTGPEIWEDTQGNVD  811
            F NP N ++HYETTGPEIWED++G VD
Sbjct  218  FDNPANPKVHYETTGPEIWEDSKGKVD  244



>ref|XP_008797336.1| PREDICTED: cysteine synthase [Phoenix dactylifera]
Length=325

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G  +  +V++LIGKTPLVYLN V  GCGA +AAK EMM+P +S+KDR   +MI DAE+KG
Sbjct  5    GLAIAKDVTELIGKTPLVYLNNVVNGCGARIAAKLEMMEPCSSVKDRIGYSMIADAEEKG  64

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ LIEPTSGN GI +AFMAA KGYK+VLTMP+  S+ERR+ ++ FGA+LVLTDP
Sbjct  65   LITPGKSVLIEPTSGNTGIGLAFMAAAKGYKLVLTMPASMSLERRIILKAFGAELVLTDP  124

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
              GM G V+KA  L   TPN+ +LQQF NP N +IHYETTGPEIW+ T G VDI +
Sbjct  125  VLGMKGAVQKAEELAAKTPNSYVLQQFENPSNPKIHYETTGPEIWKGTSGKVDILI  180



>ref|XP_009412799.1| PREDICTED: cysteine synthase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
             N+  +V+QLIGKTP++YLNKV EGC A +AAK E M+P  S+KDR   +MI DAE++GL
Sbjct  59   VNIAEDVTQLIGKTPMIYLNKVVEGCVANIAAKLESMEPCRSVKDRIGYSMINDAEERGL  118

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I P ++ L+EPTSGN G+ +AF AA +GYK++ TMP+  ++ERRV +R FGAD+VLTDP 
Sbjct  119  IFPRKSILVEPTSGNTGVGIAFAAAARGYKLIATMPASINLERRVLLRSFGADIVLTDPD  178

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KG+ G V KA  ++  TPNA M +QF NPVNT+IH+ETTGPEIWEDT G VDIF+
Sbjct  179  KGIKGAVDKAEEIVSRTPNAYMFRQFDNPVNTKIHFETTGPEIWEDTMGGVDIFI  233



>ref|XP_009412800.1| PREDICTED: probable S-sulfocysteine synthase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=366

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
             N+  +V+QLIGKTP++YLNKV EGC A +AAK E M+P  S+KDR   +MI DAE++GL
Sbjct  59   VNIAEDVTQLIGKTPMIYLNKVVEGCVANIAAKLESMEPCRSVKDRIGYSMINDAEERGL  118

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I P ++ L+EPTSGN G+ +AF AA +GYK++ TMP+  ++ERRV +R FGAD+VLTDP 
Sbjct  119  IFPRKSILVEPTSGNTGVGIAFAAAARGYKLIATMPASINLERRVLLRSFGADIVLTDPD  178

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KG+ G V KA  ++  TPNA M +QF NPVNT+IH+ETTGPEIWEDT G VDIF+
Sbjct  179  KGIKGAVDKAEEIVSRTPNAYMFRQFDNPVNTKIHFETTGPEIWEDTMGGVDIFI  233



>ref|XP_009142225.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Brassica rapa]
Length=389

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  71   NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  130

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P K
Sbjct  131  TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  190

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G ++KA  +L++TPN+ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  191  GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  244



>ref|XP_010695544.1| PREDICTED: cysteine synthase [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            N+  +V+QLIG TP+VYLN+VTEGC A +AAK E M+P  S+KDR   AMI +AE+ G I
Sbjct  87   NIADDVTQLIGCTPMVYLNRVTEGCVANIAAKLESMEPCRSVKDRIGYAMISEAEQSGAI  146

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            SP ++ L+EPTSGN GI +AF+AA KGYK+V+TMP+Y +IERR+ +R FGA+++LTD TK
Sbjct  147  SPGKSILVEPTSGNTGIGIAFVAATKGYKLVVTMPAYVNIERRILLRAFGAEVILTDSTK  206

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V+KA  L+ STP+A MLQQF N  NT+IH+ETTGPEIWEDT G+VDIFV
Sbjct  207  GMKGAVEKAEELVLSTPDAYMLQQFDNVANTKIHFETTGPEIWEDTLGSVDIFV  260



>emb|CDY17914.1| BnaC04g03050D [Brassica napus]
Length=392

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  72   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  131

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  132  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  191

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  192  AKGMTGAIQKAEEILKNTPDSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  247



>gb|ACU21178.1| unknown [Glycine max]
Length=263

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTPLVYLNK+ +GC A VAAK E+M+P +S+KDR   +MI DAE+KGL
Sbjct  6    SGIAKDVTELIGKTPLVYLNKLADGCVARVAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA +GYK+++TMP+  S+ERR+ +  FGA+LVLTDP 
Sbjct  66   ITPGKSVLIEPTSGNTGIGLAFMAAARGYKLIITMPASMSLERRIILLAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  +L  TPNA +LQQF NP N ++HYETTGPEIW+ + G +D FV
Sbjct  126  KGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGSDGKIDAFV  180



>ref|XP_009142968.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Brassica 
rapa]
Length=396

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  76   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  135

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  136  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  195

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  196  AKGMTGAIQKAEEILKNTPDSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  251



>emb|CDX79804.1| BnaA05g03520D [Brassica napus]
Length=396

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  76   GLNIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  135

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  136  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  195

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L++TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDI V
Sbjct  196  AKGMTGAIQKAEEILKNTPDSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILV  251



>gb|KHN31439.1| Cysteine synthase [Glycine soja]
Length=325

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
            ++  +V++LIGKTPLVYLN++ +GC A VAAK EMM+P +S+KDR   +MI+DAE+KGLI
Sbjct  7    SIAKDVTELIGKTPLVYLNRIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEEKGLI  66

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
            +P ++ LIEPTSGN GI +AFMAA KGYK+++TMPS  S+ERR  +R FGA+LVLTDP K
Sbjct  67   TPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPAK  126

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V+KA  + + TPN+ +LQQF NP N +IHYETTGPEIW+ + G VD  V
Sbjct  127  GMKGAVQKAEEIRDKTPNSYILQQFENPANPKIHYETTGPEIWKGSSGKVDALV  180



>ref|XP_007033724.1| O-acetylserine lyase B isoform 2 [Theobroma cacao]
 gb|EOY04650.1| O-acetylserine lyase B isoform 2 [Theobroma cacao]
Length=409

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  82   GLNIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAEQRG  141

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            +I+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  142  VITPGKSILVEPTSGNTGIGLAFIAASKGYQLILTMPASMSLERRVLLKAFGAELVLTDS  201

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STPNA MLQQF NP N +IHYETTGPEIWED++G VDIF+
Sbjct  202  AKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDSRGKVDIFI  257



>ref|XP_006826284.1| hypothetical protein AMTR_s00004p00055080 [Amborella trichopoda]
 gb|ERM93521.1| hypothetical protein AMTR_s00004p00055080 [Amborella trichopoda]
Length=330

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G+ +  ++++LIGKTPLVYLN VT+GC A VAAK E M+P +S+KDR   +MI DAE+KG
Sbjct  5    GSAIAKDITELIGKTPLVYLNNVTDGCVARVAAKLEGMEPCSSVKDRIGYSMISDAEEKG  64

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P Q+ LIEPTSGN GI +AF+AA KGY++++TMP+  S+ERR+ +R FGA+LVLTDP
Sbjct  65   LITPGQSVLIEPTSGNTGIGLAFVAAAKGYRLIITMPTSMSLERRIILRAFGAELVLTDP  124

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             +GM G V+KA  LLE  PN+ +LQQF NP N +IHYETTGPEIW+ + G +D FV
Sbjct  125  ARGMKGAVQKAEELLEKIPNSYILQQFENPANPKIHYETTGPEIWKGSGGKIDAFV  180



>emb|CDP08001.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 155/221 (70%), Gaps = 4/221 (2%)
 Frame = +2

Query  161  MNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLP-RNTPGTNVKPEVSQLIGKT  337
            M+F     SS+   S K F  + +  S+    A  I   P     G N+  +V+QLIGKT
Sbjct  37   MSFKNVNSSSI---SSKKFYKEKVSFSSVTCKAVSIEQQPVTEVEGLNIAEDVTQLIGKT  93

Query  338  PLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSG  517
            P+VYLN + +G  A++AAK E+M+P  S+KDR   +MI DAE+KG+I+P ++ L+EPTSG
Sbjct  94   PMVYLNNIVKGSVAHIAAKLEIMEPCCSVKDRIGYSMIADAEQKGVITPGKSILVEPTSG  153

Query  518  NMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALL  697
            N GI +AF+AA +GYK++LTMPS  S+ERRV +R FGA+L+LTDP KGM G V+KA  + 
Sbjct  154  NTGIGLAFIAASRGYKLILTMPSSMSLERRVLLRAFGAELILTDPAKGMKGAVEKAEEIR  213

Query  698  ESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
              TPN+ +LQQF NP N +IHY+TTGPEIWEDT+G VDI V
Sbjct  214  NKTPNSYILQQFDNPANPKIHYDTTGPEIWEDTRGKVDILV  254



>ref|XP_008223611.1| PREDICTED: cysteine synthase-like [Prunus mume]
Length=400

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 144/194 (74%), Gaps = 1/194 (1%)
 Frame = +2

Query  233  PGSASPSFAQRIRDLPRN-TPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQ  409
            P S S    + +   P+    G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+
Sbjct  59   PSSVSSVVCKAVSVTPQTAVEGLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIME  118

Query  410  PTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSY  589
            P  S+KDR   +MI+DAE++GLI P Q+ L+EPTSGN GI +AF+AA KGYK++LTMP+ 
Sbjct  119  PCCSVKDRIGYSMIIDAEQRGLIKPGQSVLVEPTSGNTGIGLAFIAATKGYKLILTMPAS  178

Query  590  TSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYET  769
             S+ERRV ++ FGA+LVLTD  KGM G V+KA  + +STPNA MLQQF NP N +IHYET
Sbjct  179  MSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEIFKSTPNAYMLQQFDNPANPKIHYET  238

Query  770  TGPEIWEDTQGNVD  811
            TGPEIWEDT+G VD
Sbjct  239  TGPEIWEDTRGKVD  252



>ref|XP_003591034.1| Cysteine synthase [Medicago truncatula]
 gb|AES61285.1| O-acetylserine (thiol) lyase [Medicago truncatula]
Length=325

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTPLVYLN V +GC A +AAK EMM+P +S+KDR   +MI DAE+KGL
Sbjct  6    STIAKDVTELIGKTPLVYLNHVVDGCVAQIAAKLEMMEPCSSVKDRIGYSMIADAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I P+++ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR  +R FGA+LVLTDP 
Sbjct  66   IRPQESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRTILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  +L  TPNA +LQQF NP N ++HYETTGPEIW+ + G VD  V
Sbjct  126  KGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKSSGGKVDALV  180



>emb|CAA57344.1| cysteine synthase [Arabidopsis thaliana]
Length=392

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+    +QLIGKTP+VYLN V +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  72   GLNIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKG  131

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+E TSGN GI +AF+AA KGYK++LTMP+  S+ERRV +R FGA+LVLT+P
Sbjct  132  LITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEP  191

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G ++KA  +L+ TPN+ MLQQF NP N +IHYETT PEIWEDT+G +DI V
Sbjct  192  AKGMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTNPEIWEDTRGKIDILV  247



>emb|CAA57498.1| cysteine synthase [Arabidopsis thaliana]
Length=424

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+   VSQLIGKTP+VYLN + +GC A +AAK E+M+P  S+KDR   +M+ DAE+KG
Sbjct  104  GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKG  163

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
             ISP ++ L+EPTSGN GI +AF+A+ +GY+++LTMP+  S+ERRV ++ FGA+LVLTDP
Sbjct  164  FISPGKSVLVEPTSGNTGIGLAFIAS-RGYRLILTMPASMSMERRVLLKAFGAELVLTDP  222

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L++TP+A MLQQF NP N +IHYETTGPEIW+DT+G VDIFV
Sbjct  223  AKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFV  278



>ref|XP_009348268.1| PREDICTED: probable S-sulfocysteine synthase, chloroplastic [Pyrus 
x bretschneideri]
Length=375

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
             N+  +V+QLIG TP+VYLNKV+EGC A +AAK E M+P  S+KDR   +MI +AEK GL
Sbjct  67   VNIAEDVTQLIGSTPMVYLNKVSEGCVANIAAKLESMEPCRSVKDRIGCSMISNAEKSGL  126

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            ISP +T L+EPTSGN G+ +AF+AA KGYK+++TMP+  +IERR+ +R FGA++VLTDP 
Sbjct  127  ISPGKTVLVEPTSGNTGLGIAFVAATKGYKLIVTMPASINIERRILLRAFGAEVVLTDPE  186

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KG+ G + KA  ++ STPN+ MLQQF N  N +IH++TTGPEIWEDT GNVDIFV  I
Sbjct  187  KGLKGALDKAGEIVLSTPNSYMLQQFDNAANAEIHFDTTGPEIWEDTIGNVDIFVAAI  244



>gb|AAA16973.1| O-acetylserine-(thiol)-lyase [Spinacia oleracea]
Length=390

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 159/228 (70%), Gaps = 14/228 (6%)
 Frame = +2

Query  158  LMNFIKARKSSMLQYSCKFFTTQPLPGSASPSFAQRIRDLPRNT-PGTNVKPEVSQLIGK  334
            L NF     SS+   SC  F       S+SP   + +   P +T  G N+  +VSQLIGK
Sbjct  25   LANFRVGPPSSL---SCNNFKKV----SSSPITCKAVSLSPPSTIEGLNIAEDVSQLIGK  77

Query  335  TPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTS  514
            TP+VYLN V++G  A +AAK E M+P  S+KDR   +MI DAE+KG+I+P +TTL+EPTS
Sbjct  78   TPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTS  137

Query  515  GNMGISMAFMAAVKGYKMVLTMPSYTS------IERRVTMRVFGADLVLTDPTKGMGGTV  676
            GN GI +AF+AA +GYK+ LTMP+  S      +ERRV ++ FGA+LVLTDP KGM G V
Sbjct  138  GNTGIGLAFIAAARGYKITLTMPASMSMEKESYLERRVILKAFGAELVLTDPAKGMKGAV  197

Query  677  KKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            +KA  +L+ TP++ MLQQF NP N +IHYETTGPEIWEDT+G VDIFV
Sbjct  198  EKAEEILKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFV  245



>ref|XP_007033723.1| O-acetylserine lyase B isoform 1 [Theobroma cacao]
 gb|EOY04649.1| O-acetylserine lyase B isoform 1 [Theobroma cacao]
Length=402

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +G  A +AAK E+M+P  S+KDR   +MI DAE++G
Sbjct  82   GLNIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAEQRG  141

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            +I+P ++ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  142  VITPGKSILVEPTSGNTGIGLAFIAASKGYQLILTMPASMSLERRVLLKAFGAELVLTDS  201

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
             KGM G V+KA  +L+STPNA MLQQF NP N +IHYETTGPEIWED++G VDIF+
Sbjct  202  AKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDSRGKVDIFI  257



>gb|KDD74825.1| pyridoxal-phosphate dependent enzyme [Helicosporidium sp. ATCC 
50920]
Length=313

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +2

Query  314  VSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLISPEQT  493
            ++ LIG TPLV L KVT GC A V AK E ++P +S+KDR   AMI DAEK+G ISPE+T
Sbjct  1    MTSLIGNTPLVELTKVTTGCNARVLAKLESLEPNSSVKDRIGYAMIEDAEKQGKISPEKT  60

Query  494  TLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKGMGGT  673
            TL+EPTSGN GI++AF+AA +GYK++LTMP+  S+ERR+ +R FGA+LVLTDP KGM G 
Sbjct  61   TLVEPTSGNTGIALAFVAAARGYKLILTMPATMSLERRIVLRAFGAELVLTDPAKGMKGA  120

Query  674  VKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            V KA  +   TP A +LQQF NP N +IHYETTGPE+WEDT+GNVDIFV
Sbjct  121  VAKAEEIEAETPGAYILQQFENPANPKIHYETTGPEVWEDTEGNVDIFV  169



>ref|XP_011071587.1| PREDICTED: cysteine synthase [Sesamum indicum]
 ref|XP_011071588.1| PREDICTED: cysteine synthase [Sesamum indicum]
Length=325

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            T +  +V++LIGKTPLVYLN V +GC A VAAK E+M+P +S+KDR   +MI DAE+KGL
Sbjct  6    TGIAKDVTELIGKTPLVYLNNVVDGCVARVAAKLEIMEPCSSVKDRIGYSMIKDAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +R FGA+LVLTDP 
Sbjct  66   INPGESILIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  + + TPN+ +LQQF NP N +IHYETTGPE+W+ T G +D FV
Sbjct  126  KGMKGAVQKAEEIRDKTPNSYILQQFENPSNPKIHYETTGPEVWKGTSGKIDAFV  180



>ref|XP_002512253.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF49705.1| cysteine synthase, putative [Ricinus communis]
Length=325

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++L+GKTPLVYLN V +GC A +AAK EMM+P +S+KDR   +MI DAE+KGL
Sbjct  6    SAIAKDVTELVGKTPLVYLNHVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I P ++ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +R FGA+LVLTDP 
Sbjct  66   IKPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRMVLRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            +GM G V+KA  +L  TPN+ +LQQF NP N +IHYETTGPEIW+ + G VD FV
Sbjct  126  RGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETTGPEIWKGSGGKVDFFV  180



>ref|XP_010277228.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
 ref|XP_010277235.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
Length=325

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = +2

Query  302  VKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLIS  481
            +  +V++LIGKTPLVYLN +T+GC A +AAK EMM+P +S+KDR   +MI DAE+KGLI 
Sbjct  8    IAKDVTELIGKTPLVYLNNITDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLIR  67

Query  482  PEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTKG  661
            P +T LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR+ +R FGA++ LTDP KG
Sbjct  68   PGETVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILRAFGAEVFLTDPAKG  127

Query  662  MGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
            + G V+KA  +L  TPNA +LQQF NP N +IHYETTGPEIW+ T G VD F
Sbjct  128  VKGAVQKAEEILAKTPNAYILQQFENPANPKIHYETTGPEIWKGTAGKVDAF  179



>ref|XP_009353050.1| PREDICTED: probable S-sulfocysteine synthase, chloroplastic [Pyrus 
x bretschneideri]
Length=377

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
             N+  +V+QLIG TP+VYLNKV+EGC A +AAK E M+P  S+KDR   +MIL+AEK GL
Sbjct  69   VNIAEDVTQLIGSTPMVYLNKVSEGCVANIAAKLESMEPCRSVKDRIGCSMILNAEKSGL  128

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            ISP +T L+EPTSGN G+ +AF+AA KGYK+++TMP+  +IERR+ +R FGA++VLTDP 
Sbjct  129  ISPGKTVLVEPTSGNTGLGIAFVAATKGYKLIVTMPASINIERRILLRAFGAEVVLTDPE  188

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFVMGI  829
            KG+ G + KA  ++  TPN+ MLQQF N  N +IH++ TGPEIWEDT GNVDIFV  I
Sbjct  189  KGLKGALDKAGEIVLCTPNSYMLQQFDNAANAEIHFDATGPEIWEDTMGNVDIFVAAI  246



>emb|CDM84690.1| unnamed protein product [Triticum aestivum]
 emb|CDM84710.1| unnamed protein product [Triticum aestivum]
Length=377

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  215  FTTQPLPGSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAK  394
            F T   P  A+P+  +   +   +    N+  +V+QLIGKTP+VYLN V EGC A +AAK
Sbjct  42   FPTASSPKVAAPAAVEIPEEYVDDVEAVNIAVDVTQLIGKTPMVYLNNVVEGCVANIAAK  101

Query  395  QEMMQPTASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVL  574
             E M P  S+KDR AL+MI DAE KGLISP +T L+EPT+GN GI +A +AA +GYKM+ 
Sbjct  102  LEYMGPCRSVKDRIALSMISDAEDKGLISPNKTILVEPTTGNTGIGLAAVAAARGYKMIA  161

Query  575  TMPSYTSIERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQ  754
            TMPS   +ERR+ +R FGAD+VLTDPT G+ G V KA  ++  TPNA M QQF+N  N++
Sbjct  162  TMPSSIDVERRILVRAFGADIVLTDPTTGLKGAVDKAEEIVSKTPNAYMFQQFNNSANSE  221

Query  755  IHYETTGPEIWEDTQGNVDIFV  820
            IH++TTGPEIWEDT G VDI +
Sbjct  222  IHFQTTGPEIWEDTLGTVDILI  243



>gb|KHN15751.1| Cysteine synthase [Glycine soja]
Length=325

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V++LIGKTP+VYLNK+ +G  A VAAK E+M+P +S+KDR A +MI DAEKKGL
Sbjct  6    SGIAKDVTELIGKTPIVYLNKIADGSVARVAAKLELMEPCSSVKDRIAYSMIADAEKKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P Q+ LIEPTSGN GI +AF+AA KGYK+++TMP+  S+ERR  +  FGA+LVLTDP 
Sbjct  66   ITPGQSILIEPTSGNTGIGLAFLAAAKGYKLIITMPASMSLERRTILLSFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  +L+ TPNA +LQQF NP N ++HYETTGPEIWE T+G VD  V
Sbjct  126  KGMKGAVQKAEEILDKTPNAYILQQFENPANPKVHYETTGPEIWEGTRGKVDALV  180



>gb|AFK41873.1| unknown [Lotus japonicus]
Length=198

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            + +  +V+QLIGKTPLVYLNK+ +GC A VAAK E+M+P +S+KDR   +MI DAE+KGL
Sbjct  6    SGIAEDVTQLIGKTPLVYLNKLADGCVARVAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA KGYK+++TMP+  S+ERR  +  FGA+LVLTDP 
Sbjct  66   ITPGKSVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRTILLAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  ++  TPN+ MLQQF N  N ++HYETTGPEIW+ T G VD  V
Sbjct  126  KGMKGAVQKAEEIVAKTPNSYMLQQFENAANPKVHYETTGPEIWKGTAGKVDALV  180



>gb|KDO74574.1| hypothetical protein CISIN_1g020501mg [Citrus sinensis]
Length=206

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  296  TNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGL  475
            +N+  +V++LIG TPLVYLN +  GC A +AAK EMM+P +S+KDR   +MI DAE KGL
Sbjct  6    SNIAKDVTELIGNTPLVYLNNIVNGCVARIAAKLEMMEPCSSVKDRIGYSMISDAEAKGL  65

Query  476  ISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPT  655
            I+P ++ LIEPTSGN GI +AFMAA K Y++++TMP+  S+ERR+ +R FGA+LVLTDP 
Sbjct  66   ITPGESVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSLERRIILRAFGAELVLTDPA  125

Query  656  KGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            KGM G V+KA  +L  TPNA MLQQF NP N +IHYETTGPE+W+ + G +D  V
Sbjct  126  KGMKGAVQKAEEILAKTPNAYMLQQFENPANPKIHYETTGPELWKGSGGRIDALV  180



>ref|XP_010466525.1| PREDICTED: putative inactive cysteine synthase 2 [Camelina sativa]
 ref|XP_010466526.1| PREDICTED: putative inactive cysteine synthase 2 [Camelina sativa]
 ref|XP_010466527.1| PREDICTED: putative inactive cysteine synthase 2 [Camelina sativa]
Length=325

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKGLI  478
             +  +V++LIG TPLVYLNKVT+ C  +VAAK EMM+P +S+KDR   +MI DAE KGLI
Sbjct  7    KIAKDVTELIGNTPLVYLNKVTKDCVGHVAAKLEMMEPCSSVKDRIGYSMIADAEAKGLI  66

Query  479  SPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPTK  658
             P ++ LIEPTSGN G+ +AF+AA KGYK+V+TMP+  SIERR+ +  FGA+LVLTDP K
Sbjct  67   KPGESVLIEPTSGNTGVGLAFVAAAKGYKLVITMPASMSIERRIILLAFGAELVLTDPAK  126

Query  659  GMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIFV  820
            GM G V KA  +L  TPN  MLQQF NP NT+IHYETTGPEIW+   G VDIFV
Sbjct  127  GMKGAVAKAEEILAKTPNGYMLQQFENPANTKIHYETTGPEIWKGCGGKVDIFV  180



>ref|NP_001045577.1| Os01g0978100 [Oryza sativa Japonica Group]
 dbj|BAD87047.1| putative plastidic cysteine synthase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF07491.1| Os01g0978100 [Oryza sativa Japonica Group]
 dbj|BAG89605.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89319.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94001.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56113.1| hypothetical protein OsJ_04976 [Oryza sativa Japonica Group]
Length=394

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  293  GTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPTASIKDRPALAMILDAEKKG  472
            G N+  +V+QLIGKTP+VYLN + +GC A VAAK E+M+P  S+KDR   +MI DAE+KG
Sbjct  74   GLNIADDVTQLIGKTPMVYLNNIVKGCVANVAAKLEIMEPCCSVKDRIGYSMISDAEEKG  133

Query  473  LISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  652
            LI+P ++ L+EPTSGN GI +AF+AA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD 
Sbjct  134  LITPGKSVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSMERRVLLKAFGAELVLTDA  193

Query  653  TKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTGPEIWEDTQGNVDIF  817
             KGM G V KA  +L  TP+A MLQQF NP N ++HYETTGPEIWED++G VD+F
Sbjct  194  AKGMKGAVDKATEILNKTPDAYMLQQFDNPANPKVHYETTGPEIWEDSKGKVDVF  248



>ref|XP_004967885.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Setaria italica]
Length=401

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = +2

Query  236  GSASPSFAQRIRDLPRNTPGTNVKPEVSQLIGKTPLVYLNKVTEGCGAYVAAKQEMMQPT  415
            GSAS S + R R +     G N+  +V+QLIGKTP+VYLN + +G  A VAAK E+M+P 
Sbjct  62   GSASVSSSARCRAVAAEVEGLNIANDVTQLIGKTPMVYLNNIVKGSVANVAAKLEIMEPC  121

Query  416  ASIKDRPALAMILDAEKKGLISPEQTTLIEPTSGNMGISMAFMAAVKGYKMVLTMPSYTS  595
             S+KDR   +MI DAE+KGLI+P ++ L+E TSGN GI +AF+AA KGYK++LTMPS  S
Sbjct  122  CSVKDRIGYSMINDAEEKGLITPGKSVLVEATSGNTGIGLAFIAASKGYKLILTMPSSMS  181

Query  596  IERRVTMRVFGADLVLTDPTKGMGGTVKKAYALLESTPNAVMLQQFSNPVNTQIHYETTG  775
            +ERRV +R FGA+LVLTD  KGM G + KA  +L+ TPN+ MLQQF NP N ++HYETTG
Sbjct  182  MERRVLLRAFGAELVLTDAAKGMKGALDKATEILDKTPNSYMLQQFDNPANPKVHYETTG  241

Query  776  PEIWEDTQGNVD  811
            PEIWED++G VD
Sbjct  242  PEIWEDSKGKVD  253



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1639611019956