BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86725_g1_i1 len=1001 path=[1:0-1000]

Length=1001
                                                                      Score     E

dbj|BAF47193.1|  embryonic element binding Factor 7                     196   5e-56   Daucus carota [carrots]
gb|AIX48026.1|  dehydration responsive element-binding protein A6       193   7e-55   
gb|ABK95243.1|  unknown                                                 194   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_002310574.2|  hypothetical protein POPTR_0007s05690g             193   3e-54   Populus trichocarpa [western balsam poplar]
gb|AHB33873.1|  ERF transcription factor 02                             192   4e-54   
emb|CDP01435.1|  unnamed protein product                                192   6e-54   
ref|XP_011022769.1|  PREDICTED: ethylene-responsive transcription...    192   6e-54   
ref|XP_002307098.1|  hypothetical protein POPTR_0005s07900g             192   8e-54   Populus trichocarpa [western balsam poplar]
gb|ABU86872.1|  dehydrate responsive element-binding protein            190   4e-53   Populus euphratica
gb|KDP46862.1|  hypothetical protein JCGZ_24071                         188   2e-52   
gb|ABQ62983.1|  TINY-like protein                                       184   7e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009616719.1|  PREDICTED: ethylene-responsive transcription...    182   2e-50   
ref|XP_006355363.1|  PREDICTED: ethylene-responsive transcription...    182   2e-50   
ref|XP_004237407.1|  PREDICTED: ethylene-responsive transcription...    182   4e-50   
ref|XP_011097593.1|  PREDICTED: ethylene-responsive transcription...    181   1e-49   
ref|XP_009798155.1|  PREDICTED: ethylene-responsive transcription...    180   2e-49   
ref|XP_002285802.1|  PREDICTED: ethylene-responsive transcription...    179   4e-49   Vitis vinifera
ref|XP_008234629.1|  PREDICTED: ethylene-responsive transcription...    179   6e-49   
ref|XP_010105895.1|  Ethylene-responsive transcription factor           178   9e-49   
ref|XP_007047994.1|  AP2/ERF domain-containing transcription fact...    178   1e-48   
ref|XP_011090520.1|  PREDICTED: ethylene-responsive transcription...    176   2e-48   
ref|XP_010526650.1|  PREDICTED: ethylene-responsive transcription...    176   2e-48   
ref|XP_002533146.1|  DNA binding protein, putative                      176   9e-48   Ricinus communis
gb|AHB33872.1|  ERF transcription factor 01                             173   1e-47   
gb|AFH56408.1|  ethylene response factor 1                              170   1e-47   
ref|XP_011011480.1|  PREDICTED: ethylene-responsive transcription...    175   1e-47   
ref|XP_008444109.1|  PREDICTED: ethylene-responsive transcription...    175   2e-47   
ref|XP_009615540.1|  PREDICTED: ethylene-responsive transcription...    174   3e-47   
ref|XP_004143476.1|  PREDICTED: ethylene-responsive transcription...    173   6e-47   
ref|XP_002307390.2|  hypothetical protein POPTR_0005s16690g             173   7e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009373164.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    172   1e-46   
gb|ADX97444.1|  DREB1p                                                  170   1e-46   
ref|XP_007205497.1|  hypothetical protein PRUPE_ppa008234mg             171   2e-46   
gb|AAZ14831.1|  putative AP2-binding protein                            169   2e-46   Jatropha curcas
emb|CBI19140.3|  unnamed protein product                                169   2e-46   
ref|XP_008219663.1|  PREDICTED: ethylene-responsive transcription...    172   2e-46   
gb|AFY98895.1|  ethylene-responsive element binding-factor              171   4e-46   
ref|XP_008440612.1|  PREDICTED: ethylene-responsive transcription...    171   5e-46   
gb|ADE41121.1|  AP2 domain class transcription factor                   168   6e-46   
ref|XP_002301042.2|  AP2 domain-containing transcription factor f...    170   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_008378545.1|  PREDICTED: ethylene-responsive transcription...    170   9e-46   
ref|XP_004299631.1|  PREDICTED: ethylene-responsive transcription...    170   1e-45   
ref|XP_004142609.1|  PREDICTED: ethylene-responsive transcription...    170   1e-45   
ref|XP_011016241.1|  PREDICTED: ethylene-responsive transcription...    169   2e-45   
gb|AHJ08575.1|  DREB6-like protein                                      168   2e-45   
ref|XP_004163671.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    169   3e-45   
gb|ABY63297.1|  DREB protein                                            167   3e-45   
ref|XP_010027841.1|  PREDICTED: ethylene-responsive transcription...    168   3e-45   
ref|XP_002513895.1|  DNA binding protein, putative                      169   4e-45   Ricinus communis
gb|ADE41115.1|  AP2 domain class transcription factor                   168   6e-45   
gb|ACY25088.1|  DREB1C                                                  167   9e-45   
ref|XP_010531386.1|  PREDICTED: ethylene-responsive transcription...    166   1e-44   
ref|XP_009138555.1|  PREDICTED: ethylene-responsive transcription...    164   1e-44   
ref|XP_011098323.1|  PREDICTED: ethylene-responsive transcription...    166   1e-44   
ref|XP_008362598.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    167   2e-44   
ref|XP_008375600.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    167   2e-44   
ref|XP_007223221.1|  hypothetical protein PRUPE_ppa007193mg             167   2e-44   
ref|XP_006428165.1|  hypothetical protein CICLE_v10025961mg             166   3e-44   
emb|CDY31606.1|  BnaA03g54460D                                          163   4e-44   
ref|XP_009345480.1|  PREDICTED: ethylene-responsive transcription...    165   5e-44   
gb|KDO56612.1|  hypothetical protein CISIN_1g018103mg                   166   5e-44   
gb|AFJ14639.1|  dehydration-responsive element-binding protein (D...    165   9e-44   
ref|XP_003526587.1|  PREDICTED: ethylene-responsive transcription...    163   9e-44   
ref|XP_007163638.1|  hypothetical protein PHAVU_001G251200g             163   1e-43   
ref|XP_011074161.1|  PREDICTED: ethylene-responsive transcription...    163   2e-43   
ref|XP_010437100.1|  PREDICTED: ethylene-responsive transcription...    162   2e-43   
emb|CDX69387.1|  BnaC01g00660D                                          161   2e-43   
ref|XP_006286220.1|  hypothetical protein CARUB_v10007787mg             162   2e-43   
gb|KFK42189.1|  hypothetical protein AALP_AA2G223100                    162   3e-43   
ref|XP_007136233.1|  hypothetical protein PHAVU_009G029600g             163   3e-43   
ref|XP_003552083.1|  PREDICTED: ethylene-responsive transcription...    162   3e-43   
ref|XP_009127404.1|  PREDICTED: ethylene-responsive transcription...    161   4e-43   
ref|NP_001234707.1|  dehydration-responsive element binding prote...    160   5e-43   
gb|KEH20859.1|  ethylene response factor                                161   5e-43   
ref|XP_006596336.1|  PREDICTED: ethylene-responsive transcription...    162   5e-43   
ref|XP_006411774.1|  hypothetical protein EUTSA_v10025958mg             160   5e-43   
gb|EYU24006.1|  hypothetical protein MIMGU_mgv1a009524mg                162   7e-43   
emb|CDY42004.1|  BnaA01g05760D                                          160   7e-43   
ref|XP_010446537.1|  PREDICTED: ethylene-responsive transcription...    160   8e-43   
ref|XP_010680571.1|  PREDICTED: ethylene-responsive transcription...    160   9e-43   
ref|XP_009349966.1|  PREDICTED: ethylene-responsive transcription...    161   1e-42   
emb|CDY39455.1|  BnaC03g60650D                                          159   1e-42   
ref|XP_010431962.1|  PREDICTED: ethylene-responsive transcription...    159   2e-42   
ref|XP_010647272.1|  PREDICTED: ethylene-responsive transcription...    159   6e-42   
emb|CDY14636.1|  BnaC02g24770D                                          157   6e-42   
ref|XP_002868928.1|  hypothetical protein ARALYDRAFT_490762             157   7e-42   
gb|ABB89754.1|  dehydration-responsive element binding protein 3        157   7e-42   Asparagus officinalis
gb|AEI16474.1|  dehydration-responsive element binding protein          159   8e-42   
ref|XP_006416222.1|  hypothetical protein EUTSA_v10008326mg             157   1e-41   
gb|ADC94856.1|  DRE transcription factor 1                              159   1e-41   Vitis pseudoreticulata
ref|XP_008445348.1|  PREDICTED: ethylene-responsive transcription...    159   1e-41   
emb|CDX90362.1|  BnaA08g16220D                                          156   1e-41   
gb|AFX68812.1|  ERF transcription factor 8                              157   1e-41   
gb|AET99101.1|  dehydration-responsive element-binding protein DREB4    159   2e-41   
ref|XP_004150659.1|  PREDICTED: ethylene-responsive transcription...    159   2e-41   
gb|AIM47745.1|  DREBa                                                   157   2e-41   
ref|XP_009128273.1|  PREDICTED: ethylene-responsive transcription...    157   2e-41   
ref|XP_003635449.1|  PREDICTED: ethylene-responsive transcription...    159   2e-41   
gb|KFK44310.1|  hypothetical protein AALP_AA1G241600                    155   2e-41   
ref|XP_006354001.1|  PREDICTED: ethylene-responsive transcription...    159   2e-41   
ref|XP_009779133.1|  PREDICTED: ethylene-responsive transcription...    158   2e-41   
gb|AAT39542.1|  transcription factor DRE-binding factor 2               158   3e-41   Gossypium hirsutum [American cotton]
ref|XP_004288218.1|  PREDICTED: ethylene-responsive transcription...    158   3e-41   
ref|NP_195688.1|  ethylene-responsive transcription factor ERF060       155   3e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79244.1|  BnaC06g20590D                                          157   4e-41   
gb|AAC49770.1|  AP2 domain containing protein RAP2.4                    154   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613405.1|  PREDICTED: ethylene-responsive transcription...    157   5e-41   
gb|ADE41127.1|  AP2 domain class transcription factor                   157   5e-41   
ref|XP_004514265.1|  PREDICTED: ethylene-responsive transcription...    156   5e-41   
gb|ABB89755.1|  putative dehydration-responsive element binding p...    157   6e-41   Broussonetia papyrifera [aka]
ref|XP_009366366.1|  PREDICTED: ethylene-responsive transcription...    156   6e-41   
gb|ADD69957.1|  DREB2                                                   156   7e-41   Caragana korshinskii
gb|AEI98834.1|  dehydration responsive element binding protein 3        154   8e-41   
ref|XP_010647274.1|  PREDICTED: ethylene-responsive transcription...    154   9e-41   
gb|ADD09620.1|  dehydration responsive element binding protein          155   1e-40   Trifolium repens [creeping white clover]
gb|AAK43967.1|AF370152_1  putative AP2 domain-containing protein        156   1e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52091.1|AC012680_2  putative AP2 domain transcriptional reg...    151   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477479.1|  PREDICTED: ethylene-responsive transcription...    154   2e-40   
ref|NP_177931.1|  ethylene-responsive transcription factor RAP2-4       155   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAF17691.1|AC009243_18  F28K19.29                                    155   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36517.1|  hypothetical protein MIMGU_mgv1a009828mg                155   2e-40   
ref|XP_009106455.1|  PREDICTED: ethylene-responsive transcription...    155   2e-40   
gb|AAT44917.1|  putative AP2/EREBP transcription factor                 153   4e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01030.1|  unnamed protein product                                154   4e-40   
ref|XP_010060168.1|  PREDICTED: ethylene-responsive transcription...    155   4e-40   
emb|CBI83762.1|  transcription factor DREB2a                            154   5e-40   
gb|ADD09598.1|  dehydration responsive element binding protein          153   5e-40   Trifolium repens [creeping white clover]
gb|KGN48763.1|  AP2/ERF domain-containing transcription factor          152   6e-40   
ref|XP_010916895.1|  PREDICTED: ethylene-responsive transcription...    154   6e-40   
ref|XP_006434017.1|  hypothetical protein CICLE_v10001563mg             153   7e-40   
ref|XP_010459960.1|  PREDICTED: ethylene-responsive transcription...    152   8e-40   
gb|AEY75252.1|  DRE binding transcription factor                        151   8e-40   
ref|XP_010521193.1|  PREDICTED: ethylene-responsive transcription...    153   1e-39   
emb|CDX68032.1|  BnaA07g20720D                                          153   1e-39   
ref|NP_001288047.1|  ethylene-responsive transcription factor ERF060    153   1e-39   
emb|CDX72672.1|  BnaC07g46940D                                          151   1e-39   
emb|CDX87480.1|  BnaA07g33930D                                          152   1e-39   
ref|XP_009104590.1|  PREDICTED: ethylene-responsive transcription...    153   1e-39   
gb|KDO80918.1|  hypothetical protein CISIN_1g017798mg                   152   1e-39   
emb|CDX88414.1|  BnaC06g38580D                                          153   1e-39   
gb|ACP18975.1|  dehydration responsive element binding factor           154   1e-39   Limonium bicolor
ref|XP_010261262.1|  PREDICTED: ethylene-responsive transcription...    155   1e-39   
ref|XP_004252538.1|  PREDICTED: ethylene-responsive transcription...    153   1e-39   
ref|XP_009797394.1|  PREDICTED: ethylene-responsive transcription...    153   2e-39   
gb|ADE41144.1|  AP2 domain class transcription factor                   152   2e-39   
dbj|BAG50057.1|  transcription factor AP2-EREBP                         154   2e-39   Lotus japonicus
ref|XP_007018819.1|  AP2 4, putative                                    154   2e-39   
ref|XP_010498682.1|  PREDICTED: ethylene-responsive transcription...    151   3e-39   
gb|KFK30541.1|  hypothetical protein AALP_AA7G275700                    150   3e-39   
ref|XP_006434018.1|  hypothetical protein CICLE_v10001563mg             152   4e-39   
ref|XP_003542454.1|  PREDICTED: ethylene-responsive transcription...    151   4e-39   
emb|CBI23500.3|  unnamed protein product                                150   4e-39   
gb|KDO80917.1|  hypothetical protein CISIN_1g017798mg                   152   5e-39   
ref|XP_006472629.1|  PREDICTED: ethylene-responsive transcription...    152   5e-39   
ref|XP_006390026.1|  hypothetical protein EUTSA_v10018771mg             152   5e-39   
ref|XP_009109443.1|  PREDICTED: ethylene-responsive transcription...    149   5e-39   
ref|XP_008352604.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    151   6e-39   
ref|XP_010102588.1|  Ethylene-responsive transcription factor           151   7e-39   
ref|XP_006303258.1|  hypothetical protein CARUB_v10009949mg             149   8e-39   
ref|XP_006394075.1|  hypothetical protein EUTSA_v10005326mg             149   9e-39   
ref|XP_008790815.1|  PREDICTED: ethylene-responsive transcription...    151   1e-38   
emb|CDY38238.1|  BnaC05g17550D                                          149   1e-38   
ref|XP_010042789.1|  PREDICTED: ethylene-responsive transcription...    150   1e-38   
gb|AAF76898.1|AF274033_1  apetala2 domain-containing protein            148   1e-38   Atriplex hortensis
ref|XP_009145366.1|  PREDICTED: ethylene-responsive transcription...    148   2e-38   
emb|CDY21346.1|  BnaA09g30810D                                          148   2e-38   
ref|XP_003615022.1|  Ethylene-responsive transcription factor RAP2-4    151   2e-38   
gb|AIM47746.1|  DREBb                                                   150   2e-38   
gb|ADC94857.1|  DRE transcription factor 2                              147   2e-38   Vitis pseudoreticulata
ref|XP_002890498.1|  hypothetical protein ARALYDRAFT_472454             148   2e-38   
gb|AEA76436.1|  DRE binding transcription factor                        147   2e-38   
gb|AFH96116.1|  DREB                                                    148   2e-38   
gb|AEX88462.1|  ethylene-responsive element binding factor 3            148   3e-38   
gb|AIZ74389.1|  DREB3                                                   149   3e-38   
ref|XP_007141161.1|  hypothetical protein PHAVU_008G172200g             149   4e-38   
gb|KHN44333.1|  Ethylene-responsive transcription factor RAP2-4         148   5e-38   
gb|AFU07642.1|  ethylene-responsive element binding factor 5            148   1e-37   
gb|AFO38387.1|  putative ethylene-responsive transcription factor...    147   1e-37   
gb|ABR53728.1|  DRE-binding protein DREB1                               147   1e-37   Cymbidium insigne
ref|XP_002887717.1|  hypothetical protein ARALYDRAFT_476975             148   1e-37   
ref|XP_004500614.1|  PREDICTED: ethylene-responsive transcription...    147   1e-37   
ref|XP_003638785.1|  Ethylene-responsive transcription factor RAP2-4    148   1e-37   
ref|XP_006360275.1|  PREDICTED: ethylene-responsive transcription...    147   2e-37   
ref|NP_173638.1|  ethylene-responsive transcription factor RAP2.4       145   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061815.1|  PREDICTED: ethylene-responsive transcription...    146   4e-37   
gb|ACU17684.1|  unknown                                                 146   4e-37   Glycine max [soybeans]
ref|XP_010937498.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    147   5e-37   
ref|XP_010535636.1|  PREDICTED: ethylene-responsive transcription...    146   5e-37   
ref|XP_009389564.1|  PREDICTED: ethylene-responsive transcription...    145   6e-37   
ref|XP_004504059.1|  PREDICTED: ethylene-responsive transcription...    145   6e-37   
gb|ABJ09421.1|  putative DRE-binding protein DREB1                      142   6e-37   Aloe vera [acibar]
ref|XP_006302477.1|  hypothetical protein CARUB_v10020567mg             146   7e-37   
gb|AFK73558.1|  AP2 transcription factor                                144   8e-37   
gb|ADM47480.1|  DREB2                                                   145   1e-36   
gb|ACM17914.1|  dehydration-responsive element binding protein          141   2e-36   Aloe vera var. chinensis
gb|KHN31362.1|  Ethylene-responsive transcription factor ERF060         142   2e-36   
ref|XP_008803760.1|  PREDICTED: ethylene-responsive transcription...    144   3e-36   
dbj|BAI94491.1|  AP2/EREBP family transcription factor                  142   4e-36   
ref|XP_008808175.1|  PREDICTED: ethylene-responsive transcription...    144   5e-36   
gb|AID51416.1|  ethylene response factor 11                             142   6e-36   
ref|XP_010416775.1|  PREDICTED: ethylene-responsive transcription...    143   8e-36   
ref|XP_010269215.1|  PREDICTED: ethylene-responsive transcription...    144   9e-36   
ref|XP_003531359.1|  PREDICTED: ethylene-responsive transcription...    142   9e-36   
ref|NP_201318.1|  ethylene-responsive transcription factor ERF057       141   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28776.1|  unknown                                                 141   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676915.1|  PREDICTED: ethylene-responsive transcription...    143   1e-35   
gb|EYU23219.1|  hypothetical protein MIMGU_mgv1a019226mg                142   2e-35   
ref|XP_009387776.1|  PREDICTED: ethylene-responsive transcription...    143   2e-35   
gb|AIZ74390.1|  DREB4                                                   141   3e-35   
ref|XP_010428923.1|  PREDICTED: ethylene-responsive transcription...    141   5e-35   
ref|XP_010462245.1|  PREDICTED: ethylene-responsive transcription...    139   5e-35   
ref|NP_001236953.1|  dehydration responsive element-binding prote...    139   5e-35   
ref|XP_003525060.1|  PREDICTED: ethylene-responsive transcription...    140   5e-35   
ref|XP_002454259.1|  hypothetical protein SORBIDRAFT_04g027660          140   6e-35   Sorghum bicolor [broomcorn]
ref|XP_010472009.1|  PREDICTED: ethylene-responsive transcription...    141   6e-35   
gb|AFK73559.1|  AP2 transcription factor                                139   1e-34   
emb|CDY14542.1|  BnaC03g49170D                                          138   1e-34   
ref|NP_001183842.1|  putative AP2/EREBP transcription factor supe...    138   2e-34   
ref|XP_002864941.1|  hypothetical protein ARALYDRAFT_919839             137   6e-34   
ref|XP_009417374.1|  PREDICTED: ethylene-responsive transcription...    138   1e-33   
gb|KHN38186.1|  Ethylene-responsive transcription factor RAP2-4         139   2e-33   
ref|XP_006280928.1|  hypothetical protein CARUB_v10026925mg             135   2e-33   
gb|AFP90308.1|  transcription factor 2                                  135   3e-33   
ref|XP_010939626.1|  PREDICTED: ethylene-responsive transcription...    135   8e-33   
gb|ABC74510.1|  DRF-like transcription factor DRFL2a                    134   2e-32   Triticum aestivum [Canadian hard winter wheat]
gb|AFP90317.1|  transcription factor 2                                  134   2e-32   
ref|XP_009150596.1|  PREDICTED: ethylene-responsive transcription...    132   4e-32   
ref|XP_004953948.1|  PREDICTED: ethylene-responsive transcription...    133   4e-32   
emb|CDY08816.1|  BnaA06g24080D                                          132   4e-32   
ref|XP_010544197.1|  PREDICTED: ethylene-responsive transcription...    132   4e-32   
ref|XP_007221531.1|  hypothetical protein PRUPE_ppa020676mg             128   4e-32   
ref|XP_004983222.1|  PREDICTED: ethylene-responsive transcription...    131   5e-32   
gb|ABC74512.1|  DRF-like transcription factor DRFL2b                    132   6e-32   Triticum aestivum [Canadian hard winter wheat]
gb|AFP90307.1|  transcription factor 2                                  132   7e-32   
gb|AFP90326.1|  transcription factor 2                                  132   7e-32   
gb|AFP90323.1|  transcription factor 2                                  132   7e-32   
gb|AFP90288.1|  transcription factor 2                                  132   8e-32   
gb|AFP90330.1|  transcription factor 2                                  132   8e-32   
gb|AFP90312.1|  transcription factor 2                                  132   8e-32   
gb|AFP90310.1|  transcription factor 2                                  132   8e-32   
gb|AFP90309.1|  transcription factor 2                                  132   8e-32   
gb|AFP90301.1|  transcription factor 2                                  132   8e-32   
gb|AFP90332.1|  transcription factor 2                                  132   8e-32   
gb|AFP90293.1|  transcription factor 2                                  132   8e-32   
gb|AFP90292.1|  transcription factor 2                                  132   9e-32   
ref|XP_010519793.1|  PREDICTED: ethylene-responsive transcription...    130   9e-32   
gb|KHN29077.1|  Ethylene-responsive transcription factor RAP2-4         130   1e-31   
ref|XP_010444489.1|  PREDICTED: ethylene-responsive transcription...    130   1e-31   
ref|XP_010484316.1|  PREDICTED: ethylene-responsive transcription...    130   1e-31   
gb|AFP90302.1|  transcription factor 2                                  131   1e-31   
gb|AFP90299.1|  transcription factor 2                                  131   1e-31   
gb|AFP90315.1|  transcription factor 2                                  131   1e-31   
gb|AFP90294.1|  transcription factor 2                                  131   1e-31   
gb|AFP90320.1|  transcription factor 2                                  131   1e-31   
gb|AFP90306.1|  transcription factor 2                                  131   1e-31   
gb|ABC74511.1|  DRF-like transcription factor DRFL2c                    131   2e-31   Triticum aestivum [Canadian hard winter wheat]
gb|AFP90321.1|  transcription factor 2                                  131   2e-31   
gb|AFP90314.1|  transcription factor 2                                  131   2e-31   
ref|XP_003570628.1|  PREDICTED: ethylene-responsive transcription...    130   2e-31   
emb|CDY33983.1|  BnaC02g43540D                                          129   2e-31   
gb|AFP90291.1|  transcription factor 2                                  130   3e-31   
gb|AFP90334.1|  transcription factor 2                                  130   3e-31   
gb|AFP90305.1|  transcription factor 2                                  130   3e-31   
ref|XP_010546408.1|  PREDICTED: ethylene-responsive transcription...    129   3e-31   
gb|KFK32834.1|  hypothetical protein AALP_AA6G293100                    128   3e-31   
gb|AFP90311.1|  transcription factor 2                                  130   4e-31   
ref|XP_009124887.1|  PREDICTED: ethylene-responsive transcription...    129   5e-31   
ref|XP_009390585.1|  PREDICTED: ethylene-responsive transcription...    130   6e-31   
gb|EPS68328.1|  dehydration responsive element-binding protein 2        124   7e-31   
gb|AFP90303.1|  transcription factor 2                                  129   7e-31   
gb|AFP90333.1|  transcription factor 2                                  129   8e-31   
emb|CBX87025.1|  DBF2 protein                                           128   1e-30   
ref|XP_007159638.1|  hypothetical protein PHAVU_002G254500g             129   1e-30   
gb|ABC65854.1|  drought-responsive factor-like transcription fact...    127   1e-30   Triticum aestivum [Canadian hard winter wheat]
gb|ABC65853.1|  drought-responsive factor-like transcription fact...    127   2e-30   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001048142.1|  Os02g0752800                                       128   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AFP90324.1|  transcription factor 2                                  128   2e-30   
ref|XP_002444319.1|  hypothetical protein SORBIDRAFT_07g020090          126   3e-30   Sorghum bicolor [broomcorn]
ref|XP_006826963.1|  hypothetical protein AMTR_s00010p00194910          126   3e-30   
gb|EEC74022.1|  hypothetical protein OsI_08968                          127   3e-30   
gb|AEW08200.1|  hypothetical protein 2_2931_01                          123   3e-30   
gb|ABR17765.1|  unknown                                                 129   3e-30   
gb|ABK24284.1|  unknown                                                 129   4e-30   
gb|AFB33269.1|  hypothetical protein 2_2931_01                          122   5e-30   
ref|XP_006296204.1|  hypothetical protein CARUB_v10025369mg             125   6e-30   
ref|XP_008652630.1|  PREDICTED: ethylene-responsive transcription...    126   7e-30   
ref|XP_010461345.1|  PREDICTED: ethylene-responsive transcription...    126   8e-30   
ref|XP_009390914.1|  PREDICTED: ethylene-responsive transcription...    126   1e-29   
ref|XP_010496065.1|  PREDICTED: ethylene-responsive transcription...    125   1e-29   
ref|XP_002880436.1|  hypothetical protein ARALYDRAFT_900671             125   1e-29   
gb|AEW08199.1|  hypothetical protein 2_2931_01                          121   1e-29   
ref|XP_010472214.1|  PREDICTED: ethylene-responsive transcription...    124   2e-29   
ref|XP_010500063.1|  PREDICTED: ethylene-responsive transcription...    125   2e-29   
ref|XP_009380194.1|  PREDICTED: ethylene-responsive transcription...    124   3e-29   
ref|XP_004985387.1|  PREDICTED: ethylene-responsive transcription...    124   3e-29   
emb|CDX73367.1|  BnaC05g27390D                                          124   3e-29   
ref|XP_010926272.1|  PREDICTED: ethylene-responsive transcription...    124   4e-29   
ref|XP_004956678.1|  PREDICTED: ethylene-responsive transcription...    124   4e-29   
ref|XP_010500062.1|  PREDICTED: ethylene-responsive transcription...    124   4e-29   
ref|XP_009404053.1|  PREDICTED: ethylene-responsive transcription...    124   4e-29   
ref|XP_003578039.1|  PREDICTED: ethylene-responsive transcription...    123   4e-29   
gb|KHN02024.1|  Ethylene-responsive transcription factor RAP2-4         120   4e-29   
ref|NP_001049235.1|  Os03g0191900                                       122   1e-28   
ref|XP_006303237.1|  hypothetical protein CARUB_v10012538mg             123   1e-28   
ref|XP_010416976.1|  PREDICTED: ethylene-responsive transcription...    122   1e-28   
ref|XP_002465715.1|  hypothetical protein SORBIDRAFT_01g044410          123   1e-28   
ref|XP_010429137.1|  PREDICTED: ethylene-responsive transcription...    122   1e-28   
ref|XP_006660575.1|  PREDICTED: ethylene-responsive transcription...    122   1e-28   
emb|CDY25578.1|  BnaA04g12700D                                          121   1e-28   
ref|NP_001141968.1|  putative AP2/EREBP transcription factor supe...    122   1e-28   
gb|EAY88866.1|  hypothetical protein OsI_10343                          122   1e-28   
ref|XP_009140335.1|  PREDICTED: ethylene-responsive transcription...    120   2e-28   
ref|XP_009381506.1|  PREDICTED: ethylene-responsive transcription...    124   2e-28   
gb|AAX13274.1|  DREB2                                                   119   2e-28   
emb|CDY31284.1|  BnaA02g34570D                                          121   2e-28   
ref|XP_009130491.1|  PREDICTED: ethylene-responsive transcription...    121   2e-28   
ref|XP_002460137.1|  hypothetical protein SORBIDRAFT_02g023230          121   4e-28   
gb|ABB90544.1|  dehydration responsive element binding protein          120   4e-28   
tpg|DAA49099.1|  TPA: putative AP2/EREBP transcription factor sup...    120   4e-28   
gb|ACN28514.1|  unknown                                                 119   4e-28   
dbj|BAJ96243.1|  predicted protein                                      122   5e-28   
tpg|DAA49098.1|  TPA: putative AP2/EREBP transcription factor sup...    120   5e-28   
ref|NP_001105578.1|  LOC542569                                          119   5e-28   
ref|XP_003574464.1|  PREDICTED: ethylene-responsive transcription...    120   5e-28   
ref|XP_004964981.1|  PREDICTED: ethylene-responsive transcription...    121   7e-28   
gb|AAZ08560.1|  DRE binding factor                                      120   7e-28   
ref|NP_001266537.1|  DRE binding factor 1                               120   8e-28   
ref|XP_006404676.1|  hypothetical protein EUTSA_v10000302mg             119   1e-27   
ref|NP_564468.1|  ethylene-responsive transcription factor ERF055       120   1e-27   
ref|NP_001136823.1|  putative AP2/EREBP transcription factor supe...    119   1e-27   
gb|EAZ06962.1|  hypothetical protein OsI_29203                          119   2e-27   
gb|ABB90886.1|  putative DRE binding factor                             119   2e-27   
ref|NP_001061779.1|  Os08g0408500                                       119   2e-27   
ref|NP_001266604.1|  DRE binding factor                                 119   2e-27   
ref|XP_008659105.1|  PREDICTED: ethylene-responsive transcription...    120   2e-27   
ref|XP_002893909.1|  hypothetical protein ARALYDRAFT_473706             119   3e-27   
ref|NP_179810.1|  ethylene-responsive transcription factor ERF056       118   3e-27   
ref|XP_003564067.1|  PREDICTED: ethylene-responsive transcription...    119   3e-27   
gb|AAP70033.1|  DRE binding factor 2                                    118   4e-27   
ref|NP_001063013.1|  Os09g0369000                                       118   4e-27   
ref|XP_002438081.1|  hypothetical protein SORBIDRAFT_10g007780          119   5e-27   
emb|CDX89442.1|  BnaC04g34610D                                          116   6e-27   
dbj|BAD37688.1|  putative AP2-domain DRE binding factor DBF1            118   9e-27   
tpg|DAA46884.1|  TPA: putative AP2/EREBP transcription factor sup...    117   9e-27   
gb|EAZ00198.1|  hypothetical protein OsI_22202                          118   9e-27   
ref|XP_008666300.1|  PREDICTED: ethylene-responsive transcription...    116   1e-26   
gb|AAL91280.1|  At2g22200/T26C19.14                                     116   1e-26   
ref|NP_001266857.1|  DRE-binding protein 2                              117   1e-26   
ref|NP_001146944.1|  LOC100280553                                       117   2e-26   
dbj|BAK01371.1|  predicted protein                                      116   2e-26   
ref|XP_003558614.1|  PREDICTED: ethylene-responsive transcription...    115   3e-26   
ref|XP_008782127.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
ref|XP_004973405.1|  PREDICTED: ethylene-responsive transcription...    115   5e-26   
dbj|BAJ90034.1|  predicted protein                                      115   6e-26   
gb|AID55124.1|  ethylene responsive factor 07                           111   1e-25   
gb|AAP56252.1|  AP2-domain DRE binding factor DBF1                      113   2e-25   
ref|XP_009415091.1|  PREDICTED: ethylene-responsive transcription...    111   9e-25   
ref|XP_010924856.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
ref|XP_004296759.1|  PREDICTED: ethylene-responsive transcription...    112   2e-24   
ref|XP_008776202.1|  PREDICTED: ethylene-responsive transcription...    110   2e-24   
ref|XP_004496081.1|  PREDICTED: ethylene-responsive transcription...    111   3e-24   
ref|XP_010913767.1|  PREDICTED: ethylene-responsive transcription...    109   3e-24   
ref|XP_008779564.1|  PREDICTED: ethylene-responsive transcription...    111   5e-24   
gb|KEH43295.1|  AP2 domain class transcription factor                   109   7e-24   
gb|AHK24883.1|  DRE-binding protein                                     104   7e-24   
ref|XP_011026904.1|  PREDICTED: ethylene-responsive transcription...    109   7e-24   
ref|XP_003591645.1|  Ethylene-responsive transcription factor RAP2-3    110   8e-24   
ref|XP_007040501.1|  AP2/ERF domain-containing transcription fact...    109   8e-24   
ref|XP_009357820.1|  PREDICTED: ethylene-responsive transcription...    110   9e-24   
ref|XP_010551186.1|  PREDICTED: ethylene-responsive transcription...    109   1e-23   
ref|XP_010274030.1|  PREDICTED: ethylene-responsive transcription...    109   2e-23   
ref|XP_009139609.1|  PREDICTED: ethylene-responsive transcription...    108   2e-23   
ref|XP_010689679.1|  PREDICTED: ethylene-responsive transcription...    108   2e-23   
ref|XP_007034359.1|  AP2/ERF domain-containing transcription fact...    109   2e-23   
gb|ABR16078.1|  unknown                                                 109   2e-23   
gb|ABQ62986.1|  RAP2-like protein                                       105   2e-23   
ref|XP_008224508.1|  PREDICTED: ethylene-responsive transcription...    108   3e-23   
ref|XP_010053127.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
ref|XP_007226002.1|  hypothetical protein PRUPE_ppa010345mg             106   4e-23   
ref|XP_004243339.1|  PREDICTED: ethylene-responsive transcription...    107   4e-23   
ref|XP_011085351.1|  PREDICTED: ethylene-responsive transcription...    107   5e-23   
emb|CBI34474.3|  unnamed protein product                                105   6e-23   
ref|XP_009397949.1|  PREDICTED: ethylene-responsive transcription...    107   7e-23   
gb|EYU32669.1|  hypothetical protein MIMGU_mgv1a017674mg                107   8e-23   
gb|KDP39366.1|  hypothetical protein JCGZ_01123                         107   8e-23   
ref|XP_008381261.1|  PREDICTED: ethylene-responsive transcription...    107   9e-23   
ref|XP_009400292.1|  PREDICTED: ethylene-responsive transcription...    106   1e-22   
emb|CDY53558.1|  BnaC04g55700D                                          106   1e-22   
ref|XP_002270561.2|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
ref|XP_009607801.1|  PREDICTED: ethylene-responsive transcription...    106   1e-22   
dbj|BAJ99190.1|  predicted protein                                      106   1e-22   
ref|XP_006420915.1|  hypothetical protein CICLE_v10007069mg             106   1e-22   
ref|XP_007144182.1|  hypothetical protein PHAVU_007G135300g             106   2e-22   
ref|XP_002518093.1|  hypothetical protein RCOM_1019500                  107   2e-22   
gb|KDO41157.1|  hypothetical protein CISIN_1g015775mg                   106   2e-22   
ref|XP_002319909.2|  hypothetical protein POPTR_0013s13920g             107   2e-22   
gb|ABQ62985.1|  RAP2-like protein                                       107   2e-22   
ref|XP_010918447.1|  PREDICTED: ethylene-responsive transcription...    107   2e-22   
ref|XP_010099577.1|  Ethylene-responsive transcription factor           106   2e-22   
gb|KHN30687.1|  Ethylene-responsive transcription factor ERF062         103   2e-22   
ref|XP_006827824.1|  hypothetical protein AMTR_s00009p00268560          106   2e-22   
ref|XP_007216848.1|  hypothetical protein PRUPE_ppa021711mg             106   2e-22   
ref|XP_008244505.1|  PREDICTED: ethylene-responsive transcription...    106   2e-22   
ref|XP_002976369.1|  hypothetical protein SELMODRAFT_104980             105   2e-22   
gb|EPS73079.1|  hypothetical protein M569_01680                         102   2e-22   
dbj|BAJ98638.1|  predicted protein                                      106   2e-22   
ref|NP_001235100.1|  dehydration-responsive element binding prote...    104   3e-22   
emb|CCF23313.1|  drought responsive element binding protein 5           104   3e-22   
emb|CCF23312.1|  drought responsive element binding protein 5           104   3e-22   
ref|XP_006285323.1|  hypothetical protein CARUB_v10006710mg             104   3e-22   
ref|XP_008342928.1|  PREDICTED: ethylene-responsive transcription...    105   3e-22   
ref|XP_003569954.1|  PREDICTED: ethylene-responsive transcription...    105   4e-22   
ref|XP_009413180.1|  PREDICTED: ethylene-responsive transcription...    104   4e-22   
ref|XP_008457242.1|  PREDICTED: ethylene-responsive transcription...    105   4e-22   
ref|XP_010035718.1|  PREDICTED: ethylene-responsive transcription...    105   4e-22   
ref|XP_003571744.2|  PREDICTED: ethylene-responsive transcription...    102   4e-22   
gb|AFV60736.1|  ethylene-responsive transcription factor 4              105   5e-22   
ref|XP_004139008.1|  PREDICTED: ethylene-responsive transcription...    104   5e-22   
gb|EPS62721.1|  hypothetical protein M569_12068                         103   5e-22   
ref|XP_010241385.1|  PREDICTED: ethylene-responsive transcription...    105   5e-22   
gb|ABQ62987.1|  RAP2-like protein                                       105   5e-22   
ref|XP_002323984.2|  hypothetical protein POPTR_0017s08250g             105   5e-22   
ref|XP_010023704.1|  PREDICTED: ethylene-responsive transcription...    104   5e-22   
emb|CBG76431.1|  OO_Ba0013J05-OO_Ba0033A15.18                           105   6e-22   
ref|XP_009393593.1|  PREDICTED: ethylene-responsive transcription...    105   6e-22   
ref|XP_008791428.1|  PREDICTED: ethylene-responsive transcription...    103   6e-22   
ref|XP_007043551.1|  AP2/ERF domain-containing transcription fact...    105   6e-22   
gb|KHN27877.1|  Ethylene-responsive transcription factor ERF053         104   6e-22   
ref|XP_006357496.1|  PREDICTED: ethylene-responsive transcription...    104   6e-22   
ref|XP_002971774.1|  hypothetical protein SELMODRAFT_15839            97.8    6e-22   
ref|XP_006840184.1|  hypothetical protein AMTR_s00089p00102760          104   7e-22   
ref|XP_009589826.1|  PREDICTED: ethylene-responsive transcription...    104   7e-22   
ref|XP_009342655.1|  PREDICTED: ethylene-responsive transcription...    104   7e-22   
ref|XP_004976312.1|  PREDICTED: ethylene-responsive transcription...    104   8e-22   
ref|XP_010440558.1|  PREDICTED: ethylene-responsive transcription...    103   8e-22   
emb|CBZ41765.1|  drought responsive element binding protein 5           103   8e-22   
gb|KDP24155.1|  hypothetical protein JCGZ_25812                         104   8e-22   
ref|XP_003526286.2|  PREDICTED: ethylene-responsive transcription...    104   8e-22   
ref|XP_010540852.1|  PREDICTED: ethylene-responsive transcription...    103   8e-22   
ref|NP_001053379.1|  Os04g0529100                                       103   8e-22   
gb|AIB05872.1|  AP2-EREBP transcription factor                          104   9e-22   
ref|XP_008678858.1|  PREDICTED: ethylene-responsive transcription...    104   9e-22   
ref|XP_002267468.1|  PREDICTED: ethylene-responsive transcription...    104   9e-22   
dbj|BAF47189.1|  embryonic element binding Factor 3                     103   9e-22   
ref|XP_006493082.1|  PREDICTED: ethylene-responsive transcription...    103   9e-22   
ref|XP_007149866.1|  hypothetical protein PHAVU_005G105200g             103   9e-22   
emb|CCD42020.1|  drought responsive element binding protein 5           103   9e-22   
gb|AFK39550.1|  unknown                                                 103   9e-22   
ref|XP_010096822.1|  Ethylene-responsive transcription factor           103   1e-21   
ref|XP_003565885.1|  PREDICTED: ethylene-responsive transcription...    102   1e-21   
ref|XP_011041894.1|  PREDICTED: ethylene-responsive transcription...    104   1e-21   
gb|KHN41135.1|  Ethylene-responsive transcription factor ERF054         103   1e-21   
gb|EYU26148.1|  hypothetical protein MIMGU_mgv11b016405mg               105   1e-21   
gb|KDO48161.1|  hypothetical protein CISIN_1g039976mg                   103   1e-21   
ref|XP_004487298.1|  PREDICTED: ethylene-responsive transcription...    103   1e-21   
gb|KHN36624.1|  Ethylene-responsive transcription factor ERF053         103   1e-21   
ref|XP_010107796.1|  Ethylene-responsive transcription factor           103   1e-21   
ref|XP_009781485.1|  PREDICTED: ethylene-responsive transcription...    103   1e-21   
ref|XP_003541916.1|  PREDICTED: ethylene-responsive transcription...    103   1e-21   
emb|CDP14752.1|  unnamed protein product                                104   1e-21   
emb|CAD41199.2|  OSJNBa0074L08.10                                       104   1e-21   
ref|XP_006298084.1|  hypothetical protein CARUB_v10014129mg             102   1e-21   
ref|XP_006447343.1|  hypothetical protein CICLE_v10015144mg             104   1e-21   
ref|XP_010676304.1|  PREDICTED: ethylene-responsive transcription...    102   2e-21   
emb|CDP11121.1|  unnamed protein product                                103   2e-21   
ref|XP_002517949.1|  conserved hypothetical protein                     103   2e-21   
ref|XP_010673427.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
ref|XP_009374592.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
ref|XP_008455331.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
gb|AAU44098.1|  hypothetical protein                                    101   2e-21   
ref|XP_006651119.1|  PREDICTED: ethylene-responsive transcription...    101   2e-21   
ref|XP_009592157.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
gb|EYU23366.1|  hypothetical protein MIMGU_mgv1a019606mg                102   2e-21   
ref|XP_008777305.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
ref|XP_006366853.1|  PREDICTED: ethylene-responsive transcription...    102   2e-21   
ref|XP_002454234.1|  hypothetical protein SORBIDRAFT_04g027180          103   2e-21   
ref|XP_004305415.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
gb|KHN35072.1|  Ethylene-responsive transcription factor ERF061         101   2e-21   
ref|XP_008380561.1|  PREDICTED: ethylene-responsive transcription...    103   2e-21   
ref|NP_001173092.1|  Os02g0638650                                       103   2e-21   
ref|XP_010555135.1|  PREDICTED: ethylene-responsive transcription...    102   2e-21   
gb|EAY99109.1|  hypothetical protein OsI_21068                          101   2e-21   
ref|XP_009781334.1|  PREDICTED: ethylene-responsive transcription...    102   2e-21   
ref|XP_011091699.1|  PREDICTED: ethylene-responsive transcription...    102   3e-21   
gb|KHN31960.1|  Ethylene-responsive transcription factor ERF053         102   3e-21   
ref|XP_006414873.1|  hypothetical protein EUTSA_v10025587mg             102   3e-21   
gb|EEC73669.1|  hypothetical protein OsI_08216                          103   3e-21   
ref|XP_003540897.1|  PREDICTED: ethylene-responsive transcription...    102   3e-21   
gb|KEH39107.1|  ethylene response factor                                102   3e-21   
ref|XP_009391372.1|  PREDICTED: ethylene-responsive transcription...  99.8    3e-21   
ref|XP_001775145.1|  predicted protein                                95.9    3e-21   
ref|XP_004136820.1|  PREDICTED: ethylene-responsive transcription...    102   3e-21   
ref|XP_010242006.1|  PREDICTED: ethylene-responsive transcription...    102   3e-21   
ref|XP_004953233.1|  PREDICTED: ethylene-responsive transcription...    103   3e-21   
ref|XP_004515941.1|  PREDICTED: ethylene-responsive transcription...    100   4e-21   
ref|XP_007132714.1|  hypothetical protein PHAVU_011G118600g             102   4e-21   
ref|XP_006837446.1|  hypothetical protein AMTR_s00107p00095070          101   4e-21   
ref|XP_011095770.1|  PREDICTED: ethylene-responsive transcription...    101   4e-21   
ref|XP_004516587.1|  PREDICTED: uncharacterized protein LOC101497734    103   4e-21   
gb|KHN25649.1|  Ethylene-responsive transcription factor ERF061         100   4e-21   



>dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota]
Length=320

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 180/282 (64%), Gaps = 37/282 (13%)
 Frame = -2

Query  973  LESCFTAEPNVFPGSVPIPSANRAFS---DGFASVGFEQSGPIGLNGLSPShileiqtqi  803
             +S F+ +P  FP   P  S  + FS    GFA +G +Q+G +GLN ++PS IL+IQ QI
Sbjct  52   FDSSFSTQPPTFPVYSPPESTTQMFSTGFSGFAHMGMDQTGSLGLNQITPSQILQIQAQI  111

Query  802  elqhqqQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQR  638
            +LQ+QQ   +  +            Q Q+ S  LG KPV MK      KP KLYRGVRQR
Sbjct  112  QLQNQQNYYSSISSLPP--------QPQRSSNFLGPKPVQMKHTGSPTKPTKLYRGVRQR  163

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFPH L  D  + 
Sbjct  164  HWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPH-LKLDQELS  222

Query  457  GFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSG--  284
             FKPLHS+V AKL+AICQ+L  N +  +   ++  + +P F        V V+  S+G  
Sbjct  223  TFKPLHSTVDAKLQAICQNL--NKEPKQKSAKKPKTSKPAF--------VKVEEASNGSD  272

Query  283  VGAASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
            +   SSPESEI+FL++        EN +L K+PS EIDW AL
Sbjct  273  LSGGSSPESEISFLDFSEPCFDESENFMLQKFPSVEIDWEAL  314



>gb|AIX48026.1| dehydration responsive element-binding protein A6 [Daucus carota]
Length=330

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 179/282 (63%), Gaps = 38/282 (13%)
 Frame = -2

Query  973  LESCFTAEPNVFPGSVPIPSANRAFS---DGFASVGFEQSGPIGLNGLSPShileiqtqi  803
             +S F+ +P  FP   P  S  + FS    GFA +G +Q+G +GLN ++PS IL+IQ QI
Sbjct  63   FDSPFSTQPTTFPVYSPPESTTQMFSTGFSGFAHMGMDQTGSLGLNQITPSQILQIQAQI  122

Query  802  elqhqqQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQR  638
            +LQ+   ++   +  SS  P+      Q+ S  LG KPV MK      KP KLYRGVRQR
Sbjct  123  QLQN---QQNYYSSISSLPPL-----PQRSSNFLGPKPVQMKHTGSVTKPTKLYRGVRQR  174

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFPH L  D  + 
Sbjct  175  HWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPH-LKLDQELS  233

Query  457  GFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSG--  284
             FKPLHS+V AKL+AICQ+L   N   K    +  + +P          V V+  S+G  
Sbjct  234  TFKPLHSTVDAKLQAICQNL---NKEPKQKNAKPKTSKPA--------VVKVEEASNGSD  282

Query  283  VGAASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
            +   SSPESE+TFL++        EN +L K+PS EIDW AL
Sbjct  283  LSGGSSPESEVTFLDFSEPCFDESENFMLQKFPSVEIDWEAL  324



>gb|ABK95243.1| unknown [Populus trichocarpa]
Length=373

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 189/314 (60%), Gaps = 57/314 (18%)
 Frame = -2

Query  967  SCF--TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqi  803
            +CF  T+ PN+   +   P++ + FS+GF+    +GFEQ+GPIGLN L+PS IL+IQ +I
Sbjct  65   NCFPVTSHPNL-DLNFYTPTSTQMFSNGFSGYNQMGFEQTGPIGLNHLTPSQILQIQAKI  123

Query  802  elqhqqQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-------KPGKLYRGVR  644
             LQ QQQ++ +A  +    P   L  NQ+ S  L  KPVPMKQ       KP KLYRGVR
Sbjct  124  HLQQQQQQQQMANHA----PTSQLVHNQRTSNFLAPKPVPMKQQSASPPPKPTKLYRGVR  179

Query  643  QRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHG  464
            QRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH       
Sbjct  180  QRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPHLRHQGAH  239

Query  463  VEG----FKPLHSSVVAKLEAICQSL-------------THNNDNSKSHEQQRNSEEPCF  335
            V G    +KPLHSSV AKL+AICQSL               ++  + S   Q   E+ C 
Sbjct  240  VSGEFGDYKPLHSSVDAKLQAICQSLGLQKQGETGEPCSVSDSKKTVSAPLQVKIEDDCS  299

Query  334  ----------GSGAAENAVNVKTES-----SGVGAASSPESEITFL--------EWENII  224
                        G  E  V + + S       +  +SSPESEI+F         E+EN  
Sbjct  300  LQGELKREFENLGVEEFKVEIPSPSPALSDESLAGSSSPESEISFFFSDSLQWDEFENFG  359

Query  223  LDKYPSAEIDWAAL  182
            L+KYPS EIDW+++
Sbjct  360  LEKYPSVEIDWSSI  373



>ref|XP_002310574.2| hypothetical protein POPTR_0007s05690g [Populus trichocarpa]
 gb|EEE91024.2| hypothetical protein POPTR_0007s05690g [Populus trichocarpa]
Length=375

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 190/314 (61%), Gaps = 55/314 (18%)
 Frame = -2

Query  967  SCF--TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqi  803
            +CF  T+ PN+   +   P++ + FS+GF+    +GFEQ+GPIGLN L+PS IL+IQ +I
Sbjct  65   NCFPVTSHPNL-DLNFYTPTSTQMFSNGFSGYNQMGFEQTGPIGLNHLTPSQILQIQAKI  123

Query  802  elqhqqQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-------KPGKLYRGVR  644
             LQ QQQ++ +A  + +  P   L  NQ+ S  L  KPVPMKQ       KP KLYRGVR
Sbjct  124  HLQQQQQQQQMANHAPA--PTSQLVHNQRTSNFLAPKPVPMKQQSASPPPKPTKLYRGVR  181

Query  643  QRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHG  464
            QRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH       
Sbjct  182  QRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPHLRHQGAH  241

Query  463  VEG----FKPLHSSVVAKLEAICQSL-------------THNNDNSKSHEQQRNSEEPCF  335
            V G    +KPLHSSV AKL+AICQSL               ++  + S   Q   E+ C 
Sbjct  242  VSGEFGDYKPLHSSVDAKLQAICQSLGLQKQGETGEPCSVSDSKKTVSAPLQVKIEDDCS  301

Query  334  ----------GSGAAENAVNVKTES-----SGVGAASSPESEITFL--------EWENII  224
                        G  E  V + + S       +  +SSPESEI+F         E+EN  
Sbjct  302  LQGELKREFENLGVEEFKVEIPSPSPALSDESLAGSSSPESEISFFFSDSLQWDEFENFG  361

Query  223  LDKYPSAEIDWAAL  182
            L+KYPS EIDW+++
Sbjct  362  LEKYPSVEIDWSSI  375



>gb|AHB33873.1| ERF transcription factor 02 [Coffea arabica]
Length=360

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 186/312 (60%), Gaps = 53/312 (17%)
 Frame = -2

Query  967  SCFTAEPNVFPG-SVPIPSANRAFSDGFAS---VGFEQS---GPIGLNGLSPShileiqt  809
            S F++EPN++   +  +P+    FS G +S   +GF++    G IGLN L+P  IL+++ 
Sbjct  52   SSFSSEPNMYSSFTSYVPTTAHMFSQGLSSFDEMGFDEQSGGGSIGLNHLTPYQILQVEA  111

Query  808  qielqhqqQKEalaalssssSPVFTLFQNQQKSPP--LGTKPVPMKQ-----KPGKLYRG  650
            QI+LQ+QQQ+   A    + S    L Q+Q  SP   LG KPV MKQ     KP KLYRG
Sbjct  112  QIKLQNQQQQYLAAQSLQNYSSTRQL-QHQNHSPLSFLGPKPVQMKQVGTPPKPAKLYRG  170

Query  649  VRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFP---HFL  479
            VRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFP   H L
Sbjct  171  VRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPNLRHQL  230

Query  478  SHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRN--------SEEPCFGSGA  323
            S D G   FKPLHSSV AKLEAICQSL  +     + EQ +           E  F    
Sbjct  231  SQDFG--DFKPLHSSVDAKLEAICQSLADSQKQGNTGEQHQKKVGVQTIPKVENTFDDSL  288

Query  322  AENAV-----NVKTESSGVGA------------ASSPESEITFLEW--------ENIILD  218
                V     +VK E +                 SSPESEITFL++        EN +L 
Sbjct  289  NSEYVYPGNEDVKVEETSSSLSPSRSDETSSLEMSSPESEITFLDFAEPTFDESENFLLQ  348

Query  217  KYPSAEIDWAAL  182
            K+PS EIDWAAL
Sbjct  349  KFPSVEIDWAAL  360



>emb|CDP01435.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 186/312 (60%), Gaps = 53/312 (17%)
 Frame = -2

Query  967  SCFTAEPNVFPG-SVPIPSANRAFSDGFAS---VGFEQS---GPIGLNGLSPShileiqt  809
            S F++EPN++   +  +P+    FS G +S   +GF++    G IGLN L+P  IL+++ 
Sbjct  78   SSFSSEPNMYSSFTSYVPTTAHMFSQGLSSFDEMGFDEQSGGGSIGLNHLTPYQILQVEA  137

Query  808  qielqhqqQKEalaalssssSPVFTLFQNQQKSPP--LGTKPVPMKQ-----KPGKLYRG  650
            QI+LQ+QQQ+   A    + S    L Q+Q  SP   LG KPV MKQ     KP KLYRG
Sbjct  138  QIKLQNQQQQYLAAQSLQNYSSTRQL-QHQNHSPLSFLGPKPVQMKQVGTPPKPAKLYRG  196

Query  649  VRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFP---HFL  479
            VRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFP   H L
Sbjct  197  VRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPNLRHQL  256

Query  478  SHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRN--------SEEPCFGSGA  323
            S D G   FKPLHSSV AKLEAICQSL  +     + EQ +           E  F    
Sbjct  257  SQDFG--DFKPLHSSVDAKLEAICQSLADSQKQGNTGEQHQKKVGVQTIPKVENTFDDSL  314

Query  322  AENAV-----NVKTESSGVGA------------ASSPESEITFLEW--------ENIILD  218
                V     +VK E +                 SSPESEITFL++        EN +L 
Sbjct  315  NSEYVYPGNEDVKVEETSSSLSPSRSDETSSLEMSSPESEITFLDFAEPTFDESENFLLQ  374

Query  217  KYPSAEIDWAAL  182
            K+PS EIDWAAL
Sbjct  375  KFPSVEIDWAAL  386



>ref|XP_011022769.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Populus euphratica]
Length=371

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 180/296 (61%), Gaps = 56/296 (19%)
 Frame = -2

Query  919  PSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            P++ + FS+GF+    +GFEQ+GPIGLN L+PS IL+IQ +I LQ QQQ+       ++ 
Sbjct  82   PTSTQMFSNGFSGYNQMGFEQTGPIGLNHLTPSQILQIQAKIHLQQQQQQ------MANH  135

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRT  590
            +P   L  NQ+ S  L  KPVPMKQ       KP KLYRGVRQRHWGKWVAEIRLPKNRT
Sbjct  136  APTSQLVHNQRTSNFLAPKPVPMKQQSASSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRT  195

Query  589  RLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAK  422
            RLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH       V G    +KPLHSSV AK
Sbjct  196  RLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPHLRHQGAHVSGEFGDYKPLHSSVDAK  255

Query  421  LEAICQSL-------------THNNDNSKSHEQQRNSEEPCF----------GSGAAENA  311
            L+AICQSL               ++  + S   Q   E+ C             G  E  
Sbjct  256  LQAICQSLGLQKQGETGEPCSVSDSKKTVSAPLQVKIEDDCSLQGELKREFENLGDEEFK  315

Query  310  VNVKTESSG-----VGAASSPESEITF-----LEW---ENIILDKYPSAEIDWAAL  182
            V + + S       +  +SSPESEI+F     L+W   EN  L+KYPS EIDW+++
Sbjct  316  VEIPSPSRALSDESLAGSSSPESEISFFFSDSLQWNGFENFGLEKYPSVEIDWSSI  371



>ref|XP_002307098.1| hypothetical protein POPTR_0005s07900g [Populus trichocarpa]
 gb|EEE94094.1| hypothetical protein POPTR_0005s07900g [Populus trichocarpa]
Length=372

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 177/296 (60%), Gaps = 54/296 (18%)
 Frame = -2

Query  919  PSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            P++ + FS+GF     +GFEQ+GPIGLN L+PS IL+IQ +I  Q QQQ++     +++S
Sbjct  81   PTSTQMFSNGFLDYNQMGFEQTGPIGLNHLTPSQILQIQAKIHFQQQQQQKMENLATTTS  140

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTR  587
              V     NQ+ S  L  KPVPMKQ      KP KLYRGVRQRHWGKWVAEIRLPKNRTR
Sbjct  141  QFV----HNQRASNFLAPKPVPMKQSAASPQKPTKLYRGVRQRHWGKWVAEIRLPKNRTR  196

Query  586  LWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKL  419
            LWLGT+DTAEEAA+A+D AAYKLRGE ARLNFPH       V G    +KPLHSSV AKL
Sbjct  197  LWLGTYDTAEEAALAYDNAAYKLRGEYARLNFPHLRHQGAHVSGEFGDYKPLHSSVDAKL  256

Query  418  EAICQSL-------------THNNDNSKSHEQQRNSEEPCFGSGAAENAV------NVKT  296
            +AICQSL               N+  + +   Q   E+ C   G  +         + K 
Sbjct  257  QAICQSLGLQKQGKTREPSSVANSKKTATAPLQAKIEDDCSLRGELKTEYENFGVEDYKV  316

Query  295  E---------SSGVGAASSPESEITFL---------EWENIILDKYPSAEIDWAAL  182
            E            +  +SSPESEI+FL         E+EN  L+KYPS EIDW+++
Sbjct  317  EIPSPSPASSDESLAGSSSPESEISFLDFSGSLQWDEFENFGLEKYPSVEIDWSSI  372



>gb|ABU86872.1| dehydrate responsive element-binding protein [Populus euphratica]
Length=375

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 179/300 (60%), Gaps = 58/300 (19%)
 Frame = -2

Query  919  PSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            P++ + FS+GF     +GFEQ+GPIGLN L+PS IL+IQ +I  Q QQQ++ +  L+++S
Sbjct  80   PTSTQMFSNGFLDYNQMGFEQTGPIGLNHLTPSQILQIQAKIHFQQQQQQQKMENLATTS  139

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTR  587
              V     N++ S  L  KPVPMKQ      KP KLYRGVRQRHWGKWVAEIRLPKNRTR
Sbjct  140  QCV----HNRKASNYLAPKPVPMKQSGASPQKPTKLYRGVRQRHWGKWVAEIRLPKNRTR  195

Query  586  LWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKL  419
            LWLGT+DTAEEAA+A+D AAYKLRGE ARLNFPH       V G    +KPLHSSV AKL
Sbjct  196  LWLGTYDTAEEAALAYDNAAYKLRGEYARLNFPHLRHQGAHVSGEFGDYKPLHSSVDAKL  255

Query  418  EAICQSL-------------THNNDNSKSHEQQRNSEEPCFGSGAAENAV------NVKT  296
            +AICQSL               N+  + +   Q   E+ C   G  +         + K 
Sbjct  256  QAICQSLGLQKQGKTREPSSVANSKKTATAPLQAKIEDDCSMRGELKTEYENFGVEDYKV  315

Query  295  E-------------SSGVGAASSPESEITFL---------EWENIILDKYPSAEIDWAAL  182
            E                V  +SSPESEI+FL         E+EN  L+KYPS EIDW+++
Sbjct  316  EIPSPSPSPSPASSDESVAGSSSPESEISFLDFPGSLHWDEFENFGLEKYPSVEIDWSSI  375



>gb|KDP46862.1| hypothetical protein JCGZ_24071 [Jatropha curcas]
Length=358

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 180/304 (59%), Gaps = 54/304 (18%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhq  788
            +++PN  P +   PS+   FS GF+    +GFEQ+G IGLN L+PS IL+IQ QI  Q Q
Sbjct  64   SSQPNFQPEACS-PSSTHVFSQGFSGYNQMGFEQTGSIGLNHLTPSQILQIQAQIHFQQQ  122

Query  787  qQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKW  623
            QQ+    + +S       L  NQ+ S  L  KPV MKQ     KP KLYRGVRQRHWGKW
Sbjct  123  QQQIPNLSSNSH------LLHNQRLSY-LAPKPVSMKQSASPSKPTKLYRGVRQRHWGKW  175

Query  622  VAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPL  443
            VAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L H      +KPL
Sbjct  176  VAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LRHQGDFGDYKPL  234

Query  442  HSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGS----------------------  329
            H+SV AKL+AICQSL  +    K+ E    S+     S                      
Sbjct  235  HASVDAKLQAICQSLATSQKQGKTGESSSVSDSKTNLSAPMKAIKEEDYSLKGELKREIE  294

Query  328  --GAAENAVNV----KTESSGVGAASSPESEITFLEW---------ENIILDKYPSAEID  194
              GA +  V +     +    +  +SSP+SEI+FL++         EN  L+KYPS EID
Sbjct  295  NLGAEDYRVEISSAAASSDESLAGSSSPQSEISFLDFSDSSQWDETENFGLEKYPSVEID  354

Query  193  WAAL  182
            WAAL
Sbjct  355  WAAL  358



>gb|ABQ62983.1| TINY-like protein [Populus trichocarpa]
 gb|ABQ62984.1| RAP2.4-like protein [Populus trichocarpa]
Length=276

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 168/280 (60%), Gaps = 51/280 (18%)
 Frame = -2

Query  880  VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPL  701
            +GFEQ+GPIGLN L+PS IL+IQ +I  Q QQQ++     +++S  V     NQ+ S  L
Sbjct  1    MGFEQTGPIGLNHLTPSQILQIQAKIHFQQQQQQKMENLATTTSQFV----HNQRASNFL  56

Query  700  GTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
              KPVPMKQ      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT+DTAEEAA+A+
Sbjct  57   APKPVPMKQSAASPQKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTYDTAEEAALAY  116

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSL---------  398
            D AAYKLRGE ARLNFPH       V G    +KPLHSSV AKL+AICQSL         
Sbjct  117  DNAAYKLRGEYARLNFPHLRHQGAHVSGEFGDYKPLHSSVDAKLQAICQSLGLQKQGKTR  176

Query  397  ----THNNDNSKSHEQQRNSEEPCFGSGAAENAV------NVKTE---------SSGVGA  275
                  N+  + +   Q   E+ C   G  +         + K E            +  
Sbjct  177  EPSSVANSKKTATAPLQAKIEDDCSLRGELKTEYENFGVEDYKVEIPSPSPASSDESLAG  236

Query  274  ASSPESEITFL---------EWENIILDKYPSAEIDWAAL  182
            +SSPESEI+FL         E+EN  L+KYPS EIDW+++
Sbjct  237  SSSPESEISFLDFSGSLQWDEFENFGLEKYPSVEIDWSSI  276



>ref|XP_009616719.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Nicotiana tomentosiformis]
Length=361

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 186/314 (59%), Gaps = 62/314 (20%)
 Frame = -2

Query  964  CFT--AEPNVFPGSVPIPSANRAFSDGFASVGF-EQSGPIGLNGLSPShileiqtqielq  794
            CF    EPN++     IPS        F  +G   ++G IGLN L+PS I +IQ QI+ Q
Sbjct  57   CFYPFGEPNLYTDFCTIPSL------SFNHMGLVAETGSIGLNHLTPSQIFQIQAQIQFQ  110

Query  793  hqqQKEalaalsss--------sSPVFTLFQNQQKSPPLGTKPVPMKQ------KPGKLY  656
            +QQQ++    L           S+P ++  +N      LG KPVPMKQ      KP KLY
Sbjct  111  NQQQQQQQQLLLQQQQSLGLLPSTPTYS--KNLNSMNYLGLKPVPMKQTGGAVQKPTKLY  168

Query  655  RGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLS  476
            RGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L 
Sbjct  169  RGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LR  227

Query  475  H--DHGVEGFKPLHSSVVAKLEAICQSLTH-----------NNDNSKSHEQQRNSEEPCF  335
            H  ++ +  FKPLHSSV AKL+AICQ+L +           +N+N+ S  ++        
Sbjct  228  HQLNNELSDFKPLHSSVDAKLQAICQNLANPKNPTNSDDLSSNNNTVSKPRKSRKAAAKV  287

Query  334  GSGAAENA---VNVKTESSGVG------------AASSPESEITFLEW--------ENII  224
             SG+ ++    VNVK E++                 SSPES+ITFL++        E+  
Sbjct  288  DSGSVQDCPENVNVKIEATSSSSPAPSEESSLSVVTSSPESDITFLDFIEPSFDESEDFF  347

Query  223  LDKYPSAEIDWAAL  182
            L KYPS EIDWAAL
Sbjct  348  LPKYPSVEIDWAAL  361



>ref|XP_006355363.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum tuberosum]
Length=370

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 187/323 (58%), Gaps = 64/323 (20%)
 Frame = -2

Query  952  EPNVFPGSVPIPS-ANRAFSDG---FASVGFEQSGPIGLNGLSPShileiqtqielqhqq  785
            EPN++     IPS A + FS G   F ++G  ++G IGLN L+PS IL+IQ QI+ Q+QQ
Sbjct  55   EPNLYTDFCAIPSTATQMFSQGYSCFNNMGVAETGSIGLNHLTPSQILQIQAQIQFQNQQ  114

Query  784  QKEalaalssss---SPVFTLFQNQQKSPPLGTKPVPMKQ-------KPGKLYRGVRQRH  635
            Q   L     S    +P  T  +N   +  LG KPVPMKQ       K  KLYRGVRQRH
Sbjct  115  QLLQLHQQQQSLGLLTPTSTYSKNLNSTNFLGMKPVPMKQTGGASSQKATKLYRGVRQRH  174

Query  634  WGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG  455
            WGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L H    E 
Sbjct  175  WGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LRHQLNNE-  232

Query  454  FKPLHSSVVAKLEAICQSLTHNNDN---SKSHEQQRNSEE-----PCFGSGAAENAVN--  305
            F PLHSSV AKL+AICQSL +   +   SKS+ + R S+      P   + A E++    
Sbjct  233  FSPLHSSVDAKLQAICQSLANPKSDDLCSKSNSKPRKSKTAAAAVPVDSNSAQESSSKSE  292

Query  304  VKTESSGVGAASSPES------------------------EITFLEW---------ENII  224
            +  + S  G  S PE+                        +ITFL++         EN  
Sbjct  293  ITIDDSLKGEFSYPENANIKIEASSSSPAPSEESSSSPESDITFLDFAEPPSFDESENFF  352

Query  223  LDKYPSAEIDWAAL*FAGICNLI  155
            L KYPS EIDWAAL     CNL+
Sbjct  353  LPKYPSVEIDWAAL-----CNLL  370



>ref|XP_004237407.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum lycopersicum]
Length=367

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 186/316 (59%), Gaps = 60/316 (19%)
 Frame = -2

Query  952  EPNVFPGSVPIPS-ANRAFSDG---FASVGFEQSGPIGLNGLSPShileiqtqielqhqq  785
            EPN++     IPS A + FS G   F ++G  ++G IGLN L+PS IL+IQ QI+ Q+QQ
Sbjct  53   EPNLYTDFCTIPSTATQMFSQGYSCFDNMGVAETGSIGLNHLTPSQILQIQAQIQFQNQQ  112

Query  784  QKEalaalssss----SPVFTLFQNQQKSPPLGTKPVPMKQ-------KPGKLYRGVRQR  638
            Q+  L      S    +P  T  +N   +  LG KPVPMKQ       K  KLYRGVRQR
Sbjct  113  QQLQLLHQQQQSLGLLTPTSTYSKNLNSTNFLGMKPVPMKQTGATSSQKATKLYRGVRQR  172

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L H    E
Sbjct  173  HWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LRHQLNNE  231

Query  457  --GFKPLHSSVVAKLEAICQSLTH---NNDNSKSHEQQRNSEEPCFG--SGAAENAVN--  305
               FKPLHSSV AKL+AICQSL +   ++  SKS+ + R S+       S +A+ + +  
Sbjct  232  FSDFKPLHSSVDAKLQAICQSLANPKSDDSCSKSNSKPRKSKTAAVSVDSNSAQESSSKS  291

Query  304  -VKTESSGVGAASSPES--------------------------EITFLEW--------EN  230
             + T+ S     S PE+                          +ITFL++        EN
Sbjct  292  EITTDDSLKEEFSYPENGTIKIEASSSSSPPTPSEESSSSSESDITFLDFAEPSFDESEN  351

Query  229  IILDKYPSAEIDWAAL  182
              L KYPS EIDWAAL
Sbjct  352  FFLPKYPSVEIDWAAL  367



>ref|XP_011097593.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Sesamum 
indicum]
Length=369

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 183/313 (58%), Gaps = 70/313 (22%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGFAS---VGFEQS-GPIGLNGLSPShileiqtqielqhqq  785
            +PN++ G   +PS  + FS GF+S   +G EQ+   IGLN L+PS IL+IQ Q  LQ QQ
Sbjct  71   QPNMYTGFSSVPSRTQIFSPGFSSFSQLGDEQTVSTIGLNQLTPSQILQIQAQFHLQQQQ  130

Query  784  QKEalaalssssSPVFTLFQNQQKSPP--LGTKPVPMKQ-----KPGKLYRGVRQRHWGK  626
             ++  +         F+  Q+Q  S    LG KPV MKQ     KPGKLYRGVRQRHWGK
Sbjct  131  LQQQQSYK-------FSQLQHQGNSFSSFLGPKPVLMKQPGTPSKPGKLYRGVRQRHWGK  183

Query  625  WVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHD--HGVEGF  452
            WVAEIRLPKNRTRLWLGTFDTAE+AA+A+DKAAYKLRGE ARLNFPH L H        F
Sbjct  184  WVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAYKLRGEFARLNFPH-LRHQLCRDSSDF  242

Query  451  KPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNS-EEPCFGS------------------  329
            KPLHSSV AKL+AICQ+L +      S +Q +NS EEPC  S                  
Sbjct  243  KPLHSSVDAKLQAICQNLAN------SQKQGKNSGEEPCSVSKQEHEIKKSSVPKIESSS  296

Query  328  -----GAAENAVNVKTESSGVG-----------AASSPESEITFLE--------WENIIL  221
                    +  V V++  S               ++SPES+IT L+        ++N +L
Sbjct  297  DDSSNDGFKETVKVESSISSSASPSPSEEASWTGSASPESDITLLDFHEPSFDGFDNFLL  356

Query  220  DKYPSAEIDWAAL  182
             KYPS EIDWAAL
Sbjct  357  QKYPSVEIDWAAL  369



>ref|XP_009798155.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Nicotiana sylvestris]
Length=356

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 188/305 (62%), Gaps = 53/305 (17%)
 Frame = -2

Query  964  CFT--AEPNVFPGSVPIPSANRAFSDGFASVG-FEQSGPIGLNGLSPShileiqtqielq  794
            CF    EPN++     IPS +      F  +G   ++G IGLN L+PS I +IQ QI+ Q
Sbjct  61   CFYPFGEPNLYTDFCTIPSLS------FNPMGHVAETGSIGLNHLTPSQIFQIQAQIQFQ  114

Query  793  hqqQKEalaalsss-----sSPVFTLFQNQQKSPPLGTKPVPMKQ------KPGKLYRGV  647
            +QQQ++ L     S     ++P ++  +N      LG KPVPMKQ      KP KLYRGV
Sbjct  115  NQQQQQLLLQQQQSLGLLPTTPTYS--KNLNSMNYLGLKPVPMKQSGGAIQKPTKLYRGV  172

Query  646  RQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSH--  473
            RQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L H  
Sbjct  173  RQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LRHQL  231

Query  472  DHGVEGFKPLHSSVVAKLEAICQSLTH-----NNDNSKSHEQQRNSEEPCFGSGAAENA-  311
            ++ +  FKPLHSSV AKL+AICQ+L +     +N+N+ S  ++         SG+ ++  
Sbjct  232  NNELSDFKPLHSSVDAKLQAICQNLANSDGLSSNNNTDSKPRKSKKAASKLNSGSVQDCP  291

Query  310  --VNVKTE------------SSGVGAASSPESEITFLEW--------ENIILDKYPSAEI  197
              VNVK E            SS     SSPES+ITFL++        EN  L KYPS EI
Sbjct  292  ENVNVKIEATSSSSPTQSEESSSSAVTSSPESDITFLDFIEPSFDESENFFLPKYPSVEI  351

Query  196  DWAAL  182
            DWAAL
Sbjct  352  DWAAL  356



>ref|XP_002285802.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Vitis 
vinifera]
Length=367

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 175/290 (60%), Gaps = 46/290 (16%)
 Frame = -2

Query  916  SANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalsss-s  749
            S     S GF+S    GFE SGPIGLN L+PS I +IQ QI+LQ         A ++S +
Sbjct  74   STTHVISQGFSSHDLQGFEHSGPIGLNHLTPSQIHQIQAQIQLQQHHNHMPAVAAAASFN  133

Query  748  SPVFTLFQNQQKSPP-LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTR  587
            +     +Q +Q++P  L  KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTR
Sbjct  134  TQNLPQWQQRQQAPNFLSPKPIPMKQVGVPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTR  193

Query  586  LWLGTFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKL  419
            LWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL
Sbjct  194  LWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIGGEFGDYKPLHSSVDAKL  253

Query  418  EAICQSLTHNNDNSKSHEQQRN---------------SEEPCFGSGAAEN------AVNV  302
            +AICQSL       K  + +++               SE        +E+      + ++
Sbjct  254  QAICQSLAETQKQGKPTQGKKSRSRAVAPSASQPVTVSESSTLSEQGSEDCKVEPTSSSM  313

Query  301  KTESSGVGAASSPESEITFLE----------WENIILDKYPSAEIDWAAL  182
             TES G G  SSP S++TF +          WEN  L KYPS EIDWAA+
Sbjct  314  FTESDGSG-GSSPLSDLTFPDDCEEAPFYGAWENFNLQKYPSNEIDWAAI  362



>ref|XP_008234629.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Prunus 
mume]
Length=374

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 181/306 (59%), Gaps = 53/306 (17%)
 Frame = -2

Query  961  FTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQ  782
            ++++PN++P     PS    F      VGFEQ+G IGLN L+PS IL+IQTQ+ LQ QQ+
Sbjct  76   YSSQPNLYPDFCS-PSTTHMFDQ----VGFEQTGSIGLNQLTPSQILQIQTQMVLQQQQE  130

Query  781  KEalaalssssSPVFTLFQNQQKSPP----LGTKPVPMKQ-----KPGKLYRGVRQRHWG  629
             +    +++ +SP     Q Q ++P     L  K +PMKQ     KP KLYRGVRQRHWG
Sbjct  131  HQQKEQIAALASPASLQNQYQHQNPRTLKFLTPKAIPMKQVGAPSKPTKLYRGVRQRHWG  190

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH       V G  
Sbjct  191  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLKHQGAHVSGDF  250

Query  454  --FKPLHSSVVAKLEAICQSLTHNN-DNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSG  284
              +KPLHSSV AKL+AICQSL  N+    K+ E    +E     S  +E  V++KTE  G
Sbjct  251  GHYKPLHSSVDAKLQAICQSLAANSAKQGKTGELCSVAERKPAISSPSE--VSLKTELKG  308

Query  283  VGAASSPES------------------------EITFLEW--------ENIILDKYPSAE  200
                +  E                         +ITFLE+        EN  L+KYPS E
Sbjct  309  ECELTGVECYRPEISSSPSQSVESSAGSSSPESDITFLEFSDSQWDEAENFGLEKYPSVE  368

Query  199  IDWAAL  182
            IDW+A+
Sbjct  369  IDWSAI  374



>ref|XP_010105895.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25985.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC06714.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=354

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 170/287 (59%), Gaps = 53/287 (18%)
 Frame = -2

Query  916  SANRAFSDGF---ASVGFEQS-GPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            S  + FSDGF   A +GFEQ  G IGLN L+PS I +IQ QI     Q +       + +
Sbjct  77   STAQMFSDGFSNQALLGFEQQPGSIGLNQLTPSQIHQIQAQICQIQAQTQ------PNLA  130

Query  748  SPVFTLFQNQQKSPP-LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTR  587
             P     Q Q  S   LG +PVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTR
Sbjct  131  YPTHNHHQQQLHSLSFLGPRPVPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTR  190

Query  586  LWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAK  422
            LWLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFPH   H   + G     +KPLHSSV AK
Sbjct  191  LWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPHLRHHGSSIGGGEFGDYKPLHSSVDAK  250

Query  421  LEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVN--------------VKTESSG  284
            L+AIC+SL  +    K   Q    + P   S +A+  V+              V TES G
Sbjct  251  LQAICESLAESQSQQK---QGVKKKPPAKRSSSAKQEVHEPKVEISPSPPSPVVTTESDG  307

Query  283  VGAASSPESEITFLE-----WE--------NIILDKYPSAEIDWAAL  182
              A SSP S++TF +     W+        N +L+KYPS EIDWA++
Sbjct  308  -SAGSSPLSDLTFPDIVESPWDCNNGGLESNYLLEKYPS-EIDWASI  352



>ref|XP_007047994.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOX92151.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=380

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 188/317 (59%), Gaps = 75/317 (24%)
 Frame = -2

Query  955  AEPNVFPGSVPIPSANRAFSD-GFAS----VGFEQSGPIGLNGLSPShileiqtqielqh  791
            ++PN++P     PS+   FS+ GF++    +GFEQ+G IGLN L+PS IL+IQ QI  Q 
Sbjct  74   SQPNMYPEFCS-PSSTHLFSNHGFSNYNNLMGFEQTGSIGLNQLTPSQILQIQAQIYQQQ  132

Query  790  qqQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGK  626
            QQQ++   A  +++S +    QNQ+ +  L  K VPMK+     KP KLYRGVRQRHWGK
Sbjct  133  QQQQQQQLASMATTSSL----QNQRLNF-LSPKAVPMKRVSTPSKPTKLYRGVRQRHWGK  187

Query  625  WVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG---  455
            WVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH       V G   
Sbjct  188  WVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPHLKHQGAHVSGEFG  247

Query  454  -FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVN---------  305
             +KPLHSSV AKL+AICQSL          ++Q NS + C  S +  N+V          
Sbjct  248  DYKPLHSSVDAKLQAICQSL----------QKQGNSGKTCSVSDSKPNSVVPSQPKVEFD  297

Query  304  --VKTE--------------------------SSGVGAASSPESEITFLEW--------E  233
              VKTE                             +  +SSPES+I+FL++        E
Sbjct  298  YPVKTEELDQSPRFSDPKVENSLSSSSSPELSDESLAGSSSPESDISFLDFSDSKWEDNE  357

Query  232  NIILDKYPSAEIDWAAL  182
            N  L+KYPS EIDW A+
Sbjct  358  NFGLEKYPSVEIDWEAI  374



>ref|XP_011090520.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Sesamum 
indicum]
Length=322

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 138/227 (61%), Gaps = 61/227 (27%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  104  LGPKPVLMKQPGSPSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  163

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVE--GFKPLHSSVVAKLEAICQSLTHNNDNSKSHE  365
            DKAAYKLRGE ARLNFPH L H    E  GFKPLHSSV AKL+AICQSL  +       +
Sbjct  164  DKAAYKLRGEFARLNFPH-LKHQLFQEFSGFKPLHSSVDAKLQAICQSLADS-------K  215

Query  364  QQRNSEEPCFGS--------------GAAENAVN-----------VKTESSGVGAA----  272
            +Q NS  PCF +               A++++ N           VK E+S   +A    
Sbjct  216  KQGNSRNPCFVAKVEPLTETGCPKLEKASDDSSNFRFKDLGSSETVKVETSVSSSAYPSP  275

Query  271  ---------SSPESEITFL--------EWENIILDKYPSAEIDWAAL  182
                      SPES ITFL        E +N +L KYPS EIDWAAL
Sbjct  276  SDEVSSAGSGSPESCITFLDFPEPSFDECDNFMLQKYPSVEIDWAAL  322



>ref|XP_010526650.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Tarenaya 
hassleriana]
Length=308

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 152/272 (56%), Gaps = 73/272 (27%)
 Frame = -2

Query  889  FASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKS  710
            F S+GF Q+ P+GLN L+P  I +IQ Q                        L Q     
Sbjct  68   FPSMGFSQTAPLGLNQLTPYQINQIQNQ------------------------LNQRHAFV  103

Query  709  PPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
              L  KPVPMK       K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA
Sbjct  104  SNLSPKPVPMKNFSSCSLKSQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA  163

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            MA+D+AAYKLRGE ARLNFPH    ++G+ G FKPLH+SV AKLEAICQ L         
Sbjct  164  MAYDQAAYKLRGELARLNFPHIRHDENGLVGSFKPLHASVDAKLEAICQGL---------  214

Query  370  HEQQRNSEEPCFGSGAA---------ENAVNVKTES------------SGVGAASSPESE  254
                R +EEPC  S            E+ ++ KTES                 +SSPES 
Sbjct  215  ----RKTEEPCSVSDETELIQPKTEQESELSDKTESGFPRFDEHSVSDESQAGSSSPESG  270

Query  253  ITFLEWE--------NIILDKYPSAEIDWAAL  182
            ITFL++         N+ L+K+PS EIDW A+
Sbjct  271  ITFLDFSDSGFDEIGNLGLEKFPSVEIDWEAI  302



>ref|XP_002533146.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29242.1| DNA binding protein, putative [Ricinus communis]
Length=374

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 171/303 (56%), Gaps = 55/303 (18%)
 Frame = -2

Query  949  PNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhqqQK  779
            P ++P     P +   FS GF+    +GFEQ+G IGLN L+PS IL+IQ QI LQ QQQ 
Sbjct  80   PTMYPDFCS-PLSTHLFSQGFSGYNQLGFEQTGSIGLNHLTPSQILQIQAQIHLQQQQQI  138

Query  778  EalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAE  614
              LA  S        L  N +K   L  KPVPMKQ     KP KLYRGVRQRHWGKWVAE
Sbjct  139  ANLATNS-------NLIHNDKKLKHLAPKPVPMKQSASPPKPTKLYRGVRQRHWGKWVAE  191

Query  613  IRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKP  446
            IRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH       V G    +KP
Sbjct  192  IRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPHLRHQGAHVSGEFGDYKP  251

Query  445  LHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEE----PCFGSGAAENAVNVKTESSGVG  278
            LHSSV AKL+AICQSL ++    KS E    ++       +     E   ++K E     
Sbjct  252  LHSSVDAKLQAICQSLANSQKQGKSGESSSVADSKANTSAYLQAKKEQDCSMKREIEDYK  311

Query  277  AASSP---------------------ESEIT----------FLEWENIILDKYPSAEIDW  191
              + P                     +SEI+          + E EN  L+KYPS EIDW
Sbjct  312  VEAIPTGSPVAPASSSDESSAGSSSPQSEISFLDFSDSSSQWDESENFCLEKYPSVEIDW  371

Query  190  AAL  182
            A+L
Sbjct  372  ASL  374



>gb|AHB33872.1| ERF transcription factor 01 [Coffea arabica]
Length=270

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 164/255 (64%), Gaps = 26/255 (10%)
 Frame = -2

Query  871  EQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP-LGT  695
            +Q G +GLN L+PS I +IQ++  LQ++ +   ++       P     Q+QQ++ P L  
Sbjct  17   DQQGSLGLNQLTPSQIHDIQSRFSLQNENRHHMISGPFHQQWPATRQSQSQQQALPFLAP  76

Query  694  KPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
            KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKA
Sbjct  77   KPVPMKQSASPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKA  136

Query  529  AYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNN--DNSKS  371
            A+KLRG+  RLNFPH L H+  + G     +KPLHSSV AKL+AICQSL      D  KS
Sbjct  137  AFKLRGDFTRLNFPH-LRHNGSLIGGDFGEYKPLHSSVDAKLQAICQSLAEGKGIDGKKS  195

Query  370  HEQQRNSEEPCFGSGAAENAVNVKTESSG-VGAASSPESEIT---FLE----W----ENI  227
               +R + E    +    +A +     SG +   SSP S++T   F E    W    EN+
Sbjct  196  KGTRRKAAEEEKAAAKTVDAGSESETGSGHLTDGSSPVSDLTVPDFTEEEGSWEAYPENL  255

Query  226  ILDKYPSAEIDWAAL  182
            +L+KYPS EIDWAAL
Sbjct  256  MLEKYPSYEIDWAAL  270



>gb|AFH56408.1| ethylene response factor 1, partial [Diospyros kaki]
Length=195

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 127/192 (66%), Gaps = 19/192 (10%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  5    LGPKPVPMKQVGSPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  64

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNNDNSK  374
            DKAAYKLRG+ ARLNFP+ L H+  + G     +KPLHS+V AKL+AICQ+L  +     
Sbjct  65   DKAAYKLRGDFARLNFPN-LRHNGSLIGGDFGEYKPLHSAVDAKLQAICQTLAQDKRLDA  123

Query  373  SHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITF-------LEWE-NIILD  218
              + + +   P        NA      S   G+  SP S++ F        EW+ ++IL 
Sbjct  124  KQQSKSDGRRPPPEEDPKPNATESPLLSESDGSTGSPSSDLAFPDFTEEEPEWDASMILQ  183

Query  217  KYPSAEIDWAAL  182
            KYPS EIDWA+L
Sbjct  184  KYPSHEIDWASL  195



>ref|XP_011011480.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Populus euphratica]
Length=349

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 166/288 (58%), Gaps = 48/288 (17%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGFA---SVGFEQ-SGPIGLNGLSPShileiqtqielqhqq  785
            +P ++P +    S    FS GF+    +G +Q S  IGLN L+P  I +IQTQI   +  
Sbjct  77   QPFLYPDACCSTSTAYPFSTGFSINDPMGLQQPSSSIGLNHLTPIQIHQIQTQIHQNNSH  136

Query  784  QKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
                              +Q  Q    L  KP PMKQ     K  KLYRGVRQRHWGKWV
Sbjct  137  S-------------YLRTYQQSQTLKFLSPKPAPMKQMGTPSKATKLYRGVRQRHWGKWV  183

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLH  440
            AEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP+       +  +KPLH
Sbjct  184  AEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIGEYKPLH  243

Query  439  SSVVAKLEAICQSLTHNNDNSKSHEQQRNS-------------EEPCFGSGAAENAVNVK  299
            SSV AKL+AIC+SL +++   +   ++R++             EEP   S   E    V 
Sbjct  244  SSVDAKLQAICESLENSSQQKRGKVEKRSNSTKKETSSVVGTQEEPVVKS---ETPSPVL  300

Query  298  TESSGVGAASSPESEITFLEWE---------NIILDKYPSAEIDWAAL  182
            TES G G  SSP S++TF ++E         N +L KYPS EIDWA++
Sbjct  301  TESDGSG-GSSPLSDLTFPDFEEAPLDFDSGNFMLQKYPSYEIDWASI  347



>ref|XP_008444109.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Cucumis melo]
Length=363

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 175/299 (59%), Gaps = 52/299 (17%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + + N++P      S N  FSDGF++   +GFEQ   IG + LS S I   Q Q      
Sbjct  75   SQQSNLYPNGCST-SMNPVFSDGFSTQNLIGFEQPFTIGPHQLSSSQIPHSQPQNSFLQN  133

Query  787  qQKEalaalssssSPVFTLFQNQQKSPP-LGTKPVPMKQ-----KPGKLYRGVRQRHWGK  626
            Q   A A    +  P  +   ++Q++P  L  KP+PMKQ     KP KLYRGVRQRHWGK
Sbjct  134  QTPLAFAWGEQNYQPPSS---SEQQTPSFLAPKPIPMKQVGSSSKPTKLYRGVRQRHWGK  190

Query  625  WVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG---  455
            WVAEIRLP+NRTRLWLGTFDTAEEAA+A+D+AA+KLRG++ARLNFP+       VEG   
Sbjct  191  WVAEIRLPRNRTRLWLGTFDTAEEAALAYDEAAFKLRGDSARLNFPNLKHQGSCVEGEFG  250

Query  454  -FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGS--------GAAENAVNV  302
             ++PLHSSV AKL+AIC       DN    ++Q NS++P   +          AE    V
Sbjct  251  EYRPLHSSVAAKLQAIC-------DNLAKPQKQGNSKKPVTAAKKSRSQFCSMAEETAAV  303

Query  301  KTESSGVGA--------ASSPESEITFLE-----------WENIILDKYPSAEIDWAAL  182
            K E+S   A        ASSP S++TF +           WEN +L+KYPS EIDWA++
Sbjct  304  KVENSSSRAVTESDGSEASSPLSDLTFPDFTELPWDQNQAWENSMLEKYPS-EIDWASI  361



>ref|XP_009615540.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 176/284 (62%), Gaps = 34/284 (12%)
 Frame = -2

Query  961  FTAEPN-VFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqq  785
              ++PN ++ G     + N  FS GF+    EQ G IGL+ L+ + + +IQ QI LQ+  
Sbjct  81   LISQPNMIYDGCSTSTTINPTFSQGFSGFEMEQPGSIGLDQLTQAQVHQIQAQIYLQNNH  140

Query  784  QKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
            Q++ + + +++     +   N   S  L  KPV MKQ     KP KLYRGVRQRHWGKWV
Sbjct  141  QQQQIMSSAATFQDSLSRQHNHHASL-LSPKPVSMKQSGSPPKPPKLYRGVRQRHWGKWV  199

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----  455
            AEIRLPKNRTRLWLGTFDTAEEAA+A+DKAA+KLRG+ ARLNFPH L H+  + G     
Sbjct  200  AEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH-LRHNGSLIGGEFGE  258

Query  454  FKPLHSSVVAKLEAICQSLTHNN--DNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV  281
            +KPLHSSV AKL+AICQ L      D++K   +  + +E    S  AE    V +ES G 
Sbjct  259  YKPLHSSVDAKLQAICQDLAQGKSIDSTKKKRKVSSKKEE---SKMAE----VGSESDGT  311

Query  280  GAASSPESEITFLEW-----------ENIILDKYPSAEIDWAAL  182
            G  SSP S++TF E+           EN +L K+PS EIDWA+L
Sbjct  312  G-GSSPISDLTFTEFAEEESIWDMCSENFMLQKHPSHEIDWASL  354



>ref|XP_004143476.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Cucumis sativus]
 ref|XP_004160135.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Cucumis sativus]
Length=346

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 165/285 (58%), Gaps = 54/285 (19%)
 Frame = -2

Query  919  PSANRAFSDGFASV---GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            PS+ R FS GF+ +   GFEQSGPIGLN  +PS IL+IQ QI+L         ++ S   
Sbjct  69   PSSTRLFSQGFSGIEQMGFEQSGPIGLNNPTPSQILQIQAQIQLPSPTMSSFSSSSSFQ-  127

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRL  584
                + + N      L  K  PMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRL
Sbjct  128  ----SQYHNF-----LTPKSFPMKHMGSPPKPNKLYRGVRQRHWGKWVAEIRLPKNRTRL  178

Query  583  WLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQ  404
            WLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFPH L H  G   FKPLH SV AKL++ICQ
Sbjct  179  WLGTFDTAEEAALAYDQAAYKLRGDFARLNFPH-LKHQFG--DFKPLHPSVDAKLQSICQ  235

Query  403  SLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVN----------VKT------------ES  290
            SL        S E ++ +  P      + +AVN          V+T            E 
Sbjct  236  SLKQGKTEVCSVEDEKPTTIPL--PSESNSAVNNFCELELKSEVETSSSSSSSSPSRSED  293

Query  289  SGVGAASSPESEITFLEW---------ENIILDKYPSAEIDWAAL  182
                  SSP+S I+FL++         E   L+K+PS EIDWAAL
Sbjct  294  YSTSTGSSPDSSISFLDFSDSQWGEGVEAFCLEKFPSIEIDWAAL  338



>ref|XP_002307390.2| hypothetical protein POPTR_0005s16690g [Populus trichocarpa]
 gb|EEE94386.2| hypothetical protein POPTR_0005s16690g [Populus trichocarpa]
Length=351

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 168/289 (58%), Gaps = 49/289 (17%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGFA---SVGFEQ-SGPIGLNGLSPShileiqtqielqhqq  785
            +P ++P      S    FS GF+   ++G +Q S  IGLN L+P+ I +IQTQI   +  
Sbjct  78   QPFLYPDVCCSTSTAYPFSTGFSINDAMGLQQPSSSIGLNHLTPNQIHQIQTQIHQNNSH  137

Query  784  QKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
                               Q  Q    L  KPVPMKQ     K  KLYRGVRQRHWGKWV
Sbjct  138  S-------------YLRTCQQPQTLKFLSPKPVPMKQMGTPSKSTKLYRGVRQRHWGKWV  184

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLH  440
            AEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP+       +  +KPLH
Sbjct  185  AEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIGEYKPLH  244

Query  439  SSVVAKLEAICQSLTHNNDNSKSHEQQRNS--------------EEPCFGSGAAENAVNV  302
            SSV AKL+AIC+SL +++   +   ++R++              EEP   S   E    V
Sbjct  245  SSVDAKLQAICESLENSSQQKRGKVEKRSNSTKKETSLVVGTQEEEPVVKS---ETPSPV  301

Query  301  KTESSGVGAASSPESEITF-------LEWE--NIILDKYPSAEIDWAAL  182
             TES G G  SSP S++TF       LE++  N +L KYPS EIDWA++
Sbjct  302  LTESDGSG-GSSPLSDLTFPDIEEAPLEFDSGNFMLQKYPSYEIDWASI  349



>ref|XP_009373164.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-4-like [Pyrus x bretschneideri]
Length=356

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 133/292 (46%), Positives = 163/292 (56%), Gaps = 43/292 (15%)
 Frame = -2

Query  961  FTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGP-IGLNGLSPShileiqtqielqhqq  785
            F  +P  +       S  + FSDGF    FEQ  P IGLN L+P      + +  L    
Sbjct  74   FPNQPTYYHDGCSTSSMTQVFSDGF----FEQQPPSIGLNHLTPPRSTRSKLRSSLNSNP  129

Query  784  QKEalaalssssSPVFTLFQNQQKSPP-LGTKPVPMKQ--------KPGKLYRGVRQRHW  632
                    +        + Q   ++   L  KP+PMKQ        KP KLYRGVRQRHW
Sbjct  130  NSPKSLGXNYHHQ----VSQTSSRTLSFLSPKPIPMKQVGSAGSPPKPTKLYRGVRQRHW  185

Query  631  GKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-  455
            GKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H+  V G 
Sbjct  186  GKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LRHNGSVVGG  244

Query  454  ----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSE------EPCFGSGAAENAVN  305
                +KPLHSSV AKL+AIC+ L       KS +  + S       EP   +   E +  
Sbjct  245  EFGEYKPLHSSVDAKLQAICEGLAETQKQGKSGKPAKRSSAASRQPEPETLAVKVETSSP  304

Query  304  VKTESSGVGAASSPESEITFLE----WEN-------IILDKYPSAEIDWAAL  182
            V T+S G  A SSP S++TF +    WEN        +L+KYPS EIDWA++
Sbjct  305  VTTDSEG-SAGSSPLSDLTFCDSTEPWENSGASESTSVLEKYPS-EIDWASI  354



>gb|ADX97444.1| DREB1p [Hevea brasiliensis]
Length=271

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 137/223 (61%), Gaps = 42/223 (19%)
 Frame = -2

Query  727  QNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT  563
            QNQ     LG KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT
Sbjct  48   QNQHTLNFLGPKPIPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT  107

Query  562  aeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSLT  395
            AEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL+AICQSL 
Sbjct  108  AEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIKGKFGEYKPLHSSVDAKLQAICQSLA  167

Query  394  HNNDNSKSHEQQRNS----------------EEPCFGSGA-------AENAVNVKTESSG  284
             +       E+Q NS                +E  F   +        E    V TES G
Sbjct  168  ESQKQGGKAEKQSNSSSTKKKAQVGMTVQAAKEAEFQQKSTLDKCCKVETPSPVLTESEG  227

Query  283  VGAASSPESEITFLEWE---------NIILDKYPSAEIDWAAL  182
             G  SSP S++TF ++E         N  L+KYPS EIDWA+L
Sbjct  228  SG-GSSPLSDLTFPDFEEAPLDVDSGNFNLEKYPSYEIDWASL  269



>ref|XP_007205497.1| hypothetical protein PRUPE_ppa008234mg [Prunus persica]
 gb|EMJ06696.1| hypothetical protein PRUPE_ppa008234mg [Prunus persica]
Length=340

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 147/308 (48%), Positives = 182/308 (59%), Gaps = 57/308 (19%)
 Frame = -2

Query  961  FTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQ  782
            ++ +PN++P     PS    F      V FEQ+G IGLN L+PS IL+IQTQ+ LQ QQ+
Sbjct  42   YSTQPNLYPDFCS-PSTTHMFDQ----VSFEQTGSIGLNQLTPSQILQIQTQMVLQQQQE  96

Query  781  KEalaalssssSPVFTLFQNQQKSPP----LGTKPVPMKQ-----KPGKLYRGVRQRHWG  629
             +    +++ +SP     Q Q ++P     L  K +PMKQ     KP KLYRGVRQRHWG
Sbjct  97   HQQKEQIAALASPASLQNQYQHQNPRTPKFLSPKAIPMKQVGAPSKPTKLYRGVRQRHWG  156

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH       V G  
Sbjct  157  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLKHQGAHVSGDF  216

Query  454  --FKPLHSSVVAKLEAICQSLTHNN-DNSKSHEQQRNSE-EPCFGSGAAENAVNVKT---  296
              +KPLHSSV AKL+AICQSL  N+    K+ E    +E +P   S      V++KT   
Sbjct  217  GHYKPLHSSVDAKLQAICQSLAANSAKQGKTGELCSVAERKPAITS---PKEVSLKTELK  273

Query  295  ---ESSGVGAASSPE-------------------SEITFLEW--------ENIILDKYPS  206
               E +GV     PE                   S+ITFLE+        EN  L+KYPS
Sbjct  274  SEWELTGV-ECYRPEISSSPSRSVESSAGSSSPESDITFLEFSDSQWDEAENFGLEKYPS  332

Query  205  AEIDWAAL  182
             EIDW+A+
Sbjct  333  VEIDWSAI  340



>gb|AAZ14831.1| putative AP2-binding protein [Jatropha curcas]
Length=256

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 133/217 (61%), Gaps = 44/217 (20%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  38   LGPKPVPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  97

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRG+ ARLNFP+       +EG    +KPLHSSV AKL+AICQSL  +      
Sbjct  98   DKAAYKLRGDFARLNFPNLRHQGSHIEGSFGEYKPLHSSVDAKLQAICQSLAESQKQGGK  157

Query  370  HEQQRNS---EEPCFGSGAA----------------------ENAVNVKTESSGVGAASS  266
             E+Q NS   ++   G+  A                      E   +V TES   G  SS
Sbjct  158  AEKQSNSSAKKKTSVGTTPATAEKVKEAKAPQQVVPDKCCKVETPSSVLTESEASG-GSS  216

Query  265  PESEITFLEWE---------NIILDKYPSAEIDWAAL  182
            P S++TF + E         N  L+KYPS EIDWA+L
Sbjct  217  PLSDLTFPDLEEAPLDVDSGNFNLEKYPSYEIDWASL  253



>emb|CBI19140.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 133/267 (50%), Positives = 155/267 (58%), Gaps = 57/267 (21%)
 Frame = -2

Query  916  SANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssS  746
            S     S GF+S    GFE SGPIGLN L+PS I +IQ QI+LQ                
Sbjct  45   STTHVISQGFSSHDLQGFEHSGPIGLNHLTPSQIHQIQAQIQLQQHHNHMPA--------  96

Query  745  PVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLW  581
                              P+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLW
Sbjct  97   ------------------PIPMKQVGVPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLW  138

Query  580  LGTFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEA  413
            LGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL+A
Sbjct  139  LGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIGGEFGDYKPLHSSVDAKLQA  198

Query  412  ICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE--  239
            ICQSL       K  + +++       S A   + +  ++ SG    SSP S++TF +  
Sbjct  199  ICQSLAETQKQGKPTQGKKSR------SRAVAPSASQPSDGSG---GSSPLSDLTFPDDC  249

Query  238  --------WENIILDKYPSAEIDWAAL  182
                    WEN  L KYPS EIDWAA+
Sbjct  250  EEAPFYGAWENFNLQKYPSNEIDWAAI  276



>ref|XP_008219663.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Prunus 
mume]
Length=377

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 140/292 (48%), Positives = 170/292 (58%), Gaps = 39/292 (13%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGF-ASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKE  776
            +PN++       S+   FSDGF   +  +Q G IGLN L+PS I +IQ QI+ Q+Q    
Sbjct  88   QPNLYQDGCSTSSSVTLFSDGFFEQLQQQQPGSIGLNHLTPSQIHQIQVQIQAQNQ--PN  145

Query  775  alaalssssSPVFTLFQNQQKSPPL---GTKPVPMKQ--------KPGKLYRGVRQRHWG  629
                         TL +N  +S  L   G KPVPMKQ        KP KLYRGVRQRHWG
Sbjct  146  LAWQNYQIQQQQITLPENHHQSHTLSFLGPKPVPMKQVGSSGSPPKPTKLYRGVRQRHWG  205

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH   +   V G  
Sbjct  206  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHNGSSVGGDF  265

Query  454  --FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV  281
              +KPLHSSV AKL+AIC+ L       K+   + +       + A    V V+T SS V
Sbjct  266  GEYKPLHSSVDAKLQAICEGLAETQKQGKA-AGKTSKRSSATRAPAPPPEVKVETSSSPV  324

Query  280  ------GAASSPESEIT------FLEWEN-------IILDKYPSAEIDWAAL  182
                   A SSP S++T      FL WEN        +L+KYPS EIDWA++
Sbjct  325  MTDSDGSAGSSPLSDLTFADNAEFLPWENASGSESTAMLEKYPS-EIDWASI  375



>gb|AFY98895.1| ethylene-responsive element binding-factor [Jatropha curcas]
 gb|KDP20230.1| hypothetical protein JCGZ_09862 [Jatropha curcas]
Length=376

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 136/225 (60%), Gaps = 44/225 (20%)
 Frame = -2

Query  727  QNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT  563
            QNQ     LG KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT
Sbjct  150  QNQHGLNFLGPKPVPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT  209

Query  562  aeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLT  395
            AEEAA+A+DKAAYKLRG+ ARLNFP+       +EG    +KPLHSSV AKL+AICQSL 
Sbjct  210  AEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIEGSFGEYKPLHSSVDAKLQAICQSLA  269

Query  394  HNNDNSKSHEQQRNS---EEPCFGSGAA----------------------ENAVNVKTES  290
             +       E+Q NS   ++   G+  A                      E   +V TES
Sbjct  270  ESQKQGGKAEKQSNSSAKKKTSVGTTPATAEKVKEAKAPQQVVPDKCCKVETPSSVLTES  329

Query  289  SGVGAASSPESEITFLEWE---------NIILDKYPSAEIDWAAL  182
               G  SSP S++TF + E         N  L+KYPS EIDWA+L
Sbjct  330  EASG-GSSPLSDLTFPDLEEAPLDVDSGNFNLEKYPSYEIDWASL  373



>ref|XP_008440612.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Cucumis 
melo]
Length=349

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 163/285 (57%), Gaps = 53/285 (19%)
 Frame = -2

Query  919  PSANRAFSDGFASV---GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            PS+ R FS GF+ +   GFEQSGPIGLN  +PS IL+IQ QI+L         ++ SS  
Sbjct  71   PSSTRLFSQGFSGIEQMGFEQSGPIGLNNPTPSQILQIQAQIQLPSPTMSSFSSSSSSFQ  130

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRL  584
            S              L  K  PMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRL
Sbjct  131  SQYHNF---------LTPKSFPMKHIGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRL  181

Query  583  WLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQ  404
            WLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFPH L H  G   FKPLH SV AKL++ICQ
Sbjct  182  WLGTFDTAEEAALAYDQAAYKLRGDFARLNFPH-LKHQFG--DFKPLHPSVDAKLQSICQ  238

Query  403  SLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVN----------------------VKTES  290
            SL        S E ++ +  P      + +AVN                       ++E 
Sbjct  239  SLKQGKTEVCSVEDEKPTTIPL--PSESNSAVNNFWEPELKSEVETSFSSSSSSPSRSED  296

Query  289  SGVGAASSPESEITFLEW---------ENIILDKYPSAEIDWAAL  182
                  SSP+S I+FL++         E   L+K+PS EIDWAAL
Sbjct  297  YSTSTGSSPDSSISFLDFSDSQWGEGVEAFCLEKFPSIEIDWAAL  341



>gb|ADE41121.1| AP2 domain class transcription factor [Malus domestica]
Length=268

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 133/204 (65%), Gaps = 33/204 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            L  KP+PMKQ        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA
Sbjct  65   LSPKPIPMKQVGSAGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA  124

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNND  383
            +A+DKAAYKLRG+ ARLNFPH L H+  V G     +KPLHSSV AKL+AIC+ L     
Sbjct  125  LAYDKAAYKLRGDFARLNFPH-LRHNGSVVGGEFGEYKPLHSSVDAKLQAICEGLAETQK  183

Query  382  NSKSHEQQRNSE------EPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE----WE  233
              KS +  + S       EP   +   E +  V T+S G  A SSP S++TF +    WE
Sbjct  184  QGKSGKPAKRSSAASRQPEPETLAVKVETSSPVTTDSEG-SAGSSPLSDLTFCDSTELWE  242

Query  232  N-------IILDKYPSAEIDWAAL  182
            N        +L+KYPS EIDWA++
Sbjct  243  NSGASESSSVLEKYPS-EIDWASI  265



>ref|XP_002301042.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ABK96094.1| unknown [Populus trichocarpa]
 gb|EEE80315.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=344

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 156/275 (57%), Gaps = 44/275 (16%)
 Frame = -2

Query  916  SANRAFSDGFA---SVGFEQ-SGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            S    FS G +    +G +Q S  IGLN L+P+ +               +    +  ++
Sbjct  82   STTYPFSTGLSFNDPMGLQQPSSSIGLNHLTPTQV--------------HQIQTQMHHNN  127

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRL  584
                  +Q  Q    L  KP+PMKQ     K  KLYRGVRQRHWGKWVAEIRLPKNRTRL
Sbjct  128  LSYLQAYQQPQTLKFLSPKPIPMKQIGTPPKATKLYRGVRQRHWGKWVAEIRLPKNRTRL  187

Query  583  WLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQ  404
            WLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFP+ L     +  +KPLHSSV AKL+AIC+
Sbjct  188  WLGTFDTAEEAALAYDRAAYKLRGDFARLNFPNLLHQGSYIGEYKPLHSSVDAKLQAICK  247

Query  403  SLTHNNDNSKSHEQQRNSEEPCFGSGAA-----ENAVNVKTES-------SGVGAASSPE  260
            SL +++   +  + +R S      +  A     E  V VK E+       S     SSP 
Sbjct  248  SLENSSQQKQGGKAKRQSNSTKKKANLAVVTQEEEQVVVKAETESPALTESTASGGSSPL  307

Query  259  SEITFLEWE---------NIILDKYPSAEIDWAAL  182
            S++TF ++E         N +L KYPS EIDWA++
Sbjct  308  SDLTFPDFEEAPLDFESGNFMLQKYPSYEIDWASI  342



>ref|XP_008378545.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Malus domestica]
Length=364

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 172/291 (59%), Gaps = 41/291 (14%)
 Frame = -2

Query  961  FTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGP-IGLNGLSPShileiqtqielqhqq  785
            F  +PN +       S  + FSDGF    FEQ  P IGLN L+ S I +IQ QI+ Q Q 
Sbjct  72   FPNQPNFYHDGCSPSSMTQVFSDGF----FEQQPPSIGLNHLTSSQIHQIQAQIQSQSQP  127

Query  784  QKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ--------KPGKLYRGVRQRHWG  629
            Q+  ++  +       T  +       L  KP+PMKQ        KP KLYRGVRQRHWG
Sbjct  128  QQPQISWDNYHQQVSQTTSRTLSF---LSPKPIPMKQVGSAGSPPKPTKLYRGVRQRHWG  184

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H+  V G  
Sbjct  185  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LRHNGSVVGGE  243

Query  454  ---FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSE------EPCFGSGAAENAVNV  302
               +KPLHSSV AKL+AIC+ L       KS +  + S       EP   +   E +  V
Sbjct  244  FGEYKPLHSSVDAKLQAICEGLAETQKQGKSGKPAKRSSAASRQPEPVTLAVKVETSSPV  303

Query  301  KTESSGVGAASSPESEITFLE----WEN-------IILDKYPSAEIDWAAL  182
             T+S G  A SSP S++TF +    WEN        +L+KYPS EIDWA++
Sbjct  304  TTDSEG-SAGSSPLSDLTFCDSMEPWENSGASESSSVLEKYPS-EIDWASI  352



>ref|XP_004299631.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Fragaria vesca subsp. vesca]
Length=372

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 170/297 (57%), Gaps = 55/297 (19%)
 Frame = -2

Query  940  FPGSVPIPSANRAFSDGFAS--VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEala  767
            F  S+P P     F DG ++  +GFEQ G IGLN L+ S I +IQTQ + Q+Q Q     
Sbjct  81   FSPSIPTPQPG-LFQDGCSTFNMGFEQQGSIGLNHLTSSQIHQIQTQFQFQNQPQMAWQQ  139

Query  766  alssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLP  602
            +           F        L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLP
Sbjct  140  SYQQPQPSHTLSF--------LSPKPVPMKQSGSPPKPTKLYRGVRQRHWGKWVAEIRLP  191

Query  601  KNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHS  437
            KNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H   V G     +KPLHS
Sbjct  192  KNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LKHTGSVVGGEFGEYKPLHS  250

Query  436  SVVAKLEAICQSLTHNNDNSKSHEQQRNSEE-----------PCFGSGAAENAVNVKTES  290
            SV AKL+AIC+ L  +    K+ +Q   +++           P         A+ VK E+
Sbjct  251  SVDAKLQAICEGLAESQKQGKAGKQAGGAKKSSAARTKPKSTPVPEPEPEPEALTVKEET  310

Query  289  SGV---------GAASSPESEITFLE-------WEN-----IILDKYPSAEIDWAAL  182
            S +          A SSP S++TF +       WEN      +L+KYPS EIDWA++
Sbjct  311  SSLSPVRTDSDGSAGSSPLSDLTFADYSESSSPWENNGSESYLLEKYPS-EIDWASI  366



>ref|XP_004142609.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cucumis sativus]
 gb|KGN54614.1| hypothetical protein Csa_4G378010 [Cucumis sativus]
Length=358

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 168/317 (53%), Gaps = 89/317 (28%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + + N++P      S N  FSDGF++   +GFEQ   IG + LS S I   Q        
Sbjct  71   SQQSNLYPNGCST-SMNPVFSDGFSTQNLIGFEQPVTIGPHQLSSSQIPHSQ--------  121

Query  787  qQKEalaalssssSPVFTLFQNQ-------------------QKSPPLGTKPVPMKQ---  674
                          P   L QNQ                   Q    L  KP+PMKQ   
Sbjct  122  --------------PQNNLLQNQTPLAFAWGQQNHQPPSSSEQPPSFLAPKPIPMKQVGS  167

Query  673  --KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENAR  500
              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAA+KLRG++AR
Sbjct  168  SSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDSAR  227

Query  499  LNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFG  332
            LNFP+       VEG    ++PLHSSV AKL+AIC       DN    ++Q NS++P   
Sbjct  228  LNFPNLKHQGSCVEGEFGEYRPLHSSVAAKLQAIC-------DNLAKPQKQGNSKKPVTA  280

Query  331  S--------GAAENAVNVKTESSGVGA--------ASSPESEITFLE-----------WE  233
            +          AE    VK E+S   A        ASSP S++TF +           WE
Sbjct  281  AKKSKSQSCSMAEETAAVKVENSSSRAVTESDGSEASSPLSDLTFPDFTEMLWDQSQPWE  340

Query  232  NIILDKYPSAEIDWAAL  182
            N +L+KYPS EIDWA++
Sbjct  341  NSMLEKYPS-EIDWASI  356



>ref|XP_011016241.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Populus 
euphratica]
Length=343

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 150/260 (58%), Gaps = 42/260 (16%)
 Frame = -2

Query  880  VGFEQ-SGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP  704
            +G +Q S  IGLN L+P+ I               E    +  S+      +Q  Q    
Sbjct  97   MGLQQPSSSIGLNHLTPTQI--------------HEIETQIHHSNLSYLQAYQQPQTLKF  142

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KP+PMKQ     K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  143  LSPKPIPMKQIGTPPKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  202

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            D+AAYKLRG+ ARLNFP+ L     +  +KPLHSSV AKL+AIC+SL +++   +  + +
Sbjct  203  DRAAYKLRGDFARLNFPNLLHQGSYIGEYKPLHSSVDAKLQAICKSLENSSQQKQGGKAK  262

Query  358  RNSEEP------------CFGSGAAENAVNVKTESSGVGAASSPESEITFLEWE------  233
            R S                     AE      TES+G G  SSP S++TF ++E      
Sbjct  263  RQSNSTKKKANLAVVTQEEQVVVKAETESPALTESTGSG-GSSPLSDLTFPDFEEAPLDF  321

Query  232  ---NIILDKYPSAEIDWAAL  182
               N +L KYPS EIDWA++
Sbjct  322  ESGNFMLQKYPSYEIDWASI  341



>gb|AHJ08575.1| DREB6-like protein [Cichorium intybus]
Length=314

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 126/195 (65%), Gaps = 21/195 (11%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  120  LAPKPVSMKQTGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  179

Query  538  dkaAYKLRGENARLNFPHFL---SHDHGVEG-FKPLHSSVVAKLEAICQSLTHNN--DNS  377
            D AAYKLRG+ ARLNFPH     SH  G  G +KPLHSSV AKL+AICQ+L      D  
Sbjct  180  DIAAYKLRGDYARLNFPHLRHNGSHIGGQFGDYKPLHSSVDAKLQAICQTLAEGKSIDGG  239

Query  376  KSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEW----------ENI  227
            K    +R++             V V+   S V   SSP S+++F E+          +N 
Sbjct  240  KKKGSKRSTAAKARTVVEQPEVVKVEGSESDVSGGSSPLSDLSFPEFTEEESALCGSDNF  299

Query  226  ILDKYPSAEIDWAAL  182
            +L+KYPS EIDW+++
Sbjct  300  LLEKYPSYEIDWSSI  314



>ref|XP_004163671.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-4-like [Cucumis sativus]
Length=358

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 167/317 (53%), Gaps = 89/317 (28%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + + N++P      S N  FSDGF++   +GFEQ   IG + LS S I   Q        
Sbjct  71   SQQSNLYPNGCST-SMNPVFSDGFSTQNLIGFEQPVTIGPHQLSSSQIPHSQ--------  121

Query  787  qQKEalaalssssSPVFTLFQNQ-------------------QKSPPLGTKPVPMKQ---  674
                          P   L QNQ                   Q    L  KP+PMKQ   
Sbjct  122  --------------PQNNLLQNQTPLAFAWGQQNHQPPSSSEQPPSFLAPKPIPMKQVGS  167

Query  673  --KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENAR  500
              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAA+KLRG++AR
Sbjct  168  SSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDSAR  227

Query  499  LNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFG  332
            LNFP+       VEG    ++PLHSSV AKL+AIC       DN    ++Q NS++P   
Sbjct  228  LNFPNLKHQGSCVEGEFGEYRPLHSSVAAKLQAIC-------DNLAKPQKQGNSKKPVTA  280

Query  331  S--------GAAENAVNVKTESSGVGA--------ASSPESEITFLE-----------WE  233
            +          AE    VK E+S   A        ASSP S++TF +           WE
Sbjct  281  AKKSKSQSCSMAEETAAVKVENSSSRAVTESDGSEASSPLSDLTFPDFTEMLWDQSQPWE  340

Query  232  NIILDKYPSAEIDWAAL  182
            N +L KYPS EIDWA++
Sbjct  341  NSMLXKYPS-EIDWASI  356



>gb|ABY63297.1| DREB protein [Populus pruinosa]
Length=291

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 137/187 (73%), Gaps = 17/187 (9%)
 Frame = -2

Query  919  PSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            P++ + FS+GF     +GFEQ+GPIGLN L+PS IL+IQ +I  Q QQQ++ +  L+++S
Sbjct  80   PTSTQMFSNGFLDYNQMGFEQTGPIGLNHLTPSQILQIQAKIHFQQQQQQQKMENLATTS  139

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTR  587
              V     N++ S  L  KPVPMKQ      KP KLYRGVRQRHWGKWVAEIRLPKNRTR
Sbjct  140  QCV----HNRKASNYLAPKPVPMKQSGASPQKPTKLYRGVRQRHWGKWVAEIRLPKNRTR  195

Query  586  LWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKL  419
            LWLGT+DTAEEAA+A+D AAYKLRG+ ARLNFPH       V G    +KPLHSSV AKL
Sbjct  196  LWLGTYDTAEEAALAYDNAAYKLRGKYARLNFPHLRHQGAHVSGEFGDYKPLHSSVDAKL  255

Query  418  EAICQSL  398
            +AICQSL
Sbjct  256  QAICQSL  262



>ref|XP_010027841.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Eucalyptus 
grandis]
 gb|KCW54474.1| hypothetical protein EUGRSUZ_I00422 [Eucalyptus grandis]
Length=349

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 169/314 (54%), Gaps = 68/314 (22%)
 Frame = -2

Query  946  NVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEala  767
            +VFP   P  + +   S     +G EQSG IGLN LS S I  IQ ++ L+ Q  +E   
Sbjct  45   SVFPQQQPNLNPDLCSSWILNPMGLEQSGSIGLNRLSHSQIQHIQDEMLLRRQN-QELWL  103

Query  766  alssssSPVFTLF-----QNQQKSPPL-GTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
            A +  S      F     QN   SP L   K +PMK+     KP KLYRGVRQRHWGKWV
Sbjct  104  ASAMKSPLQHEKFDQCRHQNHHGSPHLLRPKALPMKRVGVPPKPNKLYRGVRQRHWGKWV  163

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHG--VEGFKP  446
            AEIRLPKNRTRLWLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFP   S D G  +  + P
Sbjct  164  AEIRLPKNRTRLWLGTFDTAEEAALAYDEAAYKLRGDFARLNFPR--SRDGGSYLCDYNP  221

Query  445  LHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTES--------  290
            LHSSV AKL+AICQSL  N+      ++Q  + EPCF    A    +  TE+        
Sbjct  222  LHSSVCAKLQAICQSLAANS------QKQGKTGEPCFFPDRAMETFDAATEADEAIFFKV  275

Query  289  -------------------------------SGVGAASSPESEITFL-------EWENII  224
                                           S V  +SSPES +  L       E EN  
Sbjct  276  ALKNEYDADLAYPEQDYKVENSVSSPAFSDESSVAGSSSPESNLALLGFPPSQFEIENFY  335

Query  223  LDKYPSAEIDWAAL  182
            L+KYPSAEIDWAA+
Sbjct  336  LEKYPSAEIDWAAI  349



>ref|XP_002513895.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF48478.1| DNA binding protein, putative [Ricinus communis]
Length=383

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 136/230 (59%), Gaps = 43/230 (19%)
 Frame = -2

Query  742  VFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  578
             + L  NQ     L  KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWL
Sbjct  150  TYPLHHNQNSLNFLSPKPIPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  209

Query  577  GTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAI  410
            GTFDTAEEAA+A+DKAAYKLRG+ ARLNFP+       +EG    +KPLHS+V AKL+AI
Sbjct  210  GTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSHIEGKFGEYKPLHSAVDAKLQAI  269

Query  409  CQSLTHNNDNSKS-------------------HEQQRNSEEPCFGSGAAENAVNVK----  299
            C+SL  ++   +S                    E +   E+     G  +    V+    
Sbjct  270  CESLAQSSSQKQSGKGEKNSTKKSKKTPEVVKEEAKPTQEQHEVAVGVEDKCCKVETQSP  329

Query  298  --TESSGVGAASSPESEITFLEWE---------NIILDKYPSAEIDWAAL  182
              TES G G + SP S++TF ++E         N +L KYPS EIDWA+L
Sbjct  330  LLTESEGSGGSCSPLSDLTFPDFEEAPLDVDSSNFMLLKYPSYEIDWASL  379



>gb|ADE41115.1| AP2 domain class transcription factor [Malus domestica]
Length=365

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 161/294 (55%), Gaps = 45/294 (15%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEa  773
            +P+ +       S  + FSDG      +Q   IGLN L+P    + + +           
Sbjct  78   QPSFYDYGCSTSSMTQLFSDGLFEKHHQQLPSIGLNHLTPPRSTKSKPRSSPNPNPNPNP  137

Query  772  laalssssSPVFTLFQNQQKSPP-------LGTKPVPMKQ--------KPGKLYRGVRQR  638
                S   +       +QQ S P       LG KPV MKQ        KP KLYRGVRQR
Sbjct  138  NKPKSLGKT------HHQQVSQPSSHTLSFLGPKPVLMKQVGSSGSPPKPTKLYRGVRQR  191

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H+  V 
Sbjct  192  HWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LRHNGSVV  250

Query  457  G-----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAEN-AVNVKT  296
            G     +KPLH+SV AKL+AIC+ L       K+ +  + S        A E  AV V+T
Sbjct  251  GGEFGEYKPLHASVDAKLQAICEGLAETQKQGKAAKPAKRSSAAASRQPAPETLAVKVET  310

Query  295  ES-----SGVGAASSPESEITFLE----WEN-------IILDKYPSAEIDWAAL  182
             S     S   A SSP S++TF +    WEN        +L+KYPS EIDWA++
Sbjct  311  SSPVMTDSEGSAGSSPLSDLTFGDSTEPWENSGASESTAVLEKYPS-EIDWASI  363



>gb|ACY25088.1| DREB1C [Gossypium hirsutum]
Length=351

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 160/275 (58%), Gaps = 49/275 (18%)
 Frame = -2

Query  880  VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPL  701
            +GFEQ+G IGLN L+PS IL+IQ QI  Q QQQ+E  +  +       T     Q+   L
Sbjct  78   MGFEQTGSIGLNQLTPSQILQIQAQIYQQQQQQQEVASKST-------TASLKNQRFNFL  130

Query  700  GTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
              K VPMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  131  SPKAVPMKHVSSTPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  190

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRGE ARLNFPH       + G    +KPLHS+V AKL+AICQSL    ++ K 
Sbjct  191  DKAAYKLRGEFARLNFPHLKHQGAHISGEFGDYKPLHSAVDAKLQAICQSLQKQENSGKG  250

Query  370  H---------------EQQRNSEEPCFGSGAAE---------NAVNVKTESSGVGAASSP  263
                            +++   + P F S   E         +  +       +  +SSP
Sbjct  251  CSVPDSNPKVEFDYPVKREEFDQSPRFASPKVEMNSLSSSSSSPSSPDLSDESLAGSSSP  310

Query  262  ESEITFLE-----WEN---IILDKYPSAEIDWAAL  182
            ES+ITF +     W++     L+KYPS EIDW A+
Sbjct  311  ESDITFFDFSDSKWDDNEIFGLEKYPSVEIDWEAI  345



>ref|XP_010531386.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Tarenaya hassleriana]
Length=292

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 148/276 (54%), Gaps = 87/276 (32%)
 Frame = -2

Query  880  VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQ-----NQQ  716
            +GF Q+ P+GLN L+P                               F + Q     NQ+
Sbjct  55   MGFAQATPLGLNQLTP-------------------------------FQIIQIQHQLNQR  83

Query  715  KS--PPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTa  560
            ++    L  KPVPMK       K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TA
Sbjct  84   RTFVSNLSPKPVPMKNFSCSSSKSRKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETA  143

Query  559  eeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNND  383
            EEAAMA+D+AAYKLRGE+ARLNFPH      G+ G FKPLH+SV AKL+AICQSL     
Sbjct  144  EEAAMAYDQAAYKLRGESARLNFPHTRHDGDGLVGNFKPLHASVEAKLQAICQSL-----  198

Query  382  NSKSHEQQRNSEEPCFGSGAA---------ENAVNVKTE------------SSGVGAASS  266
                    R +EE C  S            E  ++ KTE                  +SS
Sbjct  199  --------RKTEESCSVSAQTELVQPKTEQETELSDKTEPGFPRFDGHSLSDESRAGSSS  250

Query  265  PESEITFLEWE--------NIILDKYPSAEIDWAAL  182
            PES ITFL++         N+ L+K+PS EIDW A+
Sbjct  251  PESGITFLDFSDSGIDEIGNLGLEKFPSVEIDWEAI  286



>ref|XP_009138555.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Brassica rapa]
Length=260

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 143/249 (57%), Gaps = 49/249 (20%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP--  704
            GF Q+ P+GLN L+P  I +IQ Q+                          NQ++S    
Sbjct  38   GFNQTAPLGLNQLTPYQIHQIQNQL--------------------------NQRRSTTIS  71

Query  703  -LGTKPVPMKQKP-GKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
             L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D+A
Sbjct  72   NLSPKPVPMKNMTVHKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDQA  131

Query  529  AYKLRGENARLNFPHF---LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            AYKLRGE ARLN PH      +  G E FKPLH SV AKLEAICQSL    D        
Sbjct  132  AYKLRGELARLNLPHTRRECGYGGGDESFKPLHPSVEAKLEAICQSLVKTEDLDLP----  187

Query  358  RNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEIT----------FLEWENIILDKYP  209
              SE   F     E   N  ++ S VG +SSPES +T          F E  + +L+K+P
Sbjct  188  -CSETELFLPPKTEYEENTFSDESQVG-SSSPESGVTTAFLGFLDSGFDEIGSFVLEKFP  245

Query  208  SAEIDWAAL  182
            S EIDW A+
Sbjct  246  SVEIDWDAI  254



>ref|XP_011098323.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Sesamum indicum]
Length=343

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 126/190 (66%), Gaps = 21/190 (11%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG +PV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  159  LGPRPVSMKQVGAPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  218

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAY+LRG++ARLNFPH   +   + G    ++PLH+SV AKL+AICQ+L       KS
Sbjct  219  DKAAYQLRGDSARLNFPHLRHNGSHIGGEFGEYQPLHASVDAKLQAICQTLAEG----KS  274

Query  370  HEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE-------WENIILDKY  212
             +  R        +   +N   ++ ES G G   SP+SE  F E       WE   L+KY
Sbjct  275  IDANRCKNSRSKKAVTDKNCKKLEAESDGSGEL-SPDSEQMFRELGEEQPGWEMGSLEKY  333

Query  211  PSAEIDWAAL  182
            PS EIDWAAL
Sbjct  334  PSYEIDWAAL  343



>ref|XP_008362598.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-4-like [Malus domestica]
Length=365

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 159/294 (54%), Gaps = 45/294 (15%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEa  773
            +P+ +       S  + FSDG      +Q   IGLN L+P      + +           
Sbjct  78   QPSFYDYGCSTSSMTQLFSDGLFEKHHQQLPSIGLNHLTPPRSTXSKPRSSPNPNPNPNP  137

Query  772  laalssssSPVFTLFQNQQKSPP-------LGTKPVPMKQ--------KPGKLYRGVRQR  638
                S           +QQ S P       LG KPV MKQ        KP KLYRGVRQR
Sbjct  138  NKPKSLGKX------HHQQVSQPSSHTLSFLGPKPVLMKQVGSSGSPPKPTKLYRGVRQR  191

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H+  V 
Sbjct  192  HWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LRHNGSVV  250

Query  457  G-----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAEN-AVNVKT  296
            G     +KPLH+SV AKL+AIC+ L       K+ +  + S        A E  AV V+T
Sbjct  251  GGEFGEYKPLHASVDAKLQAICEGLAETQKQGKAAKPAKRSSAAXSRQPAPETLAVKVET  310

Query  295  ES-----SGVGAASSPESEITFLE----WEN-------IILDKYPSAEIDWAAL  182
             S     S   A SSP S++TF +    WEN        +L+KYPS EIDWA++
Sbjct  311  SSPVMTDSEGSAGSSPLSDLTFGDSTEPWENSGASESTAVLEKYPS-EIDWASI  363



>ref|XP_008375600.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-13-like [Malus domestica]
Length=365

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 159/294 (54%), Gaps = 45/294 (15%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEa  773
            +P+ +       S  + FSDG      +Q   IGLN L+P      + +           
Sbjct  78   QPSFYDYGCSTSSMTQLFSDGLFEKHHQQLPSIGLNHLTPPRSTXSKPRSSPNPNPNPNP  137

Query  772  laalssssSPVFTLFQNQQKSPP-------LGTKPVPMKQ--------KPGKLYRGVRQR  638
                S           +QQ S P       LG KPV MKQ        KP KLYRGVRQR
Sbjct  138  NKPKSLGKX------HHQQVSQPSSHTLSFLGPKPVLMKQVGSSGSPPKPTKLYRGVRQR  191

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H+  V 
Sbjct  192  HWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LRHNGSVV  250

Query  457  G-----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAEN-AVNVKT  296
            G     +KPLH+SV AKL+AIC+ L       K+ +  + S        A E  AV V+T
Sbjct  251  GGEFGEYKPLHASVDAKLQAICEGLAETQKQGKAAKPAKRSSAAXSRQPAPETLAVKVET  310

Query  295  ES-----SGVGAASSPESEITFLE----WEN-------IILDKYPSAEIDWAAL  182
             S     S   A SSP S++TF +    WEN        +L+KYPS EIDWA++
Sbjct  311  SSPVMTDSEGSAGSSPLSDLTFGDSTEPWENSGASESTAVLEKYPS-EIDWASI  363



>ref|XP_007223221.1| hypothetical protein PRUPE_ppa007193mg [Prunus persica]
 gb|EMJ24420.1| hypothetical protein PRUPE_ppa007193mg [Prunus persica]
Length=378

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 137/292 (47%), Positives = 169/292 (58%), Gaps = 39/292 (13%)
 Frame = -2

Query  952  EPNVFPGSVPIPSANRAFSDGF-ASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKE  776
            +P+++       S+   FSDGF   +  +Q G IGLN L+PS I +IQ QI+ Q+Q    
Sbjct  89   QPDLYQDGCSTSSSMTLFSDGFFEQLQQQQPGSIGLNHLTPSQIHQIQVQIQAQNQ--PN  146

Query  775  alaalssssSPVFTLFQNQQKSPPLG---TKPVPMKQ--------KPGKLYRGVRQRHWG  629
                         TL +N  +S  L     KP+PMKQ        KP KLYRGVRQRHWG
Sbjct  147  LAWQNYQIQQQQITLPENHHQSHTLSFLSPKPIPMKQVGSSGSPPKPTKLYRGVRQRHWG  206

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH   +   V G  
Sbjct  207  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHNGSSVGGDF  266

Query  454  --FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV  281
              +KPLHSSV AKL+AIC+ L       K+   + +       + A    V V+T SS V
Sbjct  267  GEYKPLHSSVDAKLQAICEGLAETQKQGKA-AGKPSKRSSAARAPAPPPEVKVETSSSPV  325

Query  280  ------GAASSPESEIT------FLEWEN-------IILDKYPSAEIDWAAL  182
                   A SSP S++T      FL WEN        +L+KYPS EIDWA++
Sbjct  326  MTDSDGSAGSSPLSDLTFADNAEFLPWENGSGSESTAMLEKYPS-EIDWASI  376



>ref|XP_006428165.1| hypothetical protein CICLE_v10025961mg [Citrus clementina]
 ref|XP_006464216.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Citrus sinensis]
 gb|ESR41405.1| hypothetical protein CICLE_v10025961mg [Citrus clementina]
Length=354

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 133/215 (62%), Gaps = 37/215 (17%)
 Frame = -2

Query  715  KSPPLGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
            KS  L  K VPMK        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE
Sbjct  134  KSNLLSPKAVPMKHVSNAQVAKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE  193

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            EAA+A+D+AAYKLRGE ARLNFPH   H   V G    +KPLH+SV AKL+AICQ+L  N
Sbjct  194  EAALAYDQAAYKLRGEFARLNFPHLKHHGAHVTGEFGDYKPLHASVDAKLQAICQNLALN  253

Query  388  ND---NSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV--------------GAASSPE  260
            N+    +   +QQ+  E           A N+K E++                  +SSPE
Sbjct  254  NNVQKQTSKQQQQQQQEAETKPVLLPATAANIKVENTSATSLSSPTPDHSLSDAGSSSPE  313

Query  259  SEITFLE-----WENII----LDKYPSAEIDWAAL  182
            S+I+FL+     WE  +    L+KYPS EIDW A+
Sbjct  314  SDISFLDFNDTKWETEMDAFGLEKYPSVEIDWEAI  348



>emb|CDY31606.1| BnaA03g54460D [Brassica napus]
Length=260

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 143/249 (57%), Gaps = 49/249 (20%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP--  704
            GF Q+ P+GLN L+P  I +IQ Q+                          NQ++S    
Sbjct  38   GFNQTAPLGLNQLTPYQIHQIQNQL--------------------------NQRRSTTIS  71

Query  703  -LGTKPVPMKQKP-GKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
             L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D+A
Sbjct  72   NLSPKPVPMKNMTVHKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDQA  131

Query  529  AYKLRGENARLNFPHF---LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            AYKLRGE ARLNFPH      +  G   FKPLH SV AKLEAICQSL    D        
Sbjct  132  AYKLRGELARLNFPHTRRECGYGGGDGSFKPLHPSVEAKLEAICQSLVKTEDLDLP----  187

Query  358  RNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEIT----------FLEWENIILDKYP  209
              SE   F     E   N  ++ S VG +SSPES +T          F E  + +L+K+P
Sbjct  188  -CSETELFLPPKTEYEENTFSDESQVG-SSSPESGVTTAFLGFLDSGFDEIGSFVLEKFP  245

Query  208  SAEIDWAAL  182
            S EIDW A+
Sbjct  246  SVEIDWDAI  254



>ref|XP_009345480.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Pyrus x bretschneideri]
Length=325

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 133/217 (61%), Gaps = 49/217 (23%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L TK +PMK+     K  KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  115  LSTKAIPMKKADTPSKLTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  174

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAA+KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N+     
Sbjct  175  DKAAFKLRGDFARLNFPHLKQQGAHVSGAFGHYKPLHSSVDAKLQAICQSLAANS-----  229

Query  370  HEQQRNSEEPC-------FGSGAAENAVN--VKTE-----------------SSGVGAAS  269
              +Q N+ EPC         S   E  ++   KTE                 S     +S
Sbjct  230  -MKQGNTGEPCSVAETKPVVSAPLETRMDDSFKTELKSEWEAFLSSSSSPFWSDRSDESS  288

Query  268  SPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
            +PES+ITFL++        EN  L+KYPS EIDW+A+
Sbjct  289  TPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI  325



>gb|KDO56612.1| hypothetical protein CISIN_1g018103mg [Citrus sinensis]
Length=360

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 133/215 (62%), Gaps = 37/215 (17%)
 Frame = -2

Query  715  KSPPLGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
            KS  L  K VPMK        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE
Sbjct  140  KSNLLSPKAVPMKHVSNAQVAKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE  199

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            EAA+A+D+AAYKLRGE ARLNFPH   H   V G    +KPLH+SV AKL+AICQ+L  N
Sbjct  200  EAALAYDQAAYKLRGEFARLNFPHLKHHGAHVTGEFGDYKPLHASVDAKLQAICQNLALN  259

Query  388  ND---NSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV--------------GAASSPE  260
            N+    +   +QQ+  E           A N+K E++                  +SSPE
Sbjct  260  NNVQKQTSKQQQQQQQEAETKPVLLPATAANIKVENTSATSLSSPTPDHSLSDAGSSSPE  319

Query  259  SEITFLE-----WENII----LDKYPSAEIDWAAL  182
            S+++FL+     WE  +    L+KYPS EIDW A+
Sbjct  320  SDVSFLDFNDTKWETEMDAFGLEKYPSVEIDWEAI  354



>gb|AFJ14639.1| dehydration-responsive element-binding protein (DREB6), partial 
[Malus domestica]
Length=355

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 131/204 (64%), Gaps = 32/204 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            L  KP+PMKQ        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA
Sbjct  152  LSPKPIPMKQVGSAGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA  211

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNND  383
            +A+D+AAYKLRG+ ARLNFPH L H+  V G     +KPLH+SV AKL+AIC  L     
Sbjct  212  LAYDEAAYKLRGDFARLNFPH-LRHNGSVVGGEFGEYKPLHASVDAKLQAICGGLAETQK  270

Query  382  NSKSHEQQRNSEEPCFGSGAAEN-AVNVKTES-----SGVGAASSPESEITFLE----WE  233
              K+ +  + S        A E  AV V+T S     S   A SSP S++TF +    WE
Sbjct  271  QGKAAKPAKRSSAAASRQPAPETLAVKVETSSPVMTDSEGSAGSSPLSDLTFGDSTEPWE  330

Query  232  N-------IILDKYPSAEIDWAAL  182
            N        +L+KYPS EIDWA++
Sbjct  331  NSGASESTAVLEKYPS-EIDWASI  353



>ref|XP_003526587.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Glycine 
max]
Length=302

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 167/290 (58%), Gaps = 59/290 (20%)
 Frame = -2

Query  949  PNVFPGSVPIPSANRAFSDGFAS-----VGFEQSGP---IGLNGLSPShileiqtqielq  794
            PN FP S   PS    +S+G +S     +GF Q+ P   +GLN L+PS I +IQ QI++Q
Sbjct  38   PNYFPSS---PSLPNLYSNGLSSNTQSLIGFGQAQPTSLVGLNHLTPSQISQIQAQIQIQ  94

Query  793  hqqQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWG  629
             QQ +     LS                  LG KP+PMK      KP KLYRGVRQRHWG
Sbjct  95   AQQHQNRSNTLSF-----------------LGPKPIPMKHAGMPPKPTKLYRGVRQRHWG  137

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP+       V G  
Sbjct  138  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSSVGGDF  197

Query  454  --FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVK--TESS  287
              +KPLHS+V AKL+AIC+ L       K+ +  R S      S  AE  V+ K    S 
Sbjct  198  GEYKPLHSAVDAKLQAICEGLAELQKQGKTEKPPRKSR-----SKLAEKVVSDKENNNSC  252

Query  286  GVGAA------SSPESEITFLE-----WE----NIILDKYPSAEIDWAAL  182
             V AA      SSP S++TF +     WE    N  L KYPS EIDW +L
Sbjct  253  KVEAASWSSEGSSPLSDLTFADVSEAQWEGDSDNYNLQKYPSYEIDWDSL  302



>ref|XP_007163638.1| hypothetical protein PHAVU_001G251200g [Phaseolus vulgaris]
 gb|ESW35632.1| hypothetical protein PHAVU_001G251200g [Phaseolus vulgaris]
Length=295

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 127/197 (64%), Gaps = 23/197 (12%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            L  KPVPMKQ       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA+
Sbjct  96   LSPKPVPMKQVGGRVVSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAAL  155

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNS  377
            A+D AA+KLRGENARLNF H   H   V G    +KPL S+V AKL+AICQSL  N    
Sbjct  156  AYDNAAFKLRGENARLNFHHLRHHGGSVYGAFGTYKPLPSAVDAKLQAICQSLAINTHKE  215

Query  376  KSHEQQRNSEEPCFGSGAAENAV---NVKTESSGVGAASSPESEITFLEWEN--------  230
            +        E+   G+  A + +      + SS    +SSPES+ITFL++ +        
Sbjct  216  EETATTSEFEDVKVGNQTASSPLSDEYSSSSSSSCAGSSSPESDITFLDFSDSYEAMDNL  275

Query  229  -IILDKYPSAEIDWAAL  182
             + L+KYPS EIDW AL
Sbjct  276  GLDLEKYPSVEIDWEAL  292



>ref|XP_011074161.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Sesamum 
indicum]
Length=330

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 135/205 (66%), Gaps = 22/205 (11%)
 Frame = -2

Query  730  FQNQQKSPP----LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  578
            FQ Q    P    LG +PVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWL
Sbjct  126  FQAQYSMAPRNSFLGPRPVPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  185

Query  577  GTFDTaeeaamahdkaAYKLRGENARLNFPHFL---SHDHGVEG-FKPLHSSVVAKLEAI  410
            GTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH     SH  G  G +KPLH+SV AKLEAI
Sbjct  186  GTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHNGSHIGGEFGEYKPLHASVDAKLEAI  245

Query  409  CQSLTHNND-NSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE--  239
            CQ+L      ++K  +  R+ +     +   +N    ++ES G G +SSP S++TF E  
Sbjct  246  CQTLAQGKSIDAKKGKNSRSKKAAAAAAAEEKNCKMSESESDGSGGSSSPVSDLTFPEFA  305

Query  238  ------WENIILDKYPSAEIDWAAL  182
                  WE   L KYPS EIDW AL
Sbjct  306  EEEQPGWEMGSLPKYPSYEIDWDAL  330



>ref|XP_010437100.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Camelina sativa]
Length=290

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 155/275 (56%), Gaps = 58/275 (21%)
 Frame = -2

Query  925  PIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssS  746
            P P +N  F       GF Q+ P+GLN L+P  I +IQ Q+  +                
Sbjct  41   PCPYSNTIF-------GFNQTTPLGLNQLTPYQIHQIQNQLNQR----------------  77

Query  745  PVFTLFQNQQKSPPLGTKPVPMK-QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
                  +N   SP L  +PVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF
Sbjct  78   ------RNTIISPNLAPRPVPMKSMATQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  131

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQS  401
            DTAEEAAMA+D AAYKLRGE ARLNFP F  H+ G  G    F PLHSSV AKL+AICQS
Sbjct  132  DTAEEAAMAYDLAAYKLRGEFARLNFPQF-RHEDGYYGGDSFFNPLHSSVDAKLQAICQS  190

Query  400  L--THNNDNSKSH------------EQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSP  263
            L  T ++D+ + H             + + S+E  F   + EN+ + +++       S  
Sbjct  191  LRKTEDDDHHRIHLPCSETELFPPKTEYQESDEYGFLR-SVENSFSDESQVESSSPESCV  249

Query  262  ESEITFLEWE--------NIILDKYPSAEIDWAAL  182
             +  TFL++         +  L+K+PS EIDW A+
Sbjct  250  TTNTTFLDFSESGFDEIGSFGLEKFPSVEIDWDAI  284



>emb|CDX69387.1| BnaC01g00660D [Brassica napus]
Length=264

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 145/251 (58%), Gaps = 55/251 (22%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKS----  710
            GF Q+ P+GLN L+P                                   QNQ       
Sbjct  44   GFNQTAPLGLNQLTPYQ-----------------------------INQIQNQLNQRHNS  74

Query  709  --PPLGTKPVPMKQKP-GKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
                L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+
Sbjct  75   NISNLSPKPVPMKNMAVQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAY  134

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSL--THNNDNS  377
            D+AAY+LRGE ARLNFPH + H++G  G    FKPLH SV AKLEAICQSL  T ++D  
Sbjct  135  DQAAYQLRGELARLNFPH-MRHEYGYGGGDGSFKPLHPSVEAKLEAICQSLRKTEDDDLP  193

Query  376  KSHEQ-----QRNSEEPCFG-SGAAENAVNVKTESSGVGAASSPESEITFLEWENIILDK  215
            +S  +         +E  +G   A EN+ + +++      +SSPES   F E  + +L+K
Sbjct  194  RSETELFPPKAEEYQESEYGFLRADENSFSYESQVE----SSSPES--GFDEIGSFVLEK  247

Query  214  YPSAEIDWAAL  182
            +PS EIDW A+
Sbjct  248  FPSVEIDWDAI  258



>ref|XP_006286220.1| hypothetical protein CARUB_v10007787mg [Capsella rubella]
 gb|EOA19118.1| hypothetical protein CARUB_v10007787mg [Capsella rubella]
Length=280

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 145/258 (56%), Gaps = 55/258 (21%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP-L  701
            GF Q+ P+GLN L+P  I +IQ Q                        L Q +   PP L
Sbjct  46   GFNQTTPLGLNQLTPYQIHQIQNQ------------------------LNQRRNTIPPNL  81

Query  700  GTKPVPMK-QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAY  524
              KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D AAY
Sbjct  82   APKPVPMKSMATQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDLAAY  141

Query  523  KLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQR  356
            KLRG  ARLNFP F  H+ G  G    F PLHSSV AKL+AICQSL    D+   H    
Sbjct  142  KLRGGFARLNFPQF-RHEDGYYGGGSCFNPLHSSVDAKLQAICQSLRKTEDD---HHHLP  197

Query  355  NSEEPCF---------GSGAAENAVNVKTESSGVGAASSPESEIT-----------FLEW  236
             SE   F           G   + VN  ++ S V  +SSPES IT           F E+
Sbjct  198  CSETELFPPKTEYQETEYGFLRSVVNSFSDESQV-ESSSPESCITNTTFLDFSDPGFDEF  256

Query  235  ENIILDKYPSAEIDWAAL  182
             +  L+K+PS EIDW A+
Sbjct  257  GSFGLEKFPSVEIDWDAI  274



>gb|KFK42189.1| hypothetical protein AALP_AA2G223100 [Arabis alpina]
Length=309

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 132/206 (64%), Gaps = 25/206 (12%)
 Frame = -2

Query  724  NQQKSPPLGTKPVPMKQ------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLW  581
            N   S  L  KP+ MKQ            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLW
Sbjct  101  NNSYSHLLAPKPILMKQTGIPGSCFGVPAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLW  160

Query  580  LGTFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEA  413
            LGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEA
Sbjct  161  LGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEA  220

Query  412  ICQSLTHNNDNSKS---HEQQRNSEEPCFGSGAAENAVNVKTESSGV-GAASSPESEITF  245
            ICQS+  N  + KS    +++R S+ P       ++ V   T +  V  A SSP S++TF
Sbjct  221  ICQSMAENQKSEKSTTATKKKRGSKSPEKVKSEEKSVVESPTVTEFVESAGSSPLSDLTF  280

Query  244  LEWEN-----IILDKYPSAEIDWAAL  182
             + E        L+KYPS EIDW +L
Sbjct  281  ADTEEPPSWYETLEKYPSYEIDWDSL  306



>ref|XP_007136233.1| hypothetical protein PHAVU_009G029600g [Phaseolus vulgaris]
 gb|ESW08227.1| hypothetical protein PHAVU_009G029600g [Phaseolus vulgaris]
Length=353

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 130/214 (61%), Gaps = 41/214 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KP+PMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  141  LGPKPIPMKHAGMPLKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  200

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRG+ ARLNFP+       V G    +KPLHSSV AKL+AIC+ L       K+
Sbjct  201  DKAAYKLRGDFARLNFPNLRHQGSSVGGGFGEYKPLHSSVDAKLQAICEGLAEMQKQGKT  260

Query  370  HEQQRNS-----------EEPCFGSGAAENAVN-----------VKTESSGVGAASSPES  257
             + Q +S           E+   G G+ +   N           V TES G    SSP S
Sbjct  261  EKPQGSSRRSRAKVAPPPEKADSGKGSDDTTTNNSCKVEASSSPVTTESEG-SEGSSPLS  319

Query  256  EITFLE-----WE----NIILDKYPSAEIDWAAL  182
            ++TF++     WE    N  L KYPS EIDW +L
Sbjct  320  DLTFVDVSEPQWEGDSDNFNLHKYPSYEIDWDSL  353



>ref|XP_003552083.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Glycine max]
Length=309

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 126/206 (61%), Gaps = 32/206 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            L  KP+PMK        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+
Sbjct  101  LSPKPIPMKHVRASPSSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAL  160

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNS  377
            A+D AA+KLRGENARLNFPH   H     G    +KPL S+V AKL+AICQSL  N+   
Sbjct  161  AYDNAAFKLRGENARLNFPHLRHHGARAYGEFGNYKPLPSAVDAKLQAICQSLGTNSQKL  220

Query  376  KSHE----QQRNSEEPCFGSGAAENAVNVKTESSGV--------GAASSPESEITFLEWE  233
            K+          +E             N +T SS           ++SSPES+IT L++ 
Sbjct  221  KTQNPIVLDTHKAETETSEFQDFNKVENYQTSSSSAFSDEYSSSSSSSSPESDITLLDFS  280

Query  232  N---------IILDKYPSAEIDWAAL  182
            +         + L+KYPS EIDWAAL
Sbjct  281  DSCETMDNLGLDLEKYPSVEIDWAAL  306



>ref|XP_009127404.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Brassica 
rapa]
Length=276

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 153/261 (59%), Gaps = 63/261 (24%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP--  704
            GF Q+ P+GLN L+P  I +IQ Q+                          NQ++S    
Sbjct  44   GFNQTAPLGLNQLTPYQINQIQNQL--------------------------NQRRSTNIS  77

Query  703  -LGTKPVPMKQKP-GKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
             L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT+DTAEEAAMA+D+A
Sbjct  78   NLSPKPVPMKNMAVQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTYDTAEEAAMAYDQA  137

Query  529  AYKLRGENARLNFPHFLSHDHGV----EGFKPLHSSVVAKLEAICQSLTHNNDNS-----  377
            AY+LRGE ARLNFPH + H++G       FKPLH SV AKLEAICQSL    D+      
Sbjct  138  AYQLRGELARLNFPH-MRHEYGCGSGDSSFKPLHPSVEAKLEAICQSLRKTEDDDLPCSE  196

Query  376  ------KSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEI--TFLEWEN---  230
                  K+ E Q    E  +G   A+   N  ++ S V  +SSPES I  TFL++ +   
Sbjct  197  TELFPPKAEEYQ----ESEYGFLRADE--NSFSDESQV-ESSSPESGITTTFLDFSDSGF  249

Query  229  -----IILDKYPSAEIDWAAL  182
                  +L+K+PS EIDW A+
Sbjct  250  DEIGSFVLEKFPSVEIDWDAI  270



>ref|NP_001234707.1| dehydration-responsive element binding protein 3 [Solanum lycopersicum]
 gb|AAO13360.1| dehydration-responsive element binding protein 3 [Solanum lycopersicum]
Length=264

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 162/279 (58%), Gaps = 53/279 (19%)
 Frame = -2

Query  910  NRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTL  731
            ++ FS GF+  G EQ G IGLN L+P  I +IQ QI  Q+QQQ++    +  ++    T+
Sbjct  3    SQIFSTGFSGYGMEQQGSIGLNQLTPIQIQQIQAQINFQNQQQQQQQQMMLQTAHHASTM  62

Query  730  -FQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
             F        L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF
Sbjct  63   NF--------LAPKPVPMKQSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  114

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQ  404
            DTAEEAA+A+DKAAY LRG+ ARLNFP  L H+  + G     + PLHSSV AKL+ ICQ
Sbjct  115  DTAEEAALAYDKAAYMLRGDFARLNFPQ-LRHNGNLIGGDFGEYNPLHSSVDAKLKDICQ  173

Query  403  SLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAAS---------------  269
            SL       KS + ++   +      +AE A  VK E      A                
Sbjct  174  SLAQG----KSIDSKKKKTKGL----SAEKAAVVKMEEEESKTAEVGSESDGSHSGSGGS  225

Query  268  SPESEITFLEW----------ENIILDKYPSAEIDWAAL  182
            SP +E+ F E+          EN +L KYPS EIDWA+L
Sbjct  226  SPVTELIFPEFTEEEPTWDMSENFLLQKYPSHEIDWASL  264



>gb|KEH20859.1| ethylene response factor [Medicago truncatula]
Length=286

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 125/206 (61%), Gaps = 42/206 (20%)
 Frame = -2

Query  706  PLGTKPVPMK-----QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            PL  KPVPMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA A
Sbjct  92   PLTQKPVPMKYFGIPSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAFA  151

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            +D AAYKLRGE +RLNFPH   H      + PL SSV +KL+AIC++L  +       ++
Sbjct  152  YDNAAYKLRGEFSRLNFPHMRFHG----SYNPLPSSVDSKLQAICETLAIS-------QK  200

Query  361  QRNSEEPCFGSGAAENAVNVKTESSG-----------------VGAASSPESEITFLEW-  236
            Q N+E+PC      +  V+V  +S G                     SSPES +TFL++ 
Sbjct  201  QGNTEKPCSSVEDVKPLVHVPAQSMGEFVFEDFKAFSSMSDECSLGLSSPESGLTFLDFS  260

Query  235  --------ENIILDKYPSAEIDWAAL  182
                    EN  L K+PS EIDW AL
Sbjct  261  DSSQWDEVENFGLKKFPSVEIDWEAL  286



>ref|XP_006596336.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Glycine max]
Length=312

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 12/184 (7%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KPVPMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  131  LGPKPVPMKHVGGPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  190

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            DKAAY+LRG+ ARLNFP       G E +KP+HS+V AKL+AIC +L       K+ +  
Sbjct  191  DKAAYRLRGDFARLNFPSLKGSCPGEE-YKPVHSAVDAKLDAICANLAEMQKQGKTEKGA  249

Query  358  RNSEEPCFG-SGAAENAVNVKTESSGVGAASSPESEITF----LEWENIILDKYPSAEID  194
            R++++   G +  A+       ES G  A SSP S++TF     +WE+  L K+PS EID
Sbjct  250  RSAKKSKQGPNQEAKPEPQASAESEG-SADSSPLSDLTFDVTEPQWEHFNLQKFPSYEID  308

Query  193  WAAL  182
            W +L
Sbjct  309  WDSL  312



>ref|XP_006411774.1| hypothetical protein EUTSA_v10025958mg [Eutrema salsugineum]
 gb|ESQ53227.1| hypothetical protein EUTSA_v10025958mg [Eutrema salsugineum]
Length=275

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 125/195 (64%), Gaps = 25/195 (13%)
 Frame = -2

Query  703  LGTKPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D+AA
Sbjct  79   LSPKPVPMKNMATQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDQAA  138

Query  526  YKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNS------  377
            YKLRGE ARLNFPH +SH++G  G    FKPLH SV AKLEAICQSL    D+       
Sbjct  139  YKLRGELARLNFPH-ISHEYGYGGGDSSFKPLHPSVEAKLEAICQSLRKTEDDDLPCSET  197

Query  376  -----KSHEQQR-----NSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEWENI  227
                 K+  Q+       S+E  F   + E+ V   +  SG+       S+  F E  + 
Sbjct  198  ELFLPKTEYQESEFGFLRSDEKSF---SDESQVGSSSPESGITTTFFDFSDSGFDEIGSF  254

Query  226  ILDKYPSAEIDWAAL  182
             L+K+PS EIDW A+
Sbjct  255  GLEKFPSLEIDWDAI  269



>gb|EYU24006.1| hypothetical protein MIMGU_mgv1a009524mg [Erythranthe guttata]
Length=339

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 131/208 (63%), Gaps = 30/208 (14%)
 Frame = -2

Query  718  QKSPPLGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT  563
            Q S  L  KPV MKQ        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT
Sbjct  133  QFSSFLRPKPVSMKQTGPGLTPSKPVKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT  192

Query  562  aeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--FKPLHSSVVAKLEAICQSLTHN  389
            +EEAA+A+DKAAYKLRGE A+LNFPH L H    E   FKPL SSV AKL AIC++L   
Sbjct  193  SEEAALAYDKAAYKLRGEFAKLNFPH-LRHQLLQESSTFKPLPSSVDAKLNAICENLASA  251

Query  388  NDNSKSHEQQRNSEEPCFGS-GAAENAVNVKTES--------SGVGAASSPESEITFLEW  236
            N      + +  SE+    S  AAEN   +K E+        S     +SP+S+IT L++
Sbjct  252  NSKKPDKKIESLSEKTVLVSVSAAENEAAMKVEASISVDDASSSSSGTASPQSDITCLDF  311

Query  235  ----------ENIILDKYPSAEIDWAAL  182
                      EN+ L K+PS EIDWAAL
Sbjct  312  MTDTFFDDECENLFLQKFPSVEIDWAAL  339



>emb|CDY42004.1| BnaA01g05760D [Brassica napus]
Length=264

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 150/251 (60%), Gaps = 55/251 (22%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP--  704
            GF Q+ P+GLN L+P  I +IQ Q+                          NQ+++    
Sbjct  44   GFNQTAPLGLNQLTPYQINQIQNQL--------------------------NQRRNTNIS  77

Query  703  -LGTKPVPMKQKP-GKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
             L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT+DTAEEAAMA+D+A
Sbjct  78   NLSPKPVPMKNMAVQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTYDTAEEAAMAYDQA  137

Query  529  AYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNS-----  377
            AY+LRGE ARLNFPH + H++G  G    FKPLH SV AKLEAICQSL    D+      
Sbjct  138  AYQLRGELARLNFPH-MRHEYGYGGGDGSFKPLHPSVEAKLEAICQSLRKTEDDDLPCSE  196

Query  376  ------KSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEWENIILDK  215
                  K+ E Q    E  +G   A+   N  ++ S V  +SSPES   F E  + +L+K
Sbjct  197  TELFPPKAEEYQ----ESEYGFLRADE--NSFSDESQV-ESSSPES--GFDEIGSFVLEK  247

Query  214  YPSAEIDWAAL  182
            +PS EIDW A+
Sbjct  248  FPSVEIDWDAI  258



>ref|XP_010446537.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Camelina sativa]
Length=288

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 149/268 (56%), Gaps = 67/268 (25%)
 Frame = -2

Query  880  VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQK---S  710
             GF Q+ P+GLN L+P  I +IQ Q+                          NQ++   S
Sbjct  47   CGFNQTTPLGLNQLTPYQIHQIQNQL--------------------------NQRRNTIS  80

Query  709  PPLGTKPVPMK-QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdk  533
            P L  +PVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D 
Sbjct  81   PNLAPRPVPMKSMATQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDL  140

Query  532  aAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSL--THNNDNSKS  371
            AAYKLRGE ARLNFP F  H  G  G    F PLHSSV  KL+AICQSL  T + D+ + 
Sbjct  141  AAYKLRGEFARLNFPQF-RHADGYYGGDSFFNPLHSSVDGKLQAICQSLRKTEDEDHHRI  199

Query  370  H-------------EQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEIT------  248
            H             E Q + E      G   +  N  ++ S V ++SSPES +T      
Sbjct  200  HLPCSETELFPPKTEYQESDE-----YGYLRSVENSFSDESQVESSSSPESCVTTNTTFL  254

Query  247  ------FLEWENIILDKYPSAEIDWAAL  182
                  F E  +  L+K+PS EIDW A+
Sbjct  255  DFSESGFDEIGSFGLEKFPSVEIDWDAI  282



>ref|XP_010680571.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Beta vulgaris subsp. vulgaris]
Length=283

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 132/205 (64%), Gaps = 38/205 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            L  KP  MKQ K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT++TAEEAA+A+DKAA
Sbjct  86   LSPKPTLMKQNKSTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTYETAEEAALAYDKAA  145

Query  526  YKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            YKLRG+ ARLNFPH   H   V      +KPLHSSV AKLEAICQ+L       +  ++Q
Sbjct  146  YKLRGDYARLNFPHLKHHGAHVTTEFGHYKPLHSSVNAKLEAICQNL-------EISQKQ  198

Query  358  RNSEEPCFGSGAAENAVNVKTESS------------------GVGAASSPESEITFLEW-  236
              +E PCF S +  ++ +++  SS                     A+ SPES ++FL++ 
Sbjct  199  GKTEGPCFSSVSGSDSGSMENVSSTNAEILIPKTEVLWVSDESSAASCSPESGVSFLDFI  258

Query  235  -------ENIILDKYPSAEIDWAAL  182
                   +++ LDK+PS EIDWA+L
Sbjct  259  ESSWDESDSVALDKFPSFEIDWASL  283



>ref|XP_009349966.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Pyrus x bretschneideri]
Length=323

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 132/217 (61%), Gaps = 49/217 (23%)
 Frame = -2

Query  703  LGTKPVPMK-----QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L TK +PMK      K  KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  113  LSTKAIPMKTAGTPSKLTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  172

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAA KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N+     
Sbjct  173  DKAALKLRGDFARLNFPHLKQQGAHVSGAFGHYKPLHSSVDAKLQAICQSLAANS-----  227

Query  370  HEQQRNSEEPC-------FGSGAAENAVN--VKTE-----------------SSGVGAAS  269
              +Q N+ EPC         S  +E  ++   KTE                 S     +S
Sbjct  228  -MKQGNTGEPCSVAETKPVVSAPSETRMDDSFKTELKSEWEAFSSSSSSPFWSDRSDESS  286

Query  268  SPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
            +PES+ITFL++        EN  L+K+PS EIDW+A+
Sbjct  287  TPESDITFLDFSDSQWDEAENFGLEKFPSVEIDWSAI  323



>emb|CDY39455.1| BnaC03g60650D [Brassica napus]
Length=269

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 153/253 (60%), Gaps = 54/253 (21%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPLG  698
            GF Q+ P+GLN L+P  I +IQ Q+                          NQ+++  + 
Sbjct  44   GFNQTTPLGLNQLTPYQIHQIQNQL--------------------------NQRRNATIS  77

Query  697  T---KPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
            T   KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAAMA+D+A
Sbjct  78   TLSPKPVPMKNMAAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFNTAEEAAMAYDRA  137

Query  529  AYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSL--THNNDNSKSHEQQ-  359
            AYKLRGE ARLNFP ++ H++G   FK LH SV AKLEAICQSL  T ++D+    E + 
Sbjct  138  AYKLRGELARLNFP-YIRHEYGDSRFKALHPSVEAKLEAICQSLGKTEDDDDLPCSETEL  196

Query  358  -----RNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEWEN---------IIL  221
                    E  C  S  A+ ++   ++ S VG +SSP    TFL++ +          +L
Sbjct  197  FPPKAEYQESECSWSLRADESLF--SDESQVG-SSSPG---TFLDFSDSGFDDESGSFVL  250

Query  220  DKYPSAEIDWAAL  182
            +K+PS EIDW A+
Sbjct  251  EKFPSVEIDWDAI  263



>ref|XP_010431962.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Camelina 
sativa]
Length=287

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 146/265 (55%), Gaps = 58/265 (22%)
 Frame = -2

Query  886  ASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQK--  713
             + GF Q+ P+GLN L+P  I +IQ Q+                          NQ++  
Sbjct  45   TTFGFNQTTPLGLNQLTPYQIHQIQNQL--------------------------NQRRNT  78

Query  712  -SPPLGTKPVPMK-QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
             SP L  +PVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+
Sbjct  79   ISPNLAPRPVPMKSMATQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAY  138

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            D AAYKLRGE ARLNFP F  H+ G  G    F PLHSSV AKL+AICQSL    D+   
Sbjct  139  DLAAYKLRGEFARLNFPQF-RHEDGYYGGDSFFNPLHSSVDAKLQAICQSLRKTEDDHHH  197

Query  370  HEQQRNSEEPCF----------GSGAAENAVNVKTESSGVGAASSPESEIT---------  248
                  SE   F            G   +  N  ++ S V  +SSPES +T         
Sbjct  198  RIHLPCSETELFPPKTEYQESDEYGFLRSVENSFSDESQV-ESSSPESCVTTNTTFLDFS  256

Query  247  ---FLEWENIILDKYPSAEIDWAAL  182
               F E  +  L+K+PS EIDW A+
Sbjct  257  ESGFDEIGSFGLEKFPSVEIDWDAI  281



>ref|XP_010647272.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
isoform X2 [Vitis vinifera]
Length=337

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 179/315 (57%), Gaps = 65/315 (21%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + +PN++P      S    FS GF+    +G EQ+  IGLN ++P+ IL+IQ QI+ Q Q
Sbjct  32   STQPNMYPDFCST-STTHMFSQGFSGYDQMGLEQTRSIGLNHITPAQILQIQAQIQFQQQ  90

Query  787  qQKEalaalssssSPVFTLFQNQQKSPP--LGTKPVPMKQ-----KPGKLYRGVRQRHWG  629
            QQ+   A  ++SS     L Q QQ+     LG K +PMKQ     KP KLYRGVRQRHWG
Sbjct  91   QQQRMAAVATASSIQNQRLSQWQQQHNLNFLGPKAIPMKQVGTPPKPAKLYRGVRQRHWG  150

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAA+KLRGE ARLNFP+       V G  
Sbjct  151  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGEFARLNFPNLRHQGSLVAGEF  210

Query  454  --FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV  281
              +KPLHSSV AKL+AICQ+L  +       ++Q NS +P   + A   +   + E   +
Sbjct  211  GDYKPLHSSVDAKLQAICQNLAIS-------QKQGNSGKPGLVADAKIESSTHQAEMV-L  262

Query  280  GAASSPES----------------------------------EITFLEW--------ENI  227
              +S PES                                  +I+FL++        E +
Sbjct  263  DNSSDPESGFLGLEDCKVEISSSSSSPSPSDESSAGSSSPESDISFLDFTDSQWNDSECL  322

Query  226  ILDKYPSAEIDWAAL  182
             L+K+PS EIDWA++
Sbjct  323  TLEKFPSVEIDWASI  337



>emb|CDY14636.1| BnaC02g24770D [Brassica napus]
Length=250

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 124/193 (64%), Gaps = 22/193 (11%)
 Frame = -2

Query  694  KPVPMKQ----------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            KP+ MKQ          KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+
Sbjct  56   KPLLMKQTGVAGSCFLAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAL  115

Query  544  ahdkaAYKLRGENARLNFPHFL---SHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNS  377
            A+DKAA+KLRG++ARLNFPH     SH  G  G +KPLHS+V AKLEAICQS+       
Sbjct  116  AYDKAAFKLRGDHARLNFPHLRHNGSHIGGEFGEYKPLHSTVDAKLEAICQSMAETQKED  175

Query  376  KSHEQQRNSEEPCFGSGAAENAVNVKTESSGV-GAASSPESEITFLE------W-ENIIL  221
            K+ +  +        +   + +  V   +  V  A SSP SE+TF +      W E   L
Sbjct  176  KTAKASKKRASKVKKTEKVDLSEKVSPVTEFVESAGSSPLSELTFADTEEQSRWNETFSL  235

Query  220  DKYPSAEIDWAAL  182
            +KYPS EIDW ++
Sbjct  236  EKYPSYEIDWDSI  248



>ref|XP_002868928.1| hypothetical protein ARALYDRAFT_490762 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45187.1| hypothetical protein ARALYDRAFT_490762 [Arabidopsis lyrata subsp. 
lyrata]
Length=277

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 146/253 (58%), Gaps = 49/253 (19%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQK---SP  707
            GF Q+ P+GLN L+P  I +IQ QI                          NQ++   SP
Sbjct  47   GFNQTTPLGLNQLTPYQIHQIQNQI--------------------------NQRRNIISP  80

Query  706  PLGTKPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
             L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D A
Sbjct  81   NLVPKPVPMKNMATQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDLA  140

Query  529  AYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNND----NSK  374
            AYKLRGE ARLNFP F  H+ G  G    F PLHSSV AKL+AICQSL    D     S+
Sbjct  141  AYKLRGEFARLNFPQF-RHEDGYYGGGSCFNPLHSSVDAKLQAICQSLRKTEDVDLPCSE  199

Query  373  SHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEIT---------FLEWENIIL  221
            +      +E      G   +  N  ++ S V  +SSPES IT         F E  +  L
Sbjct  200  TELFPPKTEYQESEYGFLRSDENSFSDESQV-ESSSPESGITTFLNFSDSGFDEIGSFGL  258

Query  220  DKYPSAEIDWAAL  182
            +K+PS EIDW A+
Sbjct  259  EKFPSVEIDWDAI  271



>gb|ABB89754.1| dehydration-responsive element binding protein 3 [Asparagus officinalis]
Length=240

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 123/191 (64%), Gaps = 23/191 (12%)
 Frame = -2

Query  703  LGTKPVPMK---------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeea  551
            LG KP PMK          KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEA
Sbjct  52   LGVKPQPMKLQASVAAPQSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEA  111

Query  550  amahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            A+A+DKAAYKLRG+ ARLNFP+ L H H + G  PLHSSV AKLEAICQ+L       K 
Sbjct  112  ALAYDKAAYKLRGDYARLNFPN-LKHTH-LAG-NPLHSSVDAKLEAICQTL---ESPGKK  165

Query  370  HEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEW--------ENIILDK  215
                 +  EP   S   E      + SS  GA +SP SEI  L++        E+ +L K
Sbjct  166  KVSTGSKPEPVVSSPTVETEEESSSSSSVTGATNSPVSEIESLDFNEVPWDETEDFVLRK  225

Query  214  YPSAEIDWAAL  182
            YPS EIDW ++
Sbjct  226  YPSYEIDWDSI  236



>gb|AEI16474.1| dehydration-responsive element binding protein [Lespedeza potaninii]
Length=318

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 154/284 (54%), Gaps = 52/284 (18%)
 Frame = -2

Query  946  NVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEala  767
            N FP S+P   +N     GF  V    S  +GLN L+PS I +IQ Q             
Sbjct  58   NYFPSSLPNFYSNTQNLIGFGQVQ-PTSSLLGLNHLTPSQISQIQAQ-------------  103

Query  766  alssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLP  602
                    +     N      LG KP+PMK      KP KLYRGVRQRHWGKWVAEIRLP
Sbjct  104  --------IHVQNHNINSLNLLGPKPIPMKHVGMPPKPTKLYRGVRQRHWGKWVAEIRLP  155

Query  601  KNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSS  434
            KNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP+       V G    +KPLHSS
Sbjct  156  KNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSSVGGDFGEYKPLHSS  215

Query  433  VVAKLEAICQSLTHNNDNSKSHEQQRN------SEEPCFGSGAAENAVNVK-----TESS  287
            V AKL+AIC+ L       K+ ++         +  P     ++EN V V      TES 
Sbjct  216  VDAKLQAICEGLAELQKQGKNEKKPSKKSRSKLAPSPPEKLDSSENKVEVSSPPVTTESE  275

Query  286  GVGAASSPESEITFLE-----W----ENIILDKYPSAEIDWAAL  182
            G    SSP S++TF +     W    EN  L KYPS EIDW +L
Sbjct  276  G-SEGSSPLSDLTFADVSEPQWEGDSENFNLHKYPSYEIDWDSL  318



>ref|XP_006416222.1| hypothetical protein EUTSA_v10008326mg [Eutrema salsugineum]
 gb|ESQ34575.1| hypothetical protein EUTSA_v10008326mg [Eutrema salsugineum]
Length=298

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 127/207 (61%), Gaps = 34/207 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  89   LSPKPVPMKQTGAATKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  148

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            DKAAYKLRG+ ARLNFP+   +   + G ++PL SSV AKLEAICQ L       KS ++
Sbjct  149  DKAAYKLRGDFARLNFPNLRHNGSNIGGEYQPLQSSVDAKLEAICQDLAETQKQGKSAKK  208

Query  361  QRNSEEPCFGSG-------AAENAVNVKTES------------SGVGAASSPESEITFLE  239
              + +     +          E A  VK+E              G G  SSP S++TF +
Sbjct  209  ASSRKRSSTAAAKQPEVNSCPELAEEVKSEDYSSSGSSPSTESYGSG-DSSPLSDLTFAD  267

Query  238  -------W-ENIILDKYPSAEIDWAAL  182
                   W EN  L+KYPS EIDW ++
Sbjct  268  TEEEQPPWNENFALEKYPSYEIDWESI  294



>gb|ADC94856.1| DRE transcription factor 1 [Vitis pseudoreticulata]
Length=379

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 179/326 (55%), Gaps = 82/326 (25%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + +PN++PG     S    FS GF     +G EQ+G IGLN ++P+ IL+IQ QI+ Q Q
Sbjct  69   STQPNMYPGFCST-STTHMFSQGFLGYDQMGLEQTGSIGLNHITPAQILQIQAQIQFQQQ  127

Query  787  qQKEalaalssssSPVFTLFQNQQKSPP-------------LGTKPVPMKQ-----KPGK  662
            QQ+   A  ++SS       QNQ+ S               LG K +PMKQ     KP K
Sbjct  128  QQQRMAAVATASS------IQNQRLSQWQQQQQQQQHTLNFLGPKAIPMKQVGTPPKPAK  181

Query  661  LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHF  482
            LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAA+KLRGE ARLNFP+ 
Sbjct  182  LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGEFARLNFPNL  241

Query  481  LSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAEN  314
                  V G    +KPLHSSV AKL+AICQ+L  +       ++Q NS +P   S A   
Sbjct  242  RHQGSLVAGEFGDYKPLHSSVDAKLQAICQNLAIS-------QKQGNSGKPGLVSDAKIE  294

Query  313  AVNVKTESSGVGAASSPES----------------------------------EITFLEW  236
            +   + E   +  +S PES                                  +I+ L++
Sbjct  295  SSTHQAEMV-LDNSSDPESGFLGLEDCKVEISSSSSSPSPSDESSAGSSSPESDISLLDF  353

Query  235  --------ENIILDKYPSAEIDWAAL  182
                    E + L+K+PS EIDWA++
Sbjct  354  TDSQWNDSECLTLEKFPSVEIDWASI  379



>ref|XP_008445348.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cucumis melo]
Length=362

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 159/305 (52%), Gaps = 75/305 (25%)
 Frame = -2

Query  919  PSANRAFSDGFASVGF---EQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            P     FSDGF+   F   EQS  IGLN L+P  I +             ++   L +  
Sbjct  71   PPMTHLFSDGFSGQDFRGVEQSPSIGLNYLTPFQIQQ------------IQSQFGLQTQI  118

Query  748  SPVFTLFQNQ-------QKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRL  605
             PV+    NQ            LG K +PMK      K  KLYRGVRQRHWGKWVAEIRL
Sbjct  119  QPVWGQINNQVVRNQSNTAGNLLGPKGIPMKHVGSPPKSTKLYRGVRQRHWGKWVAEIRL  178

Query  604  PKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHS  437
            P+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH   H   V G    +KPLHS
Sbjct  179  PRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLKHHGSSVGGDFGEYKPLHS  238

Query  436  SVVAKLEAICQSLTHN-------------------------------NDNSKSHEQQRNS  350
            +V AKLEAICQ+L  +                               +D+ K  +   + 
Sbjct  239  AVDAKLEAICQTLAESQTKGKSDRRKSKSSGSSTIASEPQAPTVIDADDDLKPADAGSSG  298

Query  349  EEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE-----W----ENIILDKYPSAEI  197
             E C     AEN+ +  +  S   A SSP S++TF +     W    E+ +L KYPS EI
Sbjct  299  SEICC---KAENSSSPVSAESDESAGSSPLSDLTFQDTTDSTWEQATESCMLQKYPS-EI  354

Query  196  DWAAL  182
            DWA++
Sbjct  355  DWASI  359



>emb|CDX90362.1| BnaA08g16220D [Brassica napus]
Length=258

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 143/247 (58%), Gaps = 53/247 (21%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQ-----NQQK  713
            GF Q+ P+GLN L+P                               + ++Q     NQ++
Sbjct  44   GFNQTRPLGLNQLTP-------------------------------YQIYQIQNQLNQRR  72

Query  712  SPPLGT---KPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            +P   T   KPV MK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAAM
Sbjct  73   NPTTSTLSPKPVAMKNVTAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFNTAEEAAM  132

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHE  365
            A+D+AAYKLRGE ARLNFP ++ H+ G   FK LH SV AKLEAICQSL          E
Sbjct  133  AYDRAAYKLRGELARLNFP-YIRHEFGDSRFKALHPSVEAKLEAICQSLGKTELLPPKAE  191

Query  364  QQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFL------EWENIILDKYPSA  203
             Q   E  C  S  A+ ++   ++ S VG +SSP + + F       E  + +L+K+PS 
Sbjct  192  YQ---ESECRSSLRADESLF--SDESHVG-SSSPGTLLDFSDSGFDDESGSFVLEKFPSV  245

Query  202  EIDWAAL  182
            EIDW A+
Sbjct  246  EIDWDAI  252



>gb|AFX68812.1| ERF transcription factor 8 [Nicotiana tabacum]
Length=274

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 169/299 (57%), Gaps = 64/299 (21%)
 Frame = -2

Query  970  ESCFTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqh  791
            ESC T+  N            +  S GF+  G E  G IGLN L+P+ I +IQ QI  Q 
Sbjct  4    ESCSTSTTN----------EAQIISTGFSGYGMEHPGSIGLNQLTPAQIQQIQAQINFQT  53

Query  790  qqQKEalaalssssSPVFTLFQNQQKSPP--LGTKPVPMKQ-----KPGKLYRGVRQRHW  632
            QQQ++           +F    +   S    LG KPV MKQ     KP KLYRGVRQRHW
Sbjct  54   QQQQQM----------IFHNGSHHHASTMNLLGPKPVQMKQSGSPPKPTKLYRGVRQRHW  103

Query  631  GKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-  455
            GKWV EIRLPKNRTRLWLGTFDTAEEAA+A+DKAAY LRG+ ARLNFPH L H+  + G 
Sbjct  104  GKWVVEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYMLRGDFARLNFPH-LRHNGSLIGG  162

Query  454  ----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESS  287
                + PLHSSV AKL+ IC+SL      S   +++R S+    GS AA   V ++ E S
Sbjct  163  EFGEYNPLHSSVDAKLKEICESLAQG--KSIDSKKKRTSK----GSSAAA-VVKMEEEES  215

Query  286  GVG-------------AASSPESEITFLEW-----------ENIILDKYPSAEIDWAAL  182
             V                SSP +++TF E+           +N++L KYPS EIDWA+L
Sbjct  216  KVAEGGSESDGSGSGSGGSSPVTDLTFPEFTEEESTWDMCSDNLMLQKYPSHEIDWASL  274



>gb|AET99101.1| dehydration-responsive element-binding protein DREB4 [Solanum 
tuberosum]
Length=366

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 159/270 (59%), Gaps = 37/270 (14%)
 Frame = -2

Query  910  NRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTL  731
            ++ FS  F+  G EQ G IGLN L+P  I +IQ QI  Q+QQQ++ +   ++  +     
Sbjct  107  SQIFSTRFSGYGMEQQGSIGLNQLTPIQIQQIQAQINFQNQQQQQQMMLQTAHHASTMNF  166

Query  730  FQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
                     L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD
Sbjct  167  ---------LAPKPVPMKQSGSPPKPSKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  217

Query  565  TaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQS  401
            TAEEAA+A+DKAAY LRG+ ARLNFP  L H+  + G     + PLHSSV AKL+ ICQS
Sbjct  218  TAEEAALAYDKAAYMLRGDFARLNFPQ-LRHNGNLIGGDFGEYNPLHSSVDAKLKDICQS  276

Query  400  LTHNN--DNSKSHEQQRNSEEPCFGSGAAENAVNVKT-----ESSGVGAASSPESEITFL  242
            L      D+ K   +  ++E+        E +  V+       S      SSP +E+ F 
Sbjct  277  LAQGKSIDSKKKKTKGSSAEKAAVVKMEEEESKTVEVGSESDGSGSGSGGSSPVTELIFP  336

Query  241  EW----------ENIILDKYPSAEIDWAAL  182
            E+          EN +L KYPS EIDWA+L
Sbjct  337  EFTEEETTWDMSENFLLQKYPSHEIDWASL  366



>ref|XP_004150659.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cucumis sativus]
 ref|XP_004166434.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cucumis sativus]
Length=362

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 159/302 (53%), Gaps = 69/302 (23%)
 Frame = -2

Query  919  PSANRAFSDGFASVGF---EQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            P     FSDGF+   F   EQS  IGLN L+P  I +             ++   L +  
Sbjct  71   PPLTHLFSDGFSGQDFHGVEQSPSIGLNYLTPFQIQQ------------IQSQFGLHTQI  118

Query  748  SPVFTLFQNQ-------QKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRL  605
             PV+    NQ            LG + +PMK      K  KLYRGVRQRHWGKWVAEIRL
Sbjct  119  QPVWGQINNQVVRNQSNTAGNLLGPRGIPMKHVGSPPKSTKLYRGVRQRHWGKWVAEIRL  178

Query  604  PKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHS  437
            P+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH   H   V G    +KPLHS
Sbjct  179  PRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLKHHGSSVGGDFGEYKPLHS  238

Query  436  SVVAKLEAICQSLTHNNDNSKSHEQQ----------RNSEEPCF------------GSGA  323
            +V AKLEAICQ+L  +    KS  ++            S+ P              GS  
Sbjct  239  AVDAKLEAICQTLAESQTKGKSDRRKSKSSGSSTIASGSQAPTVIDSDDDLKPADAGSSG  298

Query  322  AENAVNVKTESSGVGA------ASSPESEITFLE-----W----ENIILDKYPSAEIDWA  188
            +E     +  SS V A       SSP S++TF +     W    E+ +L KYPS EIDWA
Sbjct  299  SEVCCKAENSSSPVSAESDESGGSSPLSDLTFQDSTDSAWEQTTESCLLQKYPS-EIDWA  357

Query  187  AL  182
            ++
Sbjct  358  SI  359



>gb|AIM47745.1| DREBa [Suaeda salsa]
Length=287

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 121/205 (59%), Gaps = 38/205 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            L  KP  MK  KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF TAEEAA+A+DKAA
Sbjct  90   LSPKPTLMKHIKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFQTAEEAALAYDKAA  149

Query  526  YKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            YKLRGE ARLNFPH   H   V      +KPLHSSV AKL+AICQSL    D  K     
Sbjct  150  YKLRGEFARLNFPHLQHHGPHVTTQFGLYKPLHSSVNAKLDAICQSLDICLDQGK-----  204

Query  358  RNSEEPCF-------------GSGAAENAV---NVKTESSGVGAASSPESEITFLEWENI  227
              ++ PCF              S +A+  V    V  ESS  GA  SPES +T L +   
Sbjct  205  --TDYPCFPSVSTSSNPIMDSASSSADVLVPKPEVSDESSSSGATCSPESGVTLLNFTES  262

Query  226  I----------LDKYPSAEIDWAAL  182
                       L+  PS EIDW ++
Sbjct  263  SSSWNESNGYSLETIPSLEIDWDSI  287



>ref|XP_009128273.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Brassica rapa]
 emb|CDY26847.1| BnaA02g18720D [Brassica napus]
Length=311

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 127/204 (62%), Gaps = 22/204 (11%)
 Frame = -2

Query  727  QNQQKSPPLGTKPVPMKQ----------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  578
            Q     P L  KP+ MKQ          KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWL
Sbjct  106  QIHHNHPLLRPKPLLMKQPGVAGSCFPAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWL  165

Query  577  GTFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAI  410
            GTFDTAEEAA+A+DKAAYKLRG++ARLNFP   H  SH  G  G +KPLHS+V AKLEAI
Sbjct  166  GTFDTAEEAALAYDKAAYKLRGDHARLNFPNLRHNGSHIGGEFGEYKPLHSTVDAKLEAI  225

Query  409  CQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV-GAASSPESEITFLE--  239
            CQS+       K+ +  +        +   + +  V   +  V  A SSP SE+TF +  
Sbjct  226  CQSMAETQKQDKTAKASKKRASTVKKTEKVDLSEKVSPVTEFVESAGSSPLSELTFADTE  285

Query  238  ----W-ENIILDKYPSAEIDWAAL  182
                W E   L+KYPS EIDW ++
Sbjct  286  EQPRWNETFSLEKYPSYEIDWDSI  309



>ref|XP_003635449.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
isoform X1 [Vitis vinifera]
Length=374

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 179/315 (57%), Gaps = 65/315 (21%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + +PN++P      S    FS GF+    +G EQ+  IGLN ++P+ IL+IQ QI+ Q Q
Sbjct  69   STQPNMYPDFCST-STTHMFSQGFSGYDQMGLEQTRSIGLNHITPAQILQIQAQIQFQQQ  127

Query  787  qQKEalaalssssSPVFTLFQNQQKSPP--LGTKPVPMKQ-----KPGKLYRGVRQRHWG  629
            QQ+   A  ++SS     L Q QQ+     LG K +PMKQ     KP KLYRGVRQRHWG
Sbjct  128  QQQRMAAVATASSIQNQRLSQWQQQHNLNFLGPKAIPMKQVGTPPKPAKLYRGVRQRHWG  187

Query  628  KWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--  455
            KWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAA+KLRGE ARLNFP+       V G  
Sbjct  188  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGEFARLNFPNLRHQGSLVAGEF  247

Query  454  --FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV  281
              +KPLHSSV AKL+AICQ+L  +       ++Q NS +P   + A   +   + E   +
Sbjct  248  GDYKPLHSSVDAKLQAICQNLAIS-------QKQGNSGKPGLVADAKIESSTHQAEMV-L  299

Query  280  GAASSPES----------------------------------EITFLEW--------ENI  227
              +S PES                                  +I+FL++        E +
Sbjct  300  DNSSDPESGFLGLEDCKVEISSSSSSPSPSDESSAGSSSPESDISFLDFTDSQWNDSECL  359

Query  226  ILDKYPSAEIDWAAL  182
             L+K+PS EIDWA++
Sbjct  360  TLEKFPSVEIDWASI  374



>gb|KFK44310.1| hypothetical protein AALP_AA1G241600 [Arabis alpina]
Length=237

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 128/209 (61%), Gaps = 38/209 (18%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  28   LTPKPIPMKQSGSAPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  87

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKS----  371
            DKAA+KLRG++ARLNFP+     H +  + PL SSV AKLEAICQ+L       KS    
Sbjct  88   DKAAFKLRGDSARLNFPNL---RHNIGEYHPLQSSVDAKLEAICQNLAQTQKQGKSTKKK  144

Query  370  --HEQQRNSEEPC-------FGSGAAENAVNVKTESSGVGAA---------SSPESEITF  245
                 +++   PC         S  +  +    TES G G +         SSP S++TF
Sbjct  145  TKRAAKQSEVNPCSDLKPEDCSSAGSGGSSPTLTESYGSGGSSPPLTESYGSSPLSDLTF  204

Query  244  LE-------W-ENIILDKYPSAEIDWAAL  182
             E       W EN  L+KYPS EIDW A+
Sbjct  205  GEAEEEQTPWNENFALEKYPSYEIDWEAI  233



>ref|XP_006354001.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum tuberosum]
Length=367

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 159/270 (59%), Gaps = 37/270 (14%)
 Frame = -2

Query  910  NRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTL  731
            ++ FS  F+  G EQ G IGLN L+P  I +IQ QI  Q+QQQ++ +   ++  +     
Sbjct  108  SQIFSTRFSGYGMEQQGSIGLNQLTPIQIQQIQAQINFQNQQQQQQMMLQTAHHASTMNF  167

Query  730  FQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
                     L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD
Sbjct  168  ---------LAPKPVPMKQSGSPPKPSKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  218

Query  565  TaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQS  401
            TAEEAA+A+DKAAY LRG+ ARLNFP  L H+  + G     + PLHSSV AKL+ ICQS
Sbjct  219  TAEEAALAYDKAAYMLRGDFARLNFPQ-LRHNGNLIGGDFGEYNPLHSSVDAKLKDICQS  277

Query  400  LTHNN--DNSKSHEQQRNSEEPCFGSGAAENAVNVKT-----ESSGVGAASSPESEITFL  242
            L      D+ K   +  ++E+        E +  V+       S      SSP +E+ F 
Sbjct  278  LAQGKSIDSKKKKTKGSSAEKAAVVKMEEEESKTVEVGSESDGSGSGSGGSSPVTELIFP  337

Query  241  EW----------ENIILDKYPSAEIDWAAL  182
            E+          EN +L KYPS EIDWA+L
Sbjct  338  EFTEEEPTWDMSENFLLQKYPSHEIDWASL  367



>ref|XP_009779133.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana sylvestris]
Length=361

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 162/278 (58%), Gaps = 57/278 (21%)
 Frame = -2

Query  910  NRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTL  731
             + FS GF+  G EQ G IGLN L+P+ I +IQ QI  Q QQQ++              +
Sbjct  106  TQIFSTGFSGYGMEQPGSIGLNQLTPAQIQQIQAQINFQTQQQQQ-------------MM  152

Query  730  FQNQQKSPPL-GTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
            F +   +  L G KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF
Sbjct  153  FHHHASTMNLLGPKPVQMKQSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  212

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQ  404
            DTAEEAA+A+DKAAY LRG+ ARLNFPH L H+  + G     + PLHSSV AKL+ IC+
Sbjct  213  DTAEEAALAYDKAAYMLRGDFARLNFPH-LRHNGSLIGGEFGEYNPLHSSVDAKLKEICE  271

Query  403  SLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVG-------------AASSP  263
            SL           +  +S++      +A   V ++ E S V                SSP
Sbjct  272  SLAQG--------KSIDSKKKTSKGSSAAAVVKMEEEESKVAEGGSESDGSGSGSGGSSP  323

Query  262  ESEITFLEW-----------ENIILDKYPSAEIDWAAL  182
             +++TF E+           EN++L KYPS EIDWA+L
Sbjct  324  VTDLTFPEFTEEESTWDMCSENMLLQKYPSHEIDWASL  361



>gb|AAT39542.1| transcription factor DRE-binding factor 2 [Gossypium hirsutum]
 gb|AAZ41376.1| dehydration responsive element-binding protein 2 [Gossypium hirsutum]
Length=350

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 127/209 (61%), Gaps = 37/209 (18%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPVPMK      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  141  LCPKPVPMKHVGAPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  200

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHN----------  389
            DKAAYKLRG+ ARLNFP+   H   V  +KPL SSV AKL+AIC+SL  N          
Sbjct  201  DKAAYKLRGDFARLNFPNLRHHGSHVGDYKPLPSSVDAKLQAICESLVQNPKQGSKKKSS  260

Query  388  --------NDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEW-  236
                     +N KS   +   EE       + +   V++ES G  A SSP S++TF ++ 
Sbjct  261  KVTADTKSRNNKKSDMAEPKPEENTAKVENSSSLSTVQSESEG-SAVSSPLSDLTFSDFD  319

Query  235  -----------ENIILDKYPSAEIDWAAL  182
                       E  +L KYPS EIDW ++
Sbjct  320  EQPWPEVVSSSETFMLSKYPS-EIDWDSI  347



>ref|XP_004288218.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Fragaria vesca subsp. vesca]
Length=356

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 163/287 (57%), Gaps = 57/287 (20%)
 Frame = -2

Query  889  FASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss-SPVFTLFQNQQK  713
            F+ VGFEQ+G +GLN L+PS I +IQTQ+ LQ   Q++    +++ +  P     QN   
Sbjct  76   FSQVGFEQTGSLGLNQLTPSQIHQIQTQMILQQHHQQQQKQQIAALAPLPNQYHHQNTHT  135

Query  712  SPPLGTKPVPMKQ----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
               L  K VPMKQ    KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA+
Sbjct  136  LNFLAPKAVPMKQSSTPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAAL  195

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNS  377
            A+DKAAYKLRG+ ARLNFPH       + G    +KPLH++V AKLEAIC+SL  N    
Sbjct  196  AYDKAAYKLRGDFARLNFPHLKHQGAHISGDFGNYKPLHAAVDAKLEAICESLAVNA---  252

Query  376  KSHEQQRNSEEPC---------------FGSGAAENAVNVKTE-----------------  293
                +Q  +EE C               F    +     +KTE                 
Sbjct  253  ---PKQTKTEELCSETETKPVISAQKMVFDDALSTERTELKTEWDFPKLEAFSSSSSPSR  309

Query  292  --SSGVGAASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
                    +SSPES+I FL++        +   L+KYPS EIDW+A+
Sbjct  310  SCDESSAGSSSPESDIPFLDFSDSQWAENDTFGLEKYPSVEIDWSAI  356



>ref|NP_195688.1| ethylene-responsive transcription factor ERF060 [Arabidopsis 
thaliana]
 sp|O65665.1|ERF60_ARATH RecName: Full=Ethylene-responsive transcription factor ERF060 
[Arabidopsis thaliana]
 emb|CAA18764.1| putative protein [Arabidopsis thaliana]
 emb|CAB80641.1| putative protein [Arabidopsis thaliana]
 gb|ABF82622.1| At4g39780 [Arabidopsis thaliana]
 gb|AEE87118.1| ethylene-responsive transcription factor ERF060 [Arabidopsis 
thaliana]
Length=272

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 125/195 (64%), Gaps = 20/195 (10%)
 Frame = -2

Query  712  SPPLGTKPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahd  536
            SP L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D
Sbjct  74   SPNLAPKPVPMKNMTAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYD  133

Query  535  kaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNND----N  380
             AAYKLRGE ARLNFP F  H+ G  G    F PLHSSV AKL+ ICQSL    D     
Sbjct  134  LAAYKLRGEFARLNFPQF-RHEDGYYGGGSCFNPLHSSVDAKLQEICQSLRKTEDIDLPC  192

Query  379  SKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEI-TFLEWEN--------I  227
            S++      +E      G   +  N  ++ S V  +SSPES I TFL++ +         
Sbjct  193  SETELFPPKTEYQESEYGFLRSDENSFSDESHV-ESSSPESGITTFLDFSDSGFDEIGSF  251

Query  226  ILDKYPSAEIDWAAL  182
             L+K+PS EIDW A+
Sbjct  252  GLEKFPSVEIDWDAI  266



>emb|CDX79244.1| BnaC06g20590D [Brassica napus]
Length=334

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 134/219 (61%), Gaps = 34/219 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ--------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
            L  KP+ MKQ              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFD
Sbjct  116  LSPKPLLMKQPGVAGSCFAYGAPPKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  175

Query  565  TaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL  398
            TAEEAA+A+D AAYKLRG+ ARLNFP   H  SH  G  G +KPLHS+V AKLEAIC+S+
Sbjct  176  TAEEAALAYDTAAYKLRGDFARLNFPNLRHNGSHVGGEFGEYKPLHSTVDAKLEAICKSM  235

Query  397  THNNDNSKSHE-QQRNSEEPCFGSGA--AENAVNVKTESSGV-----GAASSPESEITFL  242
                   K+ +  ++ +      + A  AE  +N   ES  V      A SSP SE+TF 
Sbjct  236  AETEKQEKTTKASKKRASTAALKTEAVKAEENLNSIGESPPVTEFVESAGSSPLSELTFA  295

Query  241  ------EW-ENIILDKYPSAEIDW-AAL*FAGICNLILD  149
                  +W E   L+KYPS EIDW + L    +CNL+ D
Sbjct  296  DAEEQPQWNETFALEKYPSYEIDWDSILADQFVCNLVED  334



>gb|AAC49770.1| AP2 domain containing protein RAP2.4 [Arabidopsis thaliana]
Length=229

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 126/186 (68%), Gaps = 22/186 (12%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  42   KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  101

Query  493  FPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSL--THNND----NSKSHEQQRNSEE  344
            FP+   +   + G    +KPLHSSV AKLEAIC+S+  T   D    +SK  E++ +S +
Sbjct  102  FPNLRHNGFHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPD  161

Query  343  PCFGSGAAENAVNVK-----TESSGVGAASSPESEITFLE------W-ENIILDKYPSAE  200
                  A EN+V++      TE     A SSP S++TF +      W E   L+KYPS E
Sbjct  162  LSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYE  221

Query  199  IDWAAL  182
            IDW ++
Sbjct  222  IDWDSI  227



>ref|XP_009613405.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana tomentosiformis]
Length=366

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 164/278 (59%), Gaps = 54/278 (19%)
 Frame = -2

Query  907  RAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLF  728
            +  S GF+  G E  G IGLN L+P+ I +IQ QI  Q QQQ++           +F   
Sbjct  107  QIISTGFSGYGMEHPGSIGLNQLTPAQIQQIQAQINFQTQQQQQM----------IFHNG  156

Query  727  QNQQKSPP--LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
             +   S    LG KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF
Sbjct  157  SHHHASTMNLLGPKPVQMKQSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  216

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQ  404
            DTAEEAA+A+DKAAY LRG+ ARLNFPH L H+  + G     + PLHSSV AKL+ IC+
Sbjct  217  DTAEEAALAYDKAAYMLRGDFARLNFPH-LRHNGSLIGGEFGEYNPLHSSVDAKLKEICE  275

Query  403  SLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVG-------------AASSP  263
            SL      S   +++R S+    GS AA   V ++ E S V                SSP
Sbjct  276  SLAQG--KSIDSKKKRTSK----GSSAAA-VVKMEEEESKVAEGGSESDGSGSGSGGSSP  328

Query  262  ESEITFLEW-----------ENIILDKYPSAEIDWAAL  182
             +++TF E+           +N++L KYPS EIDWA+L
Sbjct  329  VTDLTFPEFTEEESTWDMCSDNLMLQKYPSHEIDWASL  366



>gb|ADE41127.1| AP2 domain class transcription factor [Malus domestica]
Length=338

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 137/226 (61%), Gaps = 51/226 (23%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L TK +PMK+     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  115  LSTKALPMKKAGTPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  174

Query  538  dkaAYKLRGENARLNFPHFL---SHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAA+KLRG+ A LNFPH     +HD G  G +KPLHSSV AKL+ ICQSL  N+     
Sbjct  175  DKAAFKLRGDFACLNFPHLKHQGAHDSGAFGHYKPLHSSVDAKLQEICQSLAANS-----  229

Query  370  HEQQRNSEEPC-------FGSGAAENAVN--VKTESSGVGAA-----------------S  269
              +Q N+ EPC         S   E  ++   KTE      A                 S
Sbjct  230  -TKQGNTGEPCSVPETKPMVSAPLETRMDDSFKTELKSEWEAFSSLSFSPSRSDRSDESS  288

Query  268  SPESEITFLEW--------ENIILDKYPSAEIDWAAL*FAGICNLI  155
            +PE++ITFL++        EN  L+KYPS EID+  L    +C+L+
Sbjct  289  TPETDITFLDFSDSQWDEAENFGLEKYPSVEIDFLHL--QRMCSLL  332



>ref|XP_004514265.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cicer arietinum]
Length=313

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 154/270 (57%), Gaps = 50/270 (19%)
 Frame = -2

Query  901  FSDGFASVGFEQ-SGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQ  725
            FS     +GFEQ +  IGLN L+PS I +IQ QI LQ Q                     
Sbjct  64   FSQSQNFIGFEQPNSVIGLNNLTPSQINQIQAQIHLQAQN------------------LN  105

Query  724  NQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTa  560
            N      LG KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TA
Sbjct  106  NNTNLSFLGPKPIPMKQPGVPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETA  165

Query  559  eeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG--FKPLHSSVVAKLEAICQSLTHNN  386
            EEAA+A+D+AAY+LRG+ ARLNFP+ + +  G+ G  FKPLHSS+ AKL+AIC+SL    
Sbjct  166  EEAALAYDRAAYRLRGDFARLNFPN-MKNQQGLFGDQFKPLHSSIDAKLDAICESLGDVK  224

Query  385  DNSKSHEQQRNSEEPCFGSGAA--------ENAVN-----VKTESSGVGAASSPESEITF  245
                  +  R S +                +N V+     V TES G    SSP S++TF
Sbjct  225  KQGHVEKSVRGSSKKSLKDAKTIVVENNNDDNKVDASLSPVMTESEG-SDDSSPLSDLTF  283

Query  244  -----LEW----ENIILDKYPSAEIDWAAL  182
                  +W    E   L K+PS EIDW +L
Sbjct  284  GDITEPQWEAGSEQFNLQKFPSYEIDWDSL  313



>gb|ABB89755.1| putative dehydration-responsive element binding protein [Broussonetia 
papyrifera]
Length=330

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 139/304 (46%), Positives = 170/304 (56%), Gaps = 54/304 (18%)
 Frame = -2

Query  952  EPNVFPGSVPI-PSANRAFSDG----FASVGFEQSGPIGLNGLSPShileiqtqielqhq  788
            EPN +P S    PS  + FS G    F  +G EQ+G +GLN L+ S IL+IQ QI  Q Q
Sbjct  34   EPNFYPESETCSPSTTQMFSSGLFSSFNHMGSEQTGSLGLNQLTQSQILQIQAQIYFQQQ  93

Query  787  qQKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKW  623
            QQ++    +++ + P       Q     LG + VPMK      KP KLYRGVRQRHWGKW
Sbjct  94   QQQQQNLLMTTITPP-------QNSLNYLGPRAVPMKNVGANSKPNKLYRGVRQRHWGKW  146

Query  622  VAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----  455
            VAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH       V G    
Sbjct  147  VAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHEGAHVSGEFGE  206

Query  454  FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSE-----EPCFGSGAA----------  320
            +KPLHSSV AKL+AICQSL ++     + E     E     EP   S  +          
Sbjct  207  YKPLHSSVDAKLQAICQSLANSQKQGSAKEACSEPEVKPVIEPKMASDNSPKGELEVSSS  266

Query  319  ----------ENAVNVKTESSGVGAASSPESEITFLEW--------ENIILDKYPSAEID  194
                        +++          +SSPES++T L++        EN  L KYPS EID
Sbjct  267  SLSSSSSLSLSLSLSSPLSDESSAGSSSPESDVTLLDFSDSHWDGNENFGLGKYPSVEID  326

Query  193  WAAL  182
            W AL
Sbjct  327  WDAL  330



>ref|XP_009366366.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Pyrus 
x bretschneideri]
Length=323

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 172/280 (61%), Gaps = 55/280 (20%)
 Frame = -2

Query  901  FSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQN  722
            + D  ++    Q+G IGLN L+PS IL+IQ+Q+ LQ  QQK+ ++A +SS +    L   
Sbjct  59   YPDFCSAPMISQAGAIGLNQLTPSQILQIQSQMILQQHQQKQQISAFASSPAHTLKL---  115

Query  721  QQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
                  L  K VPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAE
Sbjct  116  ------LHPKAVPMKQAGTPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  169

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            EAA+A+DKAA+KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N
Sbjct  170  EAALAYDKAAFKLRGDFARLNFPHLRHQGALVCGDFGHYKPLHSSVDAKLQAICQSLAAN  229

Query  388  NDNSKSHEQQRNSEEPC-------FGSGAAENAVN--VKTE--------------SSGVG  278
            +      ++Q N+ EPC         S   E  ++  VK+E               S   
Sbjct  230  S------KKQGNTGEPCPVAERKPVVSAPLEAKMDDSVKSELKSEWEAFPSSSYSPSPSD  283

Query  277  AASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
             +SSPES+ITFL++        EN  L+KYPS EIDW+A+
Sbjct  284  ESSSPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI  323



>gb|ADD69957.1| DREB2 [Caragana korshinskii]
Length=323

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 131/200 (66%), Gaps = 26/200 (13%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  124  LGPKPIPMKQAGVPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  183

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            D+AAY+LRG+ ARLNFP+  +H +G  G +K LHSSV AKL+AIC++L       K+ ++
Sbjct  184  DRAAYRLRGDFARLNFPNLKNHQNGAFGEYKALHSSVDAKLDAICENLADMQKQGKTQKK  243

Query  361  QRNSEEPCFGSGA--AENAVN--------VKTESSGVGAASSPESEITF-----LEWEN-  230
             ++ ++ C        EN  N        V TES      SSP S++TF      +WE  
Sbjct  244  VKSCKKSCSKEAKPQVENEKNKVEASLSPVLTESEEGSDDSSPLSDLTFGDVTEPQWEAG  303

Query  229  ----IILDKYPSAEIDWAAL  182
                + L K+PS EIDW +L
Sbjct  304  SEHLLNLQKFPSYEIDWDSL  323



>gb|AEI98834.1| dehydration responsive element binding protein 3 [Solanum tuberosum]
Length=262

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 156/269 (58%), Gaps = 35/269 (13%)
 Frame = -2

Query  910  NRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTL  731
            ++ FS GF+  G EQ G IGLN L+P  I +IQ QI  Q+QQQ++ +   S+  +     
Sbjct  3    SQIFSTGFSGYGMEQQGSIGLNQLTPIQIQQIQAQINFQNQQQQQQMMLQSAHHASTMNF  62

Query  730  FQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
                     L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD
Sbjct  63   ---------LAPKPVPMKQSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  113

Query  565  TaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSL  398
            TAEEAA+A+DKAAY LRG+    +FP    + H + G    + PLHSSV AKL+ ICQSL
Sbjct  114  TAEEAALAYDKAAYMLRGDFGSTDFPQLRHNGHLIGGDFGEYNPLHSSVDAKLKDICQSL  173

Query  397  THNN--DNSKSHEQQRNSEEPCFGSGAAENAVNVKT-----ESSGVGAASSPESEITFLE  239
                  D+ K   +  ++E+        E +  V+       S      SSP +E+ F E
Sbjct  174  AQGKSIDSKKKKTKGSSAEKAAVVKMEEEESKTVEVGSESDGSGSGSGGSSPVTELIFPE  233

Query  238  W----------ENIILDKYPSAEIDWAAL  182
            +          EN +L KYPS EIDWA+L
Sbjct  234  FTEEETTWDMSENFLLQKYPSHEIDWASL  262



>ref|XP_010647274.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like, 
partial [Vitis vinifera]
Length=253

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 148/235 (63%), Gaps = 39/235 (17%)
 Frame = -2

Query  958  TAEPNVFPGSVPIPSANRAFSDGFA---SVGFEQSGPIGLNGLSPShileiqtqielqhq  788
            + +PN++P      S    FS GF+    +G EQ+G IGLN ++P+ IL+IQ QI+ Q Q
Sbjct  32   STQPNMYPDFCST-STTHVFSQGFSGYDQMGLEQTGSIGLNHITPAQILQIQAQIQFQQQ  90

Query  787  qQKEalaalssssSPVFTLFQNQQKSPP-------------LGTKPVPMKQ-----KPGK  662
            QQ+   A  ++SS       QNQ+ S               LG K +PMKQ     KP K
Sbjct  91   QQQRMAAVATASS------IQNQRLSQWQQQQQQQQHTLNFLGPKAIPMKQVGTPPKPAK  144

Query  661  LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHF  482
            LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAA+KLRGE ARLNFP+ 
Sbjct  145  LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGEFARLNFPNL  204

Query  481  LSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGS  329
                  V G    +KPLHSSV AKL+AICQ+L  +       ++Q NS + C  S
Sbjct  205  RHQGSLVAGEFGDYKPLHSSVDAKLQAICQNLAIS-------QKQGNSRKACLVS  252



>gb|ADD09620.1| dehydration responsive element binding protein [Trifolium repens]
Length=304

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 124/217 (57%), Gaps = 53/217 (24%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPV MK      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTF+TAEEAA A+
Sbjct  98   LSQKPVSMKHFSTPSKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFETAEEAAFAY  157

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            D AAYKLRGE ARLNFPH   H    E + PL SSV +KL+AIC++L  +    K    Q
Sbjct  158  DNAAYKLRGEFARLNFPHMSHH----ENYNPLPSSVDSKLQAICETLAISQKQGK----Q  209

Query  358  RNSEEPCFGSGAAENAV------------------------NVKTESSGVG-----AASS  266
             N+E+PC  S   E+                          N KT  S +        SS
Sbjct  210  GNNEKPC--SSVVEDVKPVVCVTEKPKDELVCYKFEDFKVENEKTTMSSMSDECSPCLSS  267

Query  265  PESEITFLEW---------ENIILDKYPSAEIDWAAL  182
            PES +TFL++         EN  L KYPS EIDW AL
Sbjct  268  PESGVTFLDFSDSSQWDKVENFGLKKYPSVEIDWEAL  304



>gb|AAK43967.1|AF370152_1 putative AP2 domain-containing protein [Arabidopsis thaliana]
Length=334

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 127/186 (68%), Gaps = 22/186 (12%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  147  KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  206

Query  493  FP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNND----NSKSHEQQRNSEE  344
            FP   H  SH  G  G +KPLHSSV AKLEAIC+S+  T   D    +SK  E++ +S +
Sbjct  207  FPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPD  266

Query  343  PCFGSGAAENAVNVK-----TESSGVGAASSPESEITFLE------W-ENIILDKYPSAE  200
                  A EN+V++      TE     A SSP S++TF +      W E   L+KYPS E
Sbjct  267  LSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYE  326

Query  199  IDWAAL  182
            IDW ++
Sbjct  327  IDWDSI  332



>gb|AAG52091.1|AC012680_2 putative AP2 domain transcriptional regulator, 5' partial; 1-558 
[Arabidopsis thaliana]
Length=185

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 125/183 (68%), Gaps = 22/183 (12%)
 Frame = -2

Query  664  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFP-  488
            KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP 
Sbjct  1    KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPN  60

Query  487  --HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNND----NSKSHEQQRNSEEPCF  335
              H  SH  G  G +KPLHSSV AKLEAIC+S+  T   D    +SK  E++ +S +   
Sbjct  61   LRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPDLSE  120

Query  334  GSGAAENAVNVK-----TESSGVGAASSPESEITFLE------W-ENIILDKYPSAEIDW  191
               A EN+V++      TE     A SSP S++TF +      W E   L+KYPS EIDW
Sbjct  121  KVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYEIDW  180

Query  190  AAL  182
             ++
Sbjct  181  DSI  183



>ref|XP_010477479.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Camelina 
sativa]
Length=273

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 122/204 (60%), Gaps = 30/204 (15%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPV MKQ      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A
Sbjct  64   LSPKPVSMKQTGASLPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALA  123

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            +DKAA+KLRG+ ARLNFP+   +   +  ++PL SSV AKLEAICQ+L       +    
Sbjct  124  YDKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLAETTQKKQVKST  183

Query  361  QRNSEEPCFGSGAAENAVNVKTESSGVGAASS---------------PESEITFLE----  239
            ++ +   C  +     A +   +S    +A S               P S++TF +    
Sbjct  184  KKATSRRCSAAVKQTEAADSGVKSEDYSSAGSSPPLTESYGSGGSSSPLSDLTFGDAEEE  243

Query  238  ----W-ENIILDKYPSAEIDWAAL  182
                W EN  L+KYPS EIDW ++
Sbjct  244  IQPPWNENFALEKYPSYEIDWDSI  267



>ref|NP_177931.1| ethylene-responsive transcription factor RAP2-4 [Arabidopsis 
thaliana]
 sp|Q8H1E4.1|RAP24_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-4; 
AltName: Full=Ethylene-responsive transcription factor ERF059; 
AltName: Full=Protein RELATED TO APETALA2 4 [Arabidopsis 
thaliana]
 gb|AAN12993.1| putative AP2 domain containing protein [Arabidopsis thaliana]
 gb|AEE36065.1| ethylene-responsive transcription factor RAP2-4 [Arabidopsis 
thaliana]
Length=334

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 127/186 (68%), Gaps = 22/186 (12%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  147  KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  206

Query  493  FP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNND----NSKSHEQQRNSEE  344
            FP   H  SH  G  G +KPLHSSV AKLEAIC+S+  T   D    +SK  E++ +S +
Sbjct  207  FPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPD  266

Query  343  PCFGSGAAENAVNVK-----TESSGVGAASSPESEITFLE------W-ENIILDKYPSAE  200
                  A EN+V++      TE     A SSP S++TF +      W E   L+KYPS E
Sbjct  267  LSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYE  326

Query  199  IDWAAL  182
            IDW ++
Sbjct  327  IDWDSI  332



>gb|AAF17691.1|AC009243_18 F28K19.29 [Arabidopsis thaliana]
Length=330

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 127/186 (68%), Gaps = 22/186 (12%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  143  KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  202

Query  493  FP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNND----NSKSHEQQRNSEE  344
            FP   H  SH  G  G +KPLHSSV AKLEAIC+S+  T   D    +SK  E++ +S +
Sbjct  203  FPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPD  262

Query  343  PCFGSGAAENAVNVK-----TESSGVGAASSPESEITFLE------W-ENIILDKYPSAE  200
                  A EN+V++      TE     A SSP S++TF +      W E   L+KYPS E
Sbjct  263  LSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYE  322

Query  199  IDWAAL  182
            IDW ++
Sbjct  323  IDWDSI  328



>gb|EYU36517.1| hypothetical protein MIMGU_mgv1a009828mg [Erythranthe guttata]
Length=330

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 129/215 (60%), Gaps = 42/215 (20%)
 Frame = -2

Query  724  NQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTa  560
             Q  S  LG +PVPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA
Sbjct  124  TQNTSHFLGPRPVPMKQVGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA  183

Query  559  eeaamahdkaAYKLRGENARLNFPHFL---SHDHGVEG-FKPLHSSVVAKLEAICQSLTH  392
            EEAA+A+DKAA+KLRG+ ARLNFPH     SH  G  G +KPLH+SV AKL+ IC++L  
Sbjct  184  EEAALAYDKAAHKLRGDFARLNFPHLRHSGSHIGGDFGEYKPLHASVDAKLQVICETLAQ  243

Query  391  NND-----------------NSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSP  263
                                 + +       E+ C  SG+        TES G G  SSP
Sbjct  244  GKSIDANVIKKSRSKKSSAAAAVAAAASAEEEKSCKISGSG-------TESDGSG-VSSP  295

Query  262  ESEITFLE--------WENIILDKYPSAEIDWAAL  182
             S++TF+E        WE   L KYPS EIDW AL
Sbjct  296  VSDLTFIEFTEEEQPGWEIGSLPKYPSYEIDWDAL  330



>ref|XP_009106455.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Brassica 
rapa]
Length=328

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 130/210 (62%), Gaps = 38/210 (18%)
 Frame = -2

Query  703  LGTKPVPMKQ--------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
            L  KP+ MKQ              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFD
Sbjct  119  LSPKPLLMKQTGATGSCFAYGAPAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  178

Query  565  TaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL  398
            TAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHS+V AKLEAICQS+
Sbjct  179  TAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSTVDAKLEAICQSM  238

Query  397  THNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVG-----------AASSPESEI  251
                 N K+    + S++    + ++   V  +  S+ VG           A SSP S++
Sbjct  239  AEAEKNGKT--MTKASKKRASKTVSSPEKVKAENNSNSVGGSPPVTEFVESAGSSPLSDL  296

Query  250  TFLE------W-ENIILDKYPSAEIDWAAL  182
            TF +      W E   L+KYPS EIDW ++
Sbjct  297  TFADTEEPPQWNETFSLEKYPSYEIDWDSI  326



>gb|AAT44917.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=272

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 123/192 (64%), Gaps = 20/192 (10%)
 Frame = -2

Query  712  SPPLGTKPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahd  536
            SP L  KPVPMK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D
Sbjct  74   SPNLAPKPVPMKNMTAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYD  133

Query  535  kaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNND----N  380
             AAYKLRGE ARLNFP F  H+ G  G    F PLHSSV AKL+ ICQSL    D     
Sbjct  134  LAAYKLRGEFARLNFPQF-RHEDGYYGGGSCFNPLHSSVDAKLQEICQSLRKTEDIDLPC  192

Query  379  SKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEI-TFLEWEN--------I  227
            S++      +E      G   +  N  ++ S V  +SSPES I TFL++ +         
Sbjct  193  SETELFPPKTEYQESEYGFLRSDENSFSDESHV-ESSSPESGITTFLDFSDSGFDEIGSF  251

Query  226  ILDKYPSAEIDW  191
             L+K+PS EIDW
Sbjct  252  GLEKFPSVEIDW  263



>emb|CDP01030.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 165/276 (60%), Gaps = 34/276 (12%)
 Frame = -2

Query  961  FTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQ  782
            + A+ N++P S     +     D        Q G +GLN L+PS I +IQ++  LQ++ +
Sbjct  25   YQAQFNMYPESCCSSQSTYGLVD--------QQGSLGLNQLTPSQIHDIQSRFSLQNENR  76

Query  781  KEalaalssssSPVFTLFQNQQKSPP-LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
               ++       P     Q+QQ++ P L  KPVPMKQ     KP KLYRGVRQRHWGKWV
Sbjct  77   HHMISGPFHQQWPPTRQSQSQQQALPFLAPKPVPMKQSASPPKPTKLYRGVRQRHWGKWV  136

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----  455
            AEIRLPKNRTRLWLGTFDTAEEAA+A+DKAA+KLRG+ ARLNFPH L H+  + G     
Sbjct  137  AEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH-LRHNGSLIGGDFGE  195

Query  454  FKPLHSSVVAKLEAICQSLTHNN--DNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSG-  284
            +KPLHSSV AKL+AICQSL      D  KS   +R + E    +    +A +     SG 
Sbjct  196  YKPLHSSVDAKLQAICQSLAEGKSIDGKKSKGTRRKAAEEEKAAAKTVDAGSESETGSGH  255

Query  283  VGAASSPESEIT---FLE----W----ENIILDKYP  209
            +   SSP S++T   F E    W    EN++L+K P
Sbjct  256  LTDGSSPVSDLTVPDFTEEEGSWEAYPENLMLEKCP  291



>ref|XP_010060168.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Eucalyptus grandis]
 gb|KCW66742.1| hypothetical protein EUGRSUZ_F00497 [Eucalyptus grandis]
Length=361

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 125/212 (59%), Gaps = 40/212 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG + VPMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  150  LGPRAVPMKQAGLAQKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  209

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAY+LRG+ ARLNFPH       ++G    +KPLHSSV AKL+AICQ +     + K 
Sbjct  210  DKAAYRLRGDFARLNFPHLKHKGSHIQGDFGDYKPLHSSVDAKLQAICQDMAEKPADGKK  269

Query  370  HE----QQRNSEEPCFGSGAAENAVNVKTESSGVGAA--------------SSPESEITF  245
                     +S               VKTE  GV AA              SSP SE+TF
Sbjct  270  RRSAPAGGGSSAAAASPRRPEPEPEPVKTE-VGVSAATSSSPESDDASVEESSPLSELTF  328

Query  244  LEW-----------ENIILDKYPSAEIDWAAL  182
             ++           EN  L KYPS EIDWAA+
Sbjct  329  NDFVEPQWESVGVPENFSLQKYPS-EIDWAAI  359



>emb|CBI83762.1| transcription factor DREB2a [Nicotiana benthamiana]
Length=330

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 111/154 (72%), Gaps = 17/154 (11%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            LG KPVPMKQ      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDT EEAA+A
Sbjct  157  LGLKPVPMKQSGGAVQKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTVEEAALA  216

Query  541  hdkaAYKLRGENARLNFPHFLSH--DHGVEGFKPLHSSVVAKLEAICQSLTH-----NND  383
            +DKAAYKLRGE ARLNFPH L H  ++ +  FKPLHSSV AKLEAICQ+L +     +N+
Sbjct  217  YDKAAYKLRGEFARLNFPH-LRHQLNNELSDFKPLHSSVDAKLEAICQNLANSDGLSSNN  275

Query  382  NSKSHEQQRNSEEPCFGSGAAENA---VNVKTES  290
            N+ S  ++         S + ++    VNVK E+
Sbjct  276  NTDSKPRKSKKAASKLDSDSVQDCPENVNVKIEA  309



>gb|ADD09598.1| dehydration responsive element binding protein [Trifolium repens]
Length=304

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 125/217 (58%), Gaps = 53/217 (24%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPV MK      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTF+TAEEAA A+
Sbjct  98   LSQKPVSMKHFSTPSKPIKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFETAEEAAFAY  157

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            D AAYKLRGE ARLNFPH   H    E + PL SSV +KL+AIC++L      S+   +Q
Sbjct  158  DNAAYKLRGEFARLNFPHMSHH----ENYNPLPSSVDSKLQAICETLA----ISQKQGKQ  209

Query  358  RNSEEPCFGSGAAENAV------------------------NVKTESSGVG-----AASS  266
             N+E+PC  S   E+                          N KT  S +        SS
Sbjct  210  GNNEKPC--SSVVEDVKPVVCVSEKPKDELVCHKFEDFKVENEKTMMSCMSDECSPCLSS  267

Query  265  PESEITFLEW---------ENIILDKYPSAEIDWAAL  182
            PES +TFL++         EN  L KYPS EIDW AL
Sbjct  268  PESGVTFLDFSDSSHWDEVENFGLKKYPSVEIDWEAL  304



>gb|KGN48763.1| AP2/ERF domain-containing transcription factor [Cucumis sativus]
Length=271

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 131/201 (65%), Gaps = 21/201 (10%)
 Frame = -2

Query  919  PSANRAFSDGFASV---GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssss  749
            PS+ R FS GF+ +   GFEQSGPIGLN  +PS IL+IQ QI+L         ++ S   
Sbjct  69   PSSTRLFSQGFSGIEQMGFEQSGPIGLNNPTPSQILQIQAQIQLPSPTMSSFSSSSSFQ-  127

Query  748  SPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRL  584
                + + N      L  K  PMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRL
Sbjct  128  ----SQYHNF-----LTPKSFPMKHMGSPPKPNKLYRGVRQRHWGKWVAEIRLPKNRTRL  178

Query  583  WLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQ  404
            WLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFPH L H  G   FKPLH SV AKL++ICQ
Sbjct  179  WLGTFDTAEEAALAYDQAAYKLRGDFARLNFPH-LKHQFG--DFKPLHPSVDAKLQSICQ  235

Query  403  SLTHNNDNSKSHEQQRNSEEP  341
            SL        S E ++ +  P
Sbjct  236  SLKQGKTEVCSVEDEKPTTIP  256



>ref|XP_010916895.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Elaeis guineensis]
Length=348

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 129/207 (62%), Gaps = 29/207 (14%)
 Frame = -2

Query  727  QNQQKSPPLGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            Q+QQ+   LG +P PMK+        KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  141  QSQQQMSLLGMRPQPMKRTGSPLPLPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  200

Query  571  FDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTH  392
            FDTA+EAA+A+D+AAYKLRG+ ARLNFP       G     PLHSSV AKL+AICQSL  
Sbjct  201  FDTAKEAALAYDRAAYKLRGDAARLNFPEL--RCSGAHLSVPLHSSVDAKLQAICQSLAS  258

Query  391  NNDNSKS-------HEQQRNSEEPCFGS--GAAENAVNVKTESSGVGAASSPESEITFLE  239
            +    K         E     E  C G+    +E++ +V  + S  G+ +   SE+ +L+
Sbjct  259  SKKQGKGVSNSVIPEEVGTKGELACSGTDDNKSESSSSVDGDESSSGSLAV--SEMQYLD  316

Query  238  W--------ENIILDKYPSAEIDWAAL  182
            +        E+ +L KYPS +IDW ++
Sbjct  317  FTEAPWDESESFMLTKYPSWDIDWESI  343



>ref|XP_006434017.1| hypothetical protein CICLE_v10001563mg [Citrus clementina]
 gb|ESR47257.1| hypothetical protein CICLE_v10001563mg [Citrus clementina]
Length=308

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 131/210 (62%), Gaps = 36/210 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPVPMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A
Sbjct  97   LSPKPVPMKTVGCPPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALA  156

Query  541  hdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDN  380
            +DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL AIC++L  T     
Sbjct  157  YDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSSVDAKLAAICENLAETQKLGT  216

Query  379  SKSHEQQRNSEEPCFGSG---------AAENAVNVKTES--SGVGAASSPESEITFLEW-  236
            SK  +Q  ++++    SG         A    V VK+E   S   A SSP S++T  +  
Sbjct  217  SKKEKQSNSAQKKRHRSGNKKVDVVEGAGGAGVGVKSECSLSDGSAGSSPVSDLTCQDLT  276

Query  235  ------------ENIILDKYPSAEIDWAAL  182
                        EN +L KYPS EIDWA++
Sbjct  277  EPPSELELDAASENFMLQKYPSYEIDWASI  306



>ref|XP_010459960.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Camelina sativa]
Length=285

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 134/221 (61%), Gaps = 44/221 (20%)
 Frame = -2

Query  733  LFQNQQKSPPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            L+QN    P    KPV MKQ      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  60   LYQNHHLRP----KPVSMKQTGASLPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  115

Query  571  FDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTH  392
            FDTAEEAA+A+DKAA+KLRG+ ARLNFP+   +   +  ++PL SSV AKLEAICQ+L  
Sbjct  116  FDTAEEAALAYDKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLA-  174

Query  391  NNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAAS-------------------  269
              + ++  +Q +++++      ++  A   +TE++  G  S                   
Sbjct  175  --ETTQKQKQVKSTKKATSRRRSSSTAAVKQTETADSGVKSEDYSSAGSSPTLTESYGSG  232

Query  268  ---SPESEITFLE--------W-ENIILDKYPSAEIDWAAL  182
               SP S++TF +        W EN  L+KYPS EIDW ++
Sbjct  233  GSSSPLSDLTFGDAEEEIQPPWNENFALEKYPSYEIDWDSI  273



>gb|AEY75252.1| DRE binding transcription factor [Atriplex canescens]
Length=242

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 131/216 (61%), Gaps = 42/216 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPV MK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  22   LSPKPVTMKTSGGLPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  81

Query  538  dkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC+SL    +  + 
Sbjct  82   DKAAYKLRGDFARLNFPNLRHEGSHIGGEFGEYKPLHSSVNAKLEAICESLAKQGNEKQG  141

Query  370  HEQQRNSEEPCFGSGAA------------------------ENAVNVKTES---SGVGA-  275
               +   +E    S ++                        EN  +VKTES   S VG+ 
Sbjct  142  KNGKSKKKEAVNTSSSSSSSCCTTATAAADAPQQQQQQRMPENGGDVKTESTSDSEVGSG  201

Query  274  ASSPESEITF-----LEWENIILDKYPSAEIDWAAL  182
             SSP S++TF     +  EN +L+  PS EIDW A+
Sbjct  202  GSSPLSDLTFGDNEEMGSENFLLESCPSHEIDWDAI  237



>ref|XP_010521193.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Tarenaya 
hassleriana]
Length=318

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 125/205 (61%), Gaps = 32/205 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ----------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            LG KPV MK                 KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  112  LGPKPVLMKNPGSIGSGFGFGSGQPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  171

Query  571  FDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTH  392
            FDTAEEAA+A+D+AA++LRG+ ARLNFP        +  ++PLHSSV AKL+AIC++L  
Sbjct  172  FDTAEEAALAYDEAAFRLRGDFARLNFPSLRHSGSQIGEYQPLHSSVDAKLDAICRTLAE  231

Query  391  NNDNSKSHEQQR----NSEEPCFGSGAAENAVNVKT----ESSGVGAASSPESEITFLEW  236
                 +S +Q R     +++P       E+     +    ES G  A SSP S++TF + 
Sbjct  232  TQKQGRSEKQPRKKSSTAKQPTLEKVKTEDIAVAGSPPAAESDG-SAGSSPLSDLTFADS  290

Query  235  E-------NIILDKYPSAEIDWAAL  182
            +       N  L+KYPS EIDW ++
Sbjct  291  DEQGQWNTNFALEKYPSYEIDWESI  315



>emb|CDX68032.1| BnaA07g20720D [Brassica napus]
Length=321

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 126/211 (60%), Gaps = 46/211 (22%)
 Frame = -2

Query  703  LGTKPVPMKQ--------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
            L  KP+ MKQ              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFD
Sbjct  118  LSPKPLLMKQPGVAGSCFAYGAPPKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  177

Query  565  TaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQS  401
            TAEEAA+A+D AA+KLRG+ ARLNFP+ L HD    G     +KPLHS+V AKLEAIC+S
Sbjct  178  TAEEAALAYDTAAFKLRGDFARLNFPN-LRHDGSRIGGEFGEYKPLHSTVDAKLEAICKS  236

Query  400  LTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVG-----------AASSPESE  254
            +       K+ +  +          A+  AV  +  S+ +G           A SSP SE
Sbjct  237  MAETEKQEKTTKASKKR--------ASTAAVKAEENSNSIGESPPMTELVESAGSSPLSE  288

Query  253  ITFLE------W-ENIILDKYPSAEIDWAAL  182
            +TF +      W E   L+KYPS EIDW ++
Sbjct  289  LTFADAEEQPQWNETFALEKYPSYEIDWDSI  319



>ref|NP_001288047.1| ethylene-responsive transcription factor ERF060 [Malus domestica]
 ref|XP_008338614.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Malus 
domestica]
 gb|ADZ28107.1| ethylene response factor 4 [Malus domestica]
Length=323

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 169/280 (60%), Gaps = 55/280 (20%)
 Frame = -2

Query  901  FSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQN  722
            + D  ++    Q+G IGLN L+PS IL+IQ+Q+ LQ  QQK+ ++A +SS +    L   
Sbjct  59   YPDFCSAPMISQAGAIGLNQLTPSQILQIQSQMILQQHQQKQQISAFASSPAHTLKL---  115

Query  721  QQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
                  L  K VPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAE
Sbjct  116  ------LRPKAVPMKQAGTPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  169

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            EAA+A+DKAA+KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N
Sbjct  170  EAALAYDKAAFKLRGDFARLNFPHLRHQGALVCGDFGHYKPLHSSVDAKLQAICQSLGAN  229

Query  388  NDNSKSHEQQRNSEEPC-------FGSGAAENAVNVKTES----------------SGVG  278
            +       +Q N+ EPC         S   E  ++   +S                S   
Sbjct  230  S------TKQGNTGEPCPVAETKPVVSAPLEAKMDDSFKSELKSESEAFSSSSYSPSRSD  283

Query  277  AASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
             +SSPES+ITFL++        EN  L+KYPS EIDW+A+
Sbjct  284  ESSSPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI  323



>emb|CDX72672.1| BnaC07g46940D [Brassica napus]
Length=257

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 126/194 (65%), Gaps = 18/194 (9%)
 Frame = -2

Query  724  NQQKSPP---LGTKPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
            NQ++S     L  KPV MK     KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE
Sbjct  63   NQRRSTTISNLSPKPVTMKSMTAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE  122

Query  556  eaamahdkaAYKLRGENARLNFPHF---LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNN  386
            EAAMA+D+AAYKLRGE ARLNFP       +  G   FKPLH SV AKLEAICQS     
Sbjct  123  EAAMAYDQAAYKLRGELARLNFPRTRRECGYGGGDGRFKPLHPSVEAKLEAICQSSVKTE  182

Query  385  D------NSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEWENII  224
            D       ++    +   +E  FGS  A+   N  ++ S VG +SSP+S   F E  + +
Sbjct  183  DLDLPCSETELFPPKAEYQESEFGSLRADE--NSFSDESQVG-SSSPDS--GFDEIGSFV  237

Query  223  LDKYPSAEIDWAAL  182
            L+K+PS EIDW A+
Sbjct  238  LEKFPSVEIDWDAI  251



>emb|CDX87480.1| BnaA07g33930D [Brassica napus]
Length=273

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 126/208 (61%), Gaps = 34/208 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ--------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
            L  KP+ MKQ              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFD
Sbjct  64   LSPKPLLMKQTGATGSCFAYGAPAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  123

Query  565  TaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL  398
            TAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHS+V AKLEAICQS+
Sbjct  124  TAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSTVDAKLEAICQSM  183

Query  397  THNNDNSKSHEQQRNSEEPCFGSG----AAENAVNVKTESSGV-----GAASSPESEITF  245
                   K+  +          S      AE+  N   ES+ V      A SSP S++TF
Sbjct  184  AEAEKQGKTTTKASKKRASKTVSSPEKVKAEDNSNSVDESTPVTEFVESAGSSPLSDLTF  243

Query  244  LE------W-ENIILDKYPSAEIDWAAL  182
             +      W E   L+KYPS EIDW ++
Sbjct  244  ADTEEPPQWNETFSLEKYPSYEIDWDSI  271



>ref|XP_009104590.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Brassica rapa]
Length=318

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 126/211 (60%), Gaps = 46/211 (22%)
 Frame = -2

Query  703  LGTKPVPMKQ--------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
            L  KP+ MKQ              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFD
Sbjct  115  LSPKPLLMKQPGVAGSCFADGAPPKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  174

Query  565  TaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQS  401
            TAEEAA+A+D AA+KLRG+ ARLNFP+ L HD    G     +KPLHS+V AKLEAIC+S
Sbjct  175  TAEEAALAYDTAAFKLRGDFARLNFPN-LRHDGSRIGGEFGEYKPLHSTVDAKLEAICKS  233

Query  400  LTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVG-----------AASSPESE  254
            +       K+ +  +          A+  AV  +  S+ +G           A SSP SE
Sbjct  234  MAETEKQEKTTKASKKR--------ASTAAVKAEENSNSIGESPPVTEFVESAGSSPLSE  285

Query  253  ITFLE------W-ENIILDKYPSAEIDWAAL  182
            +TF +      W E   L+KYPS EIDW ++
Sbjct  286  LTFADAEEQPQWNETFALEKYPSYEIDWDSI  316



>gb|KDO80918.1| hypothetical protein CISIN_1g017798mg [Citrus sinensis]
Length=304

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 130/210 (62%), Gaps = 36/210 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPVPMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A
Sbjct  93   LSPKPVPMKTVGCPPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALA  152

Query  541  hdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDN  380
            +DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL AIC++L  T     
Sbjct  153  YDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSSVDAKLAAICENLAETQKLGT  212

Query  379  SKSHEQQRNSEEPCFGSG---------AAENAVNVKTES--SGVGAASSPESEITFLEW-  236
            SK  +Q  ++++    SG         A    V VK E   S   A SSP S++T  +  
Sbjct  213  SKKEKQSNSAQKKRHRSGNKKVDVVEGAGGAGVGVKNECSLSDGSAGSSPVSDLTCQDLT  272

Query  235  ------------ENIILDKYPSAEIDWAAL  182
                        EN +L KYPS EIDWA++
Sbjct  273  EPPSELELDAASENFMLQKYPSYEIDWASI  302



>emb|CDX88414.1| BnaC06g38580D [Brassica napus]
Length=321

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 129/210 (61%), Gaps = 38/210 (18%)
 Frame = -2

Query  703  LGTKPVPMKQ--------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  566
            L  KP+ MKQ              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFD
Sbjct  112  LSPKPLLMKQTGATGSCFAYDAPAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  171

Query  565  TaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL  398
            TAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHS+V AKLEAICQS+
Sbjct  172  TAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSTVDAKLEAICQSM  231

Query  397  THNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVG-----------AASSPESEI  251
                   K+    + S++    + ++   V  +  S+ VG           A SSP S++
Sbjct  232  AEAEKQGKT--TTKASKKRASKTVSSPEKVKAEDNSNSVGGSPPVTEFVESAGSSPLSDL  289

Query  250  TFLE------W-ENIILDKYPSAEIDWAAL  182
            TF +      W E   L+KYPS EIDW ++
Sbjct  290  TFADTEELPQWNETFSLEKYPSYEIDWDSI  319



>gb|ACP18975.1| dehydration responsive element binding factor [Limonium bicolor]
Length=356

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 130/221 (59%), Gaps = 55/221 (25%)
 Frame = -2

Query  961  FTAEPN-VFPGSV-----PIPSANRAFSDGFA---SVGFEQ--SGPIGLNGLSPShilei  815
            F++ PN  +P SV     P P  N+ FS G +   +   EQ  S PIGLN L+PS IL+ 
Sbjct  80   FSSYPNFYYPSSVYDPNTPCPLTNQLFSTGLSGGYTTQTEQMMSSPIGLNYLTPSQILQ-  138

Query  814  qtqielqhqqQKEalaalssssSPVFTLFQNQQKSPP---------LGTKPVPMKQ----  674
                                    V   FQNQ  +PP         L  KP+PMK     
Sbjct  139  ------------------------VQIQFQNQVSNPPPHIPRSTNPLSLKPIPMKNSASV  174

Query  673  --KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENAR  500
              KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ AR
Sbjct  175  PPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFAR  234

Query  499  LNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            LNFPH       V G    +KPLHSSV AKLEAICQ++  N
Sbjct  235  LNFPHLKHEGSIVAGEFGDYKPLHSSVNAKLEAICQNMEIN  275



>ref|XP_010261262.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nelumbo nucifera]
Length=415

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 168/334 (50%), Gaps = 88/334 (26%)
 Frame = -2

Query  940  FPGSVPI----------PSANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqie  800
            FP S+P            S    FS GF+S   +G E S  IGLN LS S I +IQ Q++
Sbjct  87   FPSSIPSYTSPDSSFCSTSTTHMFSQGFSSHDLLGLEHSSSIGLNQLSLSQIQQIQAQVQ  146

Query  799  lqhqqQKEalaalssssSPVFTLFQNQQKSPP--------------LGTKPVPMKQ----  674
            +Q QQQ+   A  + S        QNQ  S                LG + +PMK     
Sbjct  147  IQQQQQQRMAALAAVS-------IQNQNSSTRQWQQQQHQQNTLNFLGPRTIPMKHVGSP  199

Query  673  ---KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENA  503
               KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE A
Sbjct  200  SPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFA  259

Query  502  RLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNN------------DNSKS  371
            RLNFP+       V G    +KPL SSV AKL+AICQSL ++             D  K+
Sbjct  260  RLNFPNLRHQGAYVGGEFGDYKPLQSSVDAKLQAICQSLANSQKQGSLGKPVVVADTKKT  319

Query  370  -----------------------HEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPE  260
                                      Q  S  P       EN+++     S   A SSPE
Sbjct  320  TAGQTQAGSTVSPAQPQRKTVSVDSSQGESGFPGLEDCKVENSLSPCLTESDESAGSSPE  379

Query  259  SEITF--------LEWENIILDKYPSAEIDWAAL  182
            S+I F         EWE+  L K+PS EIDW ++
Sbjct  380  SDIKFPDFTEPPWDEWESFQLQKFPSLEIDWESI  413



>ref|XP_004252538.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Solanum lycopersicum]
Length=337

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 132/217 (61%), Gaps = 30/217 (14%)
 Frame = -2

Query  745  PVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLW  581
            P  T   N Q +  LG KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLW
Sbjct  121  PAVTFQNNNQYASYLGPKPVSMKQTGSPPKPPKLYRGVRQRHWGKWVAEIRLPKNRTRLW  180

Query  580  LGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLE  416
            LGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L H+  + G     +KPLHSSV AKL+
Sbjct  181  LGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LRHNGSLIGSEFGEYKPLHSSVNAKLQ  239

Query  415  AICQSLTHNN--DNSKSH-----------EQQRNSEEPCFGSGAAENAVNVKTESSGVGA  275
            AICQ L      D  K             E++   +        +E+  +     SG G+
Sbjct  240  AICQDLAQGKSIDTKKKRKVSSKAMMVEVEEKEYKKSKTTAEAGSESDGSGSGSGSGSGS  299

Query  274  ASSPESEITF-----LEWENIILDKYPSAEI-DWAAL  182
             SSP SE TF     +  EN +L K PS EI +WA+L
Sbjct  300  GSSPISEYTFDSIWDMCSENYVLHKDPSQEIFNWASL  336



>ref|XP_009797394.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana sylvestris]
Length=357

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 133/199 (67%), Gaps = 13/199 (7%)
 Frame = -2

Query  961  FTAEPNV-FPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqq  785
             T++PN+ + G     + N  FS GF     EQ G IGL+ L+ + + +IQ QI LQ+  
Sbjct  84   LTSQPNMSYDGCSTSTTINPTFSQGFLGFEMEQPGSIGLDQLTQAQVHQIQAQIYLQNNH  143

Query  784  QKEalaalssssSPVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
             ++ + + +++     T  Q+   +  L  KPV MKQ     KP KLYRGVRQRHWGKWV
Sbjct  144  HQQQIMSSAATFQDSLT-HQHNHHASLLSPKPVSMKQSGWPPKPPKLYRGVRQRHWGKWV  202

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----  455
            AEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH L H   + G     
Sbjct  203  AEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH-LRHSGSLIGGEFGE  261

Query  454  FKPLHSSVVAKLEAICQSL  398
            +KPLHSSV AKL+AICQ L
Sbjct  262  YKPLHSSVDAKLQAICQDL  280



>gb|ADE41144.1| AP2 domain class transcription factor [Malus domestica]
Length=323

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 168/280 (60%), Gaps = 55/280 (20%)
 Frame = -2

Query  901  FSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQN  722
            + D  ++    Q+G IGLN L+PS IL+IQ+Q+ LQ  QQK+ ++A +SS +    L   
Sbjct  59   YPDFCSAPMISQAGAIGLNQLTPSQILQIQSQMILQQHQQKQQISAFASSPAHTLKL---  115

Query  721  QQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
                  L  K VPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAE
Sbjct  116  ------LRPKAVPMKQAGTPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  169

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            EAA+A+DKAA+KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N
Sbjct  170  EAALAYDKAAFKLRGDFARLNFPHLRHQGALVCGDFGHYKPLHSSVDAKLQAICQSLGAN  229

Query  388  NDNSKSHEQQRNSEEPC-------FGSGAAENAVNVKTESS----------------GVG  278
            +       +Q N+ EPC         S   E  ++   +S                    
Sbjct  230  S------TKQGNTGEPCPVAETKPVVSAPLEAKMDDSFKSELKSESEAFSSSSYSPFRSD  283

Query  277  AASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
             +SSPES+ITFL++        EN  L+KYPS EIDW+A+
Sbjct  284  ESSSPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI  323



>dbj|BAG50057.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=370

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 158/293 (54%), Gaps = 59/293 (20%)
 Frame = -2

Query  970  ESCFTAEPNVFPGSVPIPSANRAFSDGFASVGFEQSGP---IGLNGLSPShileiqtqie  800
            + C +  P +FP      S ++       S+GFEQ  P   IGLN L+PS I +IQTQI 
Sbjct  107  DGCSSMMPYLFPSGFSSSSQSQN-----NSIGFEQEQPSSVIGLNQLTPSQISQIQTQIH  161

Query  799  lqhqqQKEalaalssssSPVFTLFQNQQKSPP----LGTKPVPMKQ-----KPGKLYRGV  647
                                   FQ+QQ +      L  KPV MKQ     KP KLYRGV
Sbjct  162  -----------------------FQSQQNTSNSLSFLAPKPVAMKQSGTPPKPTKLYRGV  198

Query  646  RQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDH  467
            RQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA+A+D+AAY+LRG+ ARLNFP+      
Sbjct  199  RQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDRAAYRLRGDFARLNFPNLKDQGS  258

Query  466  GVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFG---SGAAENAVN---  305
                +KPLH+SV AKL+AIC++L          E+   S +           EN V    
Sbjct  259  CFGDYKPLHASVDAKLDAICENLADLQKQGTKAEKGVKSSKKGLKKQVQAEVENKVEASL  318

Query  304  --VKTESSGVGAASSPESEITFLEW----------ENIILDKYPSAEIDWAAL  182
              V TES      SSP S++TF ++          E + L K+PS EIDW +L
Sbjct  319  SPVVTESEN-SDDSSPLSDLTFGDFSEPQWDATTSEYLNLQKFPSYEIDWDSL  370



>ref|XP_007018819.1| AP2 4, putative [Theobroma cacao]
 gb|EOY16044.1| AP2 4, putative [Theobroma cacao]
Length=371

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 131/212 (62%), Gaps = 38/212 (18%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  157  LSPKPIPMKQMGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  216

Query  538  dkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHN------  389
            DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL+AIC+SL  N      
Sbjct  217  DKAAYKLRGDFARLNFPNLRHQGSHIGGDFGEYKPLHSSVDAKLQAICESLEQNQKQGNK  276

Query  388  -----------NDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFL  242
                       + N+K H  +   EE       + ++V+     S   A SSP S++TF 
Sbjct  277  KKSSKETAANKSKNNKIHVAEPEPEEKTVKVENSSSSVSPVLSESEGSAESSPLSDLTFS  336

Query  241  EW------------ENIILDKYPSAEIDWAAL  182
            ++            EN +L KYPS EIDW ++
Sbjct  337  DFNEQPWPEVVSPSENFMLAKYPSYEIDWDSI  368



>ref|XP_010498682.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Camelina sativa]
Length=285

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 134/218 (61%), Gaps = 38/218 (17%)
 Frame = -2

Query  733  LFQNQQKSPPLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            L QN   SP    KPV MKQ      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  60   LHQNHHLSP----KPVSMKQTGASLPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  115

Query  571  FDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTH  392
            FDTAEEAA+A+DKAA+KLRG+ ARLNFP+   +   +  ++PL SSV AKLEAICQ+L  
Sbjct  116  FDTAEEAALAYDKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLAE  175

Query  391  NNDNSK--------SHEQQRNSEEPCFGSGAAENAVNVK-----------TESSGVGAAS  269
                 K        +  ++ +S      + AA++ V  +           TES G G +S
Sbjct  176  TTQKQKQVKSTKKATSRRRSSSTVAVKQTEAADSGVKSEDYSSAGSSPTLTESYGSGGSS  235

Query  268  SPESEITFLE--------W-ENIILDKYPSAEIDWAAL  182
            SP S++TF +        W EN  L+KYPS EIDW ++
Sbjct  236  SPLSDLTFGDAEEEIHPPWNENFALEKYPSYEIDWDSI  273



>gb|KFK30541.1| hypothetical protein AALP_AA7G275700 [Arabis alpina]
Length=264

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 122/189 (65%), Gaps = 25/189 (13%)
 Frame = -2

Query  694  KPVPMKQKPG--KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYK  521
            KP+PMK      KL+RGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMA+D+AAYK
Sbjct  77   KPIPMKNMTTNQKLFRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDQAAYK  136

Query  520  LRGENARLNFPHFLSHD--HGVEG---FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQR  356
            LRGE ARLNFPH  + D  +G +G   FK LHSSV AKLEAIC+ +    D     E Q 
Sbjct  137  LRGEFARLNFPHLKNKDGSYGGDGYFFFKALHSSVEAKLEAICEGMRKTEDFPPKIEYQ-  195

Query  355  NSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEWENII-----------LDKYP  209
               E   G   +++  +   ES      SSPES  TFL++ + +           L+K+P
Sbjct  196  ---ESELGFLRSDHECSFSDESQ--VCYSSPES-ATFLDFSDSVFGDEIEIGSLGLEKFP  249

Query  208  SAEIDWAAL  182
            S EIDW A+
Sbjct  250  SVEIDWDAI  258



>ref|XP_006434018.1| hypothetical protein CICLE_v10001563mg [Citrus clementina]
 gb|ESR47258.1| hypothetical protein CICLE_v10001563mg [Citrus clementina]
Length=369

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 131/210 (62%), Gaps = 36/210 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPVPMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A
Sbjct  158  LSPKPVPMKTVGCPPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALA  217

Query  541  hdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDN  380
            +DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL AIC++L  T     
Sbjct  218  YDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSSVDAKLAAICENLAETQKLGT  277

Query  379  SKSHEQQRNSEEPCFGSG---------AAENAVNVKTES--SGVGAASSPESEITFLEW-  236
            SK  +Q  ++++    SG         A    V VK+E   S   A SSP S++T  +  
Sbjct  278  SKKEKQSNSAQKKRHRSGNKKVDVVEGAGGAGVGVKSECSLSDGSAGSSPVSDLTCQDLT  337

Query  235  ------------ENIILDKYPSAEIDWAAL  182
                        EN +L KYPS EIDWA++
Sbjct  338  EPPSELELDAASENFMLQKYPSYEIDWASI  367



>ref|XP_003542454.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
isoform 1 [Glycine max]
Length=311

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 126/198 (64%), Gaps = 28/198 (14%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KPVPMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  118  LGPKPVPMKHVGGPAKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  177

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            DKAAY+LRG+ ARLNFP+      G E +KP+ ++V AKL+AIC +L       K+ +  
Sbjct  178  DKAAYRLRGDLARLNFPNLKGSCPGEE-YKPMQAAVDAKLDAICANLAEMQKQGKNEKGA  236

Query  358  RNSEEPCFGSGAAENAVNVKTESSGVGAAS-SPESE--------------ITFLEWEN--  230
            R+ ++   G          + E+SG GAA+ SPESE              +T  +WE+  
Sbjct  237  RSGKKSKQGPNL---EAKPEPEASGSGAAALSPESEGSADSSALSDLTFDVTEPQWEDAS  293

Query  229  --IILDKYPSAEIDWAAL  182
                L K+PS EIDW +L
Sbjct  294  AHFNLQKFPSYEIDWDSL  311



>emb|CBI23500.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 130/203 (64%), Gaps = 36/203 (18%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG K +PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  75   LGPKAIPMKQVGTPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  134

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAA+KLRGE ARLNFP+       V G    +KPLHSSV AKL+AICQ+L  +      
Sbjct  135  DKAAFKLRGEFARLNFPNLRHQGSLVAGEFGDYKPLHSSVDAKLQAICQNLAIS------  188

Query  370  HEQQRNSEEPCFGSGAAENAVNVKTE------------SSGVGAASSPESEITFLEW---  236
             ++Q NS +P   + A   +   + E                  +SSPES+I+FL++   
Sbjct  189  -QKQGNSGKPGLVADAKIESSTHQAEMISSSSSSPSPSDESSAGSSSPESDISFLDFTDS  247

Query  235  -----ENIILDKYPSAEIDWAAL  182
                 E + L+K+PS EIDWA++
Sbjct  248  QWNDSECLTLEKFPSVEIDWASI  270



>gb|KDO80917.1| hypothetical protein CISIN_1g017798mg [Citrus sinensis]
Length=365

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 130/210 (62%), Gaps = 36/210 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPVPMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A
Sbjct  154  LSPKPVPMKTVGCPPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALA  213

Query  541  hdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDN  380
            +DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL AIC++L  T     
Sbjct  214  YDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSSVDAKLAAICENLAETQKLGT  273

Query  379  SKSHEQQRNSEEPCFGSG---------AAENAVNVKTES--SGVGAASSPESEITFLEW-  236
            SK  +Q  ++++    SG         A    V VK E   S   A SSP S++T  +  
Sbjct  274  SKKEKQSNSAQKKRHRSGNKKVDVVEGAGGAGVGVKNECSLSDGSAGSSPVSDLTCQDLT  333

Query  235  ------------ENIILDKYPSAEIDWAAL  182
                        EN +L KYPS EIDWA++
Sbjct  334  EPPSELELDAASENFMLQKYPSYEIDWASI  363



>ref|XP_006472629.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Citrus sinensis]
Length=365

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 130/210 (62%), Gaps = 36/210 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPVPMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A
Sbjct  154  LSPKPVPMKTVGCPPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALA  213

Query  541  hdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDN  380
            +DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKL AIC++L  T     
Sbjct  214  YDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSSVDAKLAAICENLAETQKLGT  273

Query  379  SKSHEQQRNSEEPCFGSG---------AAENAVNVKTES--SGVGAASSPESEITFLEW-  236
            SK  +Q  ++++    SG         A    V VK E   S   A SSP S++T  +  
Sbjct  274  SKKEKQSNSAQKKRHRSGNKKVDVVEGAGGAGVGVKNECSLSDGSAGSSPVSDLTCQDLT  333

Query  235  ------------ENIILDKYPSAEIDWAAL  182
                        EN +L KYPS EIDWA++
Sbjct  334  EPPSELELDAASENFMLQKYPSYEIDWASI  363



>ref|XP_006390026.1| hypothetical protein EUTSA_v10018771mg [Eutrema salsugineum]
 dbj|BAJ34031.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27312.1| hypothetical protein EUTSA_v10018771mg [Eutrema salsugineum]
Length=356

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 123/190 (65%), Gaps = 26/190 (14%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  163  KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  222

Query  493  FP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDNSKSHEQQRNS---EEP  341
            FP   H  SH  G  G +KPLHS+V AKLEAICQS+  T   D S    ++R S   ++ 
Sbjct  223  FPNLRHNGSHIGGEFGEYKPLHSTVDAKLEAICQSMAETQKQDKSTKPSKKRASTVTQKK  282

Query  340  CFGSGAAENAVNVKTESSG----------VGAASSPESEITFLE------W-ENIILDKY  212
                  A+    VKTE +             A SSP S++TF +      W E   L+KY
Sbjct  283  TETVSPADQPEKVKTEENSNSIAGSPPFVESAGSSPLSDLTFADTEEPPQWNETFSLEKY  342

Query  211  PSAEIDWAAL  182
            PS EIDW ++
Sbjct  343  PSYEIDWDSI  352



>ref|XP_009109443.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Brassica rapa]
Length=258

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 143/242 (59%), Gaps = 43/242 (18%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPLG  698
            GF Q+ P+GLN L+P  I +IQ Q+                          NQ+++P   
Sbjct  44   GFNQTTPLGLNQLTPYQIHQIQNQL--------------------------NQRRNPTTS  77

Query  697  T---KPVPMKQKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
            T   KPV MK     KLYRGVRQRHWGKWVAE RLPKNR RLWLGTF+TAEEAAMA+D+A
Sbjct  78   TLSPKPVAMKNMTAQKLYRGVRQRHWGKWVAETRLPKNRPRLWLGTFNTAEEAAMAYDRA  137

Query  529  AYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNS  350
            AYKLRGE ARLNFP ++ H+ G   FK LH SV AKLEAICQSL          E Q   
Sbjct  138  AYKLRGELARLNFP-YIRHEFGDSRFKALHPSVEAKLEAICQSLGKTELLPPKAEYQ---  193

Query  349  EEPCFGSGAAENAVNVKTESSGVGAASSPESEITFL------EWENIILDKYPSAEIDWA  188
            E  C  S  A+ ++   ++ S VG +SSP + + F       E  + +L+K+PS EIDW 
Sbjct  194  ESECRWSLRADESLF--SDESQVG-SSSPGTLLDFSDSGFDDESGSYVLEKFPSVEIDWD  250

Query  187  AL  182
            A+
Sbjct  251  AI  252



>ref|XP_008352604.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF060-like [Malus domestica]
Length=329

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 167/278 (60%), Gaps = 55/278 (20%)
 Frame = -2

Query  901  FSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQN  722
            + D  ++    Q+G IGLN L+PS IL+IQ+Q+ LQ  QQK+ ++A +SS +    L   
Sbjct  59   YPDFCSAPMISQAGAIGLNQLTPSQILQIQSQMILQQHQQKQQISAFASSPAHTLKL---  115

Query  721  QQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
                  L  K VPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAE
Sbjct  116  ------LRPKAVPMKQAGTPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  169

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHN  389
            EAA+A+DKAA+KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N
Sbjct  170  EAALAYDKAAFKLRGDFARLNFPHLRHQGALVCGDFGHYKPLHSSVDAKLQAICQSLGAN  229

Query  388  NDNSKSHEQQRNSEEPC-------FGSGAAENAVNVKTES----------------SGVG  278
            +       +Q N+ EPC         S   E  ++   +S                S   
Sbjct  230  S------TKQGNTGEPCPVAETKPVVSAPLEAKMDDSFKSELKSESEAFSSSSYSPSRSD  283

Query  277  AASSPESEITFLEW--------ENIILDKYPSAEIDWA  188
             +SSPES+ITFL++        EN  L+KYPS EIDW+
Sbjct  284  ESSSPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWS  321



>ref|XP_010102588.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25981.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB93691.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=335

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 159/262 (61%), Gaps = 36/262 (14%)
 Frame = -2

Query  889  FASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKS  710
            F+ +GFEQ+G +GLN L+PS IL+IQ QI  Q QQQ       ++S++     F N    
Sbjct  84   FSHMGFEQTGSLGLNQLTPSQILQIQAQIYFQQQQQNNLAMMTTTSNN-----FNNY---  135

Query  709  PPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
              LG + VPMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+
Sbjct  136  --LGPRTVPMKNAGPTSKPNKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAL  193

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNS  377
            A+DKAA+KLRG+ ARLNFPH       V G    +KPLHSSV AKL+AICQSL  N    
Sbjct  194  AYDKAAFKLRGDFARLNFPHLRHDGSHVSGDFGQYKPLHSSVDAKLQAICQSLQANAQKR  253

Query  376  KS--HEQQRNSEEP------CFGSGAAENAVNVKTESSGVGAASSPESEITFL-------  242
            ++    + + + EP         S ++ ++            +SSPES+I  L       
Sbjct  254  ETCPEPETKPTVEPKVESEASCSSPSSSSSPPPSLSDESSAGSSSPESDIMLLDFFDSRW  313

Query  241  -EWENI-ILDKYPSAEIDWAAL  182
             E EN   L KYPS EIDW AL
Sbjct  314  DECENFGALGKYPSVEIDWDAL  335



>ref|XP_006303258.1| hypothetical protein CARUB_v10009949mg [Capsella rubella]
 gb|EOA36156.1| hypothetical protein CARUB_v10009949mg [Capsella rubella]
Length=282

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 126/203 (62%), Gaps = 29/203 (14%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPV MKQ      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A
Sbjct  72   LSPKPVSMKQTGSSAPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALA  131

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNND-----NS  377
            +DKAA+KLRG+ ARLNFP+   +   +  ++PL SSV AKLEAICQ+L            
Sbjct  132  YDKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLAETTQKQVKPTK  191

Query  376  KSHEQQRNSEEPCFGSGAAENAVNVK-----------TESSGVGAASSPESEITFLEWE-  233
            KS  ++R+           ++ V  +           TES G G +SSP S++TF + E 
Sbjct  192  KSASRKRSPTAAVVKQTEVDSGVKSEDYSSAGSSPPLTESYGSGGSSSPLSDLTFGDAEE  251

Query  232  ------NIILDKYPSAEIDWAAL  182
                  N  L+KYPS EIDW ++
Sbjct  252  EIQPPWNYALEKYPSYEIDWDSI  274



>ref|XP_006394075.1| hypothetical protein EUTSA_v10005326mg [Eutrema salsugineum]
 gb|ESQ31361.1| hypothetical protein EUTSA_v10005326mg [Eutrema salsugineum]
Length=277

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 146/254 (57%), Gaps = 54/254 (21%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQ-------QKS  710
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ       QK 
Sbjct  46   QAGPIGLNQLTPTQILQIQTE----------------------LHLRQNQSRRRGGGQKL  83

Query  709  PPLGTKPVPMKQ----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
             PL  KP PMK+    KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF TAEEAA+A
Sbjct  84   HPLTVKPTPMKKTDVTKPVKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFQTAEEAALA  143

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            +D+AA+K+RGENARLNFP    +    +   P   S+ AK+E+IC S    +D     ++
Sbjct  144  YDQAAHKIRGENARLNFPIIARYGEYKQSLSP---SINAKIESICNS----SDTLPEVKK  196

Query  361  QRNSEEPCFG---SGAAENAVNVKTESSGVG-AASSPESEITFL----EWEN------II  224
               +EE  FG   +G         +E+ G G + SSPES+IT L    EW        + 
Sbjct  197  PAKTEEGSFGFHYTGPKPEQEREDSENFGCGFSGSSPESDITLLDFSREWMKEDESFFMG  256

Query  223  LDKYPSAEIDWAAL  182
            L K+PS EIDW A+
Sbjct  257  LQKFPSLEIDWEAI  270



>ref|XP_008790815.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Phoenix dactylifera]
Length=369

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 126/205 (61%), Gaps = 32/205 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            LG +P PMK        +P KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+
Sbjct  164  LGPRPQPMKHAGSPPPPRPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAL  223

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHE  365
            A+DKAA++LRG+ ARLNFPH L H+       PLHSSV AKL AICQSL ++        
Sbjct  224  AYDKAAFRLRGDFARLNFPH-LRHEIARAAGGPLHSSVDAKLHAICQSLANSPKQIIPPL  282

Query  364  QQRNSEEPC----FGSGAAENAV-------NVKTESSGVG-----AASSPESEITFL---  242
            +   + EP       +G   +A        + K+ESS  G     + SSP SE+  L   
Sbjct  283  RPTCTLEPASEAVLDAGRRPSAAKGESGSEDYKSESSSEGGEDYSSGSSPASEVQHLDFT  342

Query  241  -----EWENIILDKYPSAEIDWAAL  182
                 E E+ +L KYPS EIDW ++
Sbjct  343  EAPWDELESFVLRKYPSWEIDWDSI  367



>emb|CDY38238.1| BnaC05g17550D [Brassica napus]
Length=260

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 128/204 (63%), Gaps = 30/204 (15%)
 Frame = -2

Query  733  LFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
            L Q    S  L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTF
Sbjct  64   LNQTHSYSNLLSPKPVPMKQTGSPPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTF  123

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHN  389
            DTAEEAA+A+DKAAYKLRG+ ARLNFP+ L  + G   ++PL S V  KLEAIC+SL   
Sbjct  124  DTAEEAALAYDKAAYKLRGDFARLNFPN-LRGEFG--EYQPLQSPVDDKLEAICKSLAET  180

Query  388  NDNSKSHEQQRNSEEPCFGSGAAENAVNVKTE--SSGVGAAS-----SPESEITFLEWE-  233
               +K    +R        S  A+    VK+E  SS V   S     SP S++TF++ E 
Sbjct  181  QKPTKKSSSRRR-------SSTAKQPEEVKSEDYSSVVSPPSTESYGSPLSDLTFVDVEE  233

Query  232  -------NIILDKYPSAEIDWAAL  182
                   N  L+KYPS EIDW ++
Sbjct  234  QQQPWSVNFALEKYPSYEIDWDSI  257



>ref|XP_010042789.1| PREDICTED: ethylene-responsive transcription factor ERF060-like, 
partial [Eucalyptus grandis]
Length=341

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 161/306 (53%), Gaps = 68/306 (22%)
 Frame = -2

Query  946  NVFPGSVPIPSANRAFSDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEala  767
            +VFP   P  + +   S     +G EQSG IGLN LS S I  IQ ++ L+ Q  +E   
Sbjct  45   SVFPQQQPNLNPDLCSSWILNPMGLEQSGSIGLNRLSHSQIQHIQDEMLLRRQN-QELWL  103

Query  766  alssssSPVFTLF-----QNQQKSPPL-GTKPVPMKQ-----KPGKLYRGVRQRHWGKWV  620
            A +  S      F     QN   SP L   K +PMK+     KP KLYRGVRQRHWGKWV
Sbjct  104  ASAMKSPLQHEKFDQCRHQNHHGSPHLLRPKALPMKRVGVPPKPNKLYRGVRQRHWGKWV  163

Query  619  AEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHG--VEGFKP  446
            AEIRLPKNRTRLWLGTFDTAEEAA+A+D+AAYKLRG+ ARLNFP   S D G  +  + P
Sbjct  164  AEIRLPKNRTRLWLGTFDTAEEAALAYDEAAYKLRGDFARLNFPR--SRDGGSYLCDYNP  221

Query  445  LHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTES--------  290
            LHSSV AKL+AICQSL  N+      ++Q  + EPCF    A    +  TE+        
Sbjct  222  LHSSVCAKLQAICQSLAANS------QKQGKTGEPCFFPDRAMETFDAATEADEAIFFKV  275

Query  289  -------------------------------SGVGAASSPESEITFL-------EWENII  224
                                           S V  +SSPES +  L       E EN  
Sbjct  276  ALKNEYDADLAYPEQDYKVENSVSSPAFSDESSVAGSSSPESNLALLGFPPSQFEIENFY  335

Query  223  LDKYPS  206
            L+K+PS
Sbjct  336  LEKFPS  341



>gb|AAF76898.1|AF274033_1 apetala2 domain-containing protein [Atriplex hortensis]
Length=240

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 129/218 (59%), Gaps = 44/218 (20%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPV MK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  18   LSPKPVTMKTTGGPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  77

Query  538  dkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC+SL    +  + 
Sbjct  78   DKAAYKLRGDFARLNFPNLRHEGSHIGGEFGEYKPLHSSVNAKLEAICESLAKQGNEKQG  137

Query  370  HEQQRNSEE--------------------------PCFGSGAAENAVNVKTES---SGVG  278
               +   ++                          P       EN  +VKTES   S VG
Sbjct  138  KSGKSKKKDVANNNNNTSSSSSSSCCTTATAAADAPQQQQRMPENGGDVKTESTSDSEVG  197

Query  277  A-ASSPESEITF-----LEWENIILDKYPSAEIDWAAL  182
            +  SSP S++TF     +  EN +L+  PS EIDW A+
Sbjct  198  SGGSSPLSDLTFGDNEEMGSENFLLESCPSHEIDWDAI  235



>ref|XP_009145366.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Brassica 
rapa]
Length=260

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 128/204 (63%), Gaps = 30/204 (15%)
 Frame = -2

Query  733  LFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
            L Q    S  L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTF
Sbjct  64   LNQTHSYSNLLSPKPVPMKQTASPPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTF  123

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHN  389
            DTAEEAA+A+DKAAYKLRG+ ARLNFP+ L  + G   ++PL S V  KLEAIC+SL   
Sbjct  124  DTAEEAALAYDKAAYKLRGDFARLNFPN-LRGEFG--EYQPLQSPVDDKLEAICKSLAET  180

Query  388  NDNSKSHEQQRNSEEPCFGSGAAENAVNVKTE--SSGVGAAS-----SPESEITFLEWE-  233
               +K    ++        S  A+    VKTE  SS V   S     SP S++TF++ E 
Sbjct  181  QKPTKKSSSRK-------RSSTAKQPEEVKTEDYSSVVSPPSTESYGSPLSDLTFVDVEE  233

Query  232  -------NIILDKYPSAEIDWAAL  182
                   N  L+KYPS EIDW ++
Sbjct  234  EQEPWNVNFALEKYPSYEIDWDSI  257



>emb|CDY21346.1| BnaA09g30810D [Brassica napus]
Length=260

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 128/204 (63%), Gaps = 30/204 (15%)
 Frame = -2

Query  733  LFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  569
            L Q    S  L  KPVPMKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTF
Sbjct  64   LNQTHSYSNLLSPKPVPMKQTASPPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTF  123

Query  568  DTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHN  389
            DTAEEAA+A+DKAAYKLRG+ ARLNFP+ L  + G   ++PL S V  KLEAIC+SL   
Sbjct  124  DTAEEAALAYDKAAYKLRGDFARLNFPN-LRGEFG--EYQPLQSPVDDKLEAICKSLAET  180

Query  388  NDNSKSHEQQRNSEEPCFGSGAAENAVNVKTE--SSGVGAAS-----SPESEITFLEWE-  233
               +K    ++        S  A+    VKTE  SS V   S     SP S++TF++ E 
Sbjct  181  QKPTKKSSSRK-------RSSTAKQPEEVKTEDYSSVVSPPSTESYGSPLSDLTFVDVEE  233

Query  232  -------NIILDKYPSAEIDWAAL  182
                   N  L+KYPS EIDW ++
Sbjct  234  EEQPWNVNFALEKYPSYEIDWDSI  257



>ref|XP_003615022.1| Ethylene-responsive transcription factor RAP2-4 [Medicago truncatula]
 gb|AES97980.1| AP2 domain class transcription factor [Medicago truncatula]
 gb|AEX93412.1| putative AP2/EREBP transcription factor [Medicago truncatula]
Length=371

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 132/219 (60%), Gaps = 45/219 (21%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  153  LGPKPIPMKQPGVPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  212

Query  538  dkaAYKLRGENARLNFPHFLSHDHG--VEGFKPLHSSVVAKLEAICQSLTHNN--DNSKS  371
            D+AAY+LRG+ ARLNFP+      G     FK LHSS+ AKL+AIC+SL +NN  DN K+
Sbjct  213  DRAAYRLRGDFARLNFPNMKDQQQGGMFGEFKVLHSSIDAKLDAICESLGNNNSSDNVKN  272

Query  370  HEQQRNSEEPCFGSGAA---------------------------ENAVNVKTESSGVGAA  272
             +Q + S++       A                           E   ++ + S G    
Sbjct  273  KKQGKGSKKSLKKEVEAQPQPQPLVVVENNNDDNNNTNTNKVVVECGSSLSSHSEGGSDD  332

Query  271  SSPESEITFLE-----WEN----IILDKYPSAEIDWAAL  182
            SSP S++TF E     WEN      L K+PS EIDWA+L
Sbjct  333  SSPLSDLTFGEFAEPQWENGFEQFNLQKFPSYEIDWASL  371



>gb|AIM47746.1| DREBb [Suaeda salsa]
Length=364

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 134/228 (59%), Gaps = 40/228 (18%)
 Frame = -2

Query  745  PVFTLFQNQQKSPPLGTKPVPMK-----QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLW  581
            P    +Q+   +  L  KPVPMK     QKP KLYRGVRQRHWGKWVAEIRLPKNRTRLW
Sbjct  132  PPLPSYQSTNMNTFLSPKPVPMKTTGPPQKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLW  191

Query  580  LGTFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEA  413
            LGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEA
Sbjct  192  LGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHEGSHIGGEFGEYKPLHSSVNAKLEA  251

Query  412  ICQSLTHNNDNSKSHEQQRNSEEPCFGSGAA----------------------ENAVNVK  299
            IC+SL    + +    + ++ +     S  +                       +   VK
Sbjct  252  ICESLAKQGNETTKQGKSKSKKVAASSSTTSSSSSSTVTSSAVVQQQQQQELLHHPAEVK  311

Query  298  TES---SGVGA-ASSPESEITF-----LEWENIILDKYPSAEIDWAAL  182
             ES   S VG+  SSP S++TF     L  E  +L+  PS EIDW A+
Sbjct  312  AESASDSEVGSGGSSPLSDLTFGDGEELGAEQYLLESCPSHEIDWDAI  359



>gb|ADC94857.1| DRE transcription factor 2 [Vitis pseudoreticulata]
Length=248

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 130/225 (58%), Gaps = 59/225 (26%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG K +PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  32   LGPKAIPMKQVGTPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  91

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAA+KLRGE ARLNFP+       V G    +KPLHSSV AKL+AICQ+L  +      
Sbjct  92   DKAAFKLRGEFARLNFPNLRHQGSLVAGEFGDYKPLHSSVDAKLQAICQNLAIS------  145

Query  370  HEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPES----------------------  257
             ++Q NS +P   S A   +   + E   +  +S PES                      
Sbjct  146  -QKQGNSGKPGLVSDAKIESSTHQAEMV-LDNSSDPESGFLGLEDCKVEISSSSSSPSPS  203

Query  256  ------------EITFLEW--------ENIILDKYPSAEIDWAAL  182
                        +I+FL++        E + L+K+PS EIDWA++
Sbjct  204  DESSAGSSSPESDISFLDFTDSQWNDSECLTLEKFPSVEIDWASI  248



>ref|XP_002890498.1| hypothetical protein ARALYDRAFT_472454 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66757.1| hypothetical protein ARALYDRAFT_472454 [Arabidopsis lyrata subsp. 
lyrata]
Length=261

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 127/199 (64%), Gaps = 32/199 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPV MKQ      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A
Sbjct  62   LSPKPVSMKQTGSSAPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALA  121

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLT-----HNNDNS  377
            +DKAAYKLRG+ ARLNFP+     H  E ++PL SSV AKLEAICQ+L            
Sbjct  122  YDKAAYKLRGDFARLNFPNL---RHNGE-YQPLQSSVDAKLEAICQNLAEMTQKQGKSTK  177

Query  376  KSHEQQRNSE------EPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE--------  239
            KS  ++R+S       E  + S  +   +   TES G G +SSP S++TF +        
Sbjct  178  KSSFRKRSSTAAAKQPEEDYSSAGSSPPL---TESYGSGGSSSPLSDLTFCDTEEEIQPP  234

Query  238  WENIILDKYPSAEIDWAAL  182
            W    L+KYPS EIDW ++
Sbjct  235  WNEFALEKYPSYEIDWDSI  253



>gb|AEA76436.1| DRE binding transcription factor [Atriplex halimus]
Length=244

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 130/216 (60%), Gaps = 42/216 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPV MK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  24   LCPKPVTMKTSGGPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  83

Query  538  dkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSLTHNND----  383
            DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC+SL    +    
Sbjct  84   DKAAYKLRGDFARLNFPNLRHEGSHIGGEFGEYKPLHSSVNAKLEAICESLAKQGNEKQG  143

Query  382  -NSKSHEQQRNSEEPCFGSGAA-------------------ENAVNVKTES---SGVGA-  275
             N KS ++   +      S                      E   +VKTES   S VG+ 
Sbjct  144  KNGKSKKKDAANTSSSSSSSCCTTATAAADAPPQQQQPRMPETGGDVKTESTSDSEVGSG  203

Query  274  ASSPESEITF-----LEWENIILDKYPSAEIDWAAL  182
             SSP S++TF     +  EN +L+  PS EIDW A+
Sbjct  204  GSSPLSDLTFGDNEEMGSENFLLESCPSHEIDWDAI  239



>gb|AFH96116.1| DREB [Salicornia bigelovii]
Length=284

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 124/206 (60%), Gaps = 39/206 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            L  K   MKQ KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF TAEEAA+A+DKAA
Sbjct  86   LSPKLAVMKQNKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFQTAEEAALAYDKAA  145

Query  526  YKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            YKLRG  ARLNFPH   +   V      +KPLHSSV AKLEAICQSL          ++Q
Sbjct  146  YKLRGHFARLNFPHMKHNGSHVTTQFGLYKPLHSSVDAKLEAICQSL-------DIPQEQ  198

Query  358  RNSEEPCFGSGAAENA------VNVKTESSGV-------------GAASSPESEITFLEW  236
              +E PCF S    ++      V+  TE   +              A+ SPES +  L++
Sbjct  199  GKTEYPCFSSVCDSDSYPVLDTVSPTTEEVLIRKPKVPTVADDSPTASCSPESGLKLLDF  258

Query  235  ------ENII--LDKYPSAEIDWAAL  182
                  E+ I  LDK PS EIDW +L
Sbjct  259  TKSCWNESDISSLDKLPSLEIDWDSL  284



>gb|AEX88462.1| ethylene-responsive element binding factor 3 [Arachis hypogaea]
Length=297

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 120/203 (59%), Gaps = 41/203 (20%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  K VPMK       K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A
Sbjct  107  LSPKGVPMKHVATTPTKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALA  166

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSK  374
            +D AAYKLRGE ARLNFPH   H   V G    +KPL SSV AKL+AIC  L  +     
Sbjct  167  YDNAAYKLRGEFARLNFPHLKHHGTRVFGEFGDYKPLPSSVDAKLQAICDKLALS-----  221

Query  373  SHEQQRNSEEPCFGSGAAEN---------AVNVKTESSGVGAASSPESEITFL-------  242
                    +EPC      E             V+++ S  G +SSPES  T L       
Sbjct  222  ------QKQEPCPSLVKVEQDQVLYPELEDFKVESDESCAG-SSSPESAATTLFDFSDCC  274

Query  241  EWENII---LDKYPSAEIDWAAL  182
            +WE  +   L+K+PS EIDWAA+
Sbjct  275  KWEEPVSFGLEKFPSVEIDWAAI  297



>gb|AIZ74389.1| DREB3 [Sophora moorcroftiana]
Length=347

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 126/206 (61%), Gaps = 32/206 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPVPMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  142  LSPKPVPMKHMGVPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  201

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRG+ ARLNFP+       V G    +KPLHSSV AKL+A+C+SL       K 
Sbjct  202  DKAAYKLRGDVARLNFPNLKHQGSCVGGAFGEYKPLHSSVYAKLDALCESLGDLQKPGKP  261

Query  370  HEQQ-RNSEEPCFGSGA------AENAVNVKTESS-------GVGAASSPESEITFLE--  239
             ++  R S+    GS          N  N K E+S         G+A S  S++TF +  
Sbjct  262  EKKPVRPSKRSKLGSSKEAQPQLENNNNNCKVEASLSPVMTDSDGSAGSSLSDLTFDDVT  321

Query  238  ---W----ENIILDKYPSAEIDWAAL  182
               W    E+  L K+PS EIDW +L
Sbjct  322  EPQWEPASEHFNLQKFPSYEIDWDSL  347



>ref|XP_007141161.1| hypothetical protein PHAVU_008G172200g [Phaseolus vulgaris]
 gb|ESW13155.1| hypothetical protein PHAVU_008G172200g [Phaseolus vulgaris]
Length=327

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 125/207 (60%), Gaps = 36/207 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  124  LGPKPVAMKQVGGAPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  183

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            DKAAY+LRG+ ARLNFP+      G   +KPL S+V AKL+AICQSL       K+ +  
Sbjct  184  DKAAYRLRGDFARLNFPNLKGSLLG--EYKPLQSAVDAKLDAICQSLAEMPKQGKTEKGA  241

Query  358  RNS---------------EEP-----CFGSGAAENAVNVKTESSGVGAASSPESEITFL-  242
            R+S               ++P     C      E    +  ES G    SSP S++TF  
Sbjct  242  RSSSKKSKAAPKEARNPNQDPNPNLCCKAEPEPEAEPALSPESEG-SVDSSPLSDLTFDV  300

Query  241  ---EWEN----IILDKYPSAEIDWAAL  182
               +WE+      L K+PS EIDW +L
Sbjct  301  SEPQWEDASAHFNLQKFPSYEIDWDSL  327



>gb|KHN44333.1| Ethylene-responsive transcription factor RAP2-4 [Glycine soja]
Length=318

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 126/201 (63%), Gaps = 27/201 (13%)
 Frame = -2

Query  703  LGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            L  KP+ MK         K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA
Sbjct  115  LSPKPITMKHVRASCSNSKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAA  174

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDN  380
            +A+D AA+KLRGENARLNFPH   H   V G    +KPL S+V AKL+AICQSL      
Sbjct  175  LAYDNAAFKLRGENARLNFPHLRHHGARVYGEFGNYKPLPSAVDAKLQAICQSLGTKLQK  234

Query  379  SKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV------GAASSPESEITFLEWEN----  230
             K+ +      +    S   +  +  +T SS         ++SSPES+ITFL++ +    
Sbjct  235  LKTDQNPVVDAKVKKTSKFEDFKIENRTSSSSALSDEYSSSSSSPESDITFLDFSDSCET  294

Query  229  -----IILDKYPSAEIDWAAL  182
                 + L+KYPS EIDWAAL
Sbjct  295  TCNLGLDLEKYPSVEIDWAAL  315



>gb|AFU07642.1| ethylene-responsive element binding factor 5 [Arachis hypogaea]
Length=335

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 129/197 (65%), Gaps = 25/197 (13%)
 Frame = -2

Query  703  LGTKPVPMKQ---KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdk  533
            L  KP+PMKQ   KP KLYRGVRQR WGKWV+EIRLPKNRTRLWLGTF+TAEEAA+A+DK
Sbjct  141  LSPKPIPMKQGPPKPTKLYRGVRQRQWGKWVSEIRLPKNRTRLWLGTFETAEEAALAYDK  200

Query  532  aAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNNDNSKSH  368
            AA+KLRG+ A+LNFP+   H   + G     ++PLHS+V AKL+AIC++L+      K  
Sbjct  201  AAFKLRGDFAKLNFPNLKHHGSCILGGGFGEYRPLHSAVDAKLDAICENLSQIRKQGKQG  260

Query  367  EQ--QRNSEEPCFGS----GAAENAVNVKTESSGVGAASSPESEITF-----LEW----E  233
            ++   R   +P   +    G  +   NV++E +  G  SSP S++TF      +W    E
Sbjct  261  KKPVMRLKSKPKATTPNVEGDDDGCFNVESEEASAG--SSPLSDLTFDDVSESQWDAPSE  318

Query  232  NIILDKYPSAEIDWAAL  182
            +  L K+PS EI+W +L
Sbjct  319  HFYLQKFPSYEINWDSL  335



>gb|AFO38387.1| putative ethylene-responsive transcription factor ERF060-like 
[Glycine max]
Length=290

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 126/201 (63%), Gaps = 27/201 (13%)
 Frame = -2

Query  703  LGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            L  KP+ MK         K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA
Sbjct  87   LSPKPITMKHVRASCSNSKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAA  146

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDN  380
            +A+D AA+KLRGENARLNFPH   H   V G    +KPL S+V AKL+AICQSL      
Sbjct  147  LAYDNAAFKLRGENARLNFPHLRHHGARVYGEFGNYKPLPSAVDAKLQAICQSLGTKLQK  206

Query  379  SKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV------GAASSPESEITFLEWEN----  230
             K+ +      +    S   +  +  +T SS         ++SSPES+ITFL++ +    
Sbjct  207  LKTDQNPVVDAKVKKTSEFEDFKIENQTSSSSALSDEYSSSSSSPESDITFLDFSDSCET  266

Query  229  -----IILDKYPSAEIDWAAL  182
                 + L+KYPS EIDWAAL
Sbjct  267  TCNLGLDLEKYPSVEIDWAAL  287



>gb|ABR53728.1| DRE-binding protein DREB1 [Cymbidium insigne]
Length=309

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 121/190 (64%), Gaps = 26/190 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PL  +  PMK       KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAM
Sbjct  129  PLAPRTQPMKLFSEAAAKPPKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAM  188

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHE  365
            A+DKAA++LRGE ARLNFPH    + G +     HSSV AKLEAIC+SL      S   +
Sbjct  189  AYDKAAFRLRGEFARLNFPHLRYSNAGSDP----HSSVDAKLEAICESLA-----SSQKQ  239

Query  364  QQRNSEEPCFGSGA-AENAVNVKTESSGVGAASSPESEITFLEW--------ENIILDKY  212
            +  +S  P    G  +E  V+ + E S  G  SSP SE+  L++        E  +L KY
Sbjct  240  ESASSLTPSIAVGVKSEPEVSSEAEISSEG--SSPVSEMESLDFTEVPWDESEQFVLRKY  297

Query  211  PSAEIDWAAL  182
            PS EIDW ++
Sbjct  298  PSWEIDWDSV  307



>ref|XP_002887717.1| hypothetical protein ARALYDRAFT_476975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63976.1| hypothetical protein ARALYDRAFT_476975 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 129/218 (59%), Gaps = 44/218 (20%)
 Frame = -2

Query  703  LGTKPVPMKQ----------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            L  KP+ MKQ                KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  124  LSPKPLLMKQSGVAGSCFAYGSGVPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  183

Query  571  FDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQ  404
            FDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC+
Sbjct  184  FDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICK  243

Query  403  SL--THNNDNSKSHEQQRNS---EEPCFGSGAAENAVNVKTESSGVG------------A  275
            S+  T   D      ++R+S   E+       +E  V  + +S                A
Sbjct  244  SMAETQKQDKPTKASKKRSSSVTEKKVSSPDLSEKEVKAEEKSVSTAGSPPVTEFEESTA  303

Query  274  ASSPESEITFLE------W-ENIILDKYPSAEIDWAAL  182
             SSP S++TF +      W E   L+K+PS EIDW ++
Sbjct  304  GSSPLSDLTFADPEEPPQWNETFSLEKFPSYEIDWDSI  341



>ref|XP_004500614.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cicer arietinum]
Length=325

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 123/208 (59%), Gaps = 34/208 (16%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG K +PMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  118  LGAKAIPMKHVGNSSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  177

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNNDNSK  374
            DKAA+KLRG+ ARLNFP+       V G     +KPL SSV AKL+AIC+ L       K
Sbjct  178  DKAAFKLRGDFARLNFPNLKHTGSCVVGGEFGEYKPLPSSVDAKLQAICEDLAQIQKQGK  237

Query  373  SHEQQRNSEEPCFGSGAA-------ENAVNV--------KTESSGVGAASSPESEITFLE  239
            S +  +        S          E++V++        K E S     SSP S++TF +
Sbjct  238  SEKPTKKKTPSKLASKPVSTVTIPLEDSVDLKNVSDNCCKVEVSFSSEGSSPLSDLTFGD  297

Query  238  -----WE----NIILDKYPSAEIDWAAL  182
                 WE    N  L KYPS EIDW +L
Sbjct  298  VGEPQWEGDSDNFNLLKYPSYEIDWDSL  325



>ref|XP_003638785.1| Ethylene-responsive transcription factor RAP2-4 [Medicago truncatula]
 gb|AEX93413.1| putative AP2/EREBP transcription factor [Medicago truncatula]
 gb|KEH34901.1| ethylene response factor [Medicago truncatula]
Length=340

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 128/219 (58%), Gaps = 51/219 (23%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            L  K +PMK        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+
Sbjct  128  LSPKSIPMKHVGGSSVSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAL  187

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLEAICQSLTHNNDN  380
            A+DKAAYKLRG+ ARLNFP+ L H   + G     FKPL SSV AKL+AIC+ L      
Sbjct  188  AYDKAAYKLRGDFARLNFPN-LKHQGSIIGGEFGEFKPLPSSVDAKLQAICEGLAEMQKQ  246

Query  379  SKSH-----------------------EQQRNSE-EPCFGSGAAENAVNVKTESSGVGAA  272
             K+                        + +++SE E C        AV+V TES G    
Sbjct  247  GKAEKPKKMPASKAKASSKVVSKESVDDLKKDSEPEEC----CKVEAVSVITESEG-SEG  301

Query  271  SSPESEITFLE-----W----ENIILDKYPSAEIDWAAL  182
            SSP S++TF +     W    EN  L KYPS EIDW +L
Sbjct  302  SSPLSDLTFGDVGEPQWEGDSENFNLLKYPSYEIDWDSL  340



>ref|XP_006360275.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum tuberosum]
Length=339

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 95/128 (74%), Gaps = 11/128 (9%)
 Frame = -2

Query  745  PVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLW  581
            P  T   N Q    LG KPV MKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLW
Sbjct  121  PAVTFQNNNQYVSYLGPKPVSMKQSGSPPKPPKLYRGVRQRHWGKWVAEIRLPKNRTRLW  180

Query  580  LGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG-----FKPLHSSVVAKLE  416
            LGTFDTAEEAA+A+DKAAYKLRGE ARLNFPH L H+  + G     +KPLHSSV AKL+
Sbjct  181  LGTFDTAEEAALAYDKAAYKLRGEFARLNFPH-LRHNGSLIGSEFGEYKPLHSSVDAKLQ  239

Query  415  AICQSLTH  392
            AICQ L  
Sbjct  240  AICQDLAQ  247



>ref|NP_173638.1| ethylene-responsive transcription factor RAP2.4 [Arabidopsis 
thaliana]
 sp|Q9LM15.1|RA213_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-13; 
AltName: Full=Ethylene-responsive transcription factor ERF058; 
AltName: Full=Protein RELATED TO APETALA2 13 [Arabidopsis 
thaliana]
 gb|AAF87854.1|AC073942_8 Contains similarity to a cadmium-imduced protein AS30 from Arabidopsis 
thaliana gi|1168862 and contains an AP2 PF|00847 domain. 
EST gb|AI099641 comes from this gene [Arabidopsis thaliana]
 gb|AAN41307.1| putative AP2 domain containing protein RAP2 [Arabidopsis thaliana]
 gb|AEE30209.1| ethylene-responsive transcription factor ERF058 [Arabidopsis 
thaliana]
Length=261

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 125/200 (63%), Gaps = 34/200 (17%)
 Frame = -2

Query  703  LGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
            L  KPV MKQ      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A
Sbjct  62   LSPKPVSMKQTGTSAAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALA  121

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            +DKAAYKLRG+ ARLNFP    +D     ++PL SSV AKLEAICQ+L           +
Sbjct  122  YDKAAYKLRGDFARLNFPDLRHNDE----YQPLQSSVDAKLEAICQNLAETTQKQVRSTK  177

Query  361  QRNS------------EEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE-------  239
            + +S            EE    +G++     + TES G G +SSP SE+TF +       
Sbjct  178  KSSSRKRSSTVAVKLPEEDYSSAGSSP----LLTESYGSGGSSSPLSELTFGDTEEEIQP  233

Query  238  -WENIILDKYPSAEIDWAAL  182
             W    L+KYPS EIDW ++
Sbjct  234  PWNENALEKYPSYEIDWDSI  253



>ref|XP_010061815.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Eucalyptus grandis]
 gb|KCW68840.1| hypothetical protein EUGRSUZ_F02440 [Eucalyptus grandis]
Length=335

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 153/287 (53%), Gaps = 60/287 (21%)
 Frame = -2

Query  904  AFSDGFAS----VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVF  737
            +FSDG ++    +GFE  GPIGLN L+PS I +IQ QI+ Q                   
Sbjct  63   SFSDGCSTSPDPLGFELPGPIGLNHLTPSQINQIQAQIQFQSTNLPSYHG----------  112

Query  736  TLFQNQQKSPPLGTKPVPMK-----QKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLG  575
                    S  LG KPV MK      KP  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLG
Sbjct  113  ---HGYHPSMLLGPKPVSMKISGSAGKPATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLG  169

Query  574  TFDTaeeaamahdkaAYKLRGENARLNFPHF---LSHDHGVEGFKPLHSSVVAKLEAICQ  404
            TFDTAEEAA+A+D+AAYKLRG+ ARLNFPH     + D G     PLHSSV AKLEAICQ
Sbjct  170  TFDTAEEAALAYDRAAYKLRGDFARLNFPHLKHCAASDVGDGRVSPLHSSVDAKLEAICQ  229

Query  403  SLTHNN-DNSK--------------------SHEQQRNSEEPCFGSGAAENAVNVKTESS  287
            ++     D +K                    +    R    P   S   E      +E  
Sbjct  230  TIAEKKADGAKKPPASGRSRAAAAAAAAAAAAAAAAREVSSPEEASEVTEVTEVKGSEPE  289

Query  286  GVGAA-SSPESEITFLE-----WENI------ILDKYPSAEIDWAAL  182
              G+A SSP S++TF +     WE +       L KYPS EIDW A+
Sbjct  290  SEGSAGSSPLSDLTFDDFAEASWECVSLPEASTLMKYPS-EIDWDAI  335



>gb|ACU17684.1| unknown [Glycine max]
Length=318

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 126/201 (63%), Gaps = 27/201 (13%)
 Frame = -2

Query  703  LGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            L  KP+ M+         K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA
Sbjct  115  LSPKPITMEHVRASCSNSKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAA  174

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDN  380
            +A+D AA+KLRGENARLNFPH   H   V G    +KPL S+V AKL+AICQSL      
Sbjct  175  LAYDNAAFKLRGENARLNFPHLRHHGARVYGEFGNYKPLPSAVDAKLQAICQSLGTKLQK  234

Query  379  SKSHEQQRNSEEPCFGSGAAENAVNVKTESSGV------GAASSPESEITFLEWEN----  230
             K+ +      +    S   +  +  +T SS         ++SSPES+ITFL++ +    
Sbjct  235  LKTDQNPVVDAKVKKTSEFEDFKIENQTSSSSALSDEYSSSSSSPESDITFLDFSDSCET  294

Query  229  -----IILDKYPSAEIDWAAL  182
                 + L+KYPS EIDWAAL
Sbjct  295  TCNLGLDLEKYPSVEIDWAAL  315



>ref|XP_010937498.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-13 [Elaeis guineensis]
Length=355

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 149/263 (57%), Gaps = 37/263 (14%)
 Frame = -2

Query  898  SDGFASVGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQ  719
            S GF + G    GPIGLN L+P  I +IQ QI+LQ QQ   A             L Q +
Sbjct  104  SSGFLAAG--SPGPIGLNHLTPVQIQQIQAQIQLQQQQNLLAARQ----------LSQGR  151

Query  718  QKSPPLGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTa  560
                 LG +  PMK        +P KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA
Sbjct  152  AAPSFLGPRAQPMKHAGSPPPPRPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA  211

Query  559  eeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHN---  389
            EEAA A+DKAA++LRG+ ARLNFPH L  +       PLHSSV AKL+AICQ+L ++   
Sbjct  212  EEAAFAYDKAAFRLRGDFARLNFPH-LRDEIARAADGPLHSSVDAKLQAICQTLANSPKQ  270

Query  388  ------NDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEW---  236
                   D +    ++ N+     GS     + +         + SSP SE+  L++   
Sbjct  271  GALQPIPDAAADAGRRPNAATSVLGSEDFNKSESSSEGGDDCSSGSSPASEMQHLDFTEV  330

Query  235  -----ENIILDKYPSAEIDWAAL  182
                 E+ +L KYPS EIDW ++
Sbjct  331  PWDESESFVLRKYPSWEIDWDSI  353



>ref|XP_010535636.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Tarenaya 
hassleriana]
Length=349

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 126/198 (64%), Gaps = 36/198 (18%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  152  KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  211

Query  493  FPHFLSHD------HGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRN-------  353
            FP+ L H+       G+  ++PLHSSV AKL+AICQSL  N  + +  ++ R        
Sbjct  212  FPN-LRHNGSFVGGDGLGEYQPLHSSVDAKLDAICQSLAENQKHGQPEKKSRKKSASSAT  270

Query  352  ---SEEPCFGSGAAENAVNVKTES-----------SGVGAASSPESEITFLEWE------  233
               +++P   +   +    VK E+               A SSP S++TF++ E      
Sbjct  271  PELTKQPEL-TACPDLPEEVKMEAIAFAGSSPAAEGDASAGSSPLSDLTFVDCEDQAPWN  329

Query  232  -NIILDKYPSAEIDWAAL  182
             N  L+KYPS EIDWA++
Sbjct  330  TNFALEKYPSYEIDWASI  347



>ref|XP_009389564.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Musa acuminata subsp. malaccensis]
Length=314

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 123/196 (63%), Gaps = 29/196 (15%)
 Frame = -2

Query  703  LGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            LG +P  MK+        KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA
Sbjct  121  LGPRPQSMKRSGCSASPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAA  180

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSH  368
            MA+D+AA+KLRG+ ARLNFP      +G     PLHSSV AKL+AIC+S+  +    K+ 
Sbjct  181  MAYDRAAFKLRGDAARLNFPEL--RRNGAHFGAPLHSSVDAKLQAICESMVSSQKQGKTR  238

Query  367  EQQRNSEEPCFGSGAAENAVNVKTESSG------VGAASSPESEITFLEW--------EN  230
                 + E    SG+ +N    K+ESS         + ++  S+I +L++        E+
Sbjct  239  PNVAAANE-IISSGSEDN----KSESSSSLEGDETSSGTTAASQIQYLDFTEAPWDESES  293

Query  229  IILDKYPSAEIDWAAL  182
              L KYPS EIDW ++
Sbjct  294  FKLHKYPSWEIDWDSI  309



>ref|XP_004504059.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Cicer arietinum]
Length=313

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 123/214 (57%), Gaps = 45/214 (21%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KPVPMK      KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA A+
Sbjct  105  LAQKPVPMKHFGNPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAFAY  164

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQ  359
            D AAYKLRGE ARLNFP ++ H+     + PL SSV +KL+AIC+SL  +     S E  
Sbjct  165  DNAAYKLRGEFARLNFP-YMRHNG---NYNPLPSSVDSKLQAICESLAISQKQG-SQEML  219

Query  358  RNSEEPCFGSGAAENAV---------------------NVKTESSGVG-----AASSPES  257
             +S E         N +                     + K E + +        SSPES
Sbjct  220  CSSVEEVKPRFCVPNMIELESDVAQSKGEFEFVCSEFEDFKVEKTVLSDECSPGLSSPES  279

Query  256  EITFLEW---------ENIILDKYPSAEIDWAAL  182
             +TFL++         EN  L+KYPS EIDW A+
Sbjct  280  GVTFLDFSDSSQWDEVENFGLEKYPSVEIDWEAI  313



>gb|ABJ09421.1| putative DRE-binding protein DREB1 [Aloe vera]
Length=211

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 114/175 (65%), Gaps = 14/175 (8%)
 Frame = -2

Query  664  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPH  485
            KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH
Sbjct  35   KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDYARLNFPH  94

Query  484  FLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPC------FGSGA  323
                   +    PLHSSV AKL+AICQSL  N  ++ +  ++    +             
Sbjct  95   LKHTGAHLAPGGPLHSSVDAKLQAICQSLEQNKSSNSNSSKKEKRGDAVEEKSDKVVVVV  154

Query  322  AENAVNVKTESSGVGAASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
            AE   +  + S   G+ASSP SEI  L++        E+ +L KYPS EIDW A+
Sbjct  155  AEGEESCSSSSMNTGSASSPSSEIESLDFTEVPWDESEDFVLRKYPSWEIDWDAI  209



>ref|XP_006302477.1| hypothetical protein CARUB_v10020567mg [Capsella rubella]
 gb|EOA35375.1| hypothetical protein CARUB_v10020567mg [Capsella rubella]
Length=350

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 126/220 (57%), Gaps = 46/220 (21%)
 Frame = -2

Query  703  LGTKPVPMKQ----------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            L  KP+ MKQ                KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  129  LSPKPLLMKQSGVAGSCFAYGSGVPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  188

Query  571  FDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQ  404
            FDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC+
Sbjct  189  FDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICK  248

Query  403  SLTHNNDNSKSHEQQRNS---------EEPCFGSGAAENAVNVKTESSGVG---------  278
            S+       K  +   +S         E+       +E  V  +  S  +G         
Sbjct  249  SMAETQKQDKQTKSSSSSKKRGSSVKPEKVVSSPDPSEEKVKAEENSVSIGGSPTLEEST  308

Query  277  AASSPESEITFLEWE--------NIILDKYPSAEIDWAAL  182
            A SSP S++TF + E           L+KYPS EIDW ++
Sbjct  309  AGSSPLSDLTFADPEEPSQWAETTFSLEKYPSYEIDWDSI  348



>gb|AFK73558.1| AP2 transcription factor [Papaver somniferum]
Length=277

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 127/240 (53%), Gaps = 64/240 (27%)
 Frame = -2

Query  715  KSPPLGTKPVPMKQKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahd  536
            KS P+    +P   KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAMA+D
Sbjct  34   KSIPMKAMGLPTTAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYD  93

Query  535  kaAYKLRGENARLNFPHFLSHD--------HGVEGFKPLHSSVVAKLEAICQSLTHNN--  386
            KAAYKLRG+ ARLNFPH L H          G +  KP  S+V AKLEAICQSL  NN  
Sbjct  94   KAAYKLRGDFARLNFPH-LKHQLSSAGAGKFGDQQNKPT-STVDAKLEAICQSLAINNSA  151

Query  385  -----------------------------DNSKSHEQQRNSEEPCFGSGAAENAVNVK--  299
                                         D+S+S   + +S   C       +   VK  
Sbjct  152  SQKQGKISKPARVSSKKTKKIMVTEAAAVDSSQSVVTEMDSSSNCEMGSLFTDVYKVKNE  211

Query  298  ---------TESSGVGAASSPESEI---TFLE--WE-------NIILDKYPSAEIDWAAL  182
                     +ESS  G  SSPES +    F E  W        N +L KYPS EIDW A+
Sbjct  212  TLSPPPLMVSESSSDGNCSSPESGVEVPDFAEQAWNDDLSSSANFMLRKYPSYEIDWDAV  271



>gb|ADM47480.1| DREB2 [Eucalyptus globulus]
Length=337

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 130/289 (45%), Positives = 153/289 (53%), Gaps = 62/289 (21%)
 Frame = -2

Query  904  AFSDGFAS----VGFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVF  737
            +FSDG ++    +GFE  GPIGLN L+PS I +IQ QI+ Q                   
Sbjct  63   SFSDGCSTSPDPLGFELPGPIGLNHLTPSQINQIQAQIQFQTTNLPSYHG----------  112

Query  736  TLFQNQQKSPPLGTKPVPMK-----QKPG-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLG  575
                    S  LG KPV MK      KP  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLG
Sbjct  113  ---HGYHPSMLLGPKPVSMKISGSAGKPATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLG  169

Query  574  TFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEGFKPLHSSVVAKLEAICQ  404
            TFDTAEEAA+A+D+AAYKLRG+ ARLNFP   H  + D G     PLHSSV AKLEAICQ
Sbjct  170  TFDTAEEAALAYDRAAYKLRGDFARLNFPNLKHCAASDVGDGRVSPLHSSVDAKLEAICQ  229

Query  403  SLTHNN-DNSK----------------------SHEQQRNSEEPCFGSGAAENAVNVKTE  293
            ++     D +K                      +    R    P   S   E      +E
Sbjct  230  TIAEKKADGAKKPPASGRSRAAAAAAAAAAAAAAAAAAREVSSPEEASEVTEVTEVKGSE  289

Query  292  SSGVGAA-SSPESEITFLE-----WENI------ILDKYPSAEIDWAAL  182
                G+A SSP S++TF +     WE +       L KYPS EIDW A+
Sbjct  290  PESEGSAESSPLSDLTFDDFAEATWECVSLPEASTLMKYPS-EIDWDAI  337



>gb|ACM17914.1| dehydration-responsive element binding protein [Aloe vera var. 
chinensis]
Length=211

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 113/175 (65%), Gaps = 14/175 (8%)
 Frame = -2

Query  664  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPH  485
            KLYRGVRQRHWGKWV EIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLNFPH
Sbjct  35   KLYRGVRQRHWGKWVVEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDYARLNFPH  94

Query  484  FLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPC------FGSGA  323
                   +    PLHSSV AKL+AICQSL  N  ++ +  ++    +             
Sbjct  95   LKHTSAHLAPGGPLHSSVDAKLQAICQSLEQNKSSNSNSSKKEKRGDAVEEKSDKVVVVV  154

Query  322  AENAVNVKTESSGVGAASSPESEITFLEW--------ENIILDKYPSAEIDWAAL  182
            AE   +  + S   G+ASSP SEI  L++        E+ +L KYPS EIDW A+
Sbjct  155  AEGEESCSSSSMNTGSASSPSSEIESLDFTEVPWDESEDFVLRKYPSWEIDWDAI  209



>gb|KHN31362.1| Ethylene-responsive transcription factor ERF060 [Glycine soja]
Length=256

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 117/184 (64%), Gaps = 22/184 (12%)
 Frame = -2

Query  667  GKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFP  488
             +LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D AA+KLRGENARLNFP
Sbjct  70   AQLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDNAAFKLRGENARLNFP  129

Query  487  HFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHE----QQRNSEEPCFG  332
            H   H     G    +KPL S+V AKL+AICQSL  N+   K+          +E     
Sbjct  130  HLRHHGARAYGEFGNYKPLPSAVDAKLQAICQSLGTNSQKLKTQNPIVLDTHKAETETSE  189

Query  331  SGAAENAVNVKTESSGV-----GAASSPESEITFLEWEN---------IILDKYPSAEID  194
                    N +T SS        ++SSPES+IT L++ +         + L+KYPS EID
Sbjct  190  FQDFNKVENYQTSSSSAFSDEYSSSSSPESDITLLDFSDSCETMDNLGLDLEKYPSVEID  249

Query  193  WAAL  182
            WAAL
Sbjct  250  WAAL  253



>ref|XP_008803760.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Phoenix dactylifera]
Length=339

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 122/202 (60%), Gaps = 22/202 (11%)
 Frame = -2

Query  727  QNQQKSPPLGTKPVPMKQ--------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  572
            Q QQ+   LGT+P  MK+        KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT
Sbjct  135  QLQQQRSLLGTRPQLMKRTGSPLPPSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT  194

Query  571  FDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTH  392
            FDTA+EAA+A+D+AAYKLRG+ ARLNFP       G     PLHSSV AKL++ICQSL  
Sbjct  195  FDTAKEAALAYDRAAYKLRGDAARLNFPELRC--SGAHLSVPLHSSVDAKLQSICQSLAS  252

Query  391  NNDNSKS-------HEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE--  239
            +              E    SE  C G+   ++  +   ESS    A S    + F E  
Sbjct  253  SKKQGNGLSGSVIPEEIGPKSELGCSGTDDNKSESSSSDESSSGSLAVSEMQYLDFTEAP  312

Query  238  W---ENIILDKYPSAEIDWAAL  182
            W   E+ +L KYPS +IDW ++
Sbjct  313  WDESESFMLTKYPSWDIDWESI  334



>dbj|BAI94491.1| AP2/EREBP family transcription factor [Dianthus caryophyllus]
Length=268

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 114/181 (63%), Gaps = 12/181 (7%)
 Frame = -2

Query  706  PLGTKPVPMKQKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            P+  KP     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D AA
Sbjct  89   PVAVKPSGPPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDTAA  148

Query  526  YKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSE  347
            YKLRG+ ARLNF      D     + PLH+SV AKLE IC++L      +K  + ++N+ 
Sbjct  149  YKLRGDFARLNFRRGEFGD-----YNPLHASVDAKLETICENLAKQGSVAKGGKSKKNTV  203

Query  346  EPCFGSGAAENAVNVKTESSGVGAASSPESEITFLEWEN------IILDKYPSAEIDWAA  185
            +          A    +ES     + SP SE+TF + E+      ++L+  PS EIDW A
Sbjct  204  K-KVEEKVVVKASESCSESDLRSGSGSPLSELTFDDVEDEIGRESLMLESVPSHEIDWDA  262

Query  184  L  182
            +
Sbjct  263  I  263



>ref|XP_008808175.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Phoenix dactylifera]
Length=349

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 118/199 (59%), Gaps = 27/199 (14%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            LG +P PMK        +P KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+
Sbjct  151  LGPRPQPMKHAGSPPPPRPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAL  210

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKS--  371
            A+DKAA++LRG+ ARLNFPH         G  PLHS+V AKL+ ICQ L           
Sbjct  211  AYDKAAFRLRGDFARLNFPHLRDETARAAG-GPLHSTVDAKLQVICQGLATPPKPGAPQP  269

Query  370  ---HEQQRNSEEPCFGSGAAENAVNVKTESSG-----VGAASSPESEITFLEW-------  236
                     S  P    G + +  + K+ESS        + SSP S++  L++       
Sbjct  270  PIPDAAATASRRPNVAKGVSASE-DFKSESSSEAGDDCSSGSSPASDMQHLDFTEVPWDE  328

Query  235  -ENIILDKYPSAEIDWAAL  182
             E+ +L KYPS EIDW ++
Sbjct  329  SESFVLRKYPSWEIDWDSI  347



>gb|AID51416.1| ethylene response factor 11 [Diospyros kaki]
Length=310

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 122/193 (63%), Gaps = 17/193 (9%)
 Frame = -2

Query  721  QQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
            QQ+   LG +PV MKQ     KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAE
Sbjct  122  QQQPVALGLRPVTMKQVGCPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  181

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNS  377
            EAA+A+D AAYKLRGE+A+LNFP+F    H  E   PLH++V AKL+  C+SL       
Sbjct  182  EAALAYDTAAYKLRGESAKLNFPNF---RHSGE-HNPLHATVAAKLQDACRSLAEGKSLD  237

Query  376  KSHEQQRNSEEPCFGSGA------AENAVNVKTESSGVGA-ASSPESEITFLEW-ENIIL  221
               +    S+ P   + A       ENA + + E S  G+    P+       W  +++L
Sbjct  238  AKKKPPSWSKLPPEAAPARAVVEGGENANSSECEESSNGSDLGLPDFTDEDPAWNSSLVL  297

Query  220  DKYPSAEIDWAAL  182
             K PS+EIDWA+L
Sbjct  298  QKCPSSEIDWASL  310



>ref|XP_010416775.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Camelina sativa]
 ref|XP_010416777.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Camelina sativa]
Length=350

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 123/215 (57%), Gaps = 41/215 (19%)
 Frame = -2

Query  703  LGTKPVPMKQ-----------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLG  575
            L  KP+ MKQ                 KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLG
Sbjct  133  LSPKPLLMKQSGVAGSCFAYVSGVLPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLG  192

Query  574  TFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAIC  407
            TFDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC
Sbjct  193  TFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAIC  252

Query  406  QSL--THNNDNSKSHEQQRNSEEPCFGSGAAENAVNVKTESSG-----------VGAASS  266
            +S+  +   D   +    +             +   VK+E                A SS
Sbjct  253  KSMAESQKQDKPTTKSSSKKRGSSVKPEKVVSSPEKVKSEEKSPSIAGSPPFEESAAGSS  312

Query  265  PESEITFLE------W-ENIILDKYPSAEIDWAAL  182
            P S++TF +      W E   L+KYPS EIDW ++
Sbjct  313  PLSDLTFADPEEPPQWNETYSLEKYPSYEIDWDSI  347



>ref|XP_010269215.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Nelumbo 
nucifera]
Length=391

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 140/340 (41%), Positives = 171/340 (50%), Gaps = 101/340 (30%)
 Frame = -2

Query  940  FPGSVP-----IP-----SANRAFSDGFAS---VGFEQSGPIGLNGLSPShileiqtqie  800
            FP S+P     IP     S    FS GF+S   +G ++SG IGLN LSPS I +IQ QI+
Sbjct  64   FPSSIPSQPNPIPNFCSTSTTHMFSQGFSSHDQLGLDRSGSIGLNYLSPSQIQQIQAQIQ  123

Query  799  lqhqqQKEalaalssssSPVFTLFQNQQKSPP-------------LGTKPVPMKQKPG--  665
             Q Q    A  A +    PV    QNQ                  L  K +PMKQ  G  
Sbjct  124  FQQQLAAMAAMAAA----PVV---QNQNNPGQWQQKQQQQHTLNFLSPKAIPMKQVAGSV  176

Query  664  ----KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARL  497
                KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRGE ARL
Sbjct  177  PKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARL  236

Query  496  NFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGS  329
            NFP+       V G    +KPL SSV AKL+AICQSL  +       ++Q N  +P F +
Sbjct  237  NFPNLRHQGAHVAGEFGDYKPLQSSVDAKLQAICQSLAIS-------QKQGNLSKPVFLA  289

Query  328  GAAENAVN-----------------VKTESSGVG--------------------------  278
            G  +  ++                 +  E S  G                          
Sbjct  290  GKKKTTMDGQPQADSTVSPAQPLQTLVLEKSSQGESGFLPSENCKVENSSSPSSTDSDES  349

Query  277  AASSPE--------SEITFLEWENIILDKYPSAEIDWAAL  182
            A SSP+        +E  + E EN+ L +YPS +IDW ++
Sbjct  350  AGSSPDPDFKLPDFTEPPWDESENLSLQRYPSWDIDWESI  389



>ref|XP_003531359.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Glycine 
max]
 gb|AAQ57226.1| DREB2 [Glycine max]
Length=312

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 123/224 (55%), Gaps = 62/224 (28%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG K VPMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  101  LGPKRVPMKHAGTAAKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  160

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            D AA+KLRGE ARLNFPH   H   V G    +KPL SSV +KL+AIC+SL         
Sbjct  161  DNAAFKLRGEFARLNFPHLRHHGAFVFGEFGDYKPLPSSVDSKLQAICESLA--------  212

Query  370  HEQQRNSEEPCFGSGAAE---NAVNVKTESSGVGAASS----PESE--------------  254
                +  E+PC      +   +A  +    S V  +++    PE E              
Sbjct  213  ----KQEEKPCCSVEDVKPVIHAAELAEVESDVAKSNAEYVYPEFEDFKVEHENPMFSGE  268

Query  253  -------ITFL-------------EWENIILDKYPSAEIDWAAL  182
                   +TFL             E EN  L+K+PS EIDW A+
Sbjct  269  SSSPESSVTFLDFSDFSDSNNQWDEMENFGLEKFPSVEIDWEAI  312



>ref|NP_201318.1| ethylene-responsive transcription factor ERF057 [Arabidopsis 
thaliana]
 sp|Q9FJQ2.1|ERF57_ARATH RecName: Full=Ethylene-responsive transcription factor ERF057 
[Arabidopsis thaliana]
 dbj|BAB11649.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT44925.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABE66276.1| AP2 domain-containing transcription factor [Arabidopsis thaliana]
 gb|ABF82626.1| At5g65130 [Arabidopsis thaliana]
 gb|AED98006.1| ethylene-responsive transcription factor ERF057 [Arabidopsis 
thaliana]
Length=277

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 143/249 (57%), Gaps = 49/249 (20%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQK----SPPL  701
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ +    S  L
Sbjct  54   QTGPIGLNQLTPTQILQIQTE----------------------LHLRQNQSRRRAGSHLL  91

Query  700  GTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahd  536
              KP  MK+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TA+EAA+A+D
Sbjct  92   TAKPTSMKKIDVATKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAQEAALAYD  151

Query  535  kaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQR  356
            +AA+K+RG+NARLNFP  +   H  +   P   S+ AK+E+IC S   ++      E+Q 
Sbjct  152  QAAHKIRGDNARLNFPDIVRQGHYKQILSP---SINAKIESICNS---SDLPLPQIEKQN  205

Query  355  NSEEPCFGSGAAENAVNVKTESSGVG-AASSPESEITFLEWEN----------IILDKYP  209
             +EE   G    E       E  G G + SSPES+IT L++ +          + L KYP
Sbjct  206  KTEEVLSGFSKPEKEPEF-GEIYGCGYSGSSPESDITLLDFSSDCVKEDESFLMGLHKYP  264

Query  208  SAEIDWAAL  182
            S EIDW A+
Sbjct  265  SLEIDWDAI  273



>gb|ABK28776.1| unknown [Arabidopsis thaliana]
Length=278

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 143/249 (57%), Gaps = 49/249 (20%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQK----SPPL  701
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ +    S  L
Sbjct  54   QTGPIGLNQLTPTQILQIQTE----------------------LHLRQNQSRRRAGSHLL  91

Query  700  GTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahd  536
              KP  MK+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TA+EAA+A+D
Sbjct  92   TAKPTSMKKIDVATKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAQEAALAYD  151

Query  535  kaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQR  356
            +AA+K+RG+NARLNFP  +   H  +   P   S+ AK+E+IC S   ++      E+Q 
Sbjct  152  QAAHKIRGDNARLNFPDIVRQGHYKQILSP---SINAKIESICNS---SDLPLPQIEKQN  205

Query  355  NSEEPCFGSGAAENAVNVKTESSGVG-AASSPESEITFLEWEN----------IILDKYP  209
             +EE   G    E       E  G G + SSPES+IT L++ +          + L KYP
Sbjct  206  KTEEVLSGFSKPEKEPEF-GEIYGCGYSGSSPESDITLLDFSSDCVKEDESFLMGLHKYP  264

Query  208  SAEIDWAAL  182
            S EIDW A+
Sbjct  265  SLEIDWDAI  273



>ref|XP_010676915.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Beta vulgaris subsp. vulgaris]
Length=383

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 133/245 (54%), Gaps = 63/245 (26%)
 Frame = -2

Query  745  PVFTLFQNQQKSPPLGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLW  581
            P    +Q+   +  L  KP+PMKQ     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLW
Sbjct  142  PPLPSYQSTNMNSFLSPKPIPMKQSGTPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLW  201

Query  580  LGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEA  413
            LGTFDTAEEAA+A+DKAAYKLRG+ ARLNFP+       + G    +KPLHSSV AKLEA
Sbjct  202  LGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHEGAHIGGEFGEYKPLHSSVNAKLEA  261

Query  412  ICQSLTHN-----------------------------------------NDNSKSHEQQR  356
            IC+SL                                            ND+    +QQ+
Sbjct  262  ICESLAKQGNEKHQGKSGKSKKTKGVVTVTSSSSSSSCSSSLVAAASSSNDDQPQQQQQQ  321

Query  355  NSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITF-------LEWENIILDKYPSAEI  197
              + P      AE A + +  S G    SSP S++TF       +E  N +L+K PS EI
Sbjct  322  QQQMP--DVVKAECASDSEVGSGG----SSPLSDLTFGDADDLGVENLNYLLEKCPSHEI  375

Query  196  DWAAL  182
            DW AL
Sbjct  376  DWDAL  380



>gb|EYU23219.1| hypothetical protein MIMGU_mgv1a019226mg [Erythranthe guttata]
Length=318

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 118/200 (59%), Gaps = 34/200 (17%)
 Frame = -2

Query  694  KPVPMKQKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLR  515
            +PV +  KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D+AAYKLR
Sbjct  124  RPVYVPPKPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLR  183

Query  514  GENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNND--------------NS  377
            G++ARLNFPH      G E + PLH+SV AKL++IC++L                    +
Sbjct  184  GDSARLNFPHL--RRAGGE-YTPLHASVDAKLQSICRNLAEGKSVDGGAAKKCKKSKKAA  240

Query  376  KSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE--------------  239
             +      +  P     +      V+ ES G G   SPESE+ F +              
Sbjct  241  STAAAAATTAAPTVKEDSKYRQT-VEPESDGSGGL-SPESELRFPDFEFRVSGFAEEELP  298

Query  238  -WENIILDKYPSAEIDWAAL  182
             WE   L KYPS EIDWAAL
Sbjct  299  GWEMGSLPKYPSYEIDWAAL  318



>ref|XP_009387776.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Musa acuminata subsp. malaccensis]
Length=375

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 122/215 (57%), Gaps = 43/215 (20%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            LG +P PMK        KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+
Sbjct  158  LGPRPQPMKHTVSPAVSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAL  217

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNS----  377
            A+DKAAYKLRG+ ARLNFP++        G  PLHS+V AKL+A+CQ+L +++       
Sbjct  218  AYDKAAYKLRGDLARLNFPNYRHAAAAAPG--PLHSTVDAKLQALCQNLANSSKRGGGPP  275

Query  376  KSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPE---------------------  260
            +S   Q N E    GSG     +  +  + G       E                     
Sbjct  276  RSSTLQPNPEPATIGSGDPAPTIVEEAAARGDLVCQGSEDNKSESSSEGEDSSSGSSSAS  335

Query  259  ---------SEITFLEWENIILDKYPSAEIDWAAL  182
                     +E+ + E +N++L KYPS EIDW ++
Sbjct  336  AFEMQRLDFTEMPWDETDNLMLRKYPSWEIDWDSI  370



>gb|AIZ74390.1| DREB4 [Sophora moorcroftiana]
Length=325

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 125/225 (56%), Gaps = 55/225 (24%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  K VPMK      K  KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+
Sbjct  105  LRPKTVPMKHIGTPSKATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  164

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            D AA+KLRGE ARLNFPH       V G    +KPL SSV AKL+AIC+SL    D+S  
Sbjct  165  DNAAFKLRGEFARLNFPHLHHRGDHVYGEFGNYKPLPSSVDAKLKAICESL----DSSTK  220

Query  370  HEQQRNSEEPCFGSGAAENA--VNVKTESSGVGAAS-------------------SP---  263
             +Q   +E+PC      E    VN K ES    + S                   SP   
Sbjct  221  QKQHVKAEKPCSVMVDTETKLKVNAKLESDVAQSDSELFGCHEFEDYKVEINPMLSPLSD  280

Query  262  ----------ESEITFLEWEN--------IILDKYPSAEIDWAAL  182
                      ES+I FL++ +        + L KYPS EIDW A+
Sbjct  281  ESSSADSSSPESDINFLDFSDSNETDYFGLDLGKYPSVEIDWEAI  325



>ref|XP_010428923.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Camelina sativa]
Length=351

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 119/190 (63%), Gaps = 26/190 (14%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  160  KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  219

Query  493  FP---HFLSHDHGVEG-FKPLHSSVVAKLEAICQSL--THNNDNSKSHEQQRNSE-----  347
            FP   H  SH  G  G +KPLHSSV AKLEAIC+S+  T   D S +    +        
Sbjct  220  FPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTTKSSSKKRGSSVKP  279

Query  346  EPCFGSGAAENAVNVKTESSGVG--------AASSPESEITFLE------W-ENIILDKY  212
            E       +E   + +   S  G        A SSP S++TF +      W E   L+KY
Sbjct  280  EKVVSLSPSEKVKSEEKSPSIAGSPPFEESAAGSSPLSDLTFADPEEPPQWNETFSLEKY  339

Query  211  PSAEIDWAAL  182
            PS EIDW ++
Sbjct  340  PSYEIDWDSI  349



>ref|XP_010462245.1| PREDICTED: ethylene-responsive transcription factor ERF057-like 
[Camelina sativa]
Length=289

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 153/250 (61%), Gaps = 44/250 (18%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPLGT-K  692
            Q GPIGLN L+P+ IL+IQT++ L+H                     Q++++S  L T K
Sbjct  59   QPGPIGLNQLTPTQILQIQTELHLRHNH-------------------QSRRRSGHLLTAK  99

Query  691  PVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            P PMK+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TAEEAA+A+D+AA
Sbjct  100  PTPMKKTDVATKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDQAA  159

Query  526  YKLRGENARLNFPHF-LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNS  350
            +K+RG+NARLNFP+  L  D+  +   P   S+ AK+E+IC S + +       ++Q  +
Sbjct  160  HKIRGDNARLNFPNIALQGDYYKQTLSP---SIKAKIESICNS-SSDLLPLPQLKKQTKT  215

Query  349  EEPCFG---SGAAENAVNVKTESSGVG-AASSPESEITFLEWEN----------IILDKY  212
            EE   G   +G     V V  +  G G + SSPES+IT L++ +          I L KY
Sbjct  216  EEVFSGFHYTGPKPEKVPVYGDKFGSGLSGSSPESDITLLDFSSDCMKEDESFLIGLHKY  275

Query  211  PSAEIDWAAL  182
            PS EIDW AL
Sbjct  276  PSLEIDWDAL  285



>ref|NP_001236953.1| dehydration responsive element-binding protein 3 [Glycine max]
 gb|AAZ03388.1| dehydration responsive element-binding protein 3 [Glycine max]
Length=272

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 93/127 (73%), Gaps = 9/127 (7%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG KP+PMK      KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  119  LGPKPIPMKHVGMPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  178

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            DKAAYKLRG+ ARLNFP+       V G    +KPLHS+V AKL+AIC+ L       K+
Sbjct  179  DKAAYKLRGDFARLNFPNLRHQGSSVGGDFGEYKPLHSAVDAKLQAICEGLAELQKQGKT  238

Query  370  HEQQRNS  350
             +  R +
Sbjct  239  EKPPRKT  245



>ref|XP_003525060.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Glycine max]
Length=312

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 127/217 (59%), Gaps = 44/217 (20%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            LG K VPMK      K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+
Sbjct  97   LGPKRVPMKHAGTAAKAAKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  156

Query  538  dkaAYKLRGENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDN---  380
            D AA+KLRGE ARLNFPH   H   V G    ++PL SSV +KL+AIC+SL    +    
Sbjct  157  DNAAFKLRGEFARLNFPHLRHHGAFVFGEFGDYRPLPSSVDSKLQAICESLAKQEEKPCC  216

Query  379  ----------------SKSHEQQRNSE--EPCFGSGAAENAVNVKTESSGVGAASSPESE  254
                             +S   + N+E   P F     EN  N    SS  G +SSPES 
Sbjct  217  SVEDVKPVIHAAELAEVESDVAKLNAEYVYPEFEDFKVENE-NPMLSSSVSGESSSPESG  275

Query  253  ITFL-------------EWENIILDKYPSAEIDWAAL  182
            +TFL             E EN  L+K+PS EIDWAA+
Sbjct  276  VTFLDFSDFSDSNNQWDEMENFGLEKFPSVEIDWAAI  312



>ref|XP_002454259.1| hypothetical protein SORBIDRAFT_04g027660 [Sorghum bicolor]
 gb|EES07235.1| hypothetical protein SORBIDRAFT_04g027660 [Sorghum bicolor]
Length=331

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 118/198 (60%), Gaps = 30/198 (15%)
 Frame = -2

Query  703  LGTKPVPMKQK--------PGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            LG +  PMKQ           KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE+AA
Sbjct  138  LGPRAQPMKQSGSPPLAPAQSKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAA  197

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSH  368
            +A+DKAA++LRG+ ARLNFP        + G  PLH+SV AKL AICQSLT + +   S 
Sbjct  198  LAYDKAAFRLRGDMARLNFPALRRDGAHLAG--PLHASVDAKLTAICQSLTGSKNGGSSG  255

Query  367  EQQRNS--EEP-CFGSGAAENAVNVKTESSGVGAASSPE-------------SEITFLEW  236
            ++   S  + P C  S + E     + ES   G+  SP              +E  + E 
Sbjct  256  DESAGSPPDSPKCSASASTEG----EEESGSAGSPPSPTLAPPVPEMAKLDFTEAPWDET  311

Query  235  ENIILDKYPSAEIDWAAL  182
            E   L KYPS EIDW ++
Sbjct  312  ETFHLRKYPSWEIDWDSI  329



>ref|XP_010472009.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Camelina sativa]
Length=354

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 125/219 (57%), Gaps = 45/219 (21%)
 Frame = -2

Query  703  LGTKPVPMKQ-----------------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLG  575
            L  KP+ MKQ                 KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLG
Sbjct  134  LSPKPLMMKQSGVAGSCFAYGSGVLPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLG  193

Query  574  TFDTaeeaamahdkaAYKLRGENARLNFP---HFLSHDHGVEG-FKPLHSSVVAKLEAIC  407
            TFDTAEEAA+A+DKAAYKLRG+ ARLNFP   H  SH  G  G +KPLHSSV AKLEAIC
Sbjct  194  TFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAIC  253

Query  406  QSL--THNNDNSKSHEQQRNSEEPCFGSGAAE----NAVNVKTESSG-----------VG  278
            +S+  T   D S +    +                 ++  VK+E                
Sbjct  254  KSMAETQKQDKSTTKSSSKKRGSSVKTGKVVSSPDLSSEKVKSEEKSPSIAGSPPFEESA  313

Query  277  AASSPESEITFLE------W-ENIILDKYPSAEIDWAAL  182
            A SSP S++TF +      W E   L+KYPS EIDW ++
Sbjct  314  AGSSPLSDLTFADPEEPPQWNETFSLEKYPSYEIDWDSI  352



>gb|AFK73559.1| AP2 transcription factor [Mentha x piperita]
Length=298

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 124/230 (54%), Gaps = 67/230 (29%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAMA+D+AAYKLRG+ ARLN
Sbjct  68   KPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDRAAYKLRGDFARLN  127

Query  493  FPHFLSHD--------HGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSH----------  368
            FPH L H          G E  KPL SSV AKLEAICQSL  NN  S+            
Sbjct  128  FPH-LKHQLSSAGDGKFGDEQNKPLPSSVDAKLEAICQSLAINNSASQKQGKISKPVRVS  186

Query  367  -------------------------EQQRNSEEPCFGSGAAENAVNVKTES---------  290
                                     E+  +S +   G   + ++   K E+         
Sbjct  187  SKKTKKIMVTEAAAVVDSTPSVVVPEKDSSSSKCEMGFLGSSHSEVYKVENSLSPPLSSS  246

Query  289  --SGVGAASSPESEI---TFLE--W-------ENIILDKYPSAEIDWAAL  182
              + V + SSPES I    F E  W       EN +L KYPS E+DWAA+
Sbjct  247  DDASVLSYSSPESCIEIPDFTEQAWNNDCSSSENFMLQKYPSYEVDWAAI  296



>emb|CDY14542.1| BnaC03g49170D [Brassica napus]
Length=282

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 141/254 (56%), Gaps = 53/254 (21%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKS-------  710
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ +        
Sbjct  50   QTGPIGLNQLTPTQILQIQTE----------------------LHLRQNQARRGCSGHNV  87

Query  709  PPLGTKPVPMKQ----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
              L  KP  MK+    KP KLYRG+RQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA+A
Sbjct  88   NVLNAKPTLMKKTNVTKPAKLYRGIRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALA  147

Query  541  hdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            +D+AA+K+RGENARLNFP+        E  K L  SV AK+E+IC S        K   +
Sbjct  148  YDQAAHKIRGENARLNFPNIARRG---EYKKTLSPSVNAKIESICNSSELPMSELKKPAE  204

Query  361  QRNSEEPCFGSGAAENAVNVKTESS---GVGAASSPESEITFL-----EWEN------II  224
               +EE  FG    +  V  + E+    G G+  SPES+IT L     EW        + 
Sbjct  205  ---TEEVFFGFHYTDPKVEQEREAPDEFGYGSGYSPESDITLLDIISNEWMKEDGSFCMG  261

Query  223  LDKYPSAEIDWAAL  182
            L K PS EIDW A+
Sbjct  262  LQKCPSFEIDWDAI  275



>ref|NP_001183842.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|ACR38516.1| unknown [Zea mays]
 gb|AFU81614.1| AP2-EREBP-type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW64450.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=316

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 117/281 (42%), Positives = 150/281 (53%), Gaps = 43/281 (15%)
 Frame = -2

Query  967  SCFTAEPNVFPGSVPIPSANRAFSDGFA-SVGFEQSGPIGLNGLSPShileiqtqielqh  791
            S +T  P   P S P       +S  +A S     +GP+GLN L P+ I +IQ       
Sbjct  58   SSYTTSPLPTPTSSPFSQLPPLYSSPYAASTASGVAGPMGLNQLGPAQIQQIQ-------  110

Query  790  qqQKEalaalssssSPVFTLFQNQQK----SPPLGTKPVPMKQK-----PGKLYRGVRQR  638
                               +FQ+QQ+    +  LG +  PMKQ        KLYRGVRQR
Sbjct  111  ----------------AQLMFQHQQQRGLHAAFLGPRAQPMKQSGSPPAQSKLYRGVRQR  154

Query  637  HWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPHFLSHDHGVE  458
            HWGKWVAEIRLPKNRTRLWLGTFDTAE AA+A+D+AA++LRG+ ARLNFP  L    G  
Sbjct  155  HWGKWVAEIRLPKNRTRLWLGTFDTAEGAALAYDEAAFRLRGDTARLNFPS-LRRGGGAR  213

Query  457  GFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQR---NSEEPCFGSGAAENAVNVKTESS  287
               PLH+SV AKL AICQSL  + ++S S E      +S +    +   E++ +  +  S
Sbjct  214  LAGPLHASVDAKLTAICQSLAGSKNSSSSDESAASLPDSPKCSASTEGDEDSASAGSPPS  273

Query  286  GVGAASSPE------SEITFLEWENIILDKYPSAEIDWAAL  182
               A   PE      +E  + E E   L KYPS EIDW ++
Sbjct  274  PTQAPPVPEMAKLDFTEAPWDETEAFHLRKYPSWEIDWDSI  314



>ref|XP_002864941.1| hypothetical protein ARALYDRAFT_919839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41200.1| hypothetical protein ARALYDRAFT_919839 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 142/253 (56%), Gaps = 53/253 (21%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQK----SPPL  701
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ +    S  L
Sbjct  59   QTGPIGLNQLTPTQILQIQTE----------------------LHLRQNQPRRRAGSHLL  96

Query  700  GTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahd  536
             TKP  MK+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TA+EAA+A+D
Sbjct  97   TTKPTLMKKTDVAAKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAQEAALAYD  156

Query  535  kaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQR  356
            +AA+K+RG+NARLNFP      H      P   S+ AK+++IC    H++D      +++
Sbjct  157  QAAHKIRGDNARLNFPDIARQGHYKHTLSP---SINAKIDSIC----HSSDLPLPQLRKQ  209

Query  355  NSEEPCFG----SGAAENAVNVKTESSGVG-AASSPESEITFLEWEN----------IIL  221
            N  E        +G          E  G G + SSPES+IT L++ +          + L
Sbjct  210  NKTEEVLSAFHYTGHEPEQEPEFGEIYGSGFSGSSPESDITLLDFSSDCMKEDESFLMGL  269

Query  220  DKYPSAEIDWAAL  182
             KYPS EIDW A+
Sbjct  270  HKYPSLEIDWDAI  282



>ref|XP_009417374.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Musa acuminata subsp. malaccensis]
Length=368

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 114/195 (58%), Gaps = 35/195 (18%)
 Frame = -2

Query  700  GTKPVPMKQKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYK  521
            G+ P P   K  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D+AAY+
Sbjct  182  GSTPPP---KTTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYR  238

Query  520  LRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEP  341
            LRGE+ARLNFP    + HG      LH+SV AKL+AICQSL        S  +Q ++   
Sbjct  239  LRGESARLNFP---ENRHGAADGGSLHASVDAKLQAICQSLA-------SSSKQGSASGA  288

Query  340  CFGSGAAENAVNVKTESSGVGAASSPE----------------------SEITFLEWENI  227
               +       N  T+ +  G  S  E                      +E+ + E EN 
Sbjct  289  LLPTDTTNPDSNAATKVAAEGVTSMVEISSDGEDSSGSSPVLEMQQLDFTEVPWDESENF  348

Query  226  ILDKYPSAEIDWAAL  182
            +L KYPS EIDW ++
Sbjct  349  VLKKYPSWEIDWDSI  363



>gb|KHN38186.1| Ethylene-responsive transcription factor RAP2-4 [Glycine soja]
Length=490

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 123/209 (59%), Gaps = 39/209 (19%)
 Frame = -2

Query  694  KPVPMKQKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLR  515
            KP     KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D AA+KLR
Sbjct  283  KPTCTAAKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDNAAFKLR  342

Query  514  GENARLNFPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDN-----------  380
            GE ARLNFPH   H   V G    ++PL SSV +KL+AIC+SL    +            
Sbjct  343  GEFARLNFPHLRHHGAFVFGEFGDYRPLPSSVDSKLQAICESLAKQEEKPCCSVEDVKPV  402

Query  379  --------SKSHEQQRNSE--EPCFGSGAAENAVNVKTESSGVGAASSPESEITFL----  242
                     +S   + N+E   P F     EN  N    SS  G +SSPES +TFL    
Sbjct  403  IHAAELAEVESDVAKLNAEYVYPEFEDFKVENE-NPMLSSSVSGESSSPESGVTFLDFSD  461

Query  241  ---------EWENIILDKYPSAEIDWAAL  182
                     E EN  L+K+PS EIDWAA+
Sbjct  462  FSDSNNQWDEMENFGLEKFPSVEIDWAAI  490



>ref|XP_006280928.1| hypothetical protein CARUB_v10026925mg [Capsella rubella]
 gb|EOA13826.1| hypothetical protein CARUB_v10026925mg [Capsella rubella]
Length=281

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 120/192 (63%), Gaps = 27/192 (14%)
 Frame = -2

Query  703  LGTKPVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamah  539
            L  KP PMK+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TAE+AA+A+
Sbjct  95   LTAKPTPMKKTDVVTKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAEQAALAY  154

Query  538  dkaAYKLRGENARLNFPHF-LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQ  362
            D+AA+K+RG+NARLNFP   L  D+     + L  S+ AK+E +C+S    +D +    Q
Sbjct  155  DQAAHKIRGDNARLNFPIVALRGDYK----QTLSPSISAKIETVCKS----SDLTLPQLQ  206

Query  361  QRNSEEPCFGSGAAENAVNVKTESSGVGAAS--SPESEITFLEWEN----------IILD  218
            ++   E  F SG        + E   V   S  SPES++T L++ +          + L+
Sbjct  207  KQAKTEDVF-SGFHYTGYKPEQEPDFVSGCSGTSPESDVTLLDFSSEYMKEGESFLMGLN  265

Query  217  KYPSAEIDWAAL  182
            KYPS EIDW AL
Sbjct  266  KYPSLEIDWDAL  277



>gb|AFP90308.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 106/161 (66%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S      P  GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSPSLGSARDEDAKKNDVVSVKSET  254



>ref|XP_010939626.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Elaeis guineensis]
Length=359

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 117/201 (58%), Gaps = 29/201 (14%)
 Frame = -2

Query  703  LGTKPVPMKQ-------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            LG +P PMK        +P KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD AEEAA+
Sbjct  159  LGPRPQPMKHAGSPPPPRPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDAAEEAAL  218

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHE  365
            A+DKAA++LRG+ ARLNFPH L H+       PLHSSV AKL+AICQSL  N+    +  
Sbjct  219  AYDKAAFRLRGDFARLNFPH-LRHEIARAAGGPLHSSVDAKLQAICQSLA-NSPKQGTPL  276

Query  364  QQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPE--------------------SEITF  245
                + +P   +G   N    +       + SS E                    +E  +
Sbjct  277  PPSCTLQPVPDAGRRPNVAKSEPGVEDYKSESSSEGGEDSSSGSSPASEMQHLDFTEAPW  336

Query  244  LEWENIILDKYPSAEIDWAAL  182
             E E+  L KYPS EIDW ++
Sbjct  337  DELESFALRKYPSWEIDWDSI  357



>gb|ABC74510.1| DRF-like transcription factor DRFL2a [Triticum aestivum]
Length=333

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 104/165 (63%), Gaps = 8/165 (5%)
 Frame = -2

Query  664  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPH  485
            KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE+AA+A+DKAA++LRG+ ARLNFP 
Sbjct  171  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDLARLNFPS  230

Query  484  FLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVN  305
                   + G  PLH+SV AKL AIC+SL     +SK+  +       C  S   E++ +
Sbjct  231  LRRGGAHLAG--PLHASVDAKLTAICESLA--APSSKNSAEAEPESPKCSASTEGEDSAS  286

Query  304  VKTESSGVGAASSPE----SEITFLEWENIILDKYPSAEIDWAAL  182
              +           E    +E  + E E   L KYPS EIDW ++
Sbjct  287  AGSPPPPTPPVPEMEKLDFTEAPWDESETFHLRKYPSVEIDWDSI  331



>gb|AFP90317.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 112/177 (63%), Gaps = 25/177 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTESSGVGAASSPESEITFL  242
            + SK+ E +  S         GS   E+A     V+VK+E+    +  S +S IT L
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET--CDSDGSDDSTITAL  268



>ref|XP_009150596.1| PREDICTED: ethylene-responsive transcription factor ERF057-like 
[Brassica rapa]
Length=282

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 143/255 (56%), Gaps = 56/255 (22%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKS-------  710
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ +        
Sbjct  51   QTGPIGLNQLTPTQILQIQTE----------------------LQLRQNQARRGCSGHDL  88

Query  709  PPLGTKPVPMKQ----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
              L  KP  MK+    KP KLYRG+RQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA+A
Sbjct  89   NVLNAKPTLMKKTNVTKPAKLYRGIRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALA  148

Query  541  hdkaAYKLRGENARLNFPH--FLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSH  368
            +D+AA+K+RGENARLNFP+  FL      E  + L  SV AK+EAIC S        K  
Sbjct  149  YDQAAHKIRGENARLNFPNIAFLG-----EYNQTLSPSVNAKIEAICNSSELPPSKLK--  201

Query  367  EQQRNSEEPCFGSGAAENAVNVKTE---SSGVGAASSPESEITFLEWEN----------I  227
             +   +EE  FG     + +  + E   + G  + SSPES++T  ++ +          +
Sbjct  202  -KPAKTEEGFFGFHYMGHELEQEREVPDNFGYRSGSSPESDLTLFDFSSECVKEDESFCM  260

Query  226  ILDKYPSAEIDWAAL  182
             L K PS EIDW A+
Sbjct  261  GLQKCPSFEIDWDAI  275



>ref|XP_004953948.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Setaria italica]
Length=330

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 115/192 (60%), Gaps = 20/192 (10%)
 Frame = -2

Query  703  LGTKPVPMKQK--------PGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaa  548
            LG +  PMKQ           KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE+AA
Sbjct  139  LGPRAQPMKQSGSPPLAPAQSKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAA  198

Query  547  mahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSH  368
            +A+DKAA++LRG+ ARLNFP        + G  PLH+SV AKL AICQSL  +   S   
Sbjct  199  LAYDKAAFRLRGDMARLNFPALRRGGAHLAG--PLHASVDAKLTAICQSLAGSKSGSPDA  256

Query  367  EQQRNS--EEP-CFGSG-AAENAVNVKTESSGVGAASSPE------SEITFLEWENIILD  218
            E    S  + P C  S    E +V+  +  S   A   PE      +E  + E E   L 
Sbjct  257  ESSAASPPDSPKCSASTEGEEESVSAGSPPSPPLAPPVPEMAKLDFTEAPWDETEAFHLR  316

Query  217  KYPSAEIDWAAL  182
            KYPS EIDW ++
Sbjct  317  KYPSWEIDWDSI  328



>emb|CDY08816.1| BnaA06g24080D [Brassica napus]
Length=282

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 143/255 (56%), Gaps = 56/255 (22%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKS-------  710
            Q+GPIGLN L+P+ IL+IQT+                        L QNQ +        
Sbjct  51   QTGPIGLNQLTPTQILQIQTE----------------------LQLRQNQARRGCSGHDL  88

Query  709  PPLGTKPVPMKQ----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaama  542
              L  KP  MK+    KP KLYRG+RQRHWGKWVAEIRLPKNRTRLWLGTF+TAEEAA+A
Sbjct  89   NVLNAKPTLMKKTNVTKPAKLYRGIRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALA  148

Query  541  hdkaAYKLRGENARLNFPH--FLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSH  368
            +D+AA+K+RGENARLNFP+  FL      E  + L  SV AK+EAIC S        K  
Sbjct  149  YDQAAHKIRGENARLNFPNIAFLG-----EYNQTLSPSVNAKIEAICNSSELPPSKLKKP  203

Query  367  EQQRNSEEPCFGSGAAENAVNVKTE---SSGVGAASSPESEITFLEWEN----------I  227
             +   +EE  FG     + +  + E   + G  + SSPES++T  ++ +          +
Sbjct  204  AK---TEEGFFGFHYMGHELEQEREVPDNFGYRSGSSPESDLTLFDFSSECVKEDESFCM  260

Query  226  ILDKYPSAEIDWAAL  182
             L K PS EIDW A+
Sbjct  261  GLQKCPSFEIDWDAI  275



>ref|XP_010544197.1| PREDICTED: ethylene-responsive transcription factor ERF055 [Tarenaya 
hassleriana]
Length=306

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 115/186 (62%), Gaps = 15/186 (8%)
 Frame = -2

Query  700  GTKPVPMKQ---KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdka  530
            G  PVP+ +   KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAA+A+D+A
Sbjct  121  GYVPVPVPEPGAKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDRA  180

Query  529  AYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNS  350
            AYKLRG++ARLNF    + D+    +  LH+SV AKLEAI     +   NS+S   ++  
Sbjct  181  AYKLRGDSARLNFRPRPAADYS--EYAALHASVDAKLEAILSEPKNQPGNSESQPTRKRG  238

Query  349  EEPCFGSGAAENAV-----NVKTESSGVGAASSPESEITFLE----W-ENIILDKYPSAE  200
                   G    AV     N  +  S     SSP SE+   E    W EN +L + PS E
Sbjct  239  SSTSSAVGECSPAVVPPRMNSGSGESDGSGESSPVSELMVAEPPMPWNENFMLGRCPSYE  298

Query  199  IDWAAL  182
            IDW ++
Sbjct  299  IDWDSI  304



>ref|XP_007221531.1| hypothetical protein PRUPE_ppa020676mg, partial [Prunus persica]
 gb|EMJ22730.1| hypothetical protein PRUPE_ppa020676mg, partial [Prunus persica]
Length=152

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 82/105 (78%), Gaps = 5/105 (5%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+DKAAYKLRG+ ARLN
Sbjct  12   KPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLN  71

Query  493  FPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLTHNNDNSKS  371
            FPH   +   V G    +KPLH SV AKL+AIC+ L       K+
Sbjct  72   FPHLRHNGSSVGGDFGEYKPLH-SVDAKLQAICEGLAETQKQGKA  115



>ref|XP_004983222.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Setaria italica]
Length=288

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 114/202 (56%), Gaps = 30/202 (15%)
 Frame = -2

Query  703  LGTKPVPMKQKPG----------KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaee  554
            +G  P  MK+  G          KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGT+DTAEE
Sbjct  87   MGPAPCVMKRYYGLAAPAAAMAAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTYDTAEE  146

Query  553  aamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSK  374
            AA+A+D AA++LRG+ ARLNFP       G     PLH SV AKL+A+  S       S 
Sbjct  147  AALAYDGAAFRLRGDAARLNFPEL--RRGGRHLAPPLHPSVDAKLQAVTSSALAPAPASP  204

Query  373  SHEQQRNSEEP--CFGSGA-----AENAVNVKTESSGV-----GAASSPE------SEIT  248
             HE      EP  C GS A     A +  ++   S+G       AA  PE      SE  
Sbjct  205  RHESADVKNEPGCCSGSEASTTTTAADGADLSPSSTGSSPLAKAAAPLPEMQQLDFSEAP  264

Query  247  FLEWENIILDKYPSAEIDWAAL  182
            + E + + L KYPS EIDW A+
Sbjct  265  WDEADGVALRKYPSLEIDWDAI  286



>gb|ABC74512.1| DRF-like transcription factor DRFL2b [Triticum aestivum]
Length=333

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 103/165 (62%), Gaps = 11/165 (7%)
 Frame = -2

Query  664  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLNFPH  485
            KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE+AA+A+DKAA++LRG+ ARLNFP 
Sbjct  174  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDLARLNFPS  233

Query  484  FLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNSEEPCFGSGAAENAVN  305
                   + G  PLH+SV AKL AIC+SL   +  +   E  +     C  S   E++ +
Sbjct  234  LRRGGAHLAG--PLHASVDAKLTAICESLAAPSSKNSEPESPK-----CSASTEGEDSAS  286

Query  304  VKTESSGVGAASSPE----SEITFLEWENIILDKYPSAEIDWAAL  182
              +           E    +E  + E E   L KYPS EIDW ++
Sbjct  287  AGSPPPPTPPVPEMEKLDFTEAPWDESETFHLRKYPSVEIDWDSI  331



>gb|AFP90307.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90326.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90323.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90288.1| transcription factor 2 [Pinus densata]
 gb|AFP90289.1| transcription factor 2 [Pinus densata]
 gb|AFP90290.1| transcription factor 2 [Pinus densata]
 gb|AFP90298.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90304.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90330.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90312.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90310.1| transcription factor 2 [Pinus yunnanensis]
Length=330

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90309.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90313.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90316.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90318.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90319.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90322.1| transcription factor 2 [Pinus densata]
 gb|AFP90325.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90327.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90328.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90329.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90331.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90301.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90332.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90293.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>gb|AFP90292.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSLTHNND  383
            A+DKAAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL    +
Sbjct  155  AYDKAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSLKQPLE  213

Query  382  N-SKSHEQQRNS----EEPCFGSGAAENA-----VNVKTES  290
            + SK+ E +  S         GS   E+A     V+VK+E+
Sbjct  214  SMSKTEESEEISCAYENSGSLGSARDEDAKKNDVVSVKSET  254



>ref|XP_010519793.1| PREDICTED: ethylene-responsive transcription factor ERF057 [Tarenaya 
hassleriana]
Length=265

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 133/254 (52%), Gaps = 52/254 (20%)
 Frame = -2

Query  877  GFEQSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSP---  707
            G  Q+GPIGLN L+P+ IL+IQT+                      F L QN+  +    
Sbjct  35   GLNQTGPIGLNQLTPAQILQIQTE----------------------FYLRQNRNLARRKG  72

Query  706  ----PLGTKPVPMKQ------KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTae  557
                PL   P PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAE
Sbjct  73   HNLRPLTANPFPMKNPAASVSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  132

Query  556  eaamahdkaAYKLRGENARLNFPHFLSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNS  377
            EAA+A+D+AA+KLRGE AR+NFP    H      +KPL  SV  K +AIC  L       
Sbjct  133  EAALAYDQAAFKLRGEYARVNFPSHTRHG----DYKPLPPSVNKKFQAICDGLAPPELKI  188

Query  376  KSHEQQRNSEEPCFGSGAAENAVNVKTESSGVGAASSPESEITFLE------WENII---  224
             +  ++     P F    +  +  +KT          PES+    +      WE      
Sbjct  189  PAKAEE---GLPGFYETGSVVSKQMKT-GPCPNNRFVPESDKKLSDLSNESPWEESTSFG  244

Query  223  LDKYPSAEIDWAAL  182
            L KYPS EIDW AL
Sbjct  245  LQKYPSLEIDWDAL  258



>gb|KHN29077.1| Ethylene-responsive transcription factor RAP2-4 [Glycine soja]
Length=249

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 4/97 (4%)
 Frame = -2

Query  673  KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaAYKLRGENARLN  494
            KP KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA+A+D AA+KLRGE ARLN
Sbjct  9    KPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDNAAFKLRGEFARLN  68

Query  493  FPHFLSHDHGVEG----FKPLHSSVVAKLEAICQSLT  395
            FPH   H   V G    +KPL SSV +KL+AIC+SL 
Sbjct  69   FPHLRHHGAFVFGEFGDYKPLPSSVDSKLQAICESLA  105



>ref|XP_010444489.1| PREDICTED: ethylene-responsive transcription factor ERF057-like 
[Camelina sativa]
Length=286

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 109/250 (44%), Positives = 149/250 (60%), Gaps = 43/250 (17%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPLGT-K  692
            Q GPIGLN L+P+ IL+IQT++ L+H                     Q++++S  L T K
Sbjct  55   QPGPIGLNQLTPTQILQIQTELHLRHNH-------------------QSRRRSGHLLTAK  95

Query  691  PVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            P PMK+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TAEEAA+A+D+AA
Sbjct  96   PTPMKKTDVATKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDQAA  155

Query  526  YKLRGENARLNFPHF-LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNS  350
            +K+RG+NARLNFP+  +  D+      P   S+ AK+E+IC +           ++Q  +
Sbjct  156  HKIRGDNARLNFPNIAIQGDYYKHTLSP---SIKAKIESICNNSDLLPLPQAQLKKQAKT  212

Query  349  EEP----CFGSGAAENAVNVKTESSGVGAASSPESEITFLEW--------ENII--LDKY  212
            E+      +     E   + + +     + SSPES+IT L++        E+++  L KY
Sbjct  213  EDVFSGFLYTGPKPEKEPDFEDKFGSGFSGSSPESDITLLDFSSDCMKEDESLLMGLHKY  272

Query  211  PSAEIDWAAL  182
            PS EIDW AL
Sbjct  273  PSLEIDWDAL  282



>ref|XP_010484316.1| PREDICTED: ethylene-responsive transcription factor ERF057-like 
[Camelina sativa]
Length=284

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 150/252 (60%), Gaps = 49/252 (19%)
 Frame = -2

Query  868  QSGPIGLNGLSPShileiqtqielqhqqQKEalaalssssSPVFTLFQNQQKSPPLGT-K  692
            Q GPIGLN L+PS IL+IQT++ L+H                     Q++++S  L T K
Sbjct  55   QPGPIGLNQLTPSQILQIQTELHLRHNH-------------------QSRRRSGHLLTAK  95

Query  691  PVPMKQ-----KPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaamahdkaA  527
            P P+K+     KP KLYRGVRQR WGKWVAEIRLPKNRTRLWLGTF+TAE+AA+A+D+AA
Sbjct  96   PTPIKKTNVATKPVKLYRGVRQRQWGKWVAEIRLPKNRTRLWLGTFETAEQAALAYDQAA  155

Query  526  YKLRGENARLNFPHF-LSHDHGVEGFKPLHSSVVAKLEAICQSLTHNNDNSKSHEQQRNS  350
            +K+RG+NARLNFP+  L  D+      P   S+ AK+E+IC S    +D     + ++ +
Sbjct  156  HKIRGDNARLNFPNIALQGDYYKHTLSP---SIKAKIESICNS----SDLLPLPQLKKQA  208

Query  349  EEPCFGSGAAENAVNVKTESS-----GVG-AASSPESEITFLEW--------ENII--LD  218
            +     SG        + E       G G + SSPES+IT L++        E+ +  L 
Sbjct  209  KTEDVFSGFHYTGTKPEKEPEFDDKFGSGFSGSSPESDITLLDFSSDCMKEDESFLTGLH  268

Query  217  KYPSAEIDWAAL  182
            KYPS EIDW AL
Sbjct  269  KYPSLEIDWDAL  280



>gb|AFP90302.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 85/115 (74%), Gaps = 13/115 (11%)
 Frame = -2

Query  706  PLGTKPVPMK------QKPGKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTaeeaam  545
            PLG +  PMK       KP KLYRGVRQRHWGKWVAEIRLP+NRTRLWLGTFDTAEEAAM
Sbjct  95   PLGPRAQPMKLHGSSLSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  544  ahdkaAYKLRGENARLNFPHFLSHDHGVEGFKP------LHSSVVAKLEAICQSL  398
            A+D+AAY+LRG+ ARLNFPH   H      F P      L SSV AKL+AICQSL
Sbjct  155  AYDEAAYRLRGDYARLNFPHLKRHLEA-NSFAPWTGNSVLPSSVDAKLQAICQSL  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256