BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86605_g1_i1 len=1175 path=[1153:0-1174]

Length=1175
                                                                      Score     E

ref|XP_009799111.1|  PREDICTED: NAC domain-containing protein 8-like    436   2e-147   
ref|XP_006338624.1|  PREDICTED: NAC domain-containing protein 8-like    431   4e-145   
ref|XP_009622368.1|  PREDICTED: NAC domain-containing protein 8-like    429   5e-145   
emb|CDP02050.1|  unnamed protein product                                427   4e-144   
ref|XP_004231842.1|  PREDICTED: NAC domain-containing protein 8         425   3e-143   
ref|XP_011097382.1|  PREDICTED: NAC domain-containing protein 8-like    388   7e-129   
ref|XP_007031605.1|  NAC domain transcriptional regulator superfa...    380   7e-126   
ref|XP_002272446.1|  PREDICTED: NAC domain-containing protein 8 i...    378   1e-124   Vitis vinifera
ref|XP_007215505.1|  hypothetical protein PRUPE_ppa006948mg             377   1e-124   
gb|KHG21250.1|  NAC domain-containing 8 -like protein                   377   2e-124   
ref|XP_008230522.1|  PREDICTED: NAC domain-containing protein 8         376   3e-124   
ref|XP_010660847.1|  PREDICTED: NAC domain-containing protein 8 i...    377   1e-123   
gb|AGL39749.1|  NAC transcription factor 093                            374   3e-123   
ref|XP_006446621.1|  hypothetical protein CICLE_v10015507mg             372   1e-122   
ref|XP_006470226.1|  PREDICTED: NAC domain-containing protein 8-like    372   3e-122   
gb|AHJ79160.1|  NAC domain protein NAC19                                365   6e-120   
ref|XP_002521482.1|  conserved hypothetical protein                     366   6e-120   Ricinus communis
ref|XP_010686990.1|  PREDICTED: NAC domain-containing protein 8-like    362   7e-119   
ref|XP_008775622.1|  PREDICTED: NAC domain-containing protein 8-like    362   1e-118   
ref|XP_009371759.1|  PREDICTED: NAC domain-containing protein 8-like    361   3e-118   
ref|XP_004499395.1|  PREDICTED: NAC domain-containing protein 8-like    358   4e-117   
ref|XP_009370397.1|  PREDICTED: NAC domain-containing protein 8-like    360   5e-117   
ref|XP_002298550.2|  hypothetical protein POPTR_0001s35490g             357   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010912974.1|  PREDICTED: NAC domain-containing protein 8         356   3e-116   
ref|XP_008341697.1|  PREDICTED: NAC domain-containing protein 8         355   3e-116   
ref|XP_008362184.1|  PREDICTED: NAC domain-containing protein 8-like    354   9e-116   
ref|XP_008812203.1|  PREDICTED: NAC domain-containing protein 8-like    354   1e-115   
ref|XP_010251054.1|  PREDICTED: NAC domain-containing protein 8         353   5e-115   
ref|XP_006603789.1|  PREDICTED: NAC domain-containing protein 8-like    351   2e-114   
gb|KHN19686.1|  NAC domain-containing protein 8                         350   6e-114   
ref|XP_010248662.1|  PREDICTED: NAC domain-containing protein 8-l...    348   2e-113   
ref|XP_011003122.1|  PREDICTED: NAC domain-containing protein 8 i...    348   2e-113   
ref|XP_008458820.1|  PREDICTED: NAC domain-containing protein 8 i...    348   4e-113   
ref|XP_010248661.1|  PREDICTED: NAC domain-containing protein 8-l...    348   2e-112   
gb|KGN51354.1|  hypothetical protein Csa_5G523000                       345   6e-112   
ref|XP_006599082.1|  PREDICTED: NAC domain-containing protein 8-l...    344   1e-111   
gb|KHN27560.1|  NAC domain-containing protein 8                         344   2e-111   
ref|XP_004156732.1|  PREDICTED: NAC domain-containing protein 8-like    348   2e-111   
ref|XP_006579788.1|  PREDICTED: NAC domain-containing protein 8-like    343   2e-111   
ref|XP_006604012.1|  PREDICTED: NAC domain-containing protein 8-like    343   3e-111   
ref|XP_004142846.1|  PREDICTED: NAC domain-containing protein 8-like    345   3e-110   
ref|XP_008458821.1|  PREDICTED: NAC domain-containing protein 8 i...    339   9e-110   
ref|XP_007141004.1|  hypothetical protein PHAVU_008G159200g             338   2e-109   
ref|XP_009387344.1|  PREDICTED: NAC domain-containing protein 8-like    335   5e-108   
ref|XP_010033338.1|  PREDICTED: NAC domain-containing protein 8-l...    330   3e-106   
ref|XP_010033337.1|  PREDICTED: NAC domain-containing protein 8-l...    330   4e-106   
ref|NP_001047308.1|  Os02g0594800                                       329   9e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006369935.1|  hypothetical protein POPTR_0001s35490g             330   2e-105   
ref|XP_006599084.1|  PREDICTED: NAC domain-containing protein 8-l...    328   2e-105   
ref|XP_009416662.1|  PREDICTED: NAC domain-containing protein 8-like    328   3e-105   
gb|KCW52944.1|  hypothetical protein EUGRSUZ_J02254                     328   6e-105   
ref|XP_006648804.1|  PREDICTED: NAC domain-containing protein 8-like    325   2e-104   
gb|EAZ23656.1|  hypothetical protein OsJ_07356                          321   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003121.1|  PREDICTED: NAC domain-containing protein 8 i...    321   2e-102   
gb|EAY86512.1|  hypothetical protein OsI_07891                          320   5e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_007150911.1|  hypothetical protein PHAVU_004G004900g             317   2e-101   
ref|XP_004306377.1|  PREDICTED: NAC domain-containing protein 8-like    318   6e-101   
gb|EYU34749.1|  hypothetical protein MIMGU_mgv1a023855mg                303   5e-97    
gb|KEH22118.1|  NAC transcription factor-like protein                   308   5e-96    
gb|KHN34454.1|  NAC domain-containing protein 8                         300   1e-94    
ref|XP_007046313.1|  NAC domain protein, IPR003441 isoform 1            299   1e-93    
ref|XP_002281522.1|  PREDICTED: NAC domain-containing protein 8 i...    298   2e-93    Vitis vinifera
ref|XP_010647968.1|  PREDICTED: NAC domain-containing protein 8 i...    298   3e-93    
ref|XP_010108843.1|  NAC domain-containing protein 8                    309   1e-91    
ref|XP_003572678.2|  PREDICTED: NAC domain-containing protein 8-like    291   3e-91    
ref|XP_008446555.1|  PREDICTED: NAC domain-containing protein 8         291   1e-90    
ref|XP_011021659.1|  PREDICTED: NAC domain-containing protein 8-like    290   4e-90    
gb|AGC27317.1|  NAC domain protein 14                                   290   5e-90    
gb|KGN52047.1|  hypothetical protein Csa_5G608350                       289   5e-90    
ref|XP_004159303.1|  PREDICTED: NAC domain-containing protein 8-like    289   6e-90    
gb|AGL39748.1|  NAC transcription factor 092                            289   8e-90    
ref|XP_002311435.1|  hypothetical protein POPTR_0008s11550g             289   1e-89    Populus trichocarpa [western balsam poplar]
ref|XP_006589379.1|  PREDICTED: NAC domain-containing protein 8-l...    288   2e-89    
ref|XP_003535503.1|  PREDICTED: NAC domain-containing protein 8-l...    288   2e-89    
ref|XP_007046314.1|  NAC domain protein, IPR003441 isoform 2            288   3e-89    
gb|KHG05346.1|  NAC domain-containing 8 -like protein                   288   3e-89    
ref|XP_008800750.1|  PREDICTED: NAC domain-containing protein 8 i...    286   4e-89    
ref|XP_002524405.1|  conserved hypothetical protein                     288   9e-89    Ricinus communis
ref|XP_008800749.1|  PREDICTED: NAC domain-containing protein 8 i...    286   9e-89    
emb|CDP00573.1|  unnamed protein product                                287   1e-88    
ref|XP_002315960.1|  hypothetical protein POPTR_0010s13980g             285   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006605345.1|  PREDICTED: uncharacterized protein LOC100787...    284   6e-88    
ref|XP_006605344.1|  PREDICTED: uncharacterized protein LOC100787...    284   7e-88    
ref|XP_010066746.1|  PREDICTED: NAC domain-containing protein 8         284   9e-88    
ref|XP_010932619.1|  PREDICTED: NAC domain-containing protein 8 i...    283   1e-87    
ref|XP_006605343.1|  PREDICTED: uncharacterized protein LOC100787...    284   1e-87    
ref|XP_008800751.1|  PREDICTED: NAC domain-containing protein 8 i...    282   1e-87    
gb|AIA57535.1|  NAC domain-containing protein                           283   2e-87    
ref|XP_006484408.1|  PREDICTED: NAC domain-containing protein 8-like    283   2e-87    
ref|NP_001242773.1|  uncharacterized protein LOC100787422               283   3e-87    
gb|KHN00898.1|  NAC domain-containing protein 8                         282   5e-87    
ref|XP_003518010.1|  PREDICTED: NAC domain-containing protein 8-like    281   9e-87    
ref|XP_004952971.1|  PREDICTED: NAC domain-containing protein 8-like    280   1e-86    
gb|KDO70104.1|  hypothetical protein CISIN_1g014310mg                   280   2e-86    
ref|XP_006437738.1|  hypothetical protein CICLE_v10031598mg             280   3e-86    
ref|XP_009115341.1|  PREDICTED: NAC domain-containing protein 8-like    281   3e-86    
ref|XP_010695823.1|  PREDICTED: NAC domain-containing protein 8         280   3e-86    
ref|XP_011077291.1|  PREDICTED: NAC domain-containing protein 8         279   7e-86    
ref|XP_011008569.1|  PREDICTED: NAC domain-containing protein 8 i...    278   9e-86    
ref|XP_003614421.1|  NAC domain-containing protein                      279   1e-85    
ref|XP_006362531.1|  PREDICTED: NAC domain-containing protein 8-like    278   1e-85    
emb|CDX85002.1|  BnaC05g20530D                                          278   2e-85    
ref|XP_003614420.1|  NAC domain-containing protein                      278   2e-85    
gb|AES62079.2|  NAC transcription factor-like protein                   279   3e-85    
ref|XP_006852354.1|  hypothetical protein AMTR_s00049p00217400          275   3e-85    
ref|NP_001149204.1|  ANAC044                                            276   5e-85    Zea mays [maize]
ref|XP_008243167.1|  PREDICTED: NAC domain-containing protein 8         276   6e-85    
gb|AFK39167.1|  unknown                                                 276   1e-84    
emb|CDY16138.1|  BnaA09g28720D                                          276   1e-84    
ref|XP_002454112.1|  hypothetical protein SORBIDRAFT_04g024780          275   2e-84    Sorghum bicolor [broomcorn]
ref|XP_009391398.1|  PREDICTED: NAC domain-containing protein 8 i...    275   2e-84    
ref|XP_003591828.1|  NAC domain protein                                 279   2e-84    
ref|XP_009391397.1|  PREDICTED: NAC domain-containing protein 8 i...    275   2e-84    
ref|XP_009103075.1|  PREDICTED: NAC domain-containing protein 8-like    276   2e-84    
gb|ACJ85378.1|  unknown                                                 275   2e-84    Medicago truncatula
ref|XP_004490275.1|  PREDICTED: NAC domain-containing protein 8-like    275   3e-84    
ref|XP_004965197.1|  PREDICTED: NAC domain-containing protein 8-like    274   4e-84    
ref|XP_009336626.1|  PREDICTED: NAC domain-containing protein 8         275   4e-84    
ref|XP_004238966.1|  PREDICTED: NAC domain-containing protein 8         274   5e-84    
ref|XP_007153341.1|  hypothetical protein PHAVU_003G027100g             273   6e-84    
ref|XP_003518686.1|  PREDICTED: NAC domain-containing protein 8         274   9e-84    
gb|KHN05857.1|  NAC domain-containing protein 8                         274   1e-83    
ref|XP_009614316.1|  PREDICTED: NAC domain-containing protein 8 i...    273   1e-83    
ref|XP_009614315.1|  PREDICTED: NAC domain-containing protein 8 i...    273   1e-83    
ref|NP_564238.2|  suppressor of gamma response 1                        273   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009614314.1|  PREDICTED: NAC domain-containing protein 8 i...    273   2e-83    
gb|AAG50527.1|AC084221_9  unknown protein                               274   2e-83    Arabidopsis thaliana [mouse-ear cress]
gb|EMT06396.1|  NAC domain-containing protein 8                         278   2e-83    
gb|KDO70105.1|  hypothetical protein CISIN_1g014310mg                   271   6e-83    
ref|XP_008389315.1|  PREDICTED: NAC domain-containing protein 8         272   7e-83    
ref|XP_006378502.1|  hypothetical protein POPTR_0010s13980g             267   7e-83    
gb|KFK44551.1|  hypothetical protein AALP_AA1G271400                    272   8e-83    
ref|XP_006307460.1|  hypothetical protein CARUB_v10009087mg             270   4e-82    
ref|XP_006378501.1|  hypothetical protein POPTR_0010s13980g             269   5e-82    
ref|XP_009356240.1|  PREDICTED: NAC domain-containing protein 8-like    270   7e-82    
ref|XP_010477912.1|  PREDICTED: NAC domain-containing protein 8         269   1e-81    
ref|XP_010550156.1|  PREDICTED: NAC domain-containing protein 8 i...    265   2e-81    
ref|XP_009770387.1|  PREDICTED: NAC domain-containing protein 8 i...    267   5e-81    
ref|XP_009770386.1|  PREDICTED: NAC domain-containing protein 8 i...    267   5e-81    
ref|XP_009770385.1|  PREDICTED: NAC domain-containing protein 8 i...    266   8e-81    
ref|XP_010551309.1|  PREDICTED: NAC domain-containing protein 8 i...    266   9e-81    
ref|XP_010551308.1|  PREDICTED: NAC domain-containing protein 8 i...    266   9e-81    
ref|XP_010551307.1|  PREDICTED: NAC domain-containing protein 8 i...    266   1e-80    
ref|XP_008361739.1|  PREDICTED: NAC domain-containing protein 8-like    266   2e-80    
ref|XP_011008576.1|  PREDICTED: NAC domain-containing protein 8 i...    265   2e-80    
ref|XP_004297143.1|  PREDICTED: NAC domain-containing protein 8-like    266   3e-80    
ref|XP_006655990.1|  PREDICTED: NAC domain-containing protein 8-like    264   4e-80    
ref|XP_007222098.1|  hypothetical protein PRUPE_ppa005648mg             264   6e-80    
ref|XP_010262846.1|  PREDICTED: NAC domain-containing protein 8-like    265   1e-79    
gb|AFN55266.1|  NAC domain protein                                      263   1e-79    
gb|KFK37625.1|  hypothetical protein AALP_AA3G007500                    260   2e-79    
gb|KDO49049.1|  hypothetical protein CISIN_1g0213532mg                  258   3e-79    
emb|CDY20528.1|  BnaC07g11950D                                          263   3e-79    
ref|XP_002890682.1|  ANAC008                                            263   4e-79    
ref|XP_004135409.1|  PREDICTED: NAC domain-containing protein 8-like    263   5e-79    
gb|AAG50802.1|AC079281_4  hypothetical protein                          256   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415888.1|  hypothetical protein EUTSA_v10007551mg             261   2e-78    
emb|CDY51128.1|  BnaA07g37110D                                          266   3e-78    
ref|NP_001169606.1|  uncharacterized protein LOC100383487               258   5e-78    Zea mays [maize]
gb|AFT82664.1|  NAC13 NAC type transcription factor                     258   6e-78    
ref|XP_010499089.1|  PREDICTED: NAC domain-containing protein 8-l...    259   6e-78    
ref|NP_001146652.1|  putative NAC domain transcription factor sup...    257   1e-77    Zea mays [maize]
ref|XP_010550157.1|  PREDICTED: NAC domain-containing protein 8 i...    255   1e-77    
ref|XP_010227769.1|  PREDICTED: NAC domain-containing protein 8         259   2e-77    
gb|KHN37822.1|  NAC domain-containing protein 8                         258   2e-77    
gb|ABR16510.1|  unknown                                                 255   3e-77    Picea sitchensis
ref|XP_010932620.1|  PREDICTED: NAC domain-containing protein 8 i...    254   3e-77    
gb|EPS60726.1|  hypothetical protein M569_14078                         249   4e-77    
ref|XP_010499091.1|  PREDICTED: NAC domain-containing protein 8-l...    256   4e-77    
ref|XP_010460359.1|  PREDICTED: NAC domain-containing protein 8-l...    257   5e-77    
gb|EYU22627.1|  hypothetical protein MIMGU_mgv1a0074222mg               251   6e-77    
gb|AIZ68167.1|  NAC domain-containing protein 8 isoform X2              256   1e-76    
ref|XP_010460360.1|  PREDICTED: NAC domain-containing protein 8-l...    255   1e-76    
ref|XP_006653523.1|  PREDICTED: NAC domain-containing protein 8-like    251   4e-76    
gb|EPS68229.1|  hypothetical protein M569_06541                         249   5e-76    
gb|EAZ00449.1|  hypothetical protein OsI_22469                          254   5e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_010523400.1|  PREDICTED: NAC domain-containing protein 8-like    254   6e-76    
gb|EEE65492.1|  hypothetical protein OsJ_20915                          254   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010435643.1|  PREDICTED: NAC domain-containing protein 8-l...    250   1e-75    
ref|XP_002436832.1|  hypothetical protein SORBIDRAFT_10g009670          253   1e-75    Sorghum bicolor [broomcorn]
ref|XP_010496288.1|  PREDICTED: NAC domain-containing protein 8-like    250   2e-75    
ref|XP_004955196.1|  PREDICTED: NAC domain-containing protein 8-like    251   1e-74    
gb|AFW76919.1|  putative NAC domain transcription factor superfam...    246   1e-74    
ref|NP_196953.1|  NAC domain containing protein 85                      247   1e-74    Arabidopsis thaliana [mouse-ear cress]
gb|KHN27473.1|  NAC domain-containing protein 8                         246   1e-74    
gb|AFN55269.1|  NAC domain-containing protein                           250   2e-74    
ref|XP_003581357.1|  PREDICTED: NAC domain-containing protein 8-like    247   3e-74    
ref|XP_006289216.1|  hypothetical protein CARUB_v10002665mg             247   3e-74    
ref|XP_006408528.1|  hypothetical protein EUTSA_v10022099mg             246   5e-74    
ref|XP_010485395.1|  PREDICTED: NAC domain-containing protein 8-l...    246   6e-74    
ref|XP_002873670.1|  predicted protein                                  245   1e-73    
ref|XP_010485394.1|  PREDICTED: NAC domain-containing protein 8-l...    246   2e-73    
gb|AFW62815.1|  putative NAC domain transcription factor superfam...    244   2e-73    
ref|XP_010435640.1|  PREDICTED: NAC domain-containing protein 8-l...    244   2e-73    
ref|XP_006297963.1|  hypothetical protein CARUB_v10014004mg             244   2e-73    
ref|XP_010525257.1|  PREDICTED: NAC domain-containing protein 8-like    245   3e-73    
ref|NP_186809.1|  NAC domain containing protein 44                      243   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828400.1|  hypothetical protein AMTR_s00060p00054700          244   1e-72    
ref|XP_002884273.1|  predicted protein                                  242   2e-72    
ref|XP_008354424.1|  PREDICTED: NAC domain-containing protein 8-like    239   2e-71    
gb|EMT26627.1|  NAC domain-containing protein 8                         238   3e-71    
gb|AFN55278.1|  NAC domain-containing protein                           236   4e-71    
gb|EMS58331.1|  NAC domain-containing protein 8                         236   5e-71    
ref|XP_009134601.1|  PREDICTED: NAC domain-containing protein 8         238   5e-71    
gb|EMS59187.1|  NAC domain-containing protein 8                         238   8e-71    
ref|XP_007160268.1|  hypothetical protein PHAVU_002G307000g             240   1e-70    
ref|XP_004978080.1|  PREDICTED: NAC domain-containing protein 8-like    237   2e-70    
ref|XP_010424091.1|  PREDICTED: NAC domain-containing protein 8-like    236   3e-70    
ref|XP_010453573.1|  PREDICTED: NAC domain-containing protein 8-like    236   3e-70    
ref|XP_007141005.1|  hypothetical protein PHAVU_008G159200g             234   3e-70    
gb|KHN03216.1|  NAC domain-containing protein 8                         238   3e-70    
ref|XP_006572929.1|  PREDICTED: uncharacterized protein LOC100795...    238   6e-70    
ref|XP_006572925.1|  PREDICTED: uncharacterized protein LOC100795...    238   6e-70    
ref|XP_008649295.1|  PREDICTED: uncharacterized protein LOC103629...    246   7e-70    
gb|AIA57514.1|  NAC domain-containing protein                           232   9e-70    
ref|XP_004513073.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-li...    235   9e-70    
ref|XP_006584802.1|  PREDICTED: uncharacterized protein LOC100799...    238   1e-69    
ref|XP_007152951.1|  hypothetical protein PHAVU_004G174000g             237   1e-69    
gb|AHJ79166.1|  NAC domain protein NAC25                                233   1e-69    
ref|XP_009352582.1|  PREDICTED: uncharacterized protein LOC103943...    238   1e-69    
ref|XP_010541001.1|  PREDICTED: uncharacterized protein LOC104814586    238   1e-69    
emb|CDP03230.1|  unnamed protein product                                238   1e-69    
gb|KHN16660.1|  NAC domain-containing protein 8                         237   1e-69    
gb|KCW79603.1|  hypothetical protein EUGRSUZ_C00958                     238   1e-69    
gb|KHN40359.1|  NAC domain-containing protein 8                         237   1e-69    
ref|XP_006583563.1|  PREDICTED: uncharacterized protein LOC100791...    237   1e-69    
ref|XP_010047652.1|  PREDICTED: uncharacterized protein LOC104436544    238   1e-69    
ref|XP_009352580.1|  PREDICTED: uncharacterized protein LOC103943...    238   2e-69    
gb|AGS08757.1|  NAC domain protein                                      236   2e-69    
ref|XP_010267099.1|  PREDICTED: uncharacterized protein LOC104604...    236   2e-69    
ref|XP_010267098.1|  PREDICTED: uncharacterized protein LOC104604...    236   2e-69    
ref|XP_010267095.1|  PREDICTED: uncharacterized protein LOC104604...    236   2e-69    
ref|XP_009789699.1|  PREDICTED: NAC domain-containing protein 4-l...    235   3e-69    
ref|XP_010526422.1|  PREDICTED: uncharacterized protein LOC104803...    237   3e-69    
ref|XP_010526421.1|  PREDICTED: uncharacterized protein LOC104803...    237   4e-69    
ref|XP_002514192.1|  conserved hypothetical protein                     236   4e-69    Ricinus communis
ref|XP_007012972.1|  NAC domain containing protein 75 isoform 1         236   4e-69    
ref|XP_007012975.1|  NAC domain containing protein 75 isoform 4         236   4e-69    
ref|XP_010244406.1|  PREDICTED: uncharacterized protein LOC104588...    236   4e-69    
ref|XP_011007272.1|  PREDICTED: uncharacterized protein LOC105113...    234   5e-69    
ref|XP_011007271.1|  PREDICTED: uncharacterized protein LOC105113...    236   5e-69    
ref|XP_010244411.1|  PREDICTED: uncharacterized protein LOC104588...    235   5e-69    
ref|XP_004135810.1|  PREDICTED: uncharacterized protein LOC101216381    237   6e-69    
ref|XP_004158457.1|  PREDICTED: uncharacterized LOC101216381            237   6e-69    
gb|KGN66194.1|  hypothetical protein Csa_1G575100                       237   6e-69    
ref|XP_010656246.1|  PREDICTED: NAC domain-containing protein 8 i...    235   7e-69    
ref|XP_007201969.1|  hypothetical protein PRUPE_ppa004775mg             236   7e-69    
ref|XP_008242461.1|  PREDICTED: uncharacterized protein LOC103340794    236   7e-69    
ref|XP_004513071.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-li...    234   7e-69    
ref|XP_011078231.1|  PREDICTED: uncharacterized protein LOC105162...    236   7e-69    
ref|XP_010656245.1|  PREDICTED: NAC domain-containing protein 8 i...    235   7e-69    
ref|XP_010656241.1|  PREDICTED: NAC domain-containing protein 8 i...    235   8e-69    
gb|KDO55870.1|  hypothetical protein CISIN_1g012118mg                   234   8e-69    
ref|XP_008450799.1|  PREDICTED: uncharacterized protein LOC103492...    236   9e-69    
ref|XP_006371968.1|  hypothetical protein POPTR_0018s06790g             235   1e-68    
ref|XP_008450800.1|  PREDICTED: uncharacterized protein LOC103492...    236   1e-68    
ref|XP_009789697.1|  PREDICTED: NAC domain-containing protein 4-l...    235   1e-68    
ref|XP_010110863.1|  NAC domain-containing protein 8                    236   1e-68    
ref|XP_002308301.1|  hypothetical protein POPTR_0006s15740g             235   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_010230573.1|  PREDICTED: uncharacterized protein LOC100823...    234   1e-68    
ref|XP_011007270.1|  PREDICTED: uncharacterized protein LOC105113...    235   1e-68    
ref|XP_010688374.1|  PREDICTED: probable nuclear hormone receptor...    236   1e-68    
ref|XP_003564693.1|  PREDICTED: uncharacterized protein LOC100823...    234   1e-68    
gb|KDP33771.1|  hypothetical protein JCGZ_07342                         234   1e-68    
ref|XP_011007267.1|  PREDICTED: uncharacterized protein LOC105113...    235   1e-68    
ref|XP_006451346.1|  hypothetical protein CICLE_v10010579mg             234   2e-68    
gb|AGL39750.1|  NAC transcription factor 094                            234   2e-68    
ref|XP_011013932.1|  PREDICTED: uncharacterized protein LOC105117855    234   2e-68    
emb|CDX74307.1|  BnaA03g27400D                                          240   2e-68    
ref|XP_011078230.1|  PREDICTED: uncharacterized protein LOC105162...    234   2e-68    
ref|XP_009595153.1|  PREDICTED: putative NAC domain-containing pr...    233   2e-68    
ref|XP_009397463.1|  PREDICTED: protein SOMBRERO-like                   233   2e-68    
ref|XP_011078228.1|  PREDICTED: uncharacterized protein LOC105162...    234   2e-68    
gb|EMS54054.1|  NAC domain-containing protein 8                         232   3e-68    
ref|XP_006580485.1|  PREDICTED: uncharacterized protein LOC100794...    233   4e-68    
ref|XP_006475352.1|  PREDICTED: NAC domain-containing protein 8-l...    234   5e-68    
ref|XP_010321139.1|  PREDICTED: uncharacterized protein LOC101262...    233   8e-68    
ref|XP_009595150.1|  PREDICTED: uncharacterized protein LOC104091...    233   8e-68    
emb|CDX91940.1|  BnaC03g32420D                                          238   8e-68    
gb|AHJ79164.1|  NAC domain protein NAC23                                233   8e-68    
ref|XP_008337617.1|  PREDICTED: uncharacterized protein LOC103400738    234   8e-68    
ref|XP_009790210.1|  PREDICTED: NAC domain-containing protein 4-l...    232   9e-68    
ref|XP_006338197.1|  PREDICTED: NAC transcription factor NAM-A1-like    233   1e-67    
ref|XP_006643861.1|  PREDICTED: uncharacterized protein LOC102699541    231   1e-67    
ref|XP_009602851.1|  PREDICTED: uncharacterized protein LOC104097...    231   1e-67    
gb|EYU30683.1|  hypothetical protein MIMGU_mgv1a025425mg                233   2e-67    
ref|XP_009790209.1|  PREDICTED: NAC domain-containing protein 4-l...    232   2e-67    
ref|XP_010321135.1|  PREDICTED: uncharacterized protein LOC101262...    233   2e-67    
ref|XP_009602846.1|  PREDICTED: uncharacterized protein LOC104097...    231   2e-67    
ref|XP_009602850.1|  PREDICTED: uncharacterized protein LOC104097...    231   2e-67    
ref|XP_004960907.1|  PREDICTED: NAC domain-containing protein 8-l...    228   3e-67    
ref|XP_004287496.1|  PREDICTED: uncharacterized protein LOC101302582    232   3e-67    
ref|XP_009790208.1|  PREDICTED: NAC domain-containing protein 4-l...    231   3e-67    
ref|XP_009790203.1|  PREDICTED: NAC domain-containing protein 4-l...    231   3e-67    
gb|KHM99823.1|  NAC domain-containing protein 8                         231   3e-67    
tpg|DAA53039.1|  TPA: putative NAC domain transcription factor su...    230   4e-67    
ref|NP_001042270.2|  Os01g0191300                                       230   4e-67    
ref|XP_010230572.1|  PREDICTED: uncharacterized protein LOC100823...    230   4e-67    
ref|XP_004960906.1|  PREDICTED: NAC domain-containing protein 8-l...    228   5e-67    
ref|XP_010230571.1|  PREDICTED: uncharacterized protein LOC100823...    230   5e-67    
ref|NP_001183479.1|  uncharacterized protein LOC100501911               230   5e-67    
ref|NP_001152301.1|  ANAC075                                            230   7e-67    
ref|XP_009137841.1|  PREDICTED: uncharacterized protein LOC103861...    231   7e-67    
emb|CDY30224.1|  BnaA03g49460D                                          231   7e-67    
ref|XP_004968499.1|  PREDICTED: uncharacterized protein LOC101755...    229   9e-67    
ref|XP_002455026.1|  hypothetical protein SORBIDRAFT_03g003170          229   9e-67    
ref|XP_010447877.1|  PREDICTED: uncharacterized protein LOC104730...    231   1e-66    
gb|ACB38157.1|  NAC-type transcription factor                           230   1e-66    
ref|XP_010438322.1|  PREDICTED: uncharacterized protein LOC104721...    230   2e-66    
ref|XP_010433118.1|  PREDICTED: uncharacterized protein LOC104717...    230   2e-66    
ref|XP_004968498.1|  PREDICTED: uncharacterized protein LOC101755...    229   2e-66    
gb|EEC70093.1|  hypothetical protein OsI_00726                          230   2e-66    
gb|KFK25688.1|  hypothetical protein AALP_AA8G146200                    233   2e-66    
emb|CDY47775.1|  BnaC07g41850D                                          229   2e-66    
ref|XP_011093660.1|  PREDICTED: paired box pox-meso protein-like ...    229   2e-66    
ref|XP_011093659.1|  PREDICTED: paired box pox-meso protein-like ...    229   2e-66    
gb|EMT01861.1|  NAC domain-containing protein 8                         229   3e-66    
dbj|BAJ88977.1|  predicted protein                                      228   4e-66    
gb|KGN60561.1|  hypothetical protein Csa_2G000690                       228   5e-66    
ref|XP_006283549.1|  hypothetical protein CARUB_v10004602mg             229   5e-66    
ref|XP_009385364.1|  PREDICTED: protein ATAF2-like                      226   6e-66    
ref|XP_004141164.1|  PREDICTED: uncharacterized protein LOC101211827    228   7e-66    
ref|XP_008459078.1|  PREDICTED: uncharacterized protein LOC103498...    228   7e-66    
ref|XP_008655705.1|  PREDICTED: uncharacterized protein LOC103634...    227   9e-66    
emb|CDY06828.1|  BnaC01g09270D                                          228   9e-66    
ref|XP_006584804.1|  PREDICTED: uncharacterized protein LOC100799...    227   1e-65    
ref|XP_009137840.1|  PREDICTED: uncharacterized protein LOC103861...    228   1e-65    
ref|XP_006412861.1|  hypothetical protein EUTSA_v10024980mg             228   2e-65    
ref|XP_003593656.1|  NAC domain-containing protein                      222   2e-65    
gb|EMT21053.1|  NAC domain-containing protein 8                         228   2e-65    
ref|XP_010447876.1|  PREDICTED: uncharacterized protein LOC104730...    227   2e-65    
ref|XP_008655706.1|  PREDICTED: uncharacterized protein LOC103634...    228   3e-65    
dbj|BAK23965.1|  transcription factor                                   223   3e-65    
ref|XP_009128925.1|  PREDICTED: uncharacterized protein LOC103853...    227   3e-65    
ref|XP_010438321.1|  PREDICTED: uncharacterized protein LOC104721...    227   3e-65    
ref|XP_004968497.1|  PREDICTED: uncharacterized protein LOC101755...    225   3e-65    
ref|XP_010433117.1|  PREDICTED: uncharacterized protein LOC104717...    227   3e-65    
ref|NP_194652.1|  NAC domain containing protein 75                      227   3e-65    
ref|XP_008655702.1|  PREDICTED: uncharacterized protein LOC103634...    228   4e-65    
gb|AFW76920.1|  putative NAC domain transcription factor superfam...    220   4e-65    
gb|AFW80266.1|  putative NAC domain transcription factor superfam...    227   4e-65    
ref|XP_004503507.1|  PREDICTED: uncharacterized protein LOC101489...    225   4e-65    
ref|XP_002869446.1|  ANAC075                                            227   4e-65    
gb|EEC77483.1|  hypothetical protein OsI_16316                          224   5e-65    
ref|XP_004503506.1|  PREDICTED: uncharacterized protein LOC101489...    225   8e-65    
ref|XP_004503503.1|  PREDICTED: uncharacterized protein LOC101489...    225   8e-65    
ref|XP_009388589.1|  PREDICTED: NAC domain-containing protein 76-...    224   9e-65    
ref|XP_009388586.1|  PREDICTED: NAC domain-containing protein 76-...    224   9e-65    
tpg|DAA37312.1|  TPA: putative NAC domain transcription factor su...    219   1e-64    
ref|XP_009388588.1|  PREDICTED: NAC domain-containing protein 76-...    223   1e-64    
emb|CDY48605.1|  BnaA01g07600D                                          224   2e-64    
ref|XP_009408903.1|  PREDICTED: uncharacterized protein LOC103991251    223   2e-64    
ref|XP_010925507.1|  PREDICTED: uncharacterized protein LOC105048021    223   3e-64    
gb|KEH21329.1|  NAC transcription factor-like protein                   224   3e-64    
ref|XP_003630687.1|  NAC domain protein                                 224   3e-64    
ref|XP_008655704.1|  PREDICTED: uncharacterized protein LOC103634...    224   3e-64    
ref|XP_010231623.1|  PREDICTED: NAC domain-containing protein 8-l...    217   4e-64    
ref|XP_010231626.1|  PREDICTED: NAC domain-containing protein 8-l...    217   4e-64    
ref|XP_006655067.1|  PREDICTED: NAC domain-containing protein 8-like    218   5e-64    
ref|XP_008655703.1|  PREDICTED: uncharacterized protein LOC103634...    224   5e-64    
gb|ADM77026.1|  no apical meristem-like protein                         215   5e-64    
ref|XP_009128919.1|  PREDICTED: uncharacterized protein LOC103853...    224   6e-64    
ref|NP_001146762.1|  uncharacterized protein LOC100280364               222   8e-64    
ref|XP_010545327.1|  PREDICTED: NAC domain-containing protein 78 ...    219   8e-64    
ref|XP_002440750.1|  hypothetical protein SORBIDRAFT_09g006015          215   9e-64    
tpg|DAA37313.1|  TPA: putative NAC domain transcription factor su...    222   9e-64    
ref|XP_006401302.1|  hypothetical protein EUTSA_v10015892mg             219   9e-64    
gb|AFW76921.1|  putative NAC domain transcription factor superfam...    227   1e-63    
ref|XP_009403493.1|  PREDICTED: uncharacterized protein LOC103987034    221   1e-63    
gb|EMT32184.1|  NAC domain-containing protein 8                         221   1e-63    
ref|XP_008794090.1|  PREDICTED: NAC domain-containing protein 5-l...    221   1e-63    
ref|XP_008794089.1|  PREDICTED: NAC domain-containing protein 5-l...    221   1e-63    
ref|XP_009120171.1|  PREDICTED: uncharacterized protein LOC103845...    220   1e-63    
emb|CDY64973.1|  BnaAnng19940D                                          220   1e-63    
ref|XP_009120173.1|  PREDICTED: uncharacterized protein LOC103845...    220   2e-63    
ref|XP_010483136.1|  PREDICTED: uncharacterized protein LOC104761...    221   2e-63    
ref|XP_010483139.1|  PREDICTED: uncharacterized protein LOC104761...    220   2e-63    
ref|XP_008649294.1|  PREDICTED: uncharacterized protein LOC103629...    228   2e-63    
ref|XP_010483137.1|  PREDICTED: uncharacterized protein LOC104761...    220   2e-63    
ref|XP_010545324.1|  PREDICTED: NAC domain-containing protein 78 ...    219   3e-63    
ref|XP_010545325.1|  PREDICTED: NAC domain-containing protein 78 ...    219   3e-63    
emb|CDY32872.1|  BnaC09g33190D                                          219   4e-63    
ref|XP_008798590.1|  PREDICTED: uncharacterized protein LOC103713...    220   4e-63    
gb|EPS67020.1|  hypothetical protein M569_07755                         213   4e-63    
ref|XP_008798589.1|  PREDICTED: NAC domain-containing protein 7-l...    220   4e-63    
ref|XP_010443312.1|  PREDICTED: uncharacterized protein LOC104726...    219   5e-63    
ref|XP_010443311.1|  PREDICTED: uncharacterized protein LOC104726...    219   6e-63    
emb|CDX78580.1|  BnaA03g04920D                                          215   6e-63    
ref|XP_009120174.1|  PREDICTED: uncharacterized protein LOC103845...    219   1e-62    
ref|XP_010451292.1|  PREDICTED: uncharacterized protein LOC104733...    218   1e-62    
ref|XP_010451300.1|  PREDICTED: uncharacterized protein LOC104733...    218   1e-62    
ref|XP_010451297.1|  PREDICTED: uncharacterized protein LOC104733...    218   1e-62    
gb|EMT28823.1|  NAC domain-containing protein 8                         219   2e-62    
ref|XP_010451307.1|  PREDICTED: uncharacterized protein LOC104733...    216   2e-62    
ref|XP_006399961.1|  hypothetical protein EUTSA_v10015728mg             215   3e-62    
ref|XP_010245577.1|  PREDICTED: NAC domain-containing protein 8-l...    214   4e-62    
ref|XP_010245578.1|  PREDICTED: NAC domain-containing protein 8-l...    214   4e-62    
ref|NP_200473.1|  NAC domain containing protein 99                      215   6e-62    
ref|XP_002866158.1|  ANAC099                                            215   7e-62    
ref|XP_006281924.1|  hypothetical protein CARUB_v10028131mg             214   1e-61    
gb|EYU43368.1|  hypothetical protein MIMGU_mgv1a012155mg                211   1e-61    
ref|XP_009132241.1|  PREDICTED: NAC domain-containing protein 8         211   1e-61    
gb|KEH30972.1|  NAC transcription factor-like protein                   211   3e-61    
ref|XP_006348970.1|  PREDICTED: NAC domain-containing protein 8-like    209   5e-61    
ref|XP_011043628.1|  PREDICTED: NAC domain-containing protein 8-like    210   5e-61    
ref|XP_008663317.1|  PREDICTED: NAC domain-containing protein 8-l...    213   6e-61    
ref|XP_006372761.1|  no apical meristem family protein                  210   7e-61    
ref|XP_010052266.1|  PREDICTED: NAC domain-containing protein 8-l...    210   8e-61    
ref|XP_002275319.1|  PREDICTED: NAC domain-containing protein 8         210   8e-61    
ref|XP_006467723.1|  PREDICTED: NAC domain-containing protein 8-l...    210   9e-61    
ref|XP_002448041.1|  hypothetical protein SORBIDRAFT_06g020103          209   9e-61    
gb|KHG25545.1|  NAC domain-containing 8 -like protein                   214   1e-60    
ref|XP_010924406.1|  PREDICTED: NAC domain-containing protein 8-like    209   1e-60    
gb|KCW76203.1|  hypothetical protein EUGRSUZ_D00591                     209   1e-60    
ref|XP_003541523.1|  PREDICTED: NAC domain-containing protein 8-like    210   1e-60    
gb|KHN09961.1|  NAC domain-containing protein 8                         210   1e-60    
ref|XP_010052264.1|  PREDICTED: NAC domain-containing protein 8-like    209   1e-60    
ref|XP_004243384.1|  PREDICTED: NAC domain-containing protein 8         208   2e-60    
ref|XP_006449416.1|  hypothetical protein CICLE_v10015976mg             209   2e-60    
ref|XP_010052263.1|  PREDICTED: NAC domain-containing protein 8-like    209   2e-60    
ref|XP_002278661.1|  PREDICTED: NAC domain-containing protein 8 i...    209   2e-60    
gb|EMS51277.1|  NAC domain-containing protein 8                         214   2e-60    
gb|KCW76204.1|  hypothetical protein EUGRSUZ_D00592                     206   3e-60    
gb|AGC27318.1|  NAC domain protein 15                                   207   4e-60    
gb|KHG01044.1|  NAC domain-containing 8 -like protein                   207   4e-60    
gb|AIA57519.1|  NAC domain-containing protein                           209   4e-60    
ref|XP_003628924.1|  NAC domain protein                                 206   5e-60    
ref|XP_002509421.1|  NAC domain-containing protein 21/22, putative      208   5e-60    
ref|XP_007043703.1|  NAC domain containing protein 73                   207   5e-60    
ref|XP_003540939.1|  PREDICTED: NAC domain-containing protein 8-like    207   5e-60    
ref|XP_011047704.1|  PREDICTED: NAC domain-containing protein 8-like    207   5e-60    
emb|CDO99486.1|  unnamed protein product                                208   6e-60    
ref|XP_011047705.1|  PREDICTED: NAC domain-containing protein 8-like    207   6e-60    
ref|XP_007160521.1|  hypothetical protein PHAVU_002G328700g             207   6e-60    
emb|CBI30617.3|  unnamed protein product                                208   6e-60    
gb|KEH30715.1|  NAC transcription factor-like protein                   207   7e-60    
gb|EMT27068.1|  NAC domain-containing protein 8                         214   7e-60    
gb|AHF27222.1|  NAC transcription factor                                207   7e-60    
ref|XP_011086035.1|  PREDICTED: NAC domain-containing protein 8-like    207   7e-60    
ref|XP_004505101.1|  PREDICTED: NAC domain-containing protein 8-l...    208   7e-60    
ref|XP_008663316.1|  PREDICTED: NAC domain-containing protein 8-l...    212   7e-60    
ref|XP_004966091.1|  PREDICTED: uncharacterized protein LOC101753...    212   8e-60    
ref|XP_004966092.1|  PREDICTED: uncharacterized protein LOC101753...    212   9e-60    
ref|XP_003529352.1|  PREDICTED: NAC domain-containing protein 8-like    208   1e-59    
ref|XP_002458293.1|  hypothetical protein SORBIDRAFT_03g030750          207   1e-59    
ref|XP_009352845.1|  PREDICTED: NAC domain-containing protein 8-like    207   1e-59    
ref|XP_008353454.1|  PREDICTED: NAC domain-containing protein 8-like    207   1e-59    
ref|XP_010655462.1|  PREDICTED: NAC domain-containing protein 8 i...    208   1e-59    
ref|XP_008383681.1|  PREDICTED: NAC domain-containing protein 8-like    207   1e-59    
ref|XP_008225157.1|  PREDICTED: NAC domain-containing protein 8-like    207   1e-59    
ref|XP_007211644.1|  hypothetical protein PRUPE_ppa008828mg             207   2e-59    
ref|XP_010260337.1|  PREDICTED: NAC domain-containing protein 8-like    206   2e-59    
ref|XP_002517849.1|  transcription factor, putative                     206   2e-59    
ref|XP_010655461.1|  PREDICTED: NAC domain-containing protein 8 i...    207   2e-59    
ref|XP_008798265.1|  PREDICTED: NAC domain-containing protein 8-like    206   2e-59    
ref|XP_009394825.1|  PREDICTED: NAC domain-containing protein 8-like    206   2e-59    
ref|XP_008442882.1|  PREDICTED: NAC domain-containing protein 8-like    206   3e-59    
ref|XP_002440245.1|  hypothetical protein SORBIDRAFT_09g028430          206   3e-59    
ref|XP_006446708.1|  hypothetical protein CICLE_v100178222mg            204   3e-59    
ref|XP_007132767.1|  hypothetical protein PHAVU_011G123400g             205   3e-59    
ref|XP_006852575.1|  hypothetical protein AMTR_s00021p00209320          205   3e-59    
ref|XP_011096365.1|  PREDICTED: NAC domain-containing protein 8-like    206   3e-59    
ref|XP_004293895.1|  PREDICTED: NAC domain-containing protein 8-l...    206   3e-59    
gb|AGL39751.1|  NAC transcription factor 095                            206   4e-59    
ref|XP_010057358.1|  PREDICTED: NAC domain-containing protein 8-like    206   4e-59    
ref|XP_007025530.1|  NAC domain containing protein 73                   206   4e-59    
ref|XP_010689784.1|  PREDICTED: NAC domain-containing protein 8-like    204   4e-59    
ref|XP_009344641.1|  PREDICTED: NAC domain-containing protein 8-like    206   4e-59    
ref|XP_008371419.1|  PREDICTED: NAC domain-containing protein 8         206   4e-59    
ref|XP_002968582.1|  hypothetical protein SELMODRAFT_67638              201   5e-59    
gb|KHG10942.1|  NAC domain-containing 8 -like protein                   205   5e-59    
gb|KDO49574.1|  hypothetical protein CISIN_1g021635mg                   205   6e-59    
ref|XP_006469079.1|  PREDICTED: NAC domain-containing protein 8-like    205   6e-59    
gb|KGN64707.1|  hypothetical protein Csa_1G076100                       205   6e-59    
ref|XP_011027766.1|  PREDICTED: NAC domain-containing protein 8         205   7e-59    
gb|AHJ79197.1|  NAC domain protein NAC56                                205   7e-59    
gb|AHN09801.1|  NAC transcription factor                                205   8e-59    
ref|XP_010919316.1|  PREDICTED: NAC domain-containing protein 8-like    204   8e-59    
ref|XP_002975901.1|  hypothetical protein SELMODRAFT_58101              200   9e-59    
ref|XP_010447971.1|  PREDICTED: NAC domain-containing protein 8-like    204   9e-59    
gb|AHJ79168.1|  NAC domain protein NAC27                                205   1e-58    
ref|XP_010433209.1|  PREDICTED: NAC domain-containing protein 8-l...    204   1e-58    
gb|AAT38066.1|  unknown protein                                         206   1e-58    
ref|XP_004969491.1|  PREDICTED: NAC domain-containing protein 8-like    205   1e-58    
ref|XP_010111169.1|  NAC domain-containing protein 8                    206   1e-58    
ref|XP_007148112.1|  hypothetical protein PHAVU_006G181500g             204   1e-58    
gb|KFK29384.1|  hypothetical protein AALP_AA7G126500                    204   1e-58    
gb|KHG24850.1|  NAC domain-containing 8 -like protein                   204   1e-58    
gb|EAY99021.1|  hypothetical protein OsI_20979                          204   1e-58    
ref|NP_001056323.1|  Os05g0563000                                       204   1e-58    
ref|XP_006377419.1|  hypothetical protein POPTR_0011s05740g             206   2e-58    
ref|XP_004148793.1|  PREDICTED: NAC domain-containing protein 8-like    204   2e-58    
emb|CDY38383.1|  BnaC01g09920D                                          204   2e-58    
ref|XP_010316779.1|  PREDICTED: NAC domain-containing protein 8         203   2e-58    
ref|XP_010433210.1|  PREDICTED: NAC domain-containing protein 8-l...    204   2e-58    
ref|XP_011001220.1|  PREDICTED: NAC domain-containing protein 8-like    204   2e-58    
ref|XP_002440751.1|  hypothetical protein SORBIDRAFT_09g006018          202   2e-58    
ref|XP_009406259.1|  PREDICTED: NAC domain-containing protein 8-l...    203   2e-58    
ref|XP_004505536.1|  PREDICTED: NAC domain-containing protein 8-like    203   2e-58    
gb|AAU10833.1|  unknown protein                                         205   2e-58    



>ref|XP_009799111.1| PREDICTED: NAC domain-containing protein 8-like [Nicotiana sylvestris]
Length=392

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 238/386 (62%), Positives = 288/386 (75%), Gaps = 20/386 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +K++NAS+PA ++I+DCGA R+CPNCH+ IDN+DVS +WPG P GVKF+PSDVELLE+L 
Sbjct  14    RKIKNASAPAAHQIKDCGAKRQCPNCHYCIDNNDVSQDWPGLPVGVKFDPSDVELLEYLE  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
              KCG GNS+ H F+DEFIPTL+  EGICYTHPENLPG KKDGSS HFFYR   AY+TG R
Sbjct  74    EKCGVGNSKQHKFIDEFIPTLDIYEGICYTHPENLPGAKKDGSSVHFFYRITNAYSTGKR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKIS+E +L+ EHVRWHKTGKTK VM+NG+QKGCKKVMVLY +TKKG K  KT+WVMH
Sbjct  134   KRRKISDENNLIKEHVRWHKTGKTKVVMDNGLQKGCKKVMVLYQNTKKGLKQEKTHWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQA-----IPTTPMTAIPNPP  474
             QYHLG DEDEKEG YVVSKI+YQQQ+Q    +++  ++   A      PTTP T  PNPP
Sbjct  194   QYHLGTDEDEKEGEYVVSKIFYQQQKQSVKPNDSRVNEEASAGANHTGPTTPKTVTPNPP  253

Query  473   RAAGETPLSCDDYNAALSP--PAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAA  303
             R AGETP SCDD+     P  P +EVE  K+       SD  VK E EYP CLAGESQ  
Sbjct  254   R-AGETP-SCDDFIDDSLPFSPDQEVEVAKEPGQS---SDATVKSEMEYPTCLAGESQ-G  307

Query  302   ADATDIDDFLLCDEIVGSF--DF-NNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE  132
             ADA D+D+ LLCDE++ S+   F +NL S+   + N + +PQ   NT+    I++L NLE
Sbjct  308   ADANDVDNSLLCDELLASYLDSFEHNLGSSTEYTHNTSHLPQGNGNTTCG--ISELDNLE  365

Query  131   LDSAPEFSLQDLPFGSQDSISSWLDR  54
             LD+ P+F L DLPFGSQ+SI SWLDR
Sbjct  366   LDTPPDFQLADLPFGSQESIFSWLDR  391



>ref|XP_006338624.1| PREDICTED: NAC domain-containing protein 8-like [Solanum tuberosum]
Length=418

 Score =   431 bits (1107),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 240/387 (62%), Positives = 279/387 (72%), Gaps = 21/387 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS+PA ++I+DCGA R+CPNCH+ IDN DVS EWPG P GVKF+PSD EL+EHL A
Sbjct  40    KVKNASAPAAHQIKDCGAKRQCPNCHYSIDNKDVSHEWPGLPVGVKFDPSDAELVEHLEA  99

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNSE H F+DEFIPTL+  EGICYTHPENLPG KKDGSS HFFYR   AYATG RK
Sbjct  100   KCGVGNSEQHKFIDEFIPTLDVHEGICYTHPENLPGAKKDGSSIHFFYRITNAYATGKRK  159

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQ  636
             RRKI +E +L+ EHVRWHKTGKTK VMENG QKGCKKVMVLY T KKG K  KTNWVMHQ
Sbjct  160   RRKIHDENNLMKEHVRWHKTGKTKVVMENGFQKGCKKVMVLYQTIKKGSKQEKTNWVMHQ  219

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD-----IPQAIPTTPMTAIPNPPR  471
             YHLG DEDEKEG YVVSKI YQQQ+Q    +++ +++       Q  PTTP T  PNPPR
Sbjct  220   YHLGPDEDEKEGEYVVSKILYQQQKQSVKANDSSDNEEASVGANQTGPTTPKTVTPNPPR  279

Query  470   AAGETPLSCDDYNAALS-PPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAAAD  297
               GETP   D  + +L   P +EVE  K+       SD ++KCE EY  CLAGESQ AAD
Sbjct  280   -DGETPSYDDIVDDSLPFSPDQEVEVAKEPGQP---SDAKIKCEMEYTTCLAGESQ-AAD  334

Query  296   ATDIDDFLLCDE-----IVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE  132
             A D+D+ LLCDE      + SF  N  PS   T +  + +PQE  NT+    I++L NLE
Sbjct  335   ANDVDNSLLCDEHNDYSFLDSFGPNLGPSADYTHSTCH-LPQENGNTTCG--ISELDNLE  391

Query  131   LDSAPEFSLQDLPFGSQDSISSWLDRL  51
              DS P+F L DLPFGSQ++I SWLDRL
Sbjct  392   PDSPPDFQLADLPFGSQENIFSWLDRL  418



>ref|XP_009622368.1| PREDICTED: NAC domain-containing protein 8-like [Nicotiana tomentosiformis]
Length=392

 Score =   429 bits (1104),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 233/386 (60%), Positives = 284/386 (74%), Gaps = 20/386 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +K++NAS+P  ++I+DCGA R+CPNCH+ IDN+DVS EWPG P GVKF+PSDVELLE+L 
Sbjct  14    RKIKNASAPTAHQIKDCGAKRQCPNCHYCIDNNDVSQEWPGLPVGVKFDPSDVELLEYLE  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
              KCG GNS+ H F+DEFIPTL+  EGICYTHPENLPG KKDGSS HFFYR   AYATG R
Sbjct  74    EKCGVGNSKQHKFIDEFIPTLDIYEGICYTHPENLPGAKKDGSSIHFFYRITNAYATGKR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKIS+E +L  EHVRWHKTGKTK VMENG+QKGCKKVMVLY +TKKG K  KT+WVMH
Sbjct  134   KRRKISDENNLRKEHVRWHKTGKTKVVMENGLQKGCKKVMVLYQTTKKGLKQEKTHWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD-----IPQAIPTTPMTAIPNPP  474
             QYHLG DEDEKEG YVVSKI+YQQQ+Q    +++  ++       QA PTTP T  PNPP
Sbjct  194   QYHLGTDEDEKEGEYVVSKIFYQQQKQSVKANDSHVNEETSGGANQAGPTTPKTVTPNPP  253

Query  473   RAAGETPLSCDDYNAALSP--PAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAA  303
             RA     LSCD++     P  P +EVE  K+       SD +VK E EY  CLAGESQ  
Sbjct  254   RAG--VTLSCDNFVDDSLPFSPDQEVEVAKEPGQS---SDAKVKSEMEYHTCLAGESQ-G  307

Query  302   ADATDIDDFLLCDEIVGSF--DF-NNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE  132
             ADA ++D+ LLCDE++ S+   F +N+ S+   + N   +PQ   N +++  I++L NLE
Sbjct  308   ADANNVDNSLLCDELLASYLDSFEHNIGSSTDYAHNTCHLPQ--GNANTTCGISELDNLE  365

Query  131   LDSAPEFSLQDLPFGSQDSISSWLDR  54
             LD+ P+F L DLPFGSQ+SI SWLDR
Sbjct  366   LDTPPDFQLADLPFGSQESIFSWLDR  391



>emb|CDP02050.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   427 bits (1099),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 238/394 (60%), Positives = 278/394 (71%), Gaps = 28/394 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+ P  ++I+DCGA RECP CH++IDNSD+  EWPG PAGVKF+PSDVELLEHLAA
Sbjct  15    KVKNATLPTAHQIKDCGANRECPKCHYIIDNSDICHEWPGLPAGVKFDPSDVELLEHLAA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNSE H F+DEFIPTLEG EGICYTHPENLPG KKDGSS HFFYRT  AYATG RK
Sbjct  75    KCGVGNSESHKFIDEFIPTLEGHEGICYTHPENLPGAKKDGSSVHFFYRTTNAYATGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQ  636
             RRKI  E SL+ E VRWHKTGKTK VM+NG+QKGCKK+MVLY T  +G KP K+NWVMHQ
Sbjct  135   RRKIQIENSLIKEQVRWHKTGKTKTVMDNGIQKGCKKIMVLYRTSNRGSKPDKSNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGES-------DI--PQAIPTTPMTAIP  483
             YHLG DEDEKEG YVVSKI+YQQ +Q+    NA +        DI   +  P TP    P
Sbjct  195   YHLGSDEDEKEGQYVVSKIFYQQHKQQSDKHNAYDGSPSILDYDIGTSRTSPRTPKIVTP  254

Query  482   NPPRAAGETPL---SCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGE  315
             NPPR  GETP    + DDY  ++ P  +E+ G  KE   S  SD QVK + E+   LAGE
Sbjct  255   NPPR-PGETPSFDDATDDY--SMQPSFQEM-GFAKEALNSSSSDAQVKDKTEHNTWLAGE  310

Query  314   SQAAADATDIDDFLLCDEIVGS------FDFNNLPSNHATSANFNPMPQEANNTSSSTNI  153
             SQ AAD   +D+ LLC+EI+ S      F  +  P +  T  N N +PQ     SS+  I
Sbjct  311   SQ-AADVNGVDELLLCNEIIDSSILSSDFGLDGGPFSGLTR-NTNDVPQVVG--SSACGI  366

Query  152   ADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             A+L NLELDS P+F L DL FGSQDS+ SWLD+L
Sbjct  367   AELENLELDSPPDFQLGDLNFGSQDSVFSWLDKL  400



>ref|XP_004231842.1| PREDICTED: NAC domain-containing protein 8 [Solanum lycopersicum]
Length=393

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 279/387 (72%), Gaps = 21/387 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS+PA ++I+DCGA R+CPNC++ IDN DVS EWPG P GVKF+PSD EL+EHL A
Sbjct  15    KVKNASAPAAHQIKDCGAKRQCPNCNYSIDNKDVSHEWPGLPVGVKFDPSDAELVEHLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNSE H F+DEFIPTLE  EGICYTHPENLPG KKDGSS HFFYR   AYATG RK
Sbjct  75    KCGVGNSEQHKFIDEFIPTLEVHEGICYTHPENLPGSKKDGSSIHFFYRITNAYATGKRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQ  636
             RRKI +E +L+ EHVRWHKTGKTK VMENG QKGCKKVMVLY T KKG K  KTNWVMHQ
Sbjct  135   RRKIHDENNLMKEHVRWHKTGKTKVVMENGFQKGCKKVMVLYQTLKKGSKQEKTNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD-----IPQAIPTTPMTAIPNPPR  471
             YHLG DEDEKEG YVVSKI+YQQQ+Q    ++  +++       Q  PTTP T  PNPPR
Sbjct  195   YHLGPDEDEKEGEYVVSKIFYQQQKQSVKANDCCDNEEASVGANQTGPTTPKTVTPNPPR  254

Query  470   AAGETPLSCDDYNAALS-PPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAAAD  297
               GETP   D  + +L   P +EVE  K+       SD ++KCE EY  CLAGESQ AAD
Sbjct  255   -DGETPSYDDILDESLPFSPDQEVEVAKEPGQP---SDAKIKCEMEYSTCLAGESQ-AAD  309

Query  296   ATDIDDFLLCDE-----IVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE  132
             A D+ + LLCDE     ++ SF  N  PS   T +  + +P+   NT+    I++L NLE
Sbjct  310   ANDVHNSLLCDEHNDYSLLDSFGPNLGPSVDYTHSTCH-LPEVNGNTTCG--ISELDNLE  366

Query  131   LDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LDS P+F L DLPFGSQ++I SWLDRL
Sbjct  367   LDSPPDFQLADLPFGSQENIFSWLDRL  393



>ref|XP_011097382.1| PREDICTED: NAC domain-containing protein 8-like [Sesamum indicum]
Length=394

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 214/391 (55%), Positives = 258/391 (66%), Gaps = 26/391 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA  PA  +I+DCGA R+CPNC HLIDNSDVS EWPG PAGVKF+PSDVELL+HLA
Sbjct  14    KKVKNAGLPAAYQIKDCGANRQCPNCQHLIDNSDVSHEWPGLPAGVKFDPSDVELLDHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AK G GN +PH+F+DEFIPTLEG EGICYTHPENLPG+KKDGSS HFFY+   AYA+G R
Sbjct  74    AKRGVGNLKPHIFIDEFIPTLEGIEGICYTHPENLPGVKKDGSSVHFFYKIVNAYASGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKG----EKPGKTNW  648
             KRR+I ++ SL+  HVRWHKTGKTK VMENGV  G KK+MVLY+T K      KP K NW
Sbjct  134   KRRRIQDQESLINAHVRWHKTGKTKPVMENGVHIGFKKIMVLYATSKTGSMRTKPDKCNW  193

Query  647   VMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI--------PQAIPTTPMT  492
             VMHQ+HLG DEDE+EG YVVSKI+Y  Q  K+T D  G S +         Q IP TP T
Sbjct  194   VMHQFHLGTDEDEQEGEYVVSKIFY--QLPKETDDKNGTSLVIEEPDIGTAQVIPRTPKT  251

Query  491   AIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKK---ERYGSLWSDVQVKCEEYPGCLA  321
               P+PPRA    P  C   N  +    +E +  K+      GS   D      +Y  CLA
Sbjct  252   NTPDPPRAEKTPPSDCGSDNYFIQALVKEEDYLKELSPRSCGSWLGDEM----QYTTCLA  307

Query  320   GESQAAADATDIDDFLLCDEIVGSFDFN-NLPSNHATSANFNPMPQEANNTSSSTNIADL  144
             G S+A   +    D LLC+EI+  +  + NL S + +S +   + Q   N  SS  I DL
Sbjct  308   GNSEAFYLSR--ADSLLCNEILDPYAASGNLRSKNGSSTHLGDVQQRDGN--SSCGIGDL  363

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              NL+LD+ P+F L DL F SQDS+  WLDR 
Sbjct  364   DNLDLDTPPDFQLTDLQFASQDSVFDWLDRF  394



>ref|XP_007031605.1| NAC domain transcriptional regulator superfamily protein, putative 
[Theobroma cacao]
 gb|EOY02531.1| NAC domain transcriptional regulator superfamily protein, putative 
[Theobroma cacao]
Length=392

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 265/388 (68%), Gaps = 22/388 (6%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NAS  +  RI DCG+ RECP CH+ IDNSDV+P+WPG PAGVKF+PSD ELLEHLA
Sbjct  14    KKVKNASWSSSIRITDCGSNRECPKCHYCIDNSDVTPQWPGLPAGVKFDPSDAELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GNS+ H+F+DEFIPTLE D+GICYTHPENLPG  KDGSS HFF+RT  AYATG R
Sbjct  74    AKCGVGNSKAHLFIDEFIPTLEEDKGICYTHPENLPGANKDGSSVHFFHRTINAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI N+ +   EHVRWHKTGKTK V+ENGVQKG KK+MVLY S+K+G KP K+NWVMH
Sbjct  134   KRRKIQNQHNSNEEHVRWHKTGKTKPVIENGVQKGWKKIMVLYKSSKRGCKPEKSNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIP-----QAIPTTPMTAIPNPP  474
             QYHLG +E+E +G YVVSKI+YQQQ+Q    D+    + P     +  P TP T  PNPP
Sbjct  194   QYHLGAEEEEHDGEYVVSKIFYQQQKQNDKNDDNPMVEEPDTSTIRTSPRTPKTIPPNPP  253

Query  473   RAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE---EYPGCLAGESQAA  303
             R      +  DD +  +   A      K +   S      V+CE   +Y   LAGESQ A
Sbjct  254   RPWKS--MMDDDLDENMQQEA------KFDAEASHVPPHAVQCEDGLDYVAWLAGESQ-A  304

Query  302   ADATDID--DFLLCDEIVGSFD-FNNLPSNHAT-SANFNPMPQEANNTSSSTNIADLVNL  135
             A+ +D++  D LLCDEI+ S     N   N A+ + + + + + A N   S  I++L NL
Sbjct  305   AETSDLNCLDNLLCDEIMDSSSLLKNSGKNQASYTGSVHSINEVAGNNDVSCGISELENL  364

Query  134   ELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             + D+ P+  L DL FGSQ+SI SWLDRL
Sbjct  365   DFDTPPDLPLADLQFGSQESILSWLDRL  392



>ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Vitis 
vinifera]
 emb|CBI34849.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 215/389 (55%), Positives = 259/389 (67%), Gaps = 18/389 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA+    ++I+DCGA RECPNCHH IDNSDVS EWPG PAGVKF+PSDV+LLEHLA
Sbjct  14    RKVKNATQSFASQIKDCGANRECPNCHHRIDNSDVSHEWPGLPAGVKFDPSDVQLLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN +PH+ +DEFIPTLE D+GICYTHPENLPG KKDG S HFF+RT  AYATG R
Sbjct  74    AKCGVGNGKPHVLIDEFIPTLEEDKGICYTHPENLPGAKKDGGSIHFFHRTTNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +      EHVRWHKTGKTK V+ENGVQKGCKK+MVLY S+KKG KP K+NWVMH
Sbjct  134   KRRKIHSLHGSTEEHVRWHKTGKTKPVIENGVQKGCKKIMVLYKSSKKGSKPDKSNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN---AGESDIPQAIPTTPMTAIPNPPRA  468
             QYHLG +EDE+E  YVVSK++YQ Q+Q +T DN     E D   +  +        P   
Sbjct  194   QYHLGTEEDEREDEYVVSKVFYQPQKQTETNDNIPVIEELDAVTSQTSPRTPKTTTPNPP  253

Query  467   AGETPLSCDDYNAALSP--PAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA--A  300
               E  + C +     +P   A++ E   +  + +  +D      EYP  LAGESQA   A
Sbjct  254   RSEKSVFCANAGDDSTPHGSAQKAEFVGEASHPNPSTDQIENNMEYPLWLAGESQAIEDA  313

Query  299   DATDIDDFLLCDEIV--GSFDFNNLPSNH----ATSANFNPMPQEANNTSSSTNIADLVN  138
             D   + D LLC EI   G+  ++    NH      S N N +P + N   +   IADL N
Sbjct  314   DQNGLHDSLLCKEIFYPGAPHYDT-GLNHGPVIGFSHNMNGIPGDHN---APCGIADLEN  369

Query  137   LELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LELD+ P+F L DL FGSQDSI  WLDRL
Sbjct  370   LELDTPPDFQLADLQFGSQDSIFGWLDRL  398



>ref|XP_007215505.1| hypothetical protein PRUPE_ppa006948mg [Prunus persica]
 gb|EMJ16704.1| hypothetical protein PRUPE_ppa006948mg [Prunus persica]
Length=389

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 211/385 (55%), Positives = 255/385 (66%), Gaps = 21/385 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+  +  +I+DCGA R+CPNCH +IDNSDV  EWPG PAGVKF+PSD ELLEHLAA
Sbjct  15    KVKNAALSSAYQIKDCGANRDCPNCHFVIDNSDVLSEWPGLPAGVKFDPSDAELLEHLAA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PHMF+DEFIPTL GD GI Y HP NLPG K DGSS HFF++T  AYATG RK
Sbjct  75    KCGVGNSKPHMFIDEFIPTLAGDNGIYYDHPANLPGSKNDGSSFHFFHKTINAYATGHRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+    SL  EHVRWHKTGKTK +MENGVQKGCKK+MVLY S+KKG K  K+NWVMHQ
Sbjct  135   RRKVDCHRSLAAEHVRWHKTGKTKPIMENGVQKGCKKIMVLYKSSKKGSKADKSNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN--AGESDIPQ--AIPTTPMTAIPNPPRA  468
             YHLG ++ EKEG YVVSKI+YQQ +Q +T DN    E D+      P TP+T+ PNPPR 
Sbjct  195   YHLGTEDGEKEGEYVVSKIFYQQHKQSETNDNNLVIEDDVNALGTSPRTPITSAPNPPRP  254

Query  467   AGETPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQA--AA  300
                  + CDD      L   A+E E     ++G    D           LAGESQA    
Sbjct  255   G--KSVGCDDVPDEDVLDSSAKEAELVPGTQFGDNIGDTT--------WLAGESQADENC  304

Query  299   DATDIDDFLLCDEIVGSFD-FNNLPSNHATSANF-NPMPQEANNTSSSTNIADLVNLELD  126
             D   ++D LLC E   S    N   ++  +S +F + +     N+S+S  I DL N++L 
Sbjct  305   DLDCLEDTLLCKETFDSSTLLNGSFADGISSTDFPSNIYGVTGNSSTSCGIGDLENIDLG  364

Query  125   SAPEFSLQDLPFGSQDSISSWLDRL  51
             + P+F L DL F SQDS+  WLDRL
Sbjct  365   TPPDFQLADLQFCSQDSLLGWLDRL  389



>gb|KHG21250.1| NAC domain-containing 8 -like protein [Gossypium arboreum]
Length=387

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 211/389 (54%), Positives = 263/389 (68%), Gaps = 29/389 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NAS  +  +I DCGA RECPNCH+ IDNSDV P+WPG P GVKF+PSD ELL+HLA
Sbjct  14    KKVKNASWSSSVQITDCGANRECPNCHYRIDNSDVFPQWPGLPVGVKFDPSDAELLDHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG G+S+ H+F+DEFI TL   +GICYTHPENLPG +KDGSS HFF+RT  AY+TG R
Sbjct  74    AKCGVGDSKEHLFIDEFILTLGDCQGICYTHPENLPGARKDGSSIHFFHRTINAYSTGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI N+ S   EHVRWHKTGKTK V ENGV KG KK+MVLY STKKG KP K+NWVM+
Sbjct  134   KRRKIQNQDSTNEEHVRWHKTGKTKPVTENGVHKGWKKIMVLYKSTKKGCKPEKSNWVMY  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI-----PTTPMTAIPNPP  474
             QYHLG  EDE +G YVVSKI+YQQQ+Q +  D++  ++ P  +     P TP T  P+PP
Sbjct  194   QYHLGDTEDEHDGEYVVSKIFYQQQKQTEKNDDSPMTEEPDNLMIHTSPRTPKTITPDPP  253

Query  473   RAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQ---VKCE---EYPGCLAGES  312
             R      L  DD    +   A          +    SDV    V+CE   +YP  LAGES
Sbjct  254   RPWKSMML--DDIEENMHQEA---------NFAVERSDVHTDAVQCEDNSDYPAWLAGES  302

Query  311   QAAA--DATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVN  138
             QA    D    D+FLLC+E++   D ++LP+ +   A+   +  + NN  +S  I++L N
Sbjct  303   QAVENPDFNGFDEFLLCNELL---DSSSLPTTNDPKADCAAIETKGNN-DASCGISELEN  358

Query  137   LELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LE D+ P+ +L DL FGSQ+SI SWLDRL
Sbjct  359   LEFDTPPDVTLADLQFGSQESILSWLDRL  387



>ref|XP_008230522.1| PREDICTED: NAC domain-containing protein 8 [Prunus mume]
Length=387

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 212/392 (54%), Positives = 255/392 (65%), Gaps = 37/392 (9%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+  +  +I+DCGA R+CPNCH +IDNSDV  EWPG PAGVKF+PSD ELLEHLAA
Sbjct  15    KVKNAARSSAYQIKDCGANRDCPNCHFVIDNSDVLSEWPGLPAGVKFDPSDAELLEHLAA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PHMF+DEFIPTL+GD GI Y HP NLPG K DGSS HFF++T  AYATG RK
Sbjct  75    KCGVGNSKPHMFIDEFIPTLDGDNGIYYDHPANLPGSKNDGSSFHFFHKTINAYATGHRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+    SL  EHVRWHKTGKTK +MENGVQKGCKK+MVLY S+KKG K  K+NWVMHQ
Sbjct  135   RRKVDCHRSLAAEHVRWHKTGKTKPIMENGVQKGCKKIMVLYKSSKKGSKADKSNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN--AGESDIPQ--AIPTTPMTAIPNPPRA  468
             YHLG ++ EKEG YVVSKI+YQQ +Q +T DN    E D+      P TP+T+ PNPPR 
Sbjct  195   YHLGTEDGEKEGEYVVSKIFYQQHKQSETNDNNLVIEDDVNALGTSPRTPITSAPNPPRP  254

Query  467   AGETPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQA--AA  300
                  + CDD      L   A+E E     ++     D           LAGESQA    
Sbjct  255   G--KSVGCDDVPDEDVLHSSAKEAELVPGTQFEDNIGDTT--------WLAGESQADENC  304

Query  299   DATDIDDFLLCDE-------IVGSF--DFNNLPSNHATSANFNPMPQEANNTSSSTNIAD  147
             D   ++D LLC E       + GSF     + PSN         +     N+S+S  I D
Sbjct  305   DLDCLEDTLLCKETFNSSTLLNGSFADRITDFPSN---------IYGVTGNSSTSCGIGD  355

Query  146   LVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             L N++L + P+F L DL FGSQ+S+  WLDRL
Sbjct  356   LENIDLGTPPDFQLADLQFGSQESLLGWLDRL  387



>ref|XP_010660847.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Vitis 
vinifera]
Length=447

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/389 (55%), Positives = 259/389 (67%), Gaps = 18/389 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA+    ++I+DCGA RECPNCHH IDNSDVS EWPG PAGVKF+PSDV+LLEHLA
Sbjct  63    RKVKNATQSFASQIKDCGANRECPNCHHRIDNSDVSHEWPGLPAGVKFDPSDVQLLEHLA  122

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN +PH+ +DEFIPTLE D+GICYTHPENLPG KKDG S HFF+RT  AYATG R
Sbjct  123   AKCGVGNGKPHVLIDEFIPTLEEDKGICYTHPENLPGAKKDGGSIHFFHRTTNAYATGQR  182

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +      EHVRWHKTGKTK V+ENGVQKGCKK+MVLY S+KKG KP K+NWVMH
Sbjct  183   KRRKIHSLHGSTEEHVRWHKTGKTKPVIENGVQKGCKKIMVLYKSSKKGSKPDKSNWVMH  242

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN---AGESDIPQAIPTTPMTAIPNPPRA  468
             QYHLG +EDE+E  YVVSK++YQ Q+Q +T DN     E D   +  +        P   
Sbjct  243   QYHLGTEEDEREDEYVVSKVFYQPQKQTETNDNIPVIEELDAVTSQTSPRTPKTTTPNPP  302

Query  467   AGETPLSCDDYNAALSP--PAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA--A  300
               E  + C +     +P   A++ E   +  + +  +D      EYP  LAGESQA   A
Sbjct  303   RSEKSVFCANAGDDSTPHGSAQKAEFVGEASHPNPSTDQIENNMEYPLWLAGESQAIEDA  362

Query  299   DATDIDDFLLCDEIV--GSFDFNNLPSNH----ATSANFNPMPQEANNTSSSTNIADLVN  138
             D   + D LLC EI   G+  ++    NH      S N N +P + N   +   IADL N
Sbjct  363   DQNGLHDSLLCKEIFYPGAPHYDT-GLNHGPVIGFSHNMNGIPGDHN---APCGIADLEN  418

Query  137   LELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LELD+ P+F L DL FGSQDSI  WLDRL
Sbjct  419   LELDTPPDFQLADLQFGSQDSIFGWLDRL  447



>gb|AGL39749.1| NAC transcription factor 093 [Jatropha curcas]
 gb|KDP46403.1| hypothetical protein JCGZ_10243 [Jatropha curcas]
Length=402

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 261/391 (67%), Gaps = 20/391 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KVRN +  +  +I+  GA RECPNCHH IDNSDVS +WPG PAGVKF+PSD ELLEHL A
Sbjct  15    KVRNPARTSAYQIKGYGAHRECPNCHHCIDNSDVSHDWPGLPAGVKFDPSDAELLEHLTA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PH F+DEFIPTL+ D+GICYTHPE LPG KKDGSS HFF+RT  AY+TG RK
Sbjct  75    KCGVGNSKPHSFIDEFIPTLDEDKGICYTHPEKLPGAKKDGSSIHFFHRTINAYSTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI NE     E VRWHKTGKTK+VMENGVQKGCKK+MVLY S+KKG KP K+NWVMHQ
Sbjct  135   RRKIHNEQGSNEEQVRWHKTGKTKSVMENGVQKGCKKIMVLYRSSKKGSKPDKSNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAG------ESDIPQAIPTTPMTAIPNPP  474
             Y LG ++DEKEG YVVSKI+YQQQ+Q    DN+G      ++D+     +        P 
Sbjct  195   YQLGTEDDEKEGEYVVSKIFYQQQKQ---NDNSGDGPVIEDADVLALQASPRTPNTNPPN  251

Query  473   RAAGETPLSCDDY-NAALSPPAEEVEGG-KKERYGSLWSDVQVKCEE--YPGCLAGESQA  306
                 +   +C+D  +     P+ +VE G  K+ +     DVQ + ++  Y   LAGESQA
Sbjct  252   PPRPKKSDTCEDVADEKKVVPSSQVEPGIIKKEFEVPVPDVQPEDDDVGYATWLAGESQA  311

Query  305   A--ADATDIDDFLLCDEIV-GS---FDFNNLPSNHATSANFNPMPQEANNTSSSTNIADL  144
                +D + IDD LLC EI+ GS   F+ + L +   TS   N       N  +S  IADL
Sbjct  312   VENSDFSGIDDSLLCKEILDGSSLLFNSSGLNNVSCTSIASNTNQLTTRNNDTSYGIADL  371

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              NLELD+ P+F   DL F SQDSI  WLDR+
Sbjct  372   ENLELDTPPDFQFGDLQFSSQDSILDWLDRI  402



>ref|XP_006446621.1| hypothetical protein CICLE_v10015507mg [Citrus clementina]
 gb|ESR59861.1| hypothetical protein CICLE_v10015507mg [Citrus clementina]
Length=397

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 215/398 (54%), Positives = 256/398 (64%), Gaps = 37/398 (9%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVRNA+  +   I+D GA RECPNCH+ IDNSDVSPEWPG P GVKF+PSDVELLEHLA
Sbjct  14    KKVRNAARSSAQLIKDYGANRECPNCHYFIDNSDVSPEWPGLPIGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GNS+PHMF+DEFIPT+EGD+GICYTHPENLPG KKDGSS HFF+RT  AYATG R
Sbjct  74    AKCGVGNSKPHMFIDEFIPTIEGDQGICYTHPENLPGAKKDGSSVHFFHRTTNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E SL  EHVRWHKTGKTK V+ENG+QKGC+K+MVLY STKKG KP K+NWVMH
Sbjct  134   KRRKIQSEHSLNEEHVRWHKTGKTKPVIENGIQKGCRKIMVLYKSTKKGTKPDKSNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPN-PPRAAG  462
             QYHLG DEDEK+  YVVSK++YQQ +Q        E ++   I   P   IP+  PR   
Sbjct  194   QYHLGTDEDEKDDEYVVSKVFYQQTKQP-------EKNVDSPIIEVPDNLIPDSSPRTPL  246

Query  461   ET---------PLSCDDY---NAALSPPAEEVEGGKKERYGSLWSDVQVKCEE---YPGC  327
                         + CDD    N   S   E +   +     S      VK E+   Y  C
Sbjct  247   TNPPNPPRPGKSMVCDDVADDNTLKSSAQEPLHIAE----ASHVPQPAVKLEDDQGYITC  302

Query  326   LAGESQAAADATD------IDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSS  165
             LAGES+   D  D       D  LLC E + S  F+ + +N + +  F+       N S+
Sbjct  303   LAGESE-PQDIGDPGLDGIYDSLLLCKEDISSKVFSGV-NNVSYADIFHNAHHMKGNDSA  360

Query  164   STNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
                IADL NLE D+ P+  L DL F S +SI  WLDR+
Sbjct  361   PCGIADLENLEFDTPPDSHLADLQF-SDESILGWLDRI  397



>ref|XP_006470226.1| PREDICTED: NAC domain-containing protein 8-like [Citrus sinensis]
Length=397

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 216/399 (54%), Positives = 256/399 (64%), Gaps = 39/399 (10%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVRNA+  +   I+D GA RECPNCH+ IDNSDVSPEWPG P GVKF+PSDVELLEHLA
Sbjct  14    KKVRNAARSSAQLIKDYGANRECPNCHYFIDNSDVSPEWPGLPVGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GNS+PHMF+DEFIPT+EGD+GICYTHPENLPG KKDGSS HFF+RT  AYATG R
Sbjct  74    AKCGVGNSKPHMFIDEFIPTIEGDQGICYTHPENLPGAKKDGSSVHFFHRTTNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E SL  EHVRWHKTGKTK V+ENG+QKGC+K+MVLY STKKG KP K+NWVMH
Sbjct  134   KRRKIQSEHSLNEEHVRWHKTGKTKPVIENGIQKGCRKIMVLYKSTKKGTKPDKSNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPN-PPRAAG  462
             QYHLG DEDEK+  YVVSK++YQQ +Q        E ++   I   P   IP+  PR   
Sbjct  194   QYHLGTDEDEKDDEYVVSKVFYQQTKQP-------EKNVGSPIIEVPDNLIPDSSPRTPL  246

Query  461   ET---------PLSCDDY---NAALSPPAEEVEGGKKERYGSLWSDVQVKCEE---YPGC  327
                         + CDD    N   S   E +   +     S      VK E+   Y  C
Sbjct  247   TNPPNPPRPGKSMVCDDVADDNTLKSSAQEPLHIAE----ASHVPQPAVKLEDDQGYITC  302

Query  326   LAGESQAAADATD------IDDFLLCDEIVGSFDFNNLPSNHATSAN-FNPMPQEANNTS  168
             LAGES+   D  D       D  LLC E + S  F+ +  N  + A+ F+       N S
Sbjct  303   LAGESE-PQDIGDPGLDGIYDSLLLCKEDISSKVFSGV--NDVSYADFFHNAHHMKGNDS  359

Query  167   SSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             +   IADL NLE D+ P+  L DL F S +SI  WLDR+
Sbjct  360   APCGIADLENLEFDTPPDSHLADLQF-SDESILGWLDRI  397



>gb|AHJ79160.1| NAC domain protein NAC19 [Gossypium hirsutum]
Length=398

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 210/400 (53%), Positives = 263/400 (66%), Gaps = 40/400 (10%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NAS  +  +I DCGA RECPNC + IDNSDV P+WPG P GVKF+PSD ELL+HLA
Sbjct  14    KKVKNASWSSSVQITDCGANRECPNCLYRIDNSDVFPQWPGLPVGVKFDPSDSELLDHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLP-----------GIKKDGSSGHFFY  849
             AKCG G+S+ H+F+DEFI TL   +GICYTHPENLP           G +KDGSS HFF+
Sbjct  74    AKCGVGDSKEHLFIDEFILTLGECQGICYTHPENLPGEYSSVTLRRRGARKDGSSIHFFH  133

Query  848   RTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKG  672
             RT  AY+TG RKRRKI N+ +   EHVRWHKTGKTK V ENGV KG KK+MVLY STKKG
Sbjct  134   RTINAYSTGQRKRRKIQNQDNTNEEHVRWHKTGKTKPVTENGVHKGWKKIMVLYKSTKKG  193

Query  671   EKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI-----P  507
              KP K+NWVMHQYHLG  EDE +G YVVSKI+YQQQ+Q +  D++  ++ P  +     P
Sbjct  194   CKPEKSNWVMHQYHLGDTEDEHDGEYVVSKIFYQQQKQTEKNDDSPITEEPDNLMIRTSP  253

Query  506   TTPMTAIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQ---VKCEE-  339
              TP T  P+PPR      L  DD    +   A         ++    SDV    V+CE+ 
Sbjct  254   RTPKTITPDPPRPWKSMIL--DDIEENMHQEA---------KFAVERSDVHTDAVQCEDN  302

Query  338   --YPGCLAGESQAAA--DATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNT  171
               YP  LAGESQA    D    D+FLLC+E++   D ++LP+ +   A+   +  + NN 
Sbjct  303   SHYPAWLAGESQAVENPDFNGFDEFLLCNELL---DSSSLPTTNDPKADGAAIETKGNN-  358

Query  170   SSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              +S  I++L NLE D+ P+ +L DL FGSQ+SI SWLDRL
Sbjct  359   DASCGISELENLEFDTPPDVTLADLQFGSQESILSWLDRL  398



>ref|XP_002521482.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40972.1| conserved hypothetical protein [Ricinus communis]
Length=413

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 210/389 (54%), Positives = 252/389 (65%), Gaps = 25/389 (6%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+N +  +  +I+DCGA R+CPNCHH IDNSDVS +WPG PAGVKF+PSD ELLEHLAA
Sbjct  35    KVKNPTRTSAYQIKDCGANRDCPNCHHRIDNSDVSHDWPGLPAGVKFDPSDAELLEHLAA  94

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+ H F+DEFIPTL  D+GICYTHPENLPG K DGSS HFF+RT  AYATG RK
Sbjct  95    KCGIGNSKSHAFIDEFIPTLLEDKGICYTHPENLPGAKIDGSSVHFFHRTINAYATGQRK  154

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+ NE     EHVRWHKTGKTK VMENG+QKGCKK+MVLY S+KKG KP K+NWVMHQ
Sbjct  155   RRKVHNEHGSNEEHVRWHKTGKTKPVMENGIQKGCKKIMVLYKSSKKGTKPDKSNWVMHQ  214

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNA--GESDIPQAIPTTPMTAIPNPPRAAG  462
             YHLG DEDEKEG YVVSKI+YQQ +Q  + D+    + D+     +        P     
Sbjct  215   YHLGTDEDEKEGEYVVSKIFYQQHKQIDSNDDVPIEDCDVLALQTSPRTPNPNPPNPPRP  274

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEE------YPGCLAGESQAA-  303
                 +CDD +   +     V+ G+         DV V   +      YP  LAGESQA  
Sbjct  275   GKSGACDD-SVDDNILRSCVQVGE--------YDVPVHAVQPEDDVGYPEWLAGESQAVE  325

Query  302   -ADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN----IADLVN  138
               D + IDD LLC EI  S       S    + ++  + Q  N  + + N    IA+L N
Sbjct  326   NTDFSGIDDSLLCTEIFNSSSLFFNSSG-LHNVSYTGIAQSTNQVTGNNNAPCGIAELEN  384

Query  137   LELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LELD+ P+F+L DL   SQDSI SW+DRL
Sbjct  385   LELDTPPDFTLSDLQISSQDSIFSWIDRL  413



>ref|XP_010686990.1| PREDICTED: NAC domain-containing protein 8-like [Beta vulgaris 
subsp. vulgaris]
Length=388

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 203/387 (52%), Positives = 259/387 (67%), Gaps = 26/387 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVR+A+  +   I+DCGA RECP CH  IDNSDV+ EWPG PAGVKF+PSD +LLEHLA
Sbjct  14    KKVRHATLSSAVPIKDCGAKRECPVCHFWIDNSDVAHEWPGLPAGVKFDPSDAQLLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG G+ +PH F+DEFIPTLE D+GICYTHP++LPG +KDG S HFF++T  AYA+G R
Sbjct  74    AKCGVGDVKPHTFIDEFIPTLETDKGICYTHPKDLPGARKDGCSVHFFHKTSNAYASGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMH  639
             KRRKI N+ +   E+VRWHKTGKTK V+ENG+QKGCKK+MVLY T +KG KP K+NWVMH
Sbjct  134   KRRKIQNDQN--QENVRWHKTGKTKPVIENGIQKGCKKIMVLYRTSEKGSKPVKSNWVMH  191

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI--PQAI-----PTTPMTAIPN  480
             QYHLG+++DE+EG YVVSKI+YQ+++    T++     I  P A+     P TP T  P+
Sbjct  192   QYHLGLEDDEREGEYVVSKIFYQKEKPTDHTNDNSIVAIEEPNAVTVPYCPKTPKTFTPH  251

Query  479   PPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYP-GCLAGESQAA  303
             PPR  G + ++ D  + ++    E+ +    +    L    Q + +  P  CLAGESQA 
Sbjct  252   PPR--GTSIMNDDAMDDSMVTDTEDTKYANTDSCFPL--STQYREDVKPLTCLAGESQAQ  307

Query  302   ---ADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE  132
                 D  D DD LLC EI  S      P + + S   N +     N   S  I+DL N++
Sbjct  308   DQDPDLNDNDDSLLCREIFSSC----APLDDSIS--LNDLSDGVYN--GSYGISDLDNIQ  359

Query  131   LDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LDS P F L DL FGSQDS+ SWLD L
Sbjct  360   LDSPPNFQLADLQFGSQDSMYSWLDEL  386



>ref|XP_008775622.1| PREDICTED: NAC domain-containing protein 8-like [Phoenix dactylifera]
Length=397

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 260/392 (66%), Gaps = 25/392 (6%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KV+NA+  +  +I D GA  +RECPNC HLIDNSDV+ EWPG PAGVKF+PSDVELLEH
Sbjct  14    KKVKNAARFSNYQINDLGAEASRECPNCKHLIDNSDVTLEWPGLPAGVKFDPSDVELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             LA K G GNS+PH+F+DEFIPTLE DEGICYTHPENLPG KKDGSS HFF+RT  AYA+G
Sbjct  74    LAGKVGIGNSKPHVFIDEFIPTLEEDEGICYTHPENLPGTKKDGSSVHFFHRTSNAYASG  133

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
              RKRRKI++      E +RWHKTGKTK V+ENGVQKG KK+MVLY S+K G KP KTNWV
Sbjct  134   HRKRRKINSNCDKSEECIRWHKTGKTKPVLENGVQKGWKKIMVLYKSSKGGGKPDKTNWV  193

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqk---QTTDNAGESDI--PQAIPTTPMTAIPN  480
             MHQYHLG +EDE +G  VVSKI++QQQ ++     T+   ES+I   +  P TP +  P 
Sbjct  194   MHQYHLGTEEDEMDGDLVVSKIFFQQQAKQIDKSDTNPVNESEIFAIRVSPRTPKSNTPQ  253

Query  479   PPRAAGETPLSCDDYNAALSPPAEE--VEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQ  309
             PPR   +     D++N  + P   E   E G       +   V+++ E E P   AGESQ
Sbjct  254   PPRPKKDNLFDTDEHNLQILPVHIEQYAEVGVTRSPSPV---VRLRGEGENPVPWAGESQ  310

Query  308   AAA--DATDIDDFLLCDEIVGSF----DFNNLPSNHATSANFNPMPQEANNTSSSTNIAD  147
             A    D  ++D+ LLC E++ SF    D    P       + N MP    NT      +D
Sbjct  311   AVEEPDPNNLDESLLCHEVLDSFPRIEDSFGYPK---LDRDRNEMPAAEANTLCG--FSD  365

Query  146   LVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             L N+ +D+ P+F L DL FGSQ+SI+SWLDRL
Sbjct  366   LDNILIDTPPDFQLADLQFGSQESITSWLDRL  397



>ref|XP_009371759.1| PREDICTED: NAC domain-containing protein 8-like [Pyrus x bretschneideri]
Length=385

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 252/379 (66%), Gaps = 17/379 (4%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+      I++CGA RECPNCH +IDNSDV  EWPG P GVKF+PSD ELL HLAA
Sbjct  13    KVKNAARSTACPIKECGANRECPNCHFVIDNSDVLSEWPGLPIGVKFDPSDGELLVHLAA  72

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PH+ +DEFIPTLEGD GICY HP+NLPG  KDGSS HFF++T  AYATG RK
Sbjct  73    KCGVGNSQPHLLIDEFIPTLEGDNGICYDHPKNLPGATKDGSSIHFFHKTMNAYATGQRK  132

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+ ++ S+  E VRWHKTGKTKA++ENGV KG KK+MVLY S+KKG KP K NWVMHQ
Sbjct  133   RRKVDSQRSVASEDVRWHKTGKTKAILENGV-KGWKKIMVLYKSSKKGTKPEKVNWVMHQ  191

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN---AGESDIP--QAIPTTPMTAIPNPPR  471
             YHLG +EDE+EG YVVSKI+YQQ +Q +  DN   A +SD+   +  P TP++  P PPR
Sbjct  192   YHLGAEEDEREGDYVVSKIFYQQHKQSERNDNNVVAEDSDVNALRTSPRTPVSNPPIPPR  251

Query  470   AAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAAADA  294
                          A L    +E E  + E Y     D + +     P  LAGESQA  D 
Sbjct  252   PGKSVWFEDVPDEAMLRSSVKEPELAQ-EAYHVPQPDPRFEDNIGEPTWLAGESQAD-DL  309

Query  293   TDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEAN-NTSSSTNIADLVNLELDSAP  117
               +D+ LLC EI GS       SN  ++ +FN    E N N+S+   + DL N+ LDS P
Sbjct  310   HSLDETLLCKEIFGS------ASNLISNTDFNKNTYEVNGNSSTPCGLRDLENIGLDSPP  363

Query  116   EFSLQDLPFGSQDSISSWL  60
             +F L DL F SQDS+ +WL
Sbjct  364   DFQLPDLQFSSQDSLLNWL  382



>ref|XP_004499395.1| PREDICTED: NAC domain-containing protein 8-like [Cicer arietinum]
Length=394

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 197/382 (52%), Positives = 254/382 (66%), Gaps = 8/382 (2%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +  + ++I+DCGA RECPNCH+ IDNSDVS EWPGFP G+KF+PSDVELLEHLA
Sbjct  14    KKVKSTTLSSADQIKDCGAYRECPNCHYRIDNSDVSTEWPGFPLGIKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN++PHMF++EFIPTLEG++GICYTHPENLPG KKDGSS HFF+RT  AY+TG R
Sbjct  74    AKCGVGNTKPHMFIEEFIPTLEGNQGICYTHPENLPGAKKDGSSVHFFHRTINAYSTGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +   L  EHVRWHKTGKTKAV E+GV KG KK+MVLY  ++K  K  K+NW MH
Sbjct  134   KRRKIHHHRGLTEEHVRWHKTGKTKAVFEDGVHKGFKKIMVLYIRSEKESKSYKSNWKMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGE  459
             QYHLGI+EDEK G YVVSKI+Y+Q ++ +    A E D   +  +        P      
Sbjct  194   QYHLGINEDEKNGEYVVSKIFYKQVEKNEEKPLAEEPDNVTSRTSPTTPKPNPPNPPRTG  253

Query  458   TPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEE-YPGCLAGESQAAADAT-  291
               +  DD     AL   AE+ +    E +    SD+Q +     P   AGESQA  ++  
Sbjct  254   ICVENDDNIDETALLLFAEDAKSIPGESHAPQ-SDIQDQENTPNPAWFAGESQAIENSEY  312

Query  290   -DIDDFLLCDEIVGSFD-FNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAP  117
               +DD LLC EI+ SF  F++   +  T+ +F+    +     + T+ + L  LELD+ P
Sbjct  313   DGLDDILLCKEILDSFALFDDSGLDSITTNDFDYYENKMTGNGNVTSTSVLDTLELDTPP  372

Query  116   EFSLQDLPFGSQDSISSWLDRL  51
             +F L +L F SQDSI  W+DRL
Sbjct  373   DFDLSNLTFCSQDSILDWMDRL  394



>ref|XP_009370397.1| PREDICTED: NAC domain-containing protein 8-like [Pyrus x bretschneideri]
Length=443

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 251/379 (66%), Gaps = 17/379 (4%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+      I++CGA RECPNCH +IDNSDV  EWPG P GVKF+PSD ELL HLAA
Sbjct  71    KVKNAARSTACPIKECGANRECPNCHFVIDNSDVISEWPGLPIGVKFDPSDGELLVHLAA  130

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PH+ +DE IPTLEGD GICY HP+NLPG  KDGSS HFF++T  AYATG RK
Sbjct  131   KCGVGNSQPHLLIDELIPTLEGDNGICYDHPKNLPGATKDGSSIHFFHKTMNAYATGQRK  190

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+ ++ S+  E VRWHKTGKTKA++ENGV KG KK+MVLY S+KKG KP K NWVMHQ
Sbjct  191   RRKVDSQRSVASEDVRWHKTGKTKAILENGV-KGWKKIMVLYKSSKKGTKPEKVNWVMHQ  249

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN---AGESDIP--QAIPTTPMTAIPNPPR  471
             YHLG +EDE+EG YVVSKI+YQQ +Q +  DN   A +SD+   +  P TP++  P PPR
Sbjct  250   YHLGAEEDEREGDYVVSKIFYQQHKQSERNDNNVVAEDSDVNALRTSPRTPVSNPPIPPR  309

Query  470   AAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAAADA  294
                          A L    +E E  + E Y     D + +     P  LAGESQA  D 
Sbjct  310   PGKSVWFEDVPDEAMLRSSVKEPELAQ-EAYHVPQPDPRFEDNIGEPTWLAGESQAD-DL  367

Query  293   TDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEAN-NTSSSTNIADLVNLELDSAP  117
               +D+ LLC EI GS       SN  ++ +FN    E N N+S+   + DL N+ LDS P
Sbjct  368   HSLDETLLCKEIFGS------ASNLISNTDFNSNTYEVNGNSSTPCGLRDLENIGLDSPP  421

Query  116   EFSLQDLPFGSQDSISSWL  60
             +F L DL F SQDS+ +WL
Sbjct  422   DFQLPDLQFSSQDSLLNWL  440



>ref|XP_002298550.2| hypothetical protein POPTR_0001s35490g [Populus trichocarpa]
 gb|EEE83355.2| hypothetical protein POPTR_0001s35490g [Populus trichocarpa]
Length=395

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 251/384 (65%), Gaps = 14/384 (4%)
 Frame = -1

Query  1166  RNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKC  987
             R  S  +  +I+DCGA RECP CH  IDNSDV+ EWPG P GVKF+PSD +LLEHL AKC
Sbjct  14    RKVSRSSAYQIKDCGANRECPKCHCHIDNSDVTQEWPGLPIGVKFDPSDAQLLEHLEAKC  73

Query  986   GEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRR  807
               GNS+PHMF+DEFIPTL+GD+GICYTHP  LPG KKDG+S HFF+RT  AYATG RKRR
Sbjct  74    AVGNSKPHMFIDEFIPTLDGDKGICYTHPAKLPGAKKDGNSVHFFHRTNNAYATGQRKRR  133

Query  806   KISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYH  630
             KI  E     E VRWHKTGKTK VM+NGVQKGCKK+MVLY S+KKG KP K+ WVMHQYH
Sbjct  134   KIHCEVGSNEEGVRWHKTGKTKPVMDNGVQKGCKKIMVLYKSSKKGSKPDKSKWVMHQYH  193

Query  629   LGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGE  459
             LG DEDEKEG YVVSKI+YQQ+Q ++  DN    D   +          + P  P   G+
Sbjct  194   LGTDEDEKEGEYVVSKIFYQQKQTEKNDDNLLIEDNDILSHQTSPRTPNSNPPNPPRPGK  253

Query  458   TPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAA--ADATD  288
             + +  D  N  ++  A +    K+E         Q++ + E+P   AGESQA   +D T 
Sbjct  254   SVMYDDIANDNITHLAGQNNEIKEEAPDVPAHVFQLEGDVEFPEWFAGESQAVENSDFTA  313

Query  287   IDDFLLCDEIVGSFDFNNLPSNHATS-ANFNPMPQEANNTSSST----NIADLVNLELDS  123
             +DD LLC+EI  S     +P+N   +  ++  M    N  + +      IA+L NLELD+
Sbjct  314   LDDSLLCNEIFVSAP--RVPNNSGVNRVSYTGMAHNTNEVNGNNNEPCGIAELENLELDT  371

Query  122   APEFSLQDLPFGSQDSISSWLDRL  51
              P+F L DL FGSQ+SI  WLDRL
Sbjct  372   PPDFQLADLQFGSQESILGWLDRL  395



>ref|XP_010912974.1| PREDICTED: NAC domain-containing protein 8 [Elaeis guineensis]
Length=398

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 208/394 (53%), Positives = 256/394 (65%), Gaps = 28/394 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KV+NA+  +  +I+D    A+R+CPNC H+IDNSDV+ EWPG PAGVKF+PSDVELLEH
Sbjct  14    RKVKNATRLSNYQIKDLEAEASRKCPNCKHVIDNSDVTIEWPGLPAGVKFDPSDVELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             LA K G+GN +PHMF+DEFIPT+E DEGICYTHP NLPGIKKDGSS HFF+R   AYA+G
Sbjct  74    LAGKVGKGNLKPHMFIDEFIPTVEEDEGICYTHPINLPGIKKDGSSVHFFHRISNAYASG  133

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
              RKRRKI +E     E VRWHKTGKTK V ENGV KG KK+MVLY S+K G KP K NWV
Sbjct  134   HRKRRKIHDECDKSEERVRWHKTGKTKPVRENGVHKGWKKIMVLYRSSKGGGKPDKANWV  193

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAG------ESDI--PQAIPTTPMTA  489
             MHQYHLG DEDEK+G  VVSKI++QQQ ++  TD  G      E D+   +  P TP T 
Sbjct  194   MHQYHLGTDEDEKDGELVVSKIFFQQQVKQ--TDKNGIHPVNEEPDMFAVRVSPRTPKTN  251

Query  488   IPNPPRAAGETPLSCDDYNAALSP----PAEEVEGGKKERYGSLWSDVQVKCEEYPGCLA  321
              P PPR+   +P   D++N    P    P  EVE           +D    C  +    A
Sbjct  252   TPQPPRSKKNSPFDTDEHNLQALPGHNEPYPEVEVTSAPLPVVRLTDEGESCVWW----A  307

Query  320   GESQAAA--DATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSST--NI  153
             GESQA    D  ++D+ LLC E++ SF        H    NFN    E   T ++T    
Sbjct  308   GESQAVEEPDPNNLDESLLCHEVLDSFPPIEDCFYH---PNFNGDKNETAATKANTLCGF  364

Query  152   ADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             +DL ++ +D+ P+F L DL FGSQ+SI+SWLDRL
Sbjct  365   SDLDDIIMDTPPDFQLADLQFGSQESITSWLDRL  398



>ref|XP_008341697.1| PREDICTED: NAC domain-containing protein 8 [Malus domestica]
Length=387

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 213/382 (56%), Positives = 254/382 (66%), Gaps = 18/382 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+      I++CGA RECPNCH +IDNSDV  EWPG P GVKF+PSD ELL HLAA
Sbjct  15    KVKNAARSTACPIKECGANRECPNCHFVIDNSDVLSEWPGLPVGVKFDPSDGELLVHLAA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PH+ +DEFIPTLEGD GICY HP+NLPG  KDGSS HFF++T KAYATG RK
Sbjct  75    KCGVGNSQPHLLIDEFIPTLEGDNGICYDHPKNLPGATKDGSSIHFFHKTMKAYATGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+ ++ S+  E VRWHKTGKTKA+MENGV  G KK+MVLY S+KKG KP K NWVMHQ
Sbjct  135   RRKVDSQRSVASEDVRWHKTGKTKAIMENGVX-GWKKIMVLYXSSKKGXKPEKVNWVMHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN--AGESDIPQAIPTTPMTAIPNPPRAAG  462
             YHLG +EDE+EG YVVSKI+YQQ +Q +  DN    E +   A+ T+P T +PNPP    
Sbjct  194   YHLGAEEDEREGEYVVSKIFYQQHKQSERNDNNVVXEDNDVNALRTSPRTPVPNPPIPPR  253

Query  461   ETPLSC-DDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAAADA  294
                  C +D    A L    +E E   +E Y     D + +     P  LAGESQ A D 
Sbjct  254   PGKSVCFEDVPDEAMLRSSVKEPELA-QEAYXVPQPDTRFEDXIGQPTWLAGESQ-ADDL  311

Query  293   TDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEAN-NTSSSTNIADLVNLELDSAP  117
               +D+ LLC EI GS    NL SN     +FN    E N N+S+S    DL N+ LDS P
Sbjct  312   HSLDETLLCKEIFGS--AXNLISN----TDFNNNTYEVNGNSSTSXGXXDLENIGLDSPP  365

Query  116   EFSLQDLPFGSQDSISSWLDRL  51
             +F L D  F SQDS  +WLDRL
Sbjct  366   DFQLPDFQFSSQDSF-NWLDRL  386



>ref|XP_008362184.1| PREDICTED: NAC domain-containing protein 8-like [Malus domestica]
Length=385

 Score =   354 bits (909),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 213/382 (56%), Positives = 254/382 (66%), Gaps = 18/382 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+      I++CGA RECPNCH +IDNSDV  EWPG P GVKF+PSD ELL HLAA
Sbjct  13    KVKNAARSTACPIKECGANRECPNCHFVIDNSDVLSEWPGLPVGVKFDPSDGELLVHLAA  72

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG GNS+PH+ +DEFIPTLEGD GICY HP+NLPG  KDGSS HFF++T KAYATG RK
Sbjct  73    KCGVGNSQPHLLIDEFIPTLEGDNGICYDHPKNLPGATKDGSSIHFFHKTMKAYATGQRK  132

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRK+ ++ S+  E VRWHKTGKTKA+MENGV  G KK+MVLY S+KKG KP K NWVMHQ
Sbjct  133   RRKVDSQRSVASEDVRWHKTGKTKAIMENGVX-GWKKIMVLYXSSKKGXKPEKVNWVMHQ  191

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN--AGESDIPQAIPTTPMTAIPNPPRAAG  462
             YHLG +EDE+EG YVVSKI+YQQ +Q +  DN    E +   A+ T+P T +PNPP    
Sbjct  192   YHLGAEEDEREGEYVVSKIFYQQHKQSERNDNNVVXEDNDVNALRTSPRTPVPNPPIPPR  251

Query  461   ETPLSC-DDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAAADA  294
                  C +D    A L    +E E   +E Y     D + +     P  LAGESQ A D 
Sbjct  252   PGKSVCFEDVPDEAMLRSSVKEPELA-QEAYXVPQPDTRFEDXIGQPTWLAGESQ-ADDL  309

Query  293   TDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEAN-NTSSSTNIADLVNLELDSAP  117
               +D+ LLC EI GS    NL SN     +FN    E N N+S+S    DL N+ LDS P
Sbjct  310   HSLDETLLCKEIFGS--AXNLISN----TDFNNNTYEVNGNSSTSXGXXDLENIGLDSPP  363

Query  116   EFSLQDLPFGSQDSISSWLDRL  51
             +F L D  F SQDS  +WLDRL
Sbjct  364   DFQLPDXQFSSQDSF-NWLDRL  384



>ref|XP_008812203.1| PREDICTED: NAC domain-containing protein 8-like [Phoenix dactylifera]
Length=398

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 206/402 (51%), Positives = 261/402 (65%), Gaps = 44/402 (11%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCG--ATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KV+NA+  +  +I+D G  A+RECPNC HLIDNSDV+ EWPG PAGVKF+PSDVEL+EH
Sbjct  14    RKVKNATCFSNYQIRDLGVEASRECPNCKHLIDNSDVTIEWPGLPAGVKFDPSDVELIEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             LA K G GNS+PHMF+DEFIPTLE DEGICYTHP+NLPGIKKDGSS HFF+R   AYA+G
Sbjct  74    LAGKVGIGNSKPHMFIDEFIPTLEEDEGICYTHPKNLPGIKKDGSSVHFFHRISNAYASG  133

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
              RKRRKI ++     E VRWHKTGKT  V+ENGV KG +K++VLY S+K G KP K NWV
Sbjct  134   HRKRRKIHDDCDKSEERVRWHKTGKTIPVLENGVHKGWRKILVLYKSSKGGGKPDKANWV  193

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAG------ESDI--PQAIPTTPMTA  489
             MHQYH+G D+DE++G  VVSKI++  QQQ +  DN+G      E D+   +  P TP T 
Sbjct  194   MHQYHIGTDKDEEDGELVVSKIFF--QQQAKQIDNSGIDQVNEEPDMFAARVSPRTPKTN  251

Query  488   IPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSL------WSDVQVKCE-EYPG  330
              P PP +   + L  D++N  L P       G+ ERY  +         V +  E E P 
Sbjct  252   TPQPPWSKKNSLLDTDEHNLQLLP-------GRIERYPVVEVASAPLPVVDLTDEGESPA  304

Query  329   CLAGESQAAA--DATDIDDFLLCDEIV-------GSFDFNNLPSNHATSANFNPMPQEAN  177
               AGES A    D  ++D+ LLC E++        SFD+ NL      + + N  P  A 
Sbjct  305   WWAGESLAVEEPDPNNLDESLLCHEVLDSFPPIEDSFDYPNL------NRDKNETP--AT  356

Query  176   NTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
               S+    +DL N+ +D+ P+F L DL FGSQ+SI+SW DRL
Sbjct  357   QASTLCGFSDLDNIIIDTPPDFQLADLQFGSQESITSWPDRL  398



>ref|XP_010251054.1| PREDICTED: NAC domain-containing protein 8 [Nelumbo nucifera]
Length=393

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 204/404 (50%), Positives = 249/404 (62%), Gaps = 55/404 (14%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+  + ++I+D GA RECPNCHH IDNSDVS EWPG PAGVKF+PSD E+LEHLA 
Sbjct  15    KVKNATQFSASKIKDLGAIRECPNCHHNIDNSDVSLEWPGLPAGVKFDPSDAEILEHLAG  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G G+S+PH+F+DEFIPT+E +EGI YTHPENLPG KKDGSS HFF++T  AYATG RK
Sbjct  75    KVGLGDSKPHLFIDEFIPTIERNEGIYYTHPENLPGAKKDGSSVHFFHKTANAYATGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQ  636
             RRKI  +   + EHVRWHKTGKTK V+ENGV KGCKK+MVLY T KKG KP K+NWVMHQ
Sbjct  135   RRKIHGQGGKIEEHVRWHKTGKTKPVIENGVVKGCKKIMVLYKTSKKGSKPDKSNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAG------ESDIPQAIPTTPMTAIPNPP  474
             YHLG  +D  EG YVVSKI+YQQQQ+      A       +    Q  P TP T  P+  
Sbjct  195   YHLGTKDDVTEGEYVVSKIFYQQQQRHTDKTEAHLVNEEPDKVTLQVSPRTPKTNTPDIR  254

Query  473   RAAGETPLSCDDYN----------AALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCL  324
             R        CDD N           A   P+  ++    +R  + W              
Sbjct  255   RPGKR--FLCDDINEDSELECIKETAQPSPSVHLD---DDRMDTAW-------------W  296

Query  323   AGESQAAA--DATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQ--EANNTSSSTN  156
             AGESQA    D   +DD LLC+EI+ S+         A ++   P+P   E   + S   
Sbjct  297   AGESQAVEDPDLNVMDDILLCNEILDSY-------APADNSGLRPIPNFSEYGCSRSDAL  349

Query  155   IAD---------LVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             IAD         L ++E+D+ P+F L DL FGSQ+SI  WLDRL
Sbjct  350   IADGNTASGIPSLDDIEIDTPPDFHLADLQFGSQESIMGWLDRL  393



>ref|XP_006603789.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max]
Length=389

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 247/381 (65%), Gaps = 15/381 (4%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +   +++++DCG   ECP CH+ IDNS+VS EWPGFP GVKF+PSDVELLEHLA
Sbjct  14    KKVKDTTLSTDDQMKDCGTYSECPKCHYHIDNSNVSHEWPGFPVGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN EPHMF+ +FIPTLEG++GICYTHP+NLPG K DGSS HFF++T  AYATG R
Sbjct  74    AKCCIGNREPHMFIHQFIPTLEGEQGICYTHPQNLPGAKTDGSSVHFFHKTANAYATGRR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++  L  EHVRWHKTG+TKAV E+GV KG KK+MVLY  +KKG KP KTNWVMH
Sbjct  134   KRRKIHHQDGLTEEHVRWHKTGRTKAVTEDGVHKGFKKIMVLYIRSKKGTKPYKTNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAAG  462
             QYHLG  E EK+G YVVSKI+YQQ +Q +   +N    D   A    P T  PNPP    
Sbjct  194   QYHLG-SEVEKDGEYVVSKIFYQQHKQNEKNEENTMVEDSNVAAQAGPRTPKPNPPTRP-  251

Query  461   ETPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATD  288
                  CDD      L P  ++      E +    S+VQ   +E P  LAGESQA  D   
Sbjct  252   -CTAKCDDNFDENELLPFIQDARPIPGESHAPP-SNVQ---DEDPAWLAGESQADCDFDG  306

Query  287   IDDFLLCDEIVGS---FDFNNLPSNHATSANFNPMPQEANNTS-SSTNIADLVNLELDSA  120
             ++D LLC EI+ S    + + L S     A  N +    NN    S  ++ L  LELD+ 
Sbjct  307   LEDILLCKEILQSSALLNHSGLTSTFNGDAKANKLVAPGNNNDYGSYGVSVLDTLELDTP  366

Query  119   PEFSLQDLPFGSQDSISSWLD  57
             P+F L +L FGSQDS   W+D
Sbjct  367   PDFDLSNLQFGSQDSTLQWID  387



>gb|KHN19686.1| NAC domain-containing protein 8 [Glycine soja]
Length=389

 Score =   350 bits (897),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 199/381 (52%), Positives = 247/381 (65%), Gaps = 15/381 (4%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +   +++++DCG   ECP CH+ IDNS+VS EWPGFP GVKF+PSDVELLEHLA
Sbjct  14    KKVKDTTLSTDDQMKDCGTYSECPKCHYHIDNSNVSHEWPGFPVGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN EPHMF+ +FIPTLEG++GICYTHP+NLPG K DGSS HFF++T  AYATG R
Sbjct  74    AKCCIGNREPHMFIHQFIPTLEGEQGICYTHPQNLPGAKTDGSSVHFFHKTANAYATGRR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++  L  EHVRWHKTG+TKAV E+GV KG KK+MVLY  +KKG KP KTNWVMH
Sbjct  134   KRRKIHHQDGLTEEHVRWHKTGRTKAVTEDGVHKGFKKIMVLYIRSKKGTKPYKTNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAAG  462
             QYHLG  E EK+G YVVSKI+YQQ +Q +   +N    D   A    P T  PNPP    
Sbjct  194   QYHLG-SEVEKDGEYVVSKIFYQQHKQNEKNEENTMVEDSNVAAQAGPRTPKPNPPTRP-  251

Query  461   ETPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATD  288
                  CDD      L P  ++      E +    S+VQ   +E P  LAGESQA  D   
Sbjct  252   -CTAKCDDNFDENELLPFIQDARPIPGESHAPP-SNVQ---DEDPAWLAGESQADCDFDG  306

Query  287   IDDFLLCDEIVGS---FDFNNLPSNHATSANFNPMPQEANNTS-SSTNIADLVNLELDSA  120
             ++D LLC E++ S    + + L S     A  N +    NN    S  ++ L  LELD+ 
Sbjct  307   LEDILLCKEMLQSSALLNHSGLTSTFNGDAKANKLVAPGNNNDYGSHGVSVLDTLELDTP  366

Query  119   PEFSLQDLPFGSQDSISSWLD  57
             P+F L +L FGSQDS   W+D
Sbjct  367   PDFDLSNLQFGSQDSTLQWID  387



>ref|XP_010248662.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Nelumbo 
nucifera]
Length=380

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 200/380 (53%), Positives = 247/380 (65%), Gaps = 20/380 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+  + ++++D GA R+CPNCHH IDNSDVS EWPG PAGVKF+PSDVELLEHLA 
Sbjct  15    KVKNATQFSSHQVKDLGANRQCPNCHHHIDNSDVSLEWPGLPAGVKFDPSDVELLEHLAG  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G G+SEPH+F+DE IPTLEG+EGI YTHPENLPG KKDGSS +FF+RT  AY+ G RK
Sbjct  75    KVGVGDSEPHLFIDELIPTLEGNEGIYYTHPENLPGAKKDGSSVYFFHRTANAYSIGHRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI ++ +   EHVRWHKTGKTK V+ENG+QKG KK+MVLY S+KKG KP K NWVMHQ
Sbjct  135   RRKIHHQCNKGEEHVRWHKTGKTKPVVENGMQKGFKKIMVLYKSSKKGSKPDKYNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPN--PPRAAG  462
             YHLG + DEKEG YVVSKI+YQQ+++     +A E ++ QA P TP T  P+   PR   
Sbjct  195   YHLGTENDEKEGQYVVSKIFYQQKKKHTDKSDA-EIEMVQASPRTPKTKTPDIRQPRKGA  253

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAA--DATD  288
                  CD  N       E +E   +    ++  D        P   AGESQ     D   
Sbjct  254   ----LCDVINE--EKETEFIENAPQPPLSAVSLDDD---RLDPAWWAGESQPVEDPDPNA  304

Query  287   IDDFLLCDEIVGSFD-FNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEF  111
             +DD LLC+EI  S+   +N       S + N    + N  S   N+ D   +E+    +F
Sbjct  305   MDDLLLCNEIFDSYTPIDNSVGLSDLSCHRNDALTDVNTASGIPNLDD---VEI-GITDF  360

Query  110   SLQDLPFGSQDSISSWLDRL  51
              L DL FGSQ+SI  WLDRL
Sbjct  361   QLADLQFGSQESIMGWLDRL  380



>ref|XP_011003122.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Populus 
euphratica]
Length=395

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 201/389 (52%), Positives = 247/389 (63%), Gaps = 24/389 (6%)
 Frame = -1

Query  1166  RNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKC  987
             R  S  +  +I+DCGA RECP CH  IDNSDV+ EWPG P GVKF+PSD +LLEHL AKC
Sbjct  14    RKVSRSSAYQIKDCGAIRECPKCHCHIDNSDVTQEWPGLPIGVKFDPSDAQLLEHLEAKC  73

Query  986   GEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRR  807
               GNS+PHMF+DEFIPTL+ D+GICYTHP  LPG KKDG+S HFF+RT  AYATG RKRR
Sbjct  74    AVGNSKPHMFIDEFIPTLDSDKGICYTHPAKLPGAKKDGNSVHFFHRTNNAYATGQRKRR  133

Query  806   KISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYH  630
             KI  E     + VRWHKTGKTK VM+NGVQKGCKK+MVLY S+KKG KP K+ WVMHQYH
Sbjct  134   KIHCEVGSNEDSVRWHKTGKTKPVMDNGVQKGCKKIMVLYKSSKKGSKPDKSKWVMHQYH  193

Query  629   LGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGE  459
             LG DEDEKEG Y+VSKI+YQQ+Q ++  DN    D   +          + P  P    +
Sbjct  194   LGTDEDEKEGEYLVSKIFYQQKQTEKNDDNQLIEDNDILSHQTSPRTPNSNPPNPPRPAK  253

Query  458   TPLSCDDYNAALSPPAEEVEGGKKE------RYGSLWSDVQVKCEEYPGCLAGESQAA--  303
             + +  D  N   +  A +    K+E          L  DV     E+P   AGESQA   
Sbjct  254   SVMYDDITNDNRTQLAVQNNEIKEEAPDVPAHVFQLEGDV-----EFPEWFAGESQAVEN  308

Query  302   ADATDIDDFLLCDEIVGSFDFNNLPSNHATS-ANFNPMPQEANNTSSST----NIADLVN  138
             +D + +DD LLC+EI  S     +P+N   +  ++  M    N  + +      IA+L N
Sbjct  309   SDFSALDDSLLCNEIFVSAP--RVPNNSGVNRVSYTGMAHNTNEVNGNNNEPCGIAELEN  366

Query  137   LELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             LELD+ P+F L DL FGSQ+SI  WLDRL
Sbjct  367   LELDTPPDFQLADLQFGSQESILGWLDRL  395



>ref|XP_008458820.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Cucumis 
melo]
Length=398

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 195/391 (50%), Positives = 252/391 (64%), Gaps = 22/391 (6%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVR+ S P    I+DC A RECPNC+ +IDN+DV  EWPG PAGVKF+P+D E+++HLA
Sbjct  14    RKVRHISQPPSQVIKDCDAKRECPNCNFMIDNTDVLSEWPGLPAGVKFDPTDDEIMDHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN +PH  +DEFIPTLE D+GICYTHPENLPG+ KDG+  HFF++T  AYATG R
Sbjct  74    AKCAVGNLKPHALIDEFIPTLETDQGICYTHPENLPGVSKDGNDVHFFHKTNNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E S  +EH RWHKTGKTKA++ NGV KG KK+  LY S+K G KP K+NWV+H
Sbjct  134   KRRKIESEQSSSLEHFRWHKTGKTKAMISNGVHKGWKKIFSLYRSSKGGSKPEKSNWVIH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqq-kQTTDNA----GESDIPQAIPTTPMTAIPNPP  474
             QYHLG +EDEKEG YV+SKI YQQ +Q  +  DN      ++ + Q  P TP +  P PP
Sbjct  194   QYHLGTEEDEKEGEYVLSKISYQQPKQCIKNNDNMLIEYLDAMLHQTSPRTPKSNPPVPP  253

Query  473   RAAGETPLSCDDYNAALSPPAEEVE---GGKKERYGSLWSDVQVKCEEYPGCLAGESQAA  303
             R+      +    N+     A+E E      +  Y ++ S+    C    G +AGESQ  
Sbjct  254   RSGKSLVSNAVADNSLPQSSAKEEELTPEAFRVSYANISSENDGGCH---GWMAGESQDI  310

Query  302   ADAT--DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP-----QEANNTSSSTNIADL  144
             AD     ++D LLC+E++ S  F  + SN      F P+       E  N +    IADL
Sbjct  311   ADVELHYLEDNLLCNEVLDSSAF--ISSNQVNQIPF-PLSGSNAYHEIANDNVPCGIADL  367

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              NL+LD+ P+F L DL FGSQ+SI  W+DR+
Sbjct  368   ENLDLDTPPDFHLADLQFGSQESIFDWIDRI  398



>ref|XP_010248661.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 200/380 (53%), Positives = 247/380 (65%), Gaps = 20/380 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NA+  + ++++D GA R+CPNCHH IDNSDVS EWPG PAGVKF+PSDVELLEHLA 
Sbjct  85    KVKNATQFSSHQVKDLGANRQCPNCHHHIDNSDVSLEWPGLPAGVKFDPSDVELLEHLAG  144

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G G+SEPH+F+DE IPTLEG+EGI YTHPENLPG KKDGSS +FF+RT  AY+ G RK
Sbjct  145   KVGVGDSEPHLFIDELIPTLEGNEGIYYTHPENLPGAKKDGSSVYFFHRTANAYSIGHRK  204

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI ++ +   EHVRWHKTGKTK V+ENG+QKG KK+MVLY S+KKG KP K NWVMHQ
Sbjct  205   RRKIHHQCNKGEEHVRWHKTGKTKPVVENGMQKGFKKIMVLYKSSKKGSKPDKYNWVMHQ  264

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPN--PPRAAG  462
             YHLG + DEKEG YVVSKI+YQQ+++     +A E ++ QA P TP T  P+   PR   
Sbjct  265   YHLGTENDEKEGQYVVSKIFYQQKKKHTDKSDA-EIEMVQASPRTPKTKTPDIRQPRKGA  323

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAA--DATD  288
                  CD  N       E +E   +    ++  D        P   AGESQ     D   
Sbjct  324   ----LCDVINE--EKETEFIENAPQPPLSAVSLDDD---RLDPAWWAGESQPVEDPDPNA  374

Query  287   IDDFLLCDEIVGSFD-FNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEF  111
             +DD LLC+EI  S+   +N       S + N    + N  S   N+ D   +E+    +F
Sbjct  375   MDDLLLCNEIFDSYTPIDNSVGLSDLSCHRNDALTDVNTASGIPNLDD---VEI-GITDF  430

Query  110   SLQDLPFGSQDSISSWLDRL  51
              L DL FGSQ+SI  WLDRL
Sbjct  431   QLADLQFGSQESIMGWLDRL  450



>gb|KGN51354.1| hypothetical protein Csa_5G523000 [Cucumis sativus]
Length=398

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 194/393 (49%), Positives = 255/393 (65%), Gaps = 26/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVR+ + P    I+DC A RECPNC+ +IDN+DV  EWPG PAGVKF+P+D E+++HLA
Sbjct  14    RKVRHINQPPSQVIKDCDAKRECPNCNFMIDNTDVLSEWPGLPAGVKFDPTDDEIMDHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN +PH+ +DEFIPTLE D+GICYTHPENLPG+ KDG+  HFF++T  AYATG R
Sbjct  74    AKCAVGNLKPHVLIDEFIPTLETDQGICYTHPENLPGVSKDGNDVHFFHKTNNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E +  ++H RWHKTGKTKA++ NGV KG KK+  LY S+K G KP K+NWV+H
Sbjct  134   KRRKIESEQNSSLQHFRWHKTGKTKAMISNGVHKGWKKIFSLYRSSKGGSKPEKSNWVIH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq-qqqkQTTDNA----GESDIPQAIPTTPMTAIPNPP  474
             QYHLG +EDEKEG YV+SKI YQQ +Q  +  DN      ++ + Q  P TP +  P PP
Sbjct  194   QYHLGTEEDEKEGEYVLSKICYQQPKQSIKNNDNMLIEYLDAMLHQTSPRTPKSNPPVPP  253

Query  473   RAAGE--TPLSCDD-YNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA  303
             R+     + L  D+    +L+   E      +  Y ++ S+    C    G LAGESQ  
Sbjct  254   RSGKSLVSNLVADNSLPQSLAKEEELTPEASRVSYANISSENDGGCH---GWLAGESQDI  310

Query  302   ADAT--DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP-------QEANNTSSSTNIA  150
             AD     ++D LLC+E++   D + L SN+    N  P P        E  N +    IA
Sbjct  311   ADGELHYLEDNLLCNEVL---DSSALISNN--QVNQIPFPLSGSNAYHEIANDNVPCGIA  365

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             DL NL+LD+ P+F L DL FGSQ+SI  W+DR+
Sbjct  366   DLENLDLDTPPDFHLADLQFGSQESIFDWIDRI  398



>ref|XP_006599082.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006599083.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Glycine 
max]
Length=399

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 256/396 (65%), Gaps = 31/396 (8%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +  + ++I+DCGA RECPNC + IDNSDVS EWPGFP GVKF+PSDVELLEHLA
Sbjct  14    KKVKSITLSSADQIKDCGAYRECPNCSYHIDNSDVSTEWPGFPLGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN++ H+F++EFIPTLEGD+GICYTHPENLPG KKDG+  HFF+RT  AYATG R
Sbjct  74    AKCGIGNTKQHLFINEFIPTLEGDQGICYTHPENLPGAKKDGNYVHFFHRTTNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY--STKKGEKPGKTNWVM  642
             KRRKI ++  L  EHVRWHKTGKTKA++E+GV KG KK+MV+Y  S++ G KP K+NWVM
Sbjct  134   KRRKIHHQQGLTEEHVRWHKTGKTKAIIEDGVHKGFKKIMVIYIRSSENGSKPYKSNWVM  193

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAA  465
             HQYHLG +EDEKE  YVVSK++YQQQ+Q +   DN    D    I  T        P   
Sbjct  194   HQYHLGTEEDEKEAEYVVSKVFYQQQKQTEKNEDNPMAGDPANIISRTSPRTPKPNPPNP  253

Query  464   GET--PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPG---CLAGESQAAA  300
               T   + CDD N   +         K    GSL     ++ ++  G    LAGESQA  
Sbjct  254   PRTGKSVDCDD-NIDETVLLSAALDTKTIPEGSLAPQSDIQDQDNTGDAAWLAGESQAEE  312

Query  299   DA--TDIDDFLLCDEIVGS--------FDFNNLP--SNHATSANFNPMPQEANNTSSSTN  156
             ++    +DD LLC+EI+ S         D+ NL   +++AT        Q A N +    
Sbjct  313   NSEYDGLDDILLCNEILDSSALLNDSGLDYTNLDDIASYAT--------QRARNDNEPCG  364

Query  155   IADLVNLELDSAPEFSLQDLPFGSQD-SISSWLDRL  51
             I+ L  LELD+ P+F L  L F SQD SI  W+DRL
Sbjct  365   ISLLDTLELDT-PDFDLSSLYFCSQDSSILDWMDRL  399



>gb|KHN27560.1| NAC domain-containing protein 8 [Glycine soja]
Length=416

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 256/396 (65%), Gaps = 31/396 (8%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +  + ++I+DCGA RECPNC + IDNSDVS EWPGFP GVKF+PSDVELLEHLA
Sbjct  31    KKVKSTTLSSADQIKDCGAYRECPNCSYHIDNSDVSTEWPGFPLGVKFDPSDVELLEHLA  90

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN++ H+F++EFIPTLEGD+GICYTHPENLPG KKDG+  HFF+RT  AYATG R
Sbjct  91    AKCGIGNTKQHLFINEFIPTLEGDQGICYTHPENLPGAKKDGNYVHFFHRTTNAYATGQR  150

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY--STKKGEKPGKTNWVM  642
             KRRKI ++  L  EHVRWHKTGKTKA++E+GV KG KK+MV+Y  S++ G KP K+NWVM
Sbjct  151   KRRKIHHQQGLTEEHVRWHKTGKTKAIIEDGVHKGFKKIMVIYIRSSENGSKPYKSNWVM  210

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAA  465
             HQYHLG +EDEKE  YVVSK++YQQQ+Q +   DN    D    I  T        P   
Sbjct  211   HQYHLGTEEDEKEAEYVVSKVFYQQQKQTEKNEDNPMAGDPANIISRTSPRTPKPNPPNP  270

Query  464   GET--PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPG---CLAGESQAAA  300
               T   + CDD N   +         K    GSL     ++ ++  G    LAGESQA  
Sbjct  271   PRTGKSVDCDD-NIDETVLLSAALDTKTIPEGSLAPQSDIQDQDNTGDAAWLAGESQAEE  329

Query  299   DA--TDIDDFLLCDEIVGS--------FDFNNLP--SNHATSANFNPMPQEANNTSSSTN  156
             ++    +DD LLC+EI+ S         D+ NL   +++AT        Q A N +    
Sbjct  330   NSEYDGLDDILLCNEILDSSALLNDSGLDYTNLDDIASYAT--------QRARNDNEPCG  381

Query  155   IADLVNLELDSAPEFSLQDLPFGSQD-SISSWLDRL  51
             I+ L  LELD+ P+F L  L F SQD SI  W+DRL
Sbjct  382   ISLLDTLELDT-PDFDLSSLYFCSQDSSILDWMDRL  416



>ref|XP_004156732.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus]
Length=518

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 255/393 (65%), Gaps = 26/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVR+ + P    I+DC A RECPNC+ +IDN+DV  EWPG PAGVKF+P+D E+++HLA
Sbjct  134   RKVRHINQPPSQVIKDCDAKRECPNCNFMIDNTDVLSEWPGLPAGVKFDPTDDEIMDHLA  193

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN +PH+ +DEFIPTLE D+GICYTHPENLPG+ KDG+  HFF++T  AYATG R
Sbjct  194   AKCAVGNLKPHVLIDEFIPTLETDQGICYTHPENLPGVSKDGNDVHFFHKTNNAYATGQR  253

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E +  ++H RWHKTGKTKA++ NGV KG KK+  LY S+K G KP K+NWV+H
Sbjct  254   KRRKIESEQNSSLQHFRWHKTGKTKAMISNGVHKGWKKIFSLYRSSKGGSKPEKSNWVIH  313

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq-qqqkQTTDNA----GESDIPQAIPTTPMTAIPNPP  474
             QYHLG +EDEKEG YV+SKI YQQ +Q  +  DN      ++ + Q  P TP +  P PP
Sbjct  314   QYHLGTEEDEKEGEYVLSKICYQQPKQSIKNNDNMLIEYLDAMLHQTSPRTPKSNPPVPP  373

Query  473   RAAG---ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA  303
             R+       P++ +    +L+   E      +  Y ++ S+    C    G LAGESQ  
Sbjct  374   RSGKSLVSNPVADNSLPQSLAKEEELTPEASRVSYANISSENDGGCH---GWLAGESQDI  430

Query  302   ADAT--DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP-------QEANNTSSSTNIA  150
             AD     ++D LLC+E++   D + L SN+    N  P P        E  N +    IA
Sbjct  431   ADGELHYLEDNLLCNEVL---DSSALISNN--QVNQIPFPLSGSNAYHEIANDNVPCGIA  485

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             DL NL+LD+ P+F L DL FGSQ+SI  W+DR+
Sbjct  486   DLENLDLDTPPDFHLADLQFGSQESIFDWIDRI  518



>ref|XP_006579788.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max]
Length=390

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 250/383 (65%), Gaps = 18/383 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+N +   +++I+DCG   EC  CH+ IDN+DVS EWPGFP GVKF+PSDVELLEHLA
Sbjct  14    RKVKNTNLSTDDQIKDCGTYLECQKCHYHIDNNDVSHEWPGFPVGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  G+ EPHMF+ EFIPTLEG+ GICYTHP+NLPG K DGSS HFF++T  AYATG R
Sbjct  74    AKCCIGDREPHMFIHEFIPTLEGELGICYTHPQNLPGAKTDGSSVHFFHKTVNAYATGPR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++  +  EHVRWHKTG+TKAV+E+GV KG KK+MVLY  +KKG KP KTNWVMH
Sbjct  134   KRRKIHHQDGMTEEHVRWHKTGRTKAVIEDGVHKGFKKIMVLYIRSKKGSKPYKTNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAAG  462
             QYHLG +EDEK+  YVVSKI+YQ+Q+Q +   +N    D   A    P T  PNPP    
Sbjct  194   QYHLGSEEDEKDDEYVVSKIFYQRQKQSEKNEENTVVEDSNIAAQAGPRTPKPNPPTRPC  253

Query  461   ETPLSCDDY---NAALS--PPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAAD  297
                  CDD    N  LS    A+ + G   E +   +       ++ P  LAGESQA  D
Sbjct  254   TG--KCDDNFDENELLSFIQDAKPIPG---ESHAPPYDVQDEDNKDDPAWLAGESQADFD  308

Query  296   ATDIDDFLLCDEIVGS---FDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELD  126
                ++D LLC +++ S    + + L S +  +AN    P   +N  +S  ++ L  LE D
Sbjct  309   G--LEDILLCKDMLDSSSLLNHSGLSSTYNANANKLVAPG-TDNDYASYGVSVLDTLEFD  365

Query  125   SAPEFSLQDLPFGSQDSISSWLD  57
             + P+F L +L FGSQDS   W+D
Sbjct  366   TPPDFDLSNLQFGSQDSTLQWID  388



>ref|XP_006604012.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max]
Length=398

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 203/392 (52%), Positives = 256/392 (65%), Gaps = 24/392 (6%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +  + ++I+DCGA RECPNC + IDNSDVS EWPGFP GVKF+PSDVELLEHLA
Sbjct  14    KKVKSTTLSSADQIKDCGAYRECPNCSYHIDNSDVSTEWPGFPLGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN++ HMF++EFIPTLEGD+GICYTHPENLPG KKDGS  HFF+RT  AYATG R
Sbjct  74    AKCGIGNTQQHMFINEFIPTLEGDQGICYTHPENLPGAKKDGSYVHFFHRTTNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY--STKKGEKPGKTNWVM  642
             KRRKI ++  L  EHVRWHKTGKTKA++E+G  KG KK+MVLY  S++ G +  K+NWVM
Sbjct  134   KRRKIHHQQGLTEEHVRWHKTGKTKAIIEDGAHKGFKKIMVLYVRSSENGSRSYKSNWVM  193

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPT----TPMTAIPNPP  474
             HQYHLG  E+EKEG YVVSKI+ QQQ+Q +  +    ++ P  I +          P  P
Sbjct  194   HQYHLGTVEEEKEGEYVVSKIFCQQQKQTEKNEGNPMAEDPDNIISRTGPRTPKPNPPNP  253

Query  473   RAAGETPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPG---CLAGESQ  309
               AG++ + CDD      L   A + +    E +    SD+Q   +++ G    LAGESQ
Sbjct  254   PRAGKS-VDCDDNIDETVLLSSALDTKTIPGESHAPQ-SDIQD--QDFTGNAAWLAGESQ  309

Query  308   A--AADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP----QEANNTSSSTNIAD  147
             A  +      DD LLC EI+ S    N P     S N   +     Q A N + S  I+ 
Sbjct  310   AEESTKYDGCDDILLCKEILDSSAILNDPG--LDSTNLEDIAGYATQRARNDNESCGISV  367

Query  146   LVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             L +LELD+ P+F L  L F SQDSI  W+DRL
Sbjct  368   LDSLELDT-PDFDLSSLYFCSQDSILDWMDRL  398



>ref|XP_004142846.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus]
Length=518

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 194/393 (49%), Positives = 255/393 (65%), Gaps = 26/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVR+ + P    I+DC A RECPNC+ +IDN+DV  EWPG PAGVKF+P+D E+++HLA
Sbjct  134   RKVRHINQPPSQVIKDCDAKRECPNCNFMIDNTDVLSEWPGLPAGVKFDPTDDEIMDHLA  193

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN +PH+ +DEFIPTLE D+GICYTHPENLPG+ KDG+  HFF++T  AYATG R
Sbjct  194   AKCAVGNLKPHVLIDEFIPTLETDQGICYTHPENLPGVSKDGNDVHFFHKTNNAYATGQR  253

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E +  ++H RWHKTGKTKA++ NGV KG KK+  LY S+K G KP K+NWV+H
Sbjct  254   KRRKIESEQNSSLQHFRWHKTGKTKAMISNGVHKGWKKIFSLYRSSKGGSKPEKSNWVIH  313

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq-qqqkQTTDNA----GESDIPQAIPTTPMTAIPNPP  474
             QYHLG +EDEKEG YV+SKI YQQ +Q  +  DN      ++ + Q  P TP +  P PP
Sbjct  314   QYHLGTEEDEKEGEYVLSKICYQQPKQSIKNNDNMLIEYLDAMLHQTSPRTPKSNPPVPP  373

Query  473   RAAGE--TPLSCDD-YNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA  303
             R+     + L  D+    +L+   E      +  Y ++ S+    C    G LAGESQ  
Sbjct  374   RSGKSLVSNLVADNSLPQSLAKEEELTPEASRVSYANISSENDGGCH---GWLAGESQDI  430

Query  302   ADAT--DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP-------QEANNTSSSTNIA  150
             AD     ++D LLC+E++   D + L SN+    N  P P        E  N +    IA
Sbjct  431   ADGELHYLEDNLLCNEVL---DSSALISNN--QVNQIPFPLSGSNAYHEIANDNVPCGIA  485

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             DL NL+LD+ P+F L DL FGSQ+SI  W+DR+
Sbjct  486   DLENLDLDTPPDFHLADLQFGSQESIFDWIDRI  518



>ref|XP_008458821.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Cucumis 
melo]
Length=395

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 250/391 (64%), Gaps = 25/391 (6%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KVR+ S P    I+DC A RECPNC+ +IDN+DV  EWPG PAGVKF+P+D E+++HLA
Sbjct  14    RKVRHISQPPSQVIKDCDAKRECPNCNFMIDNTDVLSEWPGLPAGVKFDPTDDEIMDHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC  GN +PH  +DEFIPTLE D+GICYTHPENLPG+ KDG+  HFF++T  AYATG R
Sbjct  74    AKCAVGNLKPHALIDEFIPTLETDQGICYTHPENLPGVSKDGNDVHFFHKTNNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +E S  +EH RWHKTGKTKA++ NGV KG KK+  LY S+K G KP K+NWV+H
Sbjct  134   KRRKIESEQSSSLEHFRWHKTGKTKAMISNGVHKGWKKIFSLYRSSKGGSKPEKSNWVIH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqq-kQTTDNA----GESDIPQAIPTTPMTAIPNPP  474
             QYHLG +EDEKEG YV+SKI YQQ +Q  +  DN      ++ + Q  P TP +  P PP
Sbjct  194   QYHLGTEEDEKEGEYVLSKISYQQPKQCIKNNDNMLIEYLDAMLHQTSPRTPKSNPPVPP  253

Query  473   RAAGETPLSCDDYNAALSPPAEEVE---GGKKERYGSLWSDVQVKCEEYPGCLAGESQAA  303
             R+      +    N+     A+E E      +  Y ++ S+    C    G +AGESQ  
Sbjct  254   RSGKSLVSNAVADNSLPQSSAKEEELTPEAFRVSYANISSENDGGCH---GWMAGESQDI  310

Query  302   ADAT--DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP-----QEANNTSSSTNIADL  144
             AD     ++D LLC+E++ S  F  + SN      F P+       E  N +    IADL
Sbjct  311   ADVELHYLEDNLLCNEVLDSSAF--ISSNQVNQIPF-PLSGSNAYHEIANDNVPCGIADL  367

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              NL+LD+ P+F L    FGSQ+SI  W+DR+
Sbjct  368   ENLDLDTPPDFHLA---FGSQESIFDWIDRI  395



>ref|XP_007141004.1| hypothetical protein PHAVU_008G159200g [Phaseolus vulgaris]
 gb|ESW12998.1| hypothetical protein PHAVU_008G159200g [Phaseolus vulgaris]
Length=394

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 250/388 (64%), Gaps = 20/388 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ S  + ++I+DCGA RECPNCH+ I NSDVS EWPGFP GVKF+PSDVELLEHL+
Sbjct  14    KKVKSNSLSSADQIKDCGAYRECPNCHYRIGNSDVSGEWPGFPLGVKFDPSDVELLEHLS  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
              KCG GN++P MF++EFI TLEGD+GICYTHPENL G KKDGS  HFF+RT  AYATG R
Sbjct  74    GKCGVGNTQPDMFINEFITTLEGDQGICYTHPENLQGAKKDGSYFHFFHRTINAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++  +  EH RWHKTGKTKA++ENG+ KG KK+MVL+  +K G KP K+NWVMH
Sbjct  134   KRRKIHHQQGVTEEHWRWHKTGKTKAIIENGICKGFKKIMVLHVRSKSGFKPYKSNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTP----MTAIPNPPR  471
             QYHLG +EDEKEG YVVSKI+YQQQ++ +  ++    + P  I +          P  P 
Sbjct  194   QYHLGTEEDEKEGEYVVSKIFYQQQKKTEKNEDNPMVEDPDNIVSRTGPRTPKPNPPNPP  253

Query  470   AAGETPLSCDDY--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA--  303
              AG +   CDDY       P A++ +    E    +  +  +    +   LAGESQA   
Sbjct  254   RAGNSA-DCDDYIDETVPLPSAQDTKAILGESLAPISDNHDLDSSAW---LAGESQAVEH  309

Query  302   ADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMP----QEANNTSSSTNIADLVNL  135
              +   +DD LLC EI+ S     L  +   S+N   +     Q A N + S  I+ L  L
Sbjct  310   IEYDGLDDILLCKEILDSSAL--LNDSGLDSSNLYDLAFYDNQMARNDNESCGISVLDTL  367

Query  134   ELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             ELD+ P+F L +  F SQDSI  W+ RL
Sbjct  368   ELDT-PDFDLSNFNFCSQDSILQWMGRL  394



>ref|XP_009387344.1| PREDICTED: NAC domain-containing protein 8-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 250/393 (64%), Gaps = 26/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCG--ATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KV+NA+  ++N+I+D G  A RECPNC HLIDNSDV+ +WPG PAGVKF+PSD ELLEH
Sbjct  14    RKVKNATF-SDNQIKDIGVEANRECPNCKHLIDNSDVTLDWPGLPAGVKFDPSDAELLEH  72

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             LA K G  NS+ H+ +DEFIP LE DEGICYTHPENLPG+KKDGSS HFF+R   AY TG
Sbjct  73    LAGKIGLENSKLHILIDEFIPMLEEDEGICYTHPENLPGVKKDGSSIHFFHRISNAYGTG  132

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
              RKRRKI N  +L  E +RWHKTGKTK V+ENGVQKG KK+MVLY S K+G KP + NWV
Sbjct  133   RRKRRKI-NHCALSEERIRWHKTGKTKCVLENGVQKGWKKIMVLYKSAKRGSKPDRANWV  191

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT---DNAGE-SDI--PQAIPTTPMTAIP  483
             MHQYHLG +EDE EG  VVSKI+ QQ   +  T   D   E +DI   +  P TP T  P
Sbjct  192   MHQYHLGPEEDEMEGQIVVSKIFCQQPTNQLGTYAMDPVKEDNDILNVRVGPRTPKTNTP  251

Query  482   NPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSL-WSDVQVKC----EEYPGCLAG  318
              PPR      L  D  +         ++G ++     +  S + V      +E P   AG
Sbjct  252   QPPR------LKNDSLHEVNGDSMTILQGQEQHPVSEVPLSPLPVSQPKGEDETPIWWAG  305

Query  317   ESQAAADA--TDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQE--ANNTSSSTNIA  150
             ESQA  +   ++  + LLC E++ SF      S H    N +    +  A  +S+++  +
Sbjct  306   ESQAVDEMLPSNFHESLLCHEVLDSFPHYEESSIHLNCTNLDCSRNQTVAAVSSTASGFS  365

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             DL N+ +D+ P+F L DL FGSQ+SI SWLDR 
Sbjct  366   DLDNILIDTPPDFQLSDLQFGSQESIMSWLDRF  398



>ref|XP_010033338.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Eucalyptus 
grandis]
Length=397

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 245/393 (62%), Gaps = 27/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA+     +I+DCGA RECPNCH  IDN+DVSPEWPG PAGVKF+PSD ELLEHLA
Sbjct  14    KKVKNATLSTSCQIKDCGANRECPNCHFFIDNTDVSPEWPGLPAGVKFDPSDGELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GNS  H+ +DEFIPTLE +EGICYTHPENLPG+ KDG S HFF+RT  AYATG R
Sbjct  74    AKCGIGNSRQHVLIDEFIPTLEWNEGICYTHPENLPGVNKDGRSVHFFHRTMNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++ +L  E VRWHKTGKTK V  +GV  G +K+MVLY S+KKG K  K+NWVMH
Sbjct  134   KRRKIHDQHNLNREDVRWHKTGKTKPVAIDGVHIGWQKIMVLYKSSKKGSKAAKSNWVMH  193

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQA-IPTTPMTAIPNPPRAAG  462
             QYHLG D++EK+G YVVSKI+ QQ ++ +  +N  + +     I    +T +   PR   
Sbjct  194   QYHLGADKEEKDGEYVVSKIFLQQPKETEKNNNNNKENNESMDIDYQDVTTLQTNPRTPK  253

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEE-YPGCLAGESQAAADATDI  285
               PL+            +  EG  K     ++ D+Q++ +E YP  LAGESQ   D    
Sbjct  254   PNPLNPHQ-TEKFGLLDDVAEGDMKSSDQDIFKDIQLEDDELYPEWLAGESQPLEDF---  309

Query  284   DDFLLCDEIVGSFDFNNLPSNHATSAN--------------FNPMPQEANNTSSST-NIA  150
              DF   D ++    F+  PS   + +N               N +  E     ++T  I+
Sbjct  310   -DFGYIDGLL----FHEEPSRSHSPSNDRGCNLVPPTSLPEINEVVNEVVTDENATYGIS  364

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             +L  L+ DS P+F   +LPFGSQ+ I  WL R+
Sbjct  365   ELAKLDFDSPPDFLHPELPFGSQEGIFEWLGRI  397



>ref|XP_010033337.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Eucalyptus 
grandis]
Length=400

 Score =   330 bits (847),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 245/393 (62%), Gaps = 27/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA+     +I+DCGA RECPNCH  IDN+DVSPEWPG PAGVKF+PSD ELLEHLA
Sbjct  17    KKVKNATLSTSCQIKDCGANRECPNCHFFIDNTDVSPEWPGLPAGVKFDPSDGELLEHLA  76

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GNS  H+ +DEFIPTLE +EGICYTHPENLPG+ KDG S HFF+RT  AYATG R
Sbjct  77    AKCGIGNSRQHVLIDEFIPTLEWNEGICYTHPENLPGVNKDGRSVHFFHRTMNAYATGQR  136

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++ +L  E VRWHKTGKTK V  +GV  G +K+MVLY S+KKG K  K+NWVMH
Sbjct  137   KRRKIHDQHNLNREDVRWHKTGKTKPVAIDGVHIGWQKIMVLYKSSKKGSKAAKSNWVMH  196

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQA-IPTTPMTAIPNPPRAAG  462
             QYHLG D++EK+G YVVSKI+ QQ ++ +  +N  + +     I    +T +   PR   
Sbjct  197   QYHLGADKEEKDGEYVVSKIFLQQPKETEKNNNNNKENNESMDIDYQDVTTLQTNPRTPK  256

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEE-YPGCLAGESQAAADATDI  285
               PL+            +  EG  K     ++ D+Q++ +E YP  LAGESQ   D    
Sbjct  257   PNPLNPHQ-TEKFGLLDDVAEGDMKSSDQDIFKDIQLEDDELYPEWLAGESQPLEDF---  312

Query  284   DDFLLCDEIVGSFDFNNLPSNHATSAN--------------FNPMPQEANNTSSST-NIA  150
              DF   D ++    F+  PS   + +N               N +  E     ++T  I+
Sbjct  313   -DFGYIDGLL----FHEEPSRSHSPSNDRGCNLVPPTSLPEINEVVNEVVTDENATYGIS  367

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             +L  L+ DS P+F   +LPFGSQ+ I  WL R+
Sbjct  368   ELAKLDFDSPPDFLHPELPFGSQEGIFEWLGRI  400



>ref|NP_001047308.1| Os02g0594800 [Oryza sativa Japonica Group]
 dbj|BAD16820.1| no apical meristem (NAM)-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF09222.1| Os02g0594800 [Oryza sativa Japonica Group]
 dbj|BAH00731.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   329 bits (843),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 189/391 (48%), Positives = 245/391 (63%), Gaps = 27/391 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+RNA   +   I + GA    ECPNC H+IDNSDV+ +WPG PAGVKF+PSD+ELLEH
Sbjct  14    KKIRNAPHCSSRPISELGAEAQMECPNCKHVIDNSDVAIQWPGLPAGVKFDPSDLELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G S+PH F+DEFIPT++ DEGICY+HPENLPG+KKDG+SGHFF+R   AY  G
Sbjct  74    LEQKIGLGGSKPHTFIDEFIPTIDNDEGICYSHPENLPGMKKDGTSGHFFHRVSNAYGCG  133

Query  821   TRKRRKISNETSLV-MEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNW  648
              RKRRKISN   +V +EHVRWHKTGK+KA++E GV KG KK+MVLY S+++G KP K NW
Sbjct  134   QRKRRKISNCDHVVSVEHVRWHKTGKSKAIVEKGVTKGWKKIMVLYKSSQRGAKPDKANW  193

Query  647   VMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD------IPQAIPTTPMTAI  486
             VMHQYHLG +EDEK+G  VVSKI YQ   ++      G +D        +  P TP +  
Sbjct  194   VMHQYHLGAEEDEKDGELVVSKISYQLHGKQIDKSETGNADEESDAFAARVGPKTPKSNT  253

Query  485   PNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQA  306
             P P R    +P   ++Y+  L    EE          SL  D        P   AGE+QA
Sbjct  254   PQPCRLKN-SPCETENYDPILEDQDEEESNIP---IVSLKDDAG-----NPAWCAGETQA  304

Query  305   AADAT----DIDDFLLCDEIVGSFDFNN-LPSNH-ATSANFNPMPQEANNTSSSTNIADL  144
             A +A     ++D+ L C E++ SF     LPS+    S   N +     N ++   + DL
Sbjct  305   AREAVQACPNLDESLRCHEVLDSFYHETLLPSDRPILSQGGNEILDR--NLNAVYGLPDL  362

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              N++L + P+F L DL FGSQ+SI +WLD +
Sbjct  363   YNVDLGTPPDFQLADLQFGSQESIGNWLDSI  393



>ref|XP_006369935.1| hypothetical protein POPTR_0001s35490g [Populus trichocarpa]
 gb|ERP66504.1| hypothetical protein POPTR_0001s35490g [Populus trichocarpa]
Length=426

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/381 (51%), Positives = 243/381 (64%), Gaps = 16/381 (4%)
 Frame = -1

Query  1166  RNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKC  987
             R  S  +  +I+DCGA RECP CH  IDNSDV+ EWPG P GVKF+PSD +LLEHL AKC
Sbjct  14    RKVSRSSAYQIKDCGANRECPKCHCHIDNSDVTQEWPGLPIGVKFDPSDAQLLEHLEAKC  73

Query  986   GEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRR  807
               GNS+PHMF+DEFIPTL+GD+GICYTHP  LPG KKDG+S HFF+RT  AYATG RKRR
Sbjct  74    AVGNSKPHMFIDEFIPTLDGDKGICYTHPAKLPGAKKDGNSVHFFHRTNNAYATGQRKRR  133

Query  806   KISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYH  630
             KI  E     E VRWHKTGKTK VM+NGVQKGCKK+MVLY S+KKG KP K+ WVMHQYH
Sbjct  134   KIHCEVGSNEEGVRWHKTGKTKPVMDNGVQKGCKKIMVLYKSSKKGSKPDKSKWVMHQYH  193

Query  629   LGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGE  459
             LG DEDEKEG YVVSKI+YQQ+Q ++  DN    D   +          + P  P   G+
Sbjct  194   LGTDEDEKEGEYVVSKIFYQQKQTEKNDDNLLIEDNDILSHQTSPRTPNSNPPNPPRPGK  253

Query  458   TPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAA--ADATD  288
             + +  D  N  ++  A +    K+E         Q++ + E+P   AGESQA   +D T 
Sbjct  254   SVMYDDIANDNITHLAGQNNEIKEEAPDVPAHVFQLEGDVEFPEWFAGESQAVENSDFTA  313

Query  287   IDDFLLCDEIVGSFDFNNLPSNHATS-ANFNPMPQEANNTSSST----NIADLVNLELDS  123
             +DD LLC+EI  S     +P+N   +  ++  M    N  + +      IA+L NLELD+
Sbjct  314   LDDSLLCNEIFVSAP--RVPNNSGVNRVSYTGMAHNTNEVNGNNNEPCGIAELENLELDT  371

Query  122   APEFSLQDLPFGSQDSISSWL  60
              P+F L  L   +  ++  WL
Sbjct  372   PPDFQLAFLICSTGSAV--WL  390



>ref|XP_006599084.1| PREDICTED: NAC domain-containing protein 8-like isoform X3 [Glycine 
max]
Length=399

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 192/377 (51%), Positives = 244/377 (65%), Gaps = 30/377 (8%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++ +  + ++I+DCGA RECPNC + IDNSDVS EWPGFP GVKF+PSDVELLEHLA
Sbjct  14    KKVKSITLSSADQIKDCGAYRECPNCSYHIDNSDVSTEWPGFPLGVKFDPSDVELLEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN++ H+F++EFIPTLEGD+GICYTHPENLPG KKDG+  HFF+RT  AYATG R
Sbjct  74    AKCGIGNTKQHLFINEFIPTLEGDQGICYTHPENLPGAKKDGNYVHFFHRTTNAYATGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY--STKKGEKPGKTNWVM  642
             KRRKI ++  L  EHVRWHKTGKTKA++E+GV KG KK+MV+Y  S++ G KP K+NWVM
Sbjct  134   KRRKIHHQQGLTEEHVRWHKTGKTKAIIEDGVHKGFKKIMVIYIRSSENGSKPYKSNWVM  193

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAA  465
             HQYHLG +EDEKE  YVVSK++YQQQ+Q +   DN    D    I  T        P   
Sbjct  194   HQYHLGTEEDEKEAEYVVSKVFYQQQKQTEKNEDNPMAGDPANIISRTSPRTPKPNPPNP  253

Query  464   GET--PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPG---CLAGESQAAA  300
               T   + CDD N   +         K    GSL     ++ ++  G    LAGESQA  
Sbjct  254   PRTGKSVDCDD-NIDETVLLSAALDTKTIPEGSLAPQSDIQDQDNTGDAAWLAGESQAEE  312

Query  299   DA--TDIDDFLLCDEIVGS--------FDFNNLP--SNHATSANFNPMPQEANNTSSSTN  156
             ++    +DD LLC+EI+ S         D+ NL   +++AT        Q A N +    
Sbjct  313   NSEYDGLDDILLCNEILDSSALLNDSGLDYTNLDDIASYAT--------QRARNDNEPCG  364

Query  155   IADLVNLELDSAPEFSL  105
             I+ L  LELD+ P+F L
Sbjct  365   ISLLDTLELDT-PDFDL  380



>ref|XP_009416662.1| PREDICTED: NAC domain-containing protein 8-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 240/388 (62%), Gaps = 20/388 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KV+NA+    ++I+D   GA RECPNC HLIDNSDV+  WPG PAGV+F+PSDVELLEH
Sbjct  14    RKVKNANCFDNDQIKDLGVGANRECPNCKHLIDNSDVTSVWPGLPAGVRFDPSDVELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             LA K G  NS+ HM +DEFIPTL+ DEGICYTHPENLPG KKDGSS HFF+R   AY TG
Sbjct  74    LAGKIGLENSKLHMLIDEFIPTLDEDEGICYTHPENLPGAKKDGSSIHFFHRISNAYGTG  133

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
              RKRRKI N+ +   E VRWHKTGKTK V+EN    G KK+MVLY S+K+G +P K NWV
Sbjct  134   QRKRRKI-NQHAFSEECVRWHKTGKTKRVLEN----GWKKIMVLYRSSKRGSRPDKANWV  188

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAG----ESDI--PQAIPTTPMTAIP  483
             MHQYHLG +EDEK+G  VVSKI+YQ    +     A     ES++   +  P TP T  P
Sbjct  189   MHQYHLGTEEDEKKGELVVSKIFYQHSTSRLDKIEADPFNEESNVFTVKIGPRTPNTNTP  248

Query  482   NPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA  303
              PPR    +P   + ++  L    EE           L         E P   AGESQA 
Sbjct  249   QPPRQKKGSPHEVNGHSLPLLLGQEEHCPNSGVPLLPLSISPWTGEVETPARWAGESQAV  308

Query  302   --ADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFN---PMPQEANNTSSSTNIADLVN  138
                D  ++ + LLC E++ SF      S H    N N    +P  A + S++   +DL N
Sbjct  309   DEPDPINLQESLLCHEVLDSFPHFEDSSLHVNGTNLNCGRNVPASAID-STACEFSDLDN  367

Query  137   LELDSAPEFSLQDLPFGSQDSISSWLDR  54
             + +D+ P+F L DL FGSQ+S  SWLDR
Sbjct  368   ILIDTPPDFQLSDLQFGSQESSMSWLDR  395



>gb|KCW52944.1| hypothetical protein EUGRSUZ_J02254 [Eucalyptus grandis]
Length=430

 Score =   328 bits (841),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 245/393 (62%), Gaps = 27/393 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA+     +I+DCGA RECPNCH  IDN+DVSPEWPG PAGVKF+PSD ELLEHLA
Sbjct  47    KKVKNATLSTSCQIKDCGANRECPNCHFFIDNTDVSPEWPGLPAGVKFDPSDGELLEHLA  106

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GNS  H+ +DEFIPTLE +EGICYTHPENLPG+ KDG S HFF+RT  AYATG R
Sbjct  107   AKCGIGNSRQHVLIDEFIPTLEWNEGICYTHPENLPGVNKDGRSVHFFHRTMNAYATGQR  166

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++ +L  E VRWHKTGKTK V  +GV  G +K+MVLY S+KKG K  K+NWVMH
Sbjct  167   KRRKIHDQHNLNREDVRWHKTGKTKPVAIDGVHIGWQKIMVLYKSSKKGSKAAKSNWVMH  226

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQA-IPTTPMTAIPNPPRAAG  462
             QYHLG D++EK+G YVVSKI+ QQ ++ +  +N  + +     I    +T +   PR   
Sbjct  227   QYHLGADKEEKDGEYVVSKIFLQQPKETEKNNNNNKENNESMDIDYQDVTTLQTNPRTPK  286

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEE-YPGCLAGESQAAADATDI  285
               PL+            +  EG  K     ++ D+Q++ +E YP  LAGESQ   D    
Sbjct  287   PNPLN-PHQTEKFGLLDDVAEGDMKSSDQDIFKDIQLEDDELYPEWLAGESQPLEDF---  342

Query  284   DDFLLCDEIVGSFDFNNLPSNHATSAN--------------FNPMPQEANNTSSST-NIA  150
              DF   D ++    F+  PS   + +N               N +  E     ++T  I+
Sbjct  343   -DFGYIDGLL----FHEEPSRSHSPSNDRGCNLVPPTSLPEINEVVNEVVTDENATYGIS  397

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             +L  L+ DS P+F   +LPFGSQ+ I  WL R+
Sbjct  398   ELAKLDFDSPPDFLHPELPFGSQEGIFEWLGRI  430



>ref|XP_006648804.1| PREDICTED: NAC domain-containing protein 8-like [Oryza brachyantha]
Length=395

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 245/393 (62%), Gaps = 30/393 (8%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCG--ATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+RNA   +   I + G  A  ECP C H+IDNSD + +WPG PAGVKF+PSD+ELLEH
Sbjct  15    KKIRNAPHCSSRPISELGPEAQMECPKCKHVIDNSDAAIQWPGLPAGVKFDPSDLELLEH  74

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G S+PHMF+DEFIPT++ DEGICY+HPENLPG+KKDG+SGHFF+R   AY  G
Sbjct  75    LEQKIGIGGSKPHMFIDEFIPTIDNDEGICYSHPENLPGMKKDGTSGHFFHRVSNAYGCG  134

Query  821   TRKRRKIS--NETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTN  651
              RKRRKIS  +   + +EHVRWHKTGK+KA++E GV KG KK+MVLY S+++G +P K N
Sbjct  135   QRKRRKISSCDHHIVSVEHVRWHKTGKSKAIVEKGVTKGWKKIMVLYKSSQRGARPDKAN  194

Query  650   WVMHQYHLGIDEDEKEGGYVVSKIYYqq------qqqkQTTDNAGESDIPQAIPTTPMTA  489
             WVMHQYHLG DEDEK+G  VVSKI YQ       + + +  D   ++   +  P TP T 
Sbjct  195   WVMHQYHLGADEDEKDGELVVSKISYQLNGKQTDKSETENVDEESDAFAARVGPKTPKTN  254

Query  488   IPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEE-YPGCLAGES  312
              P P R    +P   ++Y     P  E+ EG +     S    V +K +   P   AGES
Sbjct  255   TPQPCR-LNNSPCETENY----VPVLEDQEGEE-----SNIPIVSLKDDSGNPAWCAGES  304

Query  311   QAAADAT----DIDDFLLCDEIVGSFDFNN-LPSNH-ATSANFNPMPQEANNTSSSTNIA  150
              A  +A     ++D+ L C E++ SF     LPS+    S   N MP    N +    + 
Sbjct  305   HAVQEAVQTRPNLDESLHCHEVLDSFLHETLLPSDRPILSQGRNEMPDR--NLNPLYGLC  362

Query  149   DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             DL N++L + P+F L DL FGSQ+SI  WLD +
Sbjct  363   DLFNVDLGTPPDFQLADLQFGSQESIGHWLDSI  395



>gb|EAZ23656.1| hypothetical protein OsJ_07356 [Oryza sativa Japonica Group]
Length=405

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 245/403 (61%), Gaps = 39/403 (10%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGA--TRECPNCHHLIDNSD------------VSPEWPGFPAGV  1038
             +K+RNA   +   I + GA    ECPNC H+IDNSD            V+ +WPG PAGV
Sbjct  14    KKIRNAPHCSSRPISELGAEAQMECPNCKHVIDNSDLQKGRLLLMRKEVAIQWPGLPAGV  73

Query  1037  KFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGH  858
             KF+PSD+ELLEHL  K G G S+PH F+DEFIPT++ DEGICY+HPENLPG+KKDG+SGH
Sbjct  74    KFDPSDLELLEHLEQKIGLGGSKPHTFIDEFIPTIDNDEGICYSHPENLPGMKKDGTSGH  133

Query  857   FFYRTKKAYATGTRKRRKISNETSLV-MEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-S  684
             FF+R   AY  G RKRRKISN   +V +EHVRWHKTGK+KA++E GV KG KK+MVLY S
Sbjct  134   FFHRVSNAYGCGQRKRRKISNCDHVVSVEHVRWHKTGKSKAIVEKGVTKGWKKIMVLYKS  193

Query  683   TKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD------I  522
             +++G KP K NWVMHQYHLG +EDEK+G  VVSKI YQ   ++      G +D       
Sbjct  194   SQRGAKPDKANWVMHQYHLGAEEDEKDGELVVSKISYQLHGKQIDKSETGNADEESDAFA  253

Query  521   PQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE  342
              +  P TP +  P P R    +P   ++Y+  L    EE          SL  D      
Sbjct  254   ARVGPKTPKSNTPQPCRLKN-SPCETENYDPILEDQDEEESNIP---IVSLKDDAG----  305

Query  341   EYPGCLAGESQAAADAT----DIDDFLLCDEIVGSFDFNN-LPSNH-ATSANFNPMPQEA  180
               P   AGE+QAA +A     ++D+ L C E++ SF     LPS+    S   N +    
Sbjct  306   -NPAWCAGETQAAREAVQACPNLDESLRCHEVLDSFYHETLLPSDRPILSQGGNEILDR-  363

Query  179   NNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              N ++   + DL N++L + P+F L DL FGSQ+SI +WLD +
Sbjct  364   -NLNAVYGLPDLYNVDLGTPPDFQLADLQFGSQESIGNWLDSI  405



>ref|XP_011003121.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Populus 
euphratica]
Length=412

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 235/369 (64%), Gaps = 14/369 (4%)
 Frame = -1

Query  1166  RNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKC  987
             R  S  +  +I+DCGA RECP CH  IDNSDV+ EWPG P GVKF+PSD +LLEHL AKC
Sbjct  14    RKVSRSSAYQIKDCGAIRECPKCHCHIDNSDVTQEWPGLPIGVKFDPSDAQLLEHLEAKC  73

Query  986   GEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRR  807
               GNS+PHMF+DEFIPTL+ D+GICYTHP  LPG KKDG+S HFF+RT  AYATG RKRR
Sbjct  74    AVGNSKPHMFIDEFIPTLDSDKGICYTHPAKLPGAKKDGNSVHFFHRTNNAYATGQRKRR  133

Query  806   KISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYH  630
             KI  E     + VRWHKTGKTK VM+NGVQKGCKK+MVLY S+KKG KP K+ WVMHQYH
Sbjct  134   KIHCEVGSNEDSVRWHKTGKTKPVMDNGVQKGCKKIMVLYKSSKKGSKPDKSKWVMHQYH  193

Query  629   LGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGE  459
             LG DEDEKEG Y+VSKI+YQQ+Q ++  DN    D   +          + P  P    +
Sbjct  194   LGTDEDEKEGEYLVSKIFYQQKQTEKNDDNQLIEDNDILSHQTSPRTPNSNPPNPPRPAK  253

Query  458   TPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE-EYPGCLAGESQAA--ADATD  288
             + +  D  N   +  A +    K+E         Q++ + E+P   AGESQA   +D + 
Sbjct  254   SVMYDDITNDNRTQLAVQNNEIKEEAPDVPAHVFQLEGDVEFPEWFAGESQAVENSDFSA  313

Query  287   IDDFLLCDEIVGSFDFNNLPSNHATS-ANFNPMPQEANNTSSST----NIADLVNLELDS  123
             +DD LLC+EI  S     +P+N   +  ++  M    N  + +      IA+L NLELD+
Sbjct  314   LDDSLLCNEIFVSAP--RVPNNSGVNRVSYTGMAHNTNEVNGNNNEPCGIAELENLELDT  371

Query  122   APEFSLQDL  96
              P+F L  L
Sbjct  372   PPDFQLAFL  380



>gb|EAY86512.1| hypothetical protein OsI_07891 [Oryza sativa Indica Group]
Length=405

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 245/403 (61%), Gaps = 39/403 (10%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGA--TRECPNCHHLIDNSD------------VSPEWPGFPAGV  1038
             +K+RNA   +   I + GA    ECPNC H+IDNSD            V+ +WPG PAGV
Sbjct  14    KKIRNAPHCSSRPISELGAEAQMECPNCKHVIDNSDLQKGRLLLMRKEVAIQWPGLPAGV  73

Query  1037  KFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGH  858
             KF+PSD+ELLEHL  K G G S+PH F+DEFIPT++ DEGICY+HPENLPG+KKDG+SGH
Sbjct  74    KFDPSDLELLEHLEQKIGLGGSKPHTFIDEFIPTIDNDEGICYSHPENLPGMKKDGTSGH  133

Query  857   FFYRTKKAYATGTRKRRKISNETSLV-MEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-S  684
             FF+R   AY  G RKRRKISN   +V +EHVRWHKTGK+KA++E GV KG KK+MVLY S
Sbjct  134   FFHRVSNAYGCGQRKRRKISNCDHVVSVEHVRWHKTGKSKAIVEKGVTKGWKKIMVLYKS  193

Query  683   TKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD------I  522
             +++G KP K NWVMHQYHLG +EDEK+G  VVSKI YQ   ++      G +D       
Sbjct  194   SQRGAKPDKANWVMHQYHLGAEEDEKDGELVVSKISYQLHGKQIDKLETGNADEESDAFA  253

Query  521   PQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE  342
              +  P TP +  P P R    +P   ++Y+  L    EE          SL  D      
Sbjct  254   ARVGPKTPKSNTPQPCRLKN-SPCETENYDPILEDQDEEESNIP---IVSLKDDAG----  305

Query  341   EYPGCLAGESQAAADAT----DIDDFLLCDEIVGSFDFNN-LPSNH-ATSANFNPMPQEA  180
               P   AGE+QAA +A     ++D+ L C E++ SF     LPS+    S   N +    
Sbjct  306   -NPAWCAGETQAAREAVQACPNLDESLRCHEVLDSFYHETLLPSDRPILSQGGNEILDR-  363

Query  179   NNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              N ++   + DL N++L + P+F L DL FGSQ+SI +WLD +
Sbjct  364   -NLNAVYGLPDLYNVDLGTPPDFQLADLQFGSQESIGNWLDSI  405



>ref|XP_007150911.1| hypothetical protein PHAVU_004G004900g [Phaseolus vulgaris]
 gb|ESW22905.1| hypothetical protein PHAVU_004G004900g [Phaseolus vulgaris]
Length=363

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 181/374 (48%), Positives = 241/374 (64%), Gaps = 23/374 (6%)
 Frame = -1

Query  1136  IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMF  957
             +++C   RECP CH+  +N+DVS EWPGFP GVKF+PSD+ELL+HL AKC  GN E H+F
Sbjct  1     MKNCETYRECPKCHYHSNNTDVSHEWPGFPVGVKFDPSDIELLKHLEAKCCVGNREQHVF  60

Query  956   LDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVM  777
             + EFIPTLEG++GICYTHPENLPG +KDG+S HFF++T  AYATG RKRRKI ++  L  
Sbjct  61    IHEFIPTLEGEQGICYTHPENLPGARKDGNSVHFFHKTANAYATGRRKRRKIHHQDGLTE  120

Query  776   EHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEG  600
             EHVRWHKTG+TK+V E+GV KG KK+MVLY  +K+G K  KTNWVMHQ+HLG +E+EK+G
Sbjct  121   EHVRWHKTGRTKSVTEDGVHKGFKKIMVLYIRSKEGSKAYKTNWVMHQFHLGSEEEEKDG  180

Query  599   GYVVSKIYYqqqqqkQTTDN---AGESDIPQAIPTTPMTAIPNPPRAAGETPLSCDDY--  435
              YVVSK++YQ Q+  +  +      +S+I      +     P      G+    CDD+  
Sbjct  181   EYVVSKVFYQHQKHTEKNEENTVVEDSNIAAQAGPSTPNPNPPTRPCTGK----CDDHFD  236

Query  434   -NAALSPPAEEVEGGKKERYGSLW--SDVQ---VKCEEYPGCLAGESQAAADATDIDDFL  273
              N  LS     ++  K     SL   SDVQ   +K +  P  LAGESQ   D  ++++ L
Sbjct  237   ENELLSF----IQDAKPIPGESLAPPSDVQHEDIKVD--PAWLAGESQPDCDFHELEEIL  290

Query  272   LCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLP  93
             L  +    F+ + L S    +AN    P   N+ +SS  ++ L  LEL+S P+F L +L 
Sbjct  291   LMSDSSALFNHSGLASPLNGTANSLVAPGNTNDYASS-GVSLLDTLELESPPDFDLSNLQ  349

Query  92    FGSQDSISSWLDRL  51
             FGSQDS   W+D+L
Sbjct  350   FGSQDSTLQWMDKL  363



>ref|XP_004306377.1| PREDICTED: NAC domain-containing protein 8-like [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   318 bits (815),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 196/408 (48%), Positives = 241/408 (59%), Gaps = 50/408 (12%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+N SS    ++QDCGA RECP CH+LI NSDVS +WPGFP GVKF+PSD EL++HLAA
Sbjct  49    KVKNCSS----QVQDCGANRECPRCHYLISNSDVSTKWPGFPTGVKFDPSDSELIDHLAA  104

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PHMF+DEFIPT++ D GICYTHPE LPG KKDGSS HFF++T  AY+TG RK
Sbjct  105   KVGVGNSKPHMFIDEFIPTIDWDVGICYTHPEKLPGAKKDGSSFHFFHKTLNAYSTGQRK  164

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  E  L  + VRWHKTGKTKA+ + GV  G KK+MVLY S+ KG K  K +WVMHQ
Sbjct  165   RRKIDKEQGLDAQAVRWHKTGKTKAI-KGGVHPGWKKIMVLYKSSNKGSKADKADWVMHQ  223

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIP---------  483
             YHLG  EDEKEG YVVSKI+YQQ +Q     +  E ++ +  P + +  I          
Sbjct  224   YHLGSTEDEKEGEYVVSKIFYQQPKQT----DKNEDNLVKGEPESSILQISPITPITCPP  279

Query  482   -------------NPPRAAGETPLSCDDYNAALSPPA--EEVEGGKKERYGSLWSDVQVK  348
                          +P     ++P    +Y   +S  A   + EG        L S  +  
Sbjct  280   TTPAPQESAWRDDDPDEYIHKSPAKVTEYVPEVSQYAVLRKFEGS-MSHVPQLDSQFEDN  338

Query  347   CEEYPGCLAGESQA--AADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANN  174
               + P  LAGESQA        +DD LLC E      FN+  S +    N   +   ANN
Sbjct  339   IGQ-PTWLAGESQADEYYGLNCVDDTLLCKET-----FNSSTSLNGPVLNPISITDYANN  392

Query  173   T-------SSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             T       S+S  + DL NLE DS P+F L  L F SQDSI  WLD +
Sbjct  393   TNGVTGNGSTSFGVPDLENLEFDSPPDFQLHGLQFCSQDSILDWLDWM  440



>gb|EYU34749.1| hypothetical protein MIMGU_mgv1a023855mg [Erythranthe guttata]
Length=289

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA     N+I DCGA  +CPNC +LIDNSD S EWPG PAGVKF+PSDVELLEHLA
Sbjct  15    KKVKNAGISTANQINDCGANWQCPNCQYLIDNSDTSHEWPGLPAGVKFDPSDVELLEHLA  74

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG G   PHMF+DEFIPTLEGDEGICYTHPENLPG KKDG+S HFFYR   AYA+G R
Sbjct  75    AKCGVGFEGPHMFIDEFIPTLEGDEGICYTHPENLPGAKKDGTSFHFFYRIVNAYASGQR  134

Query  815   KRRKISN-ETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYS-TKKGEKPGKTNWVM  642
             KRR+I + E ++   HVRWHKTGKTK+V ENGVQKG KK+MVLY+ +K G KPGK NWVM
Sbjct  135   KRRRIEDQERTIKAAHVRWHKTGKTKSVKENGVQKGFKKIMVLYAGSKTGSKPGKCNWVM  194

Query  641   HQYHLGIDEDEKEGGYV  591
             HQYHLG DEDE+EG YV
Sbjct  195   HQYHLGSDEDEREGEYV  211


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 14/93 (15%)
 Frame = -1

Query  320  GESQAAADATDID--DFLLCDEIVGSFD-FNNLPSNHATSANFNPMPQEANNTSSSTNIA  150
            GE     +A D+   + LLC+EI+GS+  F++L  N+         PQ   + +    IA
Sbjct  208  GEYVDEMEAVDLSGGESLLCNEIIGSYGAFDDLRPNY---------PQVGGDFTCG--IA  256

Query  149  DLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
            DL N+ELD+ P+F L DL F SQDS+  WLDRL
Sbjct  257  DLENIELDTPPDFQLNDLQFASQDSVFDWLDRL  289



>gb|KEH22118.1| NAC transcription factor-like protein [Medicago truncatula]
Length=501

 Score =   308 bits (788),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 211/308 (69%), Gaps = 13/308 (4%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +K+R+ S  + ++I+DCGA RECPNCH  IDNSDVS EWPGFP G+KF+PSDVE+LEHLA
Sbjct  14    KKLRSTSLSSADQIKDCGACRECPNCHSRIDNSDVSSEWPGFPLGIKFDPSDVEILEHLA  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG GN +PHMF++EFIPTLEG++GICYTHPENLPG KKDGSS HFF+RT  AY++G R
Sbjct  74    AKCGAGNIKPHMFIEEFIPTLEGEQGICYTHPENLPGAKKDGSSVHFFHRTMNAYSSGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI +  S   +HVRWHKTGKTKA++E+G  KG KK+MVLY  ++K  K  K++W MH
Sbjct  134   KRRKIHHRGS-TEDHVRWHKTGKTKAIIEHGEHKGFKKIMVLYIRSEKESKSYKSDWKMH  192

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGE  459
             QYHLG DEDEK G YVVSKI+Y+Q ++ +    A E   P +I +      P P      
Sbjct  193   QYHLGTDEDEKNGEYVVSKIFYKQNEKNEEKPMAEE---PDSITSRTSPRTPKPNPPNPP  249

Query  458   TPLSCDDY----NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPG-CLAGESQAAA--  300
                 C D       +L P AE+ +    E   ++ SD+Q +   Y    LAGESQAA   
Sbjct  250   RTGKCVDNGNIDETSLMPFAEDAKFIPVES-NAMQSDIQDQENTYNFPWLAGESQAALQF  308

Query  299   DATDIDDF  276
             D  D D+F
Sbjct  309   DIQDHDNF  316


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 7/111 (6%)
 Frame = -1

Query  386  ERYGSLWSDVQVK-CEEYPGCLAGESQAAADA--TDIDDFLLCDEIVGS---FDFNNLPS  225
            E   +L +D+Q +        LAGESQA  ++    +DD LLCDEI  S   F  + L S
Sbjct  385  ESQAALQTDIQNRDNTNNSAWLAGESQAMENSEYAGLDDLLLCDEIFDSSTLFTDSQLDS  444

Query  224  NHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSI  72
             +  +   N M    N  SS T+ A L  LELD+ P+F L +L FGSQ+SI
Sbjct  445  INDLTHYENRMTGNYN-VSSETSTAVLDTLELDTPPDFDLSNLTFGSQESI  494



>gb|KHN34454.1| NAC domain-containing protein 8 [Glycine soja]
Length=369

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 228/355 (64%), Gaps = 20/355 (6%)
 Frame = -1

Query  1070  SPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENL  891
             S EWPGFP GVKF+PSDVELLEHLAAKCG GN++ HMF++EFIPTLEGD+GICYTHPENL
Sbjct  20    STEWPGFPLGVKFDPSDVELLEHLAAKCGIGNTQQHMFINEFIPTLEGDQGICYTHPENL  79

Query  890   PGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKG  711
             PG KKDGS  HFF+RT  AYATG RKRRKI ++  L  EHVRWHKTGKTKA++E+G  KG
Sbjct  80    PGAKKDGSYVHFFHRTTNAYATGQRKRRKIHHQQGLTEEHVRWHKTGKTKAIIEDGAHKG  139

Query  710   CKKVMVLY--STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNA  537
              KK+MVLY  S++ G +  K+NWVMHQYHLG  E+EKEG YVVSKI+ QQQ+Q +  +  
Sbjct  140   FKKIMVLYVRSSENGSRSYKSNWVMHQYHLGTVEEEKEGEYVVSKIFCQQQKQTEKNEGN  199

Query  536   GESDIPQAIPT----TPMTAIPNPPRAAGETPLSCDDY--NAALSPPAEEVEGGKKERYG  375
               ++ P  I +          P  P  AG++ + CDD      L   A + +    E + 
Sbjct  200   PMAEDPDNIISRTGPRTPKPNPPNPPRAGKS-VDCDDNIDETVLLSSALDTKTIPGESHA  258

Query  374   SLWSDVQVKCEEYPG---CLAGESQA--AADATDIDDFLLCDEIVGSFDFNNLPSNHATS  210
                SD+Q   +++ G    LAGESQA  +      DD LLC EI+ S    N P   +T+
Sbjct  259   PQ-SDIQD--QDFTGNAAWLAGESQAEESTKYDGCDDILLCKEILDSSAILNDPGLDSTN  315

Query  209   AN--FNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
                      Q A N + S  I+ L +LELD+ P+F L  L F SQDSI  W+DRL
Sbjct  316   LEDIAGYATQRARNDNESCGISVLDSLELDT-PDFDLSSLYFCSQDSILDWMDRL  369



>ref|XP_007046313.1| NAC domain protein, IPR003441 isoform 1 [Theobroma cacao]
 gb|EOY02145.1| NAC domain protein, IPR003441 isoform 1 [Theobroma cacao]
Length=434

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 183/419 (44%), Positives = 235/419 (56%), Gaps = 55/419 (13%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+R+AS+P E        TR CP+CHH IDNSDV+  WPG P GVKF+PSD E++ HL  
Sbjct  15    KIRSASNP-ERVTWKSNPTRSCPSCHHTIDNSDVTQAWPGLPRGVKFDPSDQEIIWHLLT  73

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G  +S+PH F++EFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGTRK
Sbjct  74    KVGVEDSKPHPFINEFIPTIENDDGICYTHPQKLPGVKQDGSVSHFFHRAIKAYNTGTRK  133

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTK-KGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ +GVQ+GCKK+MVLY T  KG KP KTNWVMHQ
Sbjct  134   RRKIHGDD---FGDVRWHKTGRTKPVLLDGVQRGCKKIMVLYMTMVKGGKPEKTNWVMHQ  190

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SKI++QQQQ KQ   +  E D+P+          P TP +  P+
Sbjct  191   YHLGTEEDEKDGEYVISKIFHQQQQIKQG--DKCEQDLPEMTDTTIVKVDPVTPKSVTPD  248

Query  479   PPRAAGETPL--SCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKC-------------  345
             PPR   +        +Y  A   P+ +V   K      +   VQ +C             
Sbjct  249   PPRTGRQCHEYDQGQEYTIACINPSAQVLSPKHPTMQYVEDYVQTECESSSHNDLPDPEN  308

Query  344   --------------EEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATS  210
                           EE P    GESQ   D+  + + L LCDE++ S   N   +    +
Sbjct  309   HLNQMLDNNNDNRAEEDPKWWDGESQYLLDSQQLVEGLSLCDELLQSQSPNRDANVDDGA  368

Query  209   ANFNPMPQEANNTSSSTNIADL----------VNLELDSAPEFSLQDLPFGSQDSISSW  63
              N  P   +     +     DL           N+ELD+ PEF L  L FGSQDS  +W
Sbjct  369   LNSKPCLSDYAQLGAEHLKKDLEECQNLEGDPANIELDTPPEFRLSQLEFGSQDSFIAW  427



>ref|XP_002281522.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010647959.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Vitis 
vinifera]
Length=433

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 239/421 (57%), Gaps = 60/421 (14%)
 Frame = -1

Query  1172  KVRNASSPAEN-RIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS   E  R++     +R CPNC H+IDNSDV+ EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKNASGTRETERVKWKSNPSRACPNCQHIIDNSDVTQEWPGLPRGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G GN E H F+DEFIPT+E D+GICYTHP+NLPG+K+DGS+ HFF++  KAY TGT
Sbjct  76    LAKVGVGNLEAHPFIDEFIPTVEEDDGICYTHPQNLPGVKQDGSAAHFFHQAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI  +   V   VRWHKTGKTK V+ +GVQ+GCKK+MVLY S  +G KP KTNWVM
Sbjct  136   RKRRKIHGD---VFGDVRWHKTGKTKPVILDGVQRGCKKIMVLYASIVRGGKPEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG  EDEK+G YV+SK++YQQQQ KQ+  +  E D P++         P TP +A 
Sbjct  193   HQYHLGTGEDEKDGEYVISKVFYQQQQIKQS--DKIEQDFPESSGALIAKVDPVTPKSAT  250

Query  485   PNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKE-RYGSLWSDVQVKCE-----------  342
             P  P     T     D+N     P   ++   ++   G L  +VQ +CE           
Sbjct  251   PEHPL----TERRNSDFNPGQESPIACMDSSVQQPDMGHLEGEVQTECEQIDCQNILKAE  306

Query  341   ---------------EYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFN-----NLPS  225
                            E       ESQ   D+  + + L +CDE + S   N     N   
Sbjct  307   NRVDEVLDHNDNHGEEEAKWWDNESQFLLDSQQLVEGLSICDEFLQSQSPNREGHENGND  366

Query  224   NHATS-------ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISS  66
              H TS       AN      + +       + D  N+ELD+ P+F L  L FGSQDS  +
Sbjct  367   GHVTSKPRLSDYANLGAEDLKKDLEDCQDLVLDPANIELDTPPDFRLSQLEFGSQDSFIA  426

Query  65    W  63
             W
Sbjct  427   W  427



>ref|XP_010647968.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Vitis 
vinifera]
 emb|CBI27068.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 239/421 (57%), Gaps = 60/421 (14%)
 Frame = -1

Query  1172  KVRNASSPAEN-RIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS   E  R++     +R CPNC H+IDNSDV+ EWPG P GVKF+PSD E++ HL
Sbjct  13    KIKNASGTRETERVKWKSNPSRACPNCQHIIDNSDVTQEWPGLPRGVKFDPSDQEIIWHL  72

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G GN E H F+DEFIPT+E D+GICYTHP+NLPG+K+DGS+ HFF++  KAY TGT
Sbjct  73    LAKVGVGNLEAHPFIDEFIPTVEEDDGICYTHPQNLPGVKQDGSAAHFFHQAIKAYNTGT  132

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI  +   V   VRWHKTGKTK V+ +GVQ+GCKK+MVLY S  +G KP KTNWVM
Sbjct  133   RKRRKIHGD---VFGDVRWHKTGKTKPVILDGVQRGCKKIMVLYASIVRGGKPEKTNWVM  189

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG  EDEK+G YV+SK++YQQQQ KQ+  +  E D P++         P TP +A 
Sbjct  190   HQYHLGTGEDEKDGEYVISKVFYQQQQIKQS--DKIEQDFPESSGALIAKVDPVTPKSAT  247

Query  485   PNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKE-RYGSLWSDVQVKCE-----------  342
             P  P     T     D+N     P   ++   ++   G L  +VQ +CE           
Sbjct  248   PEHPL----TERRNSDFNPGQESPIACMDSSVQQPDMGHLEGEVQTECEQIDCQNILKAE  303

Query  341   ---------------EYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFN-----NLPS  225
                            E       ESQ   D+  + + L +CDE + S   N     N   
Sbjct  304   NRVDEVLDHNDNHGEEEAKWWDNESQFLLDSQQLVEGLSICDEFLQSQSPNREGHENGND  363

Query  224   NHATS-------ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISS  66
              H TS       AN      + +       + D  N+ELD+ P+F L  L FGSQDS  +
Sbjct  364   GHVTSKPRLSDYANLGAEDLKKDLEDCQDLVLDPANIELDTPPDFRLSQLEFGSQDSFIA  423

Query  65    W  63
             W
Sbjct  424   W  424



>ref|XP_010108843.1| NAC domain-containing protein 8 [Morus notabilis]
 gb|EXC20358.1| NAC domain-containing protein 8 [Morus notabilis]
Length=1077

 Score =   309 bits (791),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/274 (60%), Positives = 199/274 (73%), Gaps = 13/274 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NA+     +I+DCGA+RECPNCH  IDNSDVSPEWPG PAGVKFEPSD EL+ HLA
Sbjct  42    KKVKNAACSPSYQIKDCGASRECPNCHCRIDNSDVSPEWPGLPAGVKFEPSDEELVVHLA  101

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKC   + +PHMF+DEFIPTLEG EGI   HPENLPG KKDGSS HFF++   AYATG R
Sbjct  102   AKCDSDSIKPHMFIDEFIPTLEG-EGIYCDHPENLPGAKKDGSSIHFFHKIINAYATGQR  160

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMH  639
             KRRK+ N  S   E VRWHKTGK++ V+ENG+QKG +K+MVLY T KKG KP KT WVMH
Sbjct  161   KRRKVQNHGS-TAEQVRWHKTGKSRPVIENGLQKGWRKIMVLYETSKKGSKPDKTKWVMH  219

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAG------ESDIPQAIPTTPMTAIPNP  477
             QYHLG +EDEKEG YVVSKIYY+Q +Q +  DN        ESD  +A+ T+PMT   NP
Sbjct  220   QYHLGTEEDEKEGEYVVSKIYYKQPKQPEIYDNNSNCHLIEESDT-KALQTSPMTPNSNP  278

Query  476   PR--AAGETPLSCDDYNAAL-SPPAEEVEGGKKE  384
             P     G++ L+ D  +  L    ++E EGG+ +
Sbjct  279   PIPPRHGKSILTDDIADNTLPQSSSKEEEGGRTQ  312


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 18/102 (18%)
 Frame = -1

Query  338  YPGCLAGESQAAADA--TDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSS  165
            YP  LAGESQA  ++    IDD LLC E + S        N+ ++ +F       NN S+
Sbjct  393  YPAWLAGESQAIDNSGLNSIDDSLLCKERLDS------GCNYISNTDFT-----GNNKST  441

Query  164  STNIA-----DLVNLELDSAPEFSLQDLPFGSQDSISSWLDR  54
              NIA     DL NLELD+ P+F L DL F SQ+SI  WLDR
Sbjct  442  GENIAPCGISDLENLELDTPPDFHLPDLQFCSQESILDWLDR  483



>ref|XP_003572678.2| PREDICTED: NAC domain-containing protein 8-like [Brachypodium 
distachyon]
Length=382

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 175/386 (45%), Positives = 226/386 (59%), Gaps = 37/386 (10%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+RN +  + ++I + GA   RECPNC HLIDNSDV+ +WPG PAGVKF+PSD+ELLEH
Sbjct  14    KKIRNVNC-SSSQISEAGAEACRECPNCKHLIDNSDVAIQWPGLPAGVKFDPSDLELLEH  72

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G+S+PHMF+DEFIPTLE DEGICY+HPENLPG KKDGSS HFF+R   AY  G
Sbjct  73    LEQKVGLGDSKPHMFIDEFIPTLENDEGICYSHPENLPGTKKDGSSAHFFHRVSNAYGCG  132

Query  821   TRKRRKISNETSLVM-EHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNW  648
              RKRR+ISN       EHVRWHKTGK+K + +NGV KG KK++VLY S + G KP KT+W
Sbjct  133   KRKRRRISNSVHTTSDEHVRWHKTGKSKPIYDNGVMKGWKKILVLYKSLQTGSKPDKTDW  192

Query  647   VMHQYHLGIDEDEKEGGYVVSKIYYqqqqq---kQTTDNAGESDIPQAIPTTPMTAIPNP  477
             VMHQYHLG++E+E  G YVVSKI YQ + +   K  T+ A E          P T   N 
Sbjct  193   VMHQYHLGVEENETVGKYVVSKILYQMKTKHMEKSETEIANEEFDAFTARNGPKTPKANT  252

Query  476   PRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGS----LWSDVQVKCEEYPGCLAGESQ  309
             P+        C      L  P EE E      +       W D+  +  E    +A ++Q
Sbjct  253   PKPCRTNNSPCGTEQNDLILPDEEGEIPDVRLFDGAENPAWCDIGSQAVE----VASQAQ  308

Query  308   AAADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLEL  129
                   ++++ L C E++ S              + +      NN S+   + D  N +L
Sbjct  309   P-----NLEESLHCHEVLDSI------------LSLDRNETLGNNLSAFDGLPD--NFDL  349

Query  128   DSAPEFSL--QDLPFGSQDSISSWLD  57
              S P+F +  QD+ F S  S  SWLD
Sbjct  350   GSLPDFLISGQDVQFCSIGSFGSWLD  375



>ref|XP_008446555.1| PREDICTED: NAC domain-containing protein 8 [Cucumis melo]
Length=419

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 237/403 (59%), Gaps = 38/403 (9%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS  +  R  +  +  ++ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASGTSNPRSVEWKSNPSKSCPNCQHTIDNSDVVQEWPGLPRGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G G S PH F+DEFIPT+  D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGT
Sbjct  76    LAKVGIGGSRPHPFIDEFIPTVFEDDGICYTHPQKLPGVKQDGSVSHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+++       VRWHKTG+TK V+ +GVQKGCKK+MVLY S  KG +  KTNWVM
Sbjct  136   RKRRKITDDD---FGDVRWHKTGRTKPVVIDGVQKGCKKIMVLYMSFAKGGRAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI------PTTPMTAIPN  480
             HQYHLG +EDE++G YV+SKI++QQQ  KQ      E + P+ I      P TP +A P 
Sbjct  193   HQYHLGTEEDERDGEYVISKIFHQQQNVKQG--EVTEQEAPEIIDTIKVDPHTPNSATPE  250

Query  479   PPRAAG---------ETPLSCDDYNAALSPPAEEVEGG---KKERYGS-LWSDVQVKCEE  339
             PPR            ++ ++       + P  E+ E     K + Y + +  D     EE
Sbjct  251   PPRIESRCVDVDPEQDSIITSTSVLVEVPPEFEKSEKHNIIKPDGYSNEVIDDNDNHIEE  310

Query  338   YPGCLAGESQAAADATDIDDFL-LCDEIVGS------FDFNNLPSNHATS----ANFNPM  192
              P    GESQ   D+  + + L LCD+++ S       +FN+  S   +     A   P 
Sbjct  311   EPKWWEGESQNILDSQQLVEALSLCDDLLQSQSPPRDINFNHGASGSKSCFSEYAKLGPE  370

Query  191   PQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
               + +       + D  N+ELD+ PEF L  L FGSQ+S  +W
Sbjct  371   DLKKDLEECQNLVLDPANIELDTPPEFRLSQLDFGSQESFLAW  413



>ref|XP_011021659.1| PREDICTED: NAC domain-containing protein 8-like [Populus euphratica]
Length=428

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 233/423 (55%), Gaps = 69/423 (16%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++ASS + + I    +   + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  15    KIKSASSASNHEIVAWKSDPCKTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHL  74

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G G  +PH F+ EFIPT+E D+GICYTHP+NLPG+K+DGS  HFF++  KAY TGT
Sbjct  75    LAKAGNGEIKPHPFIKEFIPTVENDDGICYTHPKNLPGVKQDGSISHFFHKAIKAYNTGT  134

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI  +       VRWHKTG+TK V+ +G+QKGCKK+MVLY ST  G K  KTNWVM
Sbjct  135   RKRRKIQADD---FGDVRWHKTGRTKPVILDGIQKGCKKIMVLYTSTVGGGKAEKTNWVM  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGE------SDIPQAI-----PTTPM  495
             HQYHLG  EDE++G YVVSK++YQQQ       N GE      S+I  A+     P TP 
Sbjct  192   HQYHLGTGEDERDGEYVVSKVFYQQQAA-----NKGEKTEEDLSEIANAVFAKVDPVTPK  246

Query  494   TAIPNPPRAAGETPLSCDDY-------NAALSPPAEE--VEG-----------------G  393
             +  P+PPRA       C D+       N    P AE   VE                  G
Sbjct  247   SVTPDPPRAE----RRCQDFDLGKESTNVCTEPYAEHPGVENLEEANLRHESPCYNHQPG  302

Query  392   KKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSN--  222
              +     + SD     EE       ESQ   D+  + + L LCDE + S      PS   
Sbjct  303   MENHVDQMVSDNDNCAEEGTKWWDSESQNLLDSQQLVEGLSLCDEFLQS----QSPSRGG  358

Query  221   HATSANFNPMPQEANNTSSSTNIADL----------VNLELDSAPEFSLQDLPFGSQDSI  72
             H T A+      +     S     DL           N+ELD+ PEF L  L FGSQDS 
Sbjct  359   HGTGASGKSGLSDYARLGSEHLKKDLEECQNLELDPANIELDTPPEFRLSQLEFGSQDSF  418

Query  71    SSW  63
              +W
Sbjct  419   MAW  421



>gb|AGC27317.1| NAC domain protein 14 [Gossypium hirsutum]
Length=436

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 178/425 (42%), Positives = 232/425 (55%), Gaps = 65/425 (15%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+R+AS P      +   TR CPNCHH+IDNSDV+  WPG P GVKF+PSD E++ HL  
Sbjct  15    KIRSASDPGR-VTWNSNPTRSCPNCHHIIDNSDVNQAWPGLPRGVKFDPSDQEIIWHLLT  73

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G  +S+PH F++EFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGTRK
Sbjct  74    KVGVKDSKPHPFINEFIPTIENDDGICYTHPQKLPGVKEDGSVSHFFHRAIKAYNTGTRK  133

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V  +GVQ+GCKK+MVLY +T KG K  KTNWVMHQ
Sbjct  134   RRKIHGDD---FGDVRWHKTGRTKPVFLDGVQEGCKKIMVLYMTTVKGGKSEKTNWVMHQ  190

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SKI++QQQQ KQ   +  E D+P+          P TP +  P+
Sbjct  191   YHLGTEEDEKDGEYVISKIFHQQQQPKQG--DKTEQDLPETTDTMIVKVDPVTPKSVTPD  248

Query  479   PPRAAGETPLSCDDYNAALS------PPAEEVEGGKKERYGSLWSDVQVKC---------  345
             PPR   +    CD+Y+           P+ +V   K      +  + Q +C         
Sbjct  249   PPRTGRQ----CDEYDQGQEYTIPCINPSAQVFSAKHPTTQYVEDEAQAECENSSLNDLP  304

Query  344   --------------------EEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLP  228
                                 EE      GESQ   D+  + + L LCDE + S       
Sbjct  305   APENHLNEMLDNDDNNDNHAEEDSKWWDGESQFLLDSQQLVEGLSLCDEFLQSQSPRRDA  364

Query  227   SNHATSANFNPMPQEANNTSSSTNIADL----------VNLELDSAPEFSLQDLPFGSQD  78
               +    +  P   +     +     DL           N+ELD+ PEF L  L F SQD
Sbjct  365   DGNEGILDGKPRLSDCAQLGAEHLKKDLEECQNLEDDPTNIELDTPPEFRLSQLDFASQD  424

Query  77    SISSW  63
             S ++W
Sbjct  425   SYTAW  429



>gb|KGN52047.1| hypothetical protein Csa_5G608350 [Cucumis sativus]
Length=418

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 226/382 (59%), Gaps = 35/382 (9%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             ++ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL AK G G S PH F+DEFIP
Sbjct  36    SKSCPNCQHTIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVGIGGSRPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+  D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGTRKRRKI+++       VRWH
Sbjct  96    TVFEDDGICYTHPQKLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKITDDD---FGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY S  KG +  KTNWVMHQYHLG +EDE++G YV+SK
Sbjct  153   KTGRTKPVVIDGVQKGCKKIMVLYMSFAKGGRAEKTNWVMHQYHLGTEEDERDGEYVISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI------PTTPMTAIPNPPRA---------AGETPLS  447
             I++QQQ  KQ      E + P+ I      P TP +A P PPR            ++ ++
Sbjct  213   IFHQQQNVKQG--EIIEQEAPEIIDTIKVDPHTPKSATPEPPRVEIRCVNIDPEQDSVIT  270

Query  446   CDDYNAALSPPAEEVEGG--KKERYGS-LWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                    + P  E+ E    K + Y   +  D     EE P    GESQ   D+  + + 
Sbjct  271   STSVLVEVPPEFEKSENDMIKPDGYSDEVIDDNDNHIEEEPKWWEGESQNILDSQQLVEA  330

Query  275   L-LCDEIVGSF------DFNNLPSNHATS----ANFNPMPQEANNTSSSTNIADLVNLEL  129
             L LCD+++ S       +FN+  S   +     A   P   + +       + D  N+EL
Sbjct  331   LSLCDDLLQSQSPPRDGNFNHGASGSKSCFSEYAKLGPEDLKKDLEECQNLVLDPANIEL  390

Query  128   DSAPEFSLQDLPFGSQDSISSW  63
             D+ PEF L  L FGSQ+S  +W
Sbjct  391   DTPPEFRLSQLDFGSQESFLAW  412



>ref|XP_004159303.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus]
Length=419

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 229/383 (60%), Gaps = 36/383 (9%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             ++ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL AK G G S PH F+DEFIP
Sbjct  36    SKSCPNCQHTIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVGIGGSRPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+  D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGTRKRRKI+++       VRWH
Sbjct  96    TVFEDDGICYTHPQKLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKITDDD---FGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY S  KG +  KTNWVMHQYHLG +EDE++G YV+SK
Sbjct  153   KTGRTKPVVIDGVQKGCKKIMVLYMSFAKGGRAEKTNWVMHQYHLGTEEDERDGEYVISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI------PTTPMTAIPNPPRAAGETPLSCDDYNAALS  420
             I++QQQ  KQ      E + P+ I      P TP +A P PPR          + ++ ++
Sbjct  213   IFHQQQNVKQG--EVIEQEAPEIIDTIKVDPHTPKSATPEPPRVEIRCVNIDPEQDSVIT  270

Query  419   PPAEEV----EGGKKERYGSL----WSDVQV-----KCEEYPGCLAGESQAAADATDIDD  279
               +  V    E  K E++  +    +SD  +       EE P    GESQ   D+  + +
Sbjct  271   STSVLVEVPPEFEKSEKHNMIKPDGYSDEVIDDNDNHIEEEPKWWEGESQNILDSQQLVE  330

Query  278   FL-LCDEIVGSF------DFNNLPSNHATS----ANFNPMPQEANNTSSSTNIADLVNLE  132
              L LCD+++ S       +FN+  S   +     A   P   + +       + D  N+E
Sbjct  331   ALSLCDDLLQSQSPPRDGNFNHGASGSKSCFSEYAKLGPEDLKKDLEECQNLVLDPANIE  390

Query  131   LDSAPEFSLQDLPFGSQDSISSW  63
             LD+ PEF L  L FGSQ+S  +W
Sbjct  391   LDTPPEFRLSQLDFGSQESFLAW  413



>gb|AGL39748.1| NAC transcription factor 092 [Jatropha curcas]
 gb|KDP29362.1| hypothetical protein JCGZ_18283 [Jatropha curcas]
Length=428

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 177/413 (43%), Positives = 240/413 (58%), Gaps = 49/413 (12%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS P + + +    ++ CPNC H+IDNSDV+ +WPG P GVKF+P+D E++ HL A
Sbjct  16    KIKSASDPEKVKWE-SNPSKACPNCQHVIDNSDVTQKWPGLPRGVKFDPTDQEIIWHLLA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G G  EPH F+DEFIPT+  D+GICYTHP+NLPG+++DGS  HFF+R  KAY TGTRK
Sbjct  75    KVGIGGLEPHPFIDEFIPTVYNDDGICYTHPQNLPGVRQDGSVSHFFHRAIKAYNTGTRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +    +  VRWHKTG+TK+VM +GVQKGCKK+MVLY S+ +G K  KTNWVMHQ
Sbjct  135   RRKILGDN---LGDVRWHKTGRTKSVMVDGVQKGCKKIMVLYMSSTRGGKAEKTNWVMHQ  191

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqk---QTTDNAGESD--IPQAIPTTPMTAIPNPPR  471
             YHLGI EDE++G YVVSKI++QQQQ     +  D   E+   I +  P TP +  P PPR
Sbjct  192   YHLGIGEDERDGEYVVSKIFHQQQQTNKGDKAEDGLSENTDMIVKEDPVTPKSVTPEPPR  251

Query  470   ------------AAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGC  327
                         A   T +S D +     P  E +E      + +  SD ++K E++   
Sbjct  252   NEKRCLDSDFGKANVVTNISADPFTQ--HPEMEFLEVQVPPEHENTNSDDKLKPEDHSDQ  309

Query  326   LA---------------GESQAAADATDIDDFL-LCDEIVGS-----FDFNNLPSNH---  219
             +                 ESQ   D+  + + L LCDE++ S     +   N   N    
Sbjct  310   MVDNNDNNIEEDTKWWDSESQNLFDSQQLVEGLSLCDELLQSQSPDRYGDGNRAGNGKPR  369

Query  218   -ATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              +  +   P   + +       + D  N+ELD+ PEF L  L FGSQ+S  SW
Sbjct  370   LSDYSQLGPENLKKDLEECQNLVLDPANIELDTPPEFRLSQLEFGSQESFLSW  422



>ref|XP_002311435.1| hypothetical protein POPTR_0008s11550g [Populus trichocarpa]
 gb|EEE88802.1| hypothetical protein POPTR_0008s11550g [Populus trichocarpa]
Length=428

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 185/424 (44%), Positives = 234/424 (55%), Gaps = 71/424 (17%)
 Frame = -1

Query  1172  KVRNASSPA--ENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++ASS +  E         + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  15    KIKSASSASNHERVAWKSDPCKTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHL  74

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G G  + H F+ EFIPT+E D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGT
Sbjct  75    LAKAGNGGIKSHPFIKEFIPTVENDDGICYTHPKNLPGVKQDGSISHFFHRAIKAYNTGT  134

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI  + S     VRWHKTG+TK V+ +GVQKGCKK+MVLY ST +G K  KTNWVM
Sbjct  135   RKRRKIQGDDS---GDVRWHKTGRTKPVILDGVQKGCKKIMVLYTSTVRGGKAEKTNWVM  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGE------SDIPQAI-----PTTPM  495
             HQYHLG  EDE++G YVVSK++YQQQ       N GE      S+I  A+     P TP 
Sbjct  192   HQYHLGTGEDERDGEYVVSKVFYQQQAA-----NKGEKTEEDLSEIANAVVAKVDPVTPK  246

Query  494   TAIPNPPRAAGETPLSCDDYNA------------ALSPPAEEVEGGKKERYGSLWSDVQV  351
             +  P+PPRA       C D++             A  P  E +E    +     ++D Q 
Sbjct  247   SVTPDPPRAE----RRCQDFDLGKESTNVCTEPYAEHPGVENLEEANLQHESPCYND-QP  301

Query  350   KCEEYPGCLAG---------------ESQAAADATDIDDFL-LCDEIVGSFDFNNLPSN-  222
               E +   + G               ESQ   D+  + + L LCDE + S      PS  
Sbjct  302   GMENHVDQMVGDNDNCAEEGTKWWDSESQHLLDSQQLVEGLSLCDEFLQS----QSPSRG  357

Query  221   -HATSAN----------FNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDS  75
              H T A+            P   + +         D  N+ELD+ PEF L  L FGSQDS
Sbjct  358   GHGTGASGKSGLSDYARLGPEHLKKDLEECQNLELDPANIELDTPPEFRLSQLEFGSQDS  417

Query  74    ISSW  63
               +W
Sbjct  418   FMAW  421



>ref|XP_006589379.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Glycine 
max]
Length=421

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 229/405 (57%), Gaps = 40/405 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K++N S      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  15    KIKNVSGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPLGVKFDPSDQEIIWHLLA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PH F+DEFI +LE D+GICYTHP++LPG+K+DGS+ H F+R  KAY TG+RK
Sbjct  75    KVGAGNSKPHPFIDEFITSLEVDDGICYTHPQHLPGVKQDGSASHLFHRAIKAYNTGSRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NGVQKGCKK+MVLY S  +G KP KTNWVMHQ
Sbjct  135   RRKICGQD---FGDVRWHKTGRTKPVILNGVQKGCKKIMVLYISPVRGGKPEKTNWVMHQ  191

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SK++YQQQQ K      G+ DIP+          P TP +  P 
Sbjct  192   YHLGTEEDEKDGEYVISKVFYQQQQVKFG--EKGDQDIPETTEATTVKVDPVTPKSVTPE  249

Query  479   PPRAAGE---TPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQV--------------  351
             PPR         L  + ++    P  + +E  + +       D+ +              
Sbjct  250   PPRIENRWSNLDLGQESHHIPQHPQTDCLEDLQADCEDLAKDDLLIVETENNEGIDNIEN  309

Query  350   KCEEYPGCLAGESQAAADATD-IDDFLLCDEIVGSF-------DFNNLPSNHATSANFNP  195
               EE       ESQ    +   ++   LCD+++ S        + +   S+ +  AN  P
Sbjct  310   NAEEDSKWWDSESQNLLSSQQLVEALFLCDDLLQSQSPKRDGENEHKKRSSLSVYANLGP  369

Query  194   MPQEANNTSSSTNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
                + +       + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  370   EHLKKDIVECQNLVLDTANVVPETPPSEFQLSQLDFSSQDSFVSW  414



>ref|XP_003535503.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Glycine 
max]
Length=422

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 229/405 (57%), Gaps = 40/405 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K++N S      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  16    KIKNVSGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPLGVKFDPSDQEIIWHLLA  75

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PH F+DEFI +LE D+GICYTHP++LPG+K+DGS+ H F+R  KAY TG+RK
Sbjct  76    KVGAGNSKPHPFIDEFITSLEVDDGICYTHPQHLPGVKQDGSASHLFHRAIKAYNTGSRK  135

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NGVQKGCKK+MVLY S  +G KP KTNWVMHQ
Sbjct  136   RRKICGQD---FGDVRWHKTGRTKPVILNGVQKGCKKIMVLYISPVRGGKPEKTNWVMHQ  192

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SK++YQQQQ K      G+ DIP+          P TP +  P 
Sbjct  193   YHLGTEEDEKDGEYVISKVFYQQQQVKFG--EKGDQDIPETTEATTVKVDPVTPKSVTPE  250

Query  479   PPRAAGE---TPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQV--------------  351
             PPR         L  + ++    P  + +E  + +       D+ +              
Sbjct  251   PPRIENRWSNLDLGQESHHIPQHPQTDCLEDLQADCEDLAKDDLLIVETENNEGIDNIEN  310

Query  350   KCEEYPGCLAGESQAAADATD-IDDFLLCDEIVGSF-------DFNNLPSNHATSANFNP  195
               EE       ESQ    +   ++   LCD+++ S        + +   S+ +  AN  P
Sbjct  311   NAEEDSKWWDSESQNLLSSQQLVEALFLCDDLLQSQSPKRDGENEHKKRSSLSVYANLGP  370

Query  194   MPQEANNTSSSTNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
                + +       + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  371   EHLKKDIVECQNLVLDTANVVPETPPSEFQLSQLDFSSQDSFVSW  415



>ref|XP_007046314.1| NAC domain protein, IPR003441 isoform 2 [Theobroma cacao]
 gb|EOY02146.1| NAC domain protein, IPR003441 isoform 2 [Theobroma cacao]
Length=430

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 181/419 (43%), Positives = 231/419 (55%), Gaps = 59/419 (14%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+R+AS+P E        TR CP+CHH IDNSDV+  WPG P GVKF+PSD E++ HL  
Sbjct  15    KIRSASNP-ERVTWKSNPTRSCPSCHHTIDNSDVTQAWPGLPRGVKFDPSDQEIIWHLLT  73

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G  +S+PH F++EFIPT+E D+GICYTHP+ LP    DGS  HFF+R  KAY TGTRK
Sbjct  74    KVGVEDSKPHPFINEFIPTIENDDGICYTHPQKLP----DGSVSHFFHRAIKAYNTGTRK  129

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTK-KGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ +GVQ+GCKK+MVLY T  KG KP KTNWVMHQ
Sbjct  130   RRKIHGDD---FGDVRWHKTGRTKPVLLDGVQRGCKKIMVLYMTMVKGGKPEKTNWVMHQ  186

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SKI++QQQQ KQ   +  E D+P+          P TP +  P+
Sbjct  187   YHLGTEEDEKDGEYVISKIFHQQQQIKQG--DKCEQDLPEMTDTTIVKVDPVTPKSVTPD  244

Query  479   PPRAAGETPL--SCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKC-------------  345
             PPR   +        +Y  A   P+ +V   K      +   VQ +C             
Sbjct  245   PPRTGRQCHEYDQGQEYTIACINPSAQVLSPKHPTMQYVEDYVQTECESSSHNDLPDPEN  304

Query  344   --------------EEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATS  210
                           EE P    GESQ   D+  + + L LCDE++ S   N   +    +
Sbjct  305   HLNQMLDNNNDNRAEEDPKWWDGESQYLLDSQQLVEGLSLCDELLQSQSPNRDANVDDGA  364

Query  209   ANFNPMPQEANNTSSSTNIADL----------VNLELDSAPEFSLQDLPFGSQDSISSW  63
              N  P   +     +     DL           N+ELD+ PEF L  L FGSQDS  +W
Sbjct  365   LNSKPCLSDYAQLGAEHLKKDLEECQNLEGDPANIELDTPPEFRLSQLEFGSQDSFIAW  423



>gb|KHG05346.1| NAC domain-containing 8 -like protein [Gossypium arboreum]
Length=432

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 178/428 (42%), Positives = 234/428 (55%), Gaps = 71/428 (17%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+R+AS P      +   TR CPNCHH+IDNSDV+  WPG P GVKF+PSD E++ HL  
Sbjct  15    KIRSASDPG-RVTWNSNPTRSCPNCHHIIDNSDVNQSWPGLPRGVKFDPSDQEIIWHLLT  73

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G  +S+PH F++EFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGTRK
Sbjct  74    KVGVKDSKPHPFINEFIPTIENDDGICYTHPQKLPGVKEDGSVSHFFHRAIKAYNTGTRK  133

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V  +GVQ+GCKK+MVLY +T KG K  KTNWVMHQ
Sbjct  134   RRKIHGDD---FGDVRWHKTGRTKPVFLDGVQEGCKKIMVLYMTTVKGGKSEKTNWVMHQ  190

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqq------qkQTTDNAGESDIPQAIPTTPMTAIPNPP  474
             YHLG +EDEK+G YV+SKI++QQQQ       +Q      E+ I +  P TP +  P+PP
Sbjct  191   YHLGTEEDEKDGEYVISKIFHQQQQPKQGDKTEQDLSETTETMIVRVDPVTPKSVTPDPP  250

Query  473   RAAGETPLSCDDYNAALS------PPAEEVEGGKKERYGSLWSDVQVKC-----------  345
             R   +    C +Y+           P+ +V   K      +  + Q +C           
Sbjct  251   RTGRQ----CHEYDQGQEYTIPCIDPSAQVFSAKHPTTQYVEDEAQAECENSSLNDLPAP  306

Query  344   ------------------EEYPGCLAGESQAAADATDIDDFL-LCDEIV-----------  255
                               EE      GESQ   D+  + + L LCDE++           
Sbjct  307   ENHLNEMLDNDDNNDNHAEEDSKWWDGESQFLLDSQQLVEGLSLCDELLQSQSPRRDADG  366

Query  254   --GSFDFNNLPSNHAT--SANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFG  87
               G  D     S++A   + +     +E  N        D  N+ELD+ PEF L  L F 
Sbjct  367   NEGILDGKPRLSDYAELGAEHLKKDLEECQNLED-----DPTNIELDTPPEFRLSQLDFA  421

Query  86    SQDSISSW  63
             SQDS ++W
Sbjct  422   SQDSYTAW  429



>ref|XP_008800750.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Phoenix 
dactylifera]
Length=407

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 235/391 (60%), Gaps = 27/391 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS P ++      +  T+ CP C+H+IDNSDV  EWPG P GVKF+PSD ELL HL
Sbjct  16    KIKNASEPVDSSRYKWMSNPTKACPRCNHIIDNSDVVQEWPGLPRGVKFDPSDQELLWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+G+++PH F++EFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TGT
Sbjct  76    LAKVGKGDAKPHPFINEFIPTVEEDDGICYTHPQKLPGVKQDGSMSHFFHRTFKAYTTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+++    +  VRWHKTGKTK V+ +G   GCKK+MVLY S+ KGEK  KTNWVM
Sbjct  136   RKRRKINSDD---LGDVRWHKTGKTKPVIIDGKHLGCKKIMVLYVSSVKGEKSEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAG  462
             HQYHLG  EDEK+G YVVSKI+YQQ +           +I + +    +  + +P   + 
Sbjct  193   HQYHLGTGEDEKDGEYVVSKIFYQQSKPGDKNGLDPTLEIMKTV-VADVDLVADPESVSS  251

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEY----------PGCLAGES  312
             E  +   D   +    +++V+   + R      + Q++CE++               GES
Sbjct  252   ECHVGKQDLVHSPEQTSDQVKMYHENRVEE--HNAQLECEKFNDQDNHPTEDTKWWEGES  309

Query  311   QAAADATDI-DDFLLCDEIV---GSFDFNNLPSNHATSANFNPMPQE--ANNTSSSTNIA  150
             Q   D+  + +   +CDE +    S   +    +    +++  M  E    +  +  N++
Sbjct  310   QFLLDSQQLAEGIAICDEFLQSQSSCGGDEAKKSRPRLSDYAHMGVEDLKKDLEACQNLS  369

Query  149   --DLVNLELDSAPEFSLQDLPFGSQDSISSW  63
               D  N+ELD+ P+F L  L FGSQDS  +W
Sbjct  370   NNDHTNIELDTPPDFRLSQLEFGSQDSFLAW  400



>ref|XP_002524405.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38016.1| conserved hypothetical protein [Ricinus communis]
Length=467

 Score =   288 bits (736),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 231/409 (56%), Gaps = 43/409 (11%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++A++P E  I     ++ CP C H+IDN+DV+ +WPG P GVKF+P+D E++ HL A
Sbjct  56    KIKSAANP-EKVIWQSNPSKPCPKCQHVIDNADVTQQWPGLPKGVKFDPTDQEIIWHLLA  114

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G G  EPH F++EFIPT+  D+GICYTHP+NLPG+++DGS  HFF+R  KAY TGTRK
Sbjct  115   KVGAGGFEPHPFINEFIPTVNKDDGICYTHPQNLPGVRQDGSVSHFFHRAIKAYNTGTRK  174

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +    +  VRWHKTG+ K V+ +GVQ+GCKK+MVLY ST +G K  KTNWVMHQ
Sbjct  175   RRKIQGDD---LGDVRWHKTGRNKPVLLDGVQRGCKKIMVLYMSTVRGGKAEKTNWVMHQ  231

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqk---QTTDNAGESD---IPQAIPTTPMTAIPNPP  474
             YHLG  +DE+EG YVVSKI+YQQQ      +T D+  E+    I +  P TP++  P PP
Sbjct  232   YHLGTGDDEREGDYVVSKIFYQQQHINKGDKTEDDLFENIDPVIAKVDPVTPVSVTPEPP  291

Query  473   RAAGETP---LSCDDYNAAL-----SPPAEEVEGGKKERYGSLWSDVQVK----------  348
                   P   L  D Y+         P  E  E   +    +   D Q+K          
Sbjct  292   SIERRCPDLDLDTDIYDIPFFFFLKHPGMEHAEIQVQPERENPSYDDQLKTENTNEMMEN  351

Query  347   ----CEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNH---------ATS  210
                  EE       ESQ   D+  + + L LCDE + S   N   S +         A  
Sbjct  352   NDDCVEENQKWWDSESQNLLDSQQLVEALSLCDEFLQSQSPNRYESGNGRANGKPCLADY  411

Query  209   ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             A   P   + +       + D  N+ELD+ P+F L  L FGSQ+S  +W
Sbjct  412   ARLGPEDLKKDLEECQNLVLDPANIELDTPPDFRLSQLEFGSQESFIAW  460



>ref|XP_008800749.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Phoenix 
dactylifera]
Length=411

 Score =   286 bits (731),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 235/391 (60%), Gaps = 27/391 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS P ++      +  T+ CP C+H+IDNSDV  EWPG P GVKF+PSD ELL HL
Sbjct  20    KIKNASEPVDSSRYKWMSNPTKACPRCNHIIDNSDVVQEWPGLPRGVKFDPSDQELLWHL  79

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+G+++PH F++EFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TGT
Sbjct  80    LAKVGKGDAKPHPFINEFIPTVEEDDGICYTHPQKLPGVKQDGSMSHFFHRTFKAYTTGT  139

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+++    +  VRWHKTGKTK V+ +G   GCKK+MVLY S+ KGEK  KTNWVM
Sbjct  140   RKRRKINSDD---LGDVRWHKTGKTKPVIIDGKHLGCKKIMVLYVSSVKGEKSEKTNWVM  196

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAG  462
             HQYHLG  EDEK+G YVVSKI+YQQ +           +I + +    +  + +P   + 
Sbjct  197   HQYHLGTGEDEKDGEYVVSKIFYQQSKPGDKNGLDPTLEIMKTV-VADVDLVADPESVSS  255

Query  461   ETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEY----------PGCLAGES  312
             E  +   D   +    +++V+   + R      + Q++CE++               GES
Sbjct  256   ECHVGKQDLVHSPEQTSDQVKMYHENRVEE--HNAQLECEKFNDQDNHPTEDTKWWEGES  313

Query  311   QAAADATDI-DDFLLCDEIV---GSFDFNNLPSNHATSANFNPMPQE--ANNTSSSTNIA  150
             Q   D+  + +   +CDE +    S   +    +    +++  M  E    +  +  N++
Sbjct  314   QFLLDSQQLAEGIAICDEFLQSQSSCGGDEAKKSRPRLSDYAHMGVEDLKKDLEACQNLS  373

Query  149   --DLVNLELDSAPEFSLQDLPFGSQDSISSW  63
               D  N+ELD+ P+F L  L FGSQDS  +W
Sbjct  374   NNDHTNIELDTPPDFRLSQLEFGSQDSFLAW  404



>emb|CDP00573.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 180/409 (44%), Positives = 228/409 (56%), Gaps = 44/409 (11%)
 Frame = -1

Query  1172  KVRNASSPAENRIQ---DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             K+R+AS  A N  Q       T+ CPNC H+IDNSDV+ EWPG P GVKF+PSD E++ H
Sbjct  16    KIRSASG-ASNLQQVNWTSNPTKTCPNCQHVIDNSDVTQEWPGLPRGVKFDPSDQEIIWH  74

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G  N +PH F++EFIPT+  D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TG
Sbjct  75    LLGKVGIENMKPHPFIEEFIPTVNEDDGICYTHPQNLPGVKQDGSVAHFFHRAIKAYNTG  134

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
             TRKRRKI  ++S     VRWHKTG+TK V  + +QKGCKK+MVLY S  +G KP KTNWV
Sbjct  135   TRKRRKILGDSS---GDVRWHKTGRTKPVHLDCIQKGCKKIMVLYLSPVRGGKPEKTNWV  191

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGE-----SDIPQAIPTTPMTAIPN  480
             MHQYHLG +EDE+EG YV+SK++YQQQQ KQ      E     + I +  P TP +  P 
Sbjct  192   MHQYHLGTEEDEREGEYVISKVFYQQQQVKQNEKAEVEVPEDDASIVKVDPVTPKSVTPE  251

Query  479   PPRAAGETPLSCDDYNAAL---------------SPPAEEVEGGKKERYGSLWSDVQVKC  345
             PPR     P  CD   + L                PP+++           L      K 
Sbjct  252   PPRTESHFP-DCDAQESVLPAAQHHGVVCMEDEVRPPSDQPNCEDPVSAVDLADQQDDKT  310

Query  344   EEYPG----CLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNH----------ATS  210
             +   G        ESQ   D+  + + L LCDE + S   N     +          A  
Sbjct  311   DNDAGEKREWWDSESQYLLDSQQLVEALSLCDEFLRSQSPNRDGDKNEQELKPKPRLADY  370

Query  209   ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             A+  P   + +       + D VNLELD+ P+F L  L F SQDS  SW
Sbjct  371   AHLGPEHLKKDLEECQDLVLDPVNLELDTPPDFRLSQLEFASQDSFISW  419



>ref|XP_002315960.1| hypothetical protein POPTR_0010s13980g [Populus trichocarpa]
 gb|EEF02131.1| hypothetical protein POPTR_0010s13980g [Populus trichocarpa]
Length=422

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/395 (44%), Positives = 219/395 (55%), Gaps = 53/395 (13%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPT  936
             + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL AK  +G  +PH F+ EFIPT
Sbjct  36    KTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVSDGGIKPHPFIKEFIPT  95

Query  935   LEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHK  756
             ++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWHK
Sbjct  96    VDNDDGICYTHPQNLPGVKQDGSISHFFHRAIKAYNTGTRKRRKIQGDN---FGDVRWHK  152

Query  755   TGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             TG+TK V+ +G+QKGCKK+MVLY ST +G K  KTNWVMHQYHLG  EDE++G YVVSKI
Sbjct  153   TGRTKPVILDGIQKGCKKIMVLYMSTVRGGKAEKTNWVMHQYHLGTSEDERDGEYVVSKI  212

Query  578   YYqqqqqkQTTDNAGESDIPQAI-----PTTPMTAIPNPPRAAGETPLSCDDYN------  432
             +YQQQ  K        S+I   +     P TP +  P+PPRA       C D+       
Sbjct  213   FYQQQANKGEKPEEDLSEIVDDVVAKVDPVTPKSVTPDPPRAE----RRCQDFEMGQEST  268

Query  431   ------AALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAG---------------E  315
                    A  P  E +E        +L    Q++ E     + G               E
Sbjct  269   NICTDPCAQQPGIECLEEEVNLLQKNLSYVDQLETENNVNHMVGDNDNCAGEERKWWDSE  328

Query  314   SQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATSAN----------FNPMPQEANNTS  168
             SQ   D+  + + L LC E + S   +     H T AN            P   + +   
Sbjct  329   SQQLLDSQQLVEGLSLCAEFLQSQSPDR--GGHGTEANGKTGLSDYALLGPEYLKKDLEE  386

Query  167   SSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                   D  N+ELD+ PEF L  L FGSQDS ++W
Sbjct  387   CQNLELDQANIELDTPPEFRLSQLEFGSQDSFTAW  421



>ref|XP_006605345.1| PREDICTED: uncharacterized protein LOC100787422 isoform X3 [Glycine 
max]
Length=426

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 228/405 (56%), Gaps = 40/405 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  20    KIKSASGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPIGVKFDPSDQEIIWHLLA  79

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PH F+DEFI TLE D+GICYTHP++LPG+K+DGSS HFF+R  KAY TG+RK
Sbjct  80    KVGAGNSKPHPFIDEFITTLEVDDGICYTHPQHLPGVKQDGSSSHFFHRVIKAYNTGSRK  139

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NG+QKGCKK+MVLY S  +G K  KTNWVMHQ
Sbjct  140   RRKICGQD---FGDVRWHKTGRTKPVILNGIQKGCKKIMVLYISPVRGGKSEKTNWVMHQ  196

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SK++YQQQQ K    +  + DIP+          P TP +  P 
Sbjct  197   YHLGTEEDEKDGEYVISKVFYQQQQVKFGEKD--DQDIPEITEATTVKVDPATPKSVTPE  254

Query  479   PPRAAG---------------ETPLS--CDDYNAALSPPAEEVEGGKKERYGSLWSDVQV  351
             PPR                  + P +   DD  A     A++     + +      +++ 
Sbjct  255   PPRIEKRCSNLDLGQESHHIPQHPQTDYLDDLQAVCEDLAKDDLLIVETQNNEAIDNIEN  314

Query  350   KCEEYPGCLAGESQAAADATD-IDDFLLCDEIVGSFDFNNLPSNH-------ATSANFNP  195
               EE       ESQ    +   ++   LCD+++ S        N        +  A+  P
Sbjct  315   NAEEDSKWWDSESQNLLSSQQLVEALFLCDDLLQSQSPKRDEENEHKKRPSLSVYADLGP  374

Query  194   MPQEANNTSSSTNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
                + +       + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  375   EHLKKDIEECQNLVLDPANVVPETPPSEFRLSQLDFSSQDSFVSW  419



>ref|XP_006605344.1| PREDICTED: uncharacterized protein LOC100787422 isoform X2 [Glycine 
max]
Length=431

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 170/395 (43%), Positives = 225/395 (57%), Gaps = 31/395 (8%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  36    KIKSASGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPIGVKFDPSDQEIIWHLLA  95

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PH F+DEFI TLE D+GICYTHP++LPG+K+DGSS HFF+R  KAY TG+RK
Sbjct  96    KVGAGNSKPHPFIDEFITTLEVDDGICYTHPQHLPGVKQDGSSSHFFHRVIKAYNTGSRK  155

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NG+QKGCKK+MVLY S  +G K  KTNWVMHQ
Sbjct  156   RRKICGQD---FGDVRWHKTGRTKPVILNGIQKGCKKIMVLYISPVRGGKSEKTNWVMHQ  212

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SK++YQQQQ K    +  + DIP+          P TP +  P 
Sbjct  213   YHLGTEEDEKDGEYVISKVFYQQQQVKFGEKD--DQDIPEITEATTVKVDPATPKSVTPE  270

Query  479   PPRAAGETPLSCDDYNAALSPPAEEVEGGKKE-------RYGSLWSDVQVKCEEYPGCLA  321
             PPR       + D    +   P    E   K+       +      +++   EE      
Sbjct  271   PPRIEKRCS-NLDLGQESHHIPQAVCEDLAKDDLLIVETQNNEAIDNIENNAEEDSKWWD  329

Query  320   GESQAAADATD-IDDFLLCDEIVGSFDFNNLPSNH-------ATSANFNPMPQEANNTSS  165
              ESQ    +   ++   LCD+++ S        N        +  A+  P   + +    
Sbjct  330   SESQNLLSSQQLVEALFLCDDLLQSQSPKRDEENEHKKRPSLSVYADLGPEHLKKDIEEC  389

Query  164   STNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
                + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  390   QNLVLDPANVVPETPPSEFRLSQLDFSSQDSFVSW  424



>ref|XP_010066746.1| PREDICTED: NAC domain-containing protein 8 [Eucalyptus grandis]
 gb|KCW64775.1| hypothetical protein EUGRSUZ_G02349 [Eucalyptus grandis]
Length=429

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 224/413 (54%), Gaps = 49/413 (12%)
 Frame = -1

Query  1172  KVRNAS--SPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+R+AS  S  E        TR CPNC H+IDNSDV+ +WPG P GVKF+PSD E++ HL
Sbjct  16    KIRSASGASDPEKVKWKSNPTRACPNCQHVIDNSDVAKQWPGLPTGVKFDPSDSEIMHHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G    + H F++EFIPT++ D+GICYTHP NLPG+K+DGS  HFF+R  KAY TGT
Sbjct  76    LAKAGFEGLKSHPFIEEFIPTVDEDDGICYTHPRNLPGVKQDGSVAHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVM  642
             RKRRKI  +       VRWHKTGKTK VM +GVQKG KK+MVLY+   +G K  KTNW M
Sbjct  136   RKRRKILGDD---FGDVRWHKTGKTKPVMVDGVQKGWKKIMVLYTNLVRGGKSEKTNWKM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD--------IPQAIPTTPMTAI  486
             HQYHLG +EDEK+G +V+SKI+Y  QQQ+       E +          +A P +P +A 
Sbjct  193   HQYHLGTEEDEKDGEFVISKIFYDHQQQQLDQGEKNEQNNRERVDATTMKADPVSPKSAT  252

Query  485   PNPPRAAGETPLSCD----DYNAALSPPAEEVEGGKKERYGSL-----------------  369
             PNPPR       SCD      +A   P A+ VE    +  G L                 
Sbjct  253   PNPPRTERR---SCDSDPVQDSACGGPLAQHVETQCADLDGPLEIENPQHREQTISAPEM  309

Query  368   WSDVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATS------  210
               D   + EE       ESQ   D+  + + L LCDE + S   N    NH         
Sbjct  310   MVDGDQQAEEESKWWDSESQNLLDSQQLVEGLSLCDEFLQSQSPNRDDINHHVESKKRIL  369

Query  209   ----ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                 A   P   + +         D  N+ELD+ P+F L  L FGSQDS  +W
Sbjct  370   LSDYAKLGPEDLKKDLEECHNLALDPANIELDTPPDFRLSQLEFGSQDSFLAW  422



>ref|XP_010932619.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Elaeis 
guineensis]
Length=408

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 172/394 (44%), Positives = 240/394 (61%), Gaps = 32/394 (8%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS P ++      +  T+ CP C+H+IDNSDV  EWPG P GVKF+PSD ELL HL
Sbjct  16    KIKNASEPVDSSRYKWMSNPTKACPRCNHIIDNSDVVQEWPGLPRGVKFDPSDQELLWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+G+++PH F++EFIPT+E  +GICYTHP+ LPG+K+DGS  HFF+RT KAY TGT
Sbjct  76    LAKVGQGDAKPHPFINEFIPTVEEGDGICYTHPQKLPGVKQDGSVSHFFHRTFKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+++    +  VRWHKTGKTK V+ +G  +GCKK+MVLY ST KGEKP KTNWVM
Sbjct  136   RKRRKINSDD---LGDVRWHKTGKTKPVIMDGKHQGCKKIMVLYMSTIKGEKPEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGES---DIPQAIPTTPMTAIPNPPR  471
             HQYHLG  EDEK+G YVVSKI+Y  QQQ +  D  G+    +I +A+    +  + NP  
Sbjct  193   HQYHLGTGEDEKDGEYVVSKIFY--QQQSKPGDKNGQDLTLEIVEAV-VAEVDPVANPKS  249

Query  470   AAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEY-------PGCLA---  321
              + E  +   D   +    +++V+   + R      +  ++CE++        G L    
Sbjct  250   VSSECHVGKQDPAHSPEQTSDQVKMYHENRVEE--HNAPLECEKFDDQDNHPTGDLKWWE  307

Query  320   GESQAAADATDI-DDFLLCDEIV---GSFDFNNLPSNHATSANFNPMPQE--ANNTSSST  159
             GESQ   D+  + +   +CDE +    S   +    +    +++  M  E    +  +  
Sbjct  308   GESQFLLDSQQLAEGIAICDEFLLSQSSCGGDEAKKSRPRLSDYAHMGAEDLKKDLEACQ  367

Query  158   NIA--DLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             N++  D  N+ELD   +F L  L FGSQDS  +W
Sbjct  368   NLSNYDRSNIELDPPQDFRLSQLEFGSQDSFLAW  401



>ref|XP_006605343.1| PREDICTED: uncharacterized protein LOC100787422 isoform X1 [Glycine 
max]
Length=442

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 228/405 (56%), Gaps = 40/405 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  36    KIKSASGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPIGVKFDPSDQEIIWHLLA  95

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PH F+DEFI TLE D+GICYTHP++LPG+K+DGSS HFF+R  KAY TG+RK
Sbjct  96    KVGAGNSKPHPFIDEFITTLEVDDGICYTHPQHLPGVKQDGSSSHFFHRVIKAYNTGSRK  155

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NG+QKGCKK+MVLY S  +G K  KTNWVMHQ
Sbjct  156   RRKICGQD---FGDVRWHKTGRTKPVILNGIQKGCKKIMVLYISPVRGGKSEKTNWVMHQ  212

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SK++YQQQQ K    +  + DIP+          P TP +  P 
Sbjct  213   YHLGTEEDEKDGEYVISKVFYQQQQVKFGEKD--DQDIPEITEATTVKVDPATPKSVTPE  270

Query  479   PPRAAG---------------ETPLS--CDDYNAALSPPAEEVEGGKKERYGSLWSDVQV  351
             PPR                  + P +   DD  A     A++     + +      +++ 
Sbjct  271   PPRIEKRCSNLDLGQESHHIPQHPQTDYLDDLQAVCEDLAKDDLLIVETQNNEAIDNIEN  330

Query  350   KCEEYPGCLAGESQAAADATD-IDDFLLCDEIVGSFDFNNLPSNH-------ATSANFNP  195
               EE       ESQ    +   ++   LCD+++ S        N        +  A+  P
Sbjct  331   NAEEDSKWWDSESQNLLSSQQLVEALFLCDDLLQSQSPKRDEENEHKKRPSLSVYADLGP  390

Query  194   MPQEANNTSSSTNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
                + +       + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  391   EHLKKDIEECQNLVLDPANVVPETPPSEFRLSQLDFSSQDSFVSW  435



>ref|XP_008800751.1| PREDICTED: NAC domain-containing protein 8 isoform X3 [Phoenix 
dactylifera]
Length=376

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 225/371 (61%), Gaps = 25/371 (7%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP C+H+IDNSDV  EWPG P GVKF+PSD ELL HL AK G+G+++PH F++EFIP
Sbjct  5     TKACPRCNHIIDNSDVVQEWPGLPRGVKFDPSDQELLWHLLAKVGKGDAKPHPFINEFIP  64

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TGTRKRRKI+++    +  VRWH
Sbjct  65    TVEEDDGICYTHPQKLPGVKQDGSMSHFFHRTFKAYTTGTRKRRKINSDD---LGDVRWH  121

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTGKTK V+ +G   GCKK+MVLY S+ KGEK  KTNWVMHQYHLG  EDEK+G YVVSK
Sbjct  122   KTGKTKPVIIDGKHLGCKKIMVLYVSSVKGEKSEKTNWVMHQYHLGTGEDEKDGEYVVSK  181

Query  581   IYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALSPPAEEV  402
             I+YQQ +           +I + +    +  + +P   + E  +   D   +    +++V
Sbjct  182   IFYQQSKPGDKNGLDPTLEIMKTV-VADVDLVADPESVSSECHVGKQDLVHSPEQTSDQV  240

Query  401   EGGKKERYGSLWSDVQVKCEEY----------PGCLAGESQAAADATDI-DDFLLCDEIV  255
             +   + R      + Q++CE++               GESQ   D+  + +   +CDE +
Sbjct  241   KMYHENRVEE--HNAQLECEKFNDQDNHPTEDTKWWEGESQFLLDSQQLAEGIAICDEFL  298

Query  254   ---GSFDFNNLPSNHATSANFNPMPQE--ANNTSSSTNIA--DLVNLELDSAPEFSLQDL  96
                 S   +    +    +++  M  E    +  +  N++  D  N+ELD+ P+F L  L
Sbjct  299   QSQSSCGGDEAKKSRPRLSDYAHMGVEDLKKDLEACQNLSNNDHTNIELDTPPDFRLSQL  358

Query  95    PFGSQDSISSW  63
              FGSQDS  +W
Sbjct  359   EFGSQDSFLAW  369



>gb|AIA57535.1| NAC domain-containing protein [Boehmeria nivea]
Length=437

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 183/426 (43%), Positives = 244/426 (57%), Gaps = 58/426 (14%)
 Frame = -1

Query  1172  KVRNASSPAEN-RIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++ASS  E+ R++     TR CPNC ++IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASSSYESERVKWKSNPTRSCPNCQYVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK GE +++PH F++EFIPT++ ++GICY HP+ LPG+K+DGS  HFF+R  KAY TGT
Sbjct  76    LAKVGEADAKPHPFINEFIPTVDENDGICYVHPKKLPGVKQDGSVAHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI +  S     VRWHKTG+TK V  +GVQ+GCKK+MVLY S  KG K  KTNWVM
Sbjct  136   RKRRKIQDGDS----DVRWHKTGRTKPVSLDGVQRGCKKIMVLYMSVAKGGKTEKTNWVM  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGE-SDIPQAI-----PTTPMTAIPN  480
             HQYHLG +EDEK+G YV+SKI+YQQ Q KQ   N  + +++  A+     P TP +  P+
Sbjct  192   HQYHLGTEEDEKDGEYVISKIFYQQHQVKQGDKNDQDVAEVTDAVNAKVDPLTPKSVTPD  251

Query  479   PPR----------------AAGETP---------LSCDDYNAALSPPAEEVEGGK----K  387
             PPR                AA   P         L  D+  A    P+   E  +    +
Sbjct  252   PPRGERRHSDDADMGAETIAANTDPYTQFDGIECLEDDEILAECENPSHNEEPKEENLVE  311

Query  386   ERYGSLWSDVQVKCE-EYPGCLAGESQAAADATDIDDFL-LCDEIVGS----FDFNNLPS  225
             E  G   S+  V C  E P     ESQ   D+  + + L LCD+++ S     D + L +
Sbjct  312   EELGI--SENNVGCNPEEPKWWDSESQNLLDSQQLVEGLSLCDDLLQSQSPNRDGDPLEN  369

Query  224   NH--------ATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSIS  69
                       A  A   P   + +       + D  N+ELD+ PEF L  L FGSQ+S  
Sbjct  370   GQPWKDRPKLADYAQLGPEDLKKDLEECQNLVIDPTNIELDTPPEFRLSQLDFGSQESFL  429

Query  68    SWLDRL  51
             +W  +L
Sbjct  430   AWGTKL  435



>ref|XP_006484408.1| PREDICTED: NAC domain-containing protein 8-like [Citrus sinensis]
Length=432

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 171/392 (44%), Positives = 219/392 (56%), Gaps = 48/392 (12%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNCHH+IDNSDV+ EWPG P GVKF+PSD E++ HL AK G     PH F+DEFIP
Sbjct  36    TKACPNCHHVIDNSDVAHEWPGLPRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D GICYTHP+NLPG+K+DGS+ HFFYR  KAY+TGTRKRRKI+ +       VRWH
Sbjct  96    TVDQDGGICYTHPQNLPGVKQDGSAAHFFYRAIKAYSTGTRKRRKINGDD---FGEVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK VM +GVQKGCKK+MVLY S  +G KP KTNWVMHQYHLG +EDEK+  YV+SK
Sbjct  153   KTGRTKPVMLDGVQKGCKKIMVLYMSMVRGGKPEKTNWVMHQYHLGTEEDEKDDNYVISK  212

Query  581   IYYqqqqqk---QTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALS  420
             I+YQQQQ K   +   +  ES    IP+  P TP +  P+PPR            +    
Sbjct  213   IFYQQQQAKYGDKIEQDILESTGAIIPKVDPVTPKSVTPDPPRTERHPDFGPRQESPTTD  272

Query  419   PPAEEVEGGKKERYGSL----WSDVQVKCEEYPGCLAGESQAAADATD------------  288
                ++ E    E    L     S+ +++ E +   + G +   + A D            
Sbjct  273   AFDQQSEIRHVEEVQPLCENPGSNDKIEAENHANMMVGNNDNGSQAGDDRKWWDSESQNG  332

Query  287   -----------IDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----  156
                         +   LC+E + S    N  +N  TS     +   A   S         
Sbjct  333   LSQNILDTQQLAEALTLCEEFLNSQSDGN--ANDGTSKGKPGLSDYARLGSEHLKKDLEE  390

Query  155   ----IADLVNLELDSAPEFSLQDLPFGSQDSI  72
                 + D  N+ELD+ PEF L  L F SQDS 
Sbjct  391   CQMLVHDPANIELDTPPEFGLSQLEFNSQDSF  422



>ref|NP_001242773.1| uncharacterized protein LOC100787422 [Glycine max]
 gb|ACU20787.1| unknown [Glycine max]
Length=439

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 170/402 (42%), Positives = 228/402 (57%), Gaps = 37/402 (9%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  36    KIKSASGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPIGVKFDPSDQEIIWHLLA  95

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+P+ F+DEFI TLE D+GICYTHP++LPG+K+DGSS HFF+R  KAY TG+RK
Sbjct  96    KVGAGNSKPYPFIDEFITTLEVDDGICYTHPQHLPGVKQDGSSSHFFHRVIKAYNTGSRK  155

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NG+QKGCKK+MVLY S  +G K  KTNWVMHQ
Sbjct  156   RRKICGQD---FGDVRWHKTGRTKPVILNGIQKGCKKIMVLYISPVRGGKSEKTNWVMHQ  212

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G YV+SK++YQQQQ K    +  + DIP+          P TP +  P 
Sbjct  213   YHLGTEEDEKDGEYVISKVFYQQQQVKFGEKD--DQDIPEITEATTVKVDPATPKSVTPE  270

Query  479   PPRA------------AGETPLS--CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE  342
             PPR             +   P +   DD  A     A++     + +      +++   E
Sbjct  271   PPRIEKRCSNLDLGQESHHIPQTDYLDDLQAVCEDLAKDDLLIVETQNNEAIDNIENNAE  330

Query  341   EYPGCLAGESQAAADATD-IDDFLLCDEIVGSFDFNNLPSNH-------ATSANFNPMPQ  186
             E       ESQ    +   ++   LCD+++ S        N        +  A+  P   
Sbjct  331   EDSKWWDSESQNLLSSQQLVEALFLCDDLLQSQSPKRDEENEHKKRPSLSVYADLGPEHL  390

Query  185   EANNTSSSTNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
             + +       + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  391   KKDIEECQNLVLDPANVVPETPPSEFRLSQLDFSSQDSFVSW  432



>gb|KHN00898.1| NAC domain-containing protein 8 [Glycine soja]
Length=442

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 170/405 (42%), Positives = 227/405 (56%), Gaps = 40/405 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS      I     +R CP+CHH+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  36    KIKSASGTCGKVIWKSNPSRACPSCHHVIDNSDVAQEWPGLPIGVKFDPSDQEIIWHLLA  95

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GNS+PH F+DEFI TLE D+GICYTHP++LPG+K+DGSS HFF+R  KAY TG+RK
Sbjct  96    KVGAGNSKPHPFIDEFITTLEVDDGICYTHPQHLPGVKQDGSSSHFFHRVIKAYNTGSRK  155

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK V+ NG+QKGCKK+MVLY S  +G K  KTNWVMHQ
Sbjct  156   RRKICGQD---FGDVRWHKTGRTKPVILNGIQKGCKKIMVLYISPVRGGKSEKTNWVMHQ  212

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPN  480
             YHLG +EDEK+G Y +SK++YQQQQ K    +  + DIP+          P TP +  P 
Sbjct  213   YHLGTEEDEKDGEYAISKVFYQQQQVKFGEKD--DQDIPEITEATTVKVDPATPKSVTPE  270

Query  479   PPRAAG---------------ETPLS--CDDYNAALSPPAEEVEGGKKERYGSLWSDVQV  351
             PPR                  + P +   DD  A     A++     + +      +++ 
Sbjct  271   PPRIEKRCSNLDLGQESHHIPQHPQTDYLDDLQAVCEDLAKDDLLIVETQNNEAIDNIEN  330

Query  350   KCEEYPGCLAGESQAAADATD-IDDFLLCDEIVGSFDFNNLPSNH-------ATSANFNP  195
               EE       ESQ    +   ++   LCD+++ S        N        +  A+  P
Sbjct  331   NAEEDSKWWDSESQNLLSSQQLVEALFLCDDLLQSQSPKRDEENEHKKRPSLSVYADLGP  390

Query  194   MPQEANNTSSSTNIADLVNLELDSAP-EFSLQDLPFGSQDSISSW  63
                + +       + D  N+  ++ P EF L  L F SQDS  SW
Sbjct  391   EHLKKDIEECQNLVLDPANVVPETPPSEFRLSQLDFSSQDSFVSW  435



>ref|XP_003518010.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max]
 gb|KHN10787.1| NAC domain-containing protein 8 [Glycine soja]
Length=426

 Score =   281 bits (719),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 166/390 (43%), Positives = 221/390 (57%), Gaps = 44/390 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC H IDN DV+ EWPG P GVKF+PSD E++ HL AK G G+S+PH F+DEFI 
Sbjct  36    TKPCPNCQHAIDNDDVAQEWPGLPKGVKFDPSDQEIIWHLLAKVGVGDSKPHPFIDEFIT  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             TLE D+GICYTHP+NLPG+K+DGS+ HFF+R   AY TGTRKRRKI  +       VRWH
Sbjct  96    TLEVDDGICYTHPQNLPGVKQDGSASHFFHRAINAYNTGTRKRRKILGQD---FGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ NG+QKGCKK+MVLY S  +G +  KTNWVMHQYHLG +EDEK+G Y++SK
Sbjct  153   KTGRTKPVVFNGIQKGCKKIMVLYVSNVRGGRAEKTNWVMHQYHLGTEEDEKDGEYIISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI-----------PTTPMTAIPNPP---RAAGETPLSC  444
             ++Y  QQQ+    +  + D+P+A            P TP    P  P   R   +  L  
Sbjct  213   VFY--QQQQVKLGDKDDKDVPEATEINESTIVKVDPVTPKFVTPETPCNERWCADLDLGQ  270

Query  443   DDYNAALSPPA---EEVEGGKKE----------RYGSLWSDVQVKCEEYPGCLAGESQAA  303
             + +N+   P     +E++   ++          ++     D +   EE       ESQ  
Sbjct  271   ETHNSPQLPQMDCLDEIQADYQDLANESSMVETQHNEGMDDKEKNTEEGQKWWDSESQNL  330

Query  302   ADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMPQEANNTSSSTNI  153
              D+  + + L LCD+++ S          D  N P   +  A   P   + +        
Sbjct  331   LDSQQLVEALSLCDDLLQSQSPSRDGKHEDHKNQPG-LSVYAQLGPENLKKDIEECQNLA  389

Query  152   ADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              D  N+E D+  EF L  L FGSQDS  SW
Sbjct  390   LDKANIENDTPSEFRLSQLEFGSQDSFISW  419



>ref|XP_004952971.1| PREDICTED: NAC domain-containing protein 8-like [Setaria italica]
Length=403

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 177/398 (44%), Positives = 238/398 (60%), Gaps = 31/398 (8%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+R  +    +RI +    A RECPNC H+IDNSDV+ +WPG PAGVKF+PSD+ELLEH
Sbjct  14    KKIRYTTPSGNHRISELIAEARRECPNCSHVIDNSDVAMQWPGLPAGVKFDPSDLELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G S PH+ +DEFIP ++ DEGICY+HPENLPG+K DGS+ HFF+R  KAY  G
Sbjct  74    LEEKIGLGGSRPHVLIDEFIPIIDNDEGICYSHPENLPGMKTDGSNAHFFHRVSKAYGRG  133

Query  821   TRKRRKI---SNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTK-KGEKPGKT  654
              RKRR++   S++ ++  EHVRWHKTG++K + +NGV+KG KK+MVLY T  +GEKP + 
Sbjct  134   QRKRRRVISCSSDHTVTDEHVRWHKTGRSKPIYDNGVKKGWKKIMVLYKTSHRGEKPDRA  193

Query  653   NWVMHQYHLGIDEDEKEGGYVVSKIY-YqqqqqkQTTDNAGESDIPQAIPT-------TP  498
             +WVMHQYHLG +EDEK+G  VVSKI+     +  + ++     D P A  +       TP
Sbjct  194   HWVMHQYHLGQEEDEKDGDLVVSKIFCQITNKSMEVSETEAAYDKPDASASVIGPKTPTP  253

Query  497   MTAIPNPPRAAGETPLSCDDYNAALSPP-AEEVEGGKKERYGSLWSDVQVKCEEYPGCLA  321
              T  P  PR A  +P   +   + L      + EG       SL  D        P   A
Sbjct  254   KTNAPQ-PRLANNSPCETEQNVSILQDQLLLQDEGEPIIPIVSLEDDAM-----NPAWCA  307

Query  320   G--ESQAAADAT----DIDDFLLCDEIVGSF-DFNNLPSNH-ATSANFNPMPQEANNTSS  165
             G  E QA   A+    ++D+ LLC E   S  D   LP ++   S   N +   + NT  
Sbjct  308   GAEEQQAVGGASRAQLNLDEPLLCREDPNSLNDEALLPMDYPILSQCRNEILDRSLNT--  365

Query  164   STNIADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
                + DL N++L + P+  L DL FGSQ+S+ SWLDR+
Sbjct  366   FYGLPDLHNVDLGTPPDLQLGDLQFGSQESLGSWLDRI  403



>gb|KDO70104.1| hypothetical protein CISIN_1g014310mg [Citrus sinensis]
Length=427

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 173/387 (45%), Positives = 218/387 (56%), Gaps = 43/387 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNCHH+IDNSDV+ EWPG P GVKF+PSD E++ HL AK G     PH F+DEFIP
Sbjct  36    TKACPNCHHVIDNSDVAHEWPGLPRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D GICYTHP+NLPG+K+DGS+ HFFYR  KAY+TGTRKRRKI+ +       VRWH
Sbjct  96    TVDQDGGICYTHPQNLPGVKQDGSAAHFFYRAIKAYSTGTRKRRKINGDD---FGEVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK VM +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG +EDEK+  YV+SK
Sbjct  153   KTGRTKPVMLDGVQKGCKKIMVLYMSMVRGGKAEKTNWVMHQYHLGTEEDEKDRDYVISK  212

Query  581   IYYqqqqqk---QTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALS  420
             I YQQQQ K   +   +  ES    IP+  P TP    P+PPR            +    
Sbjct  213   ISYQQQQAKYGDKIEQDILESTGAIIPKVDPVTPKLVTPDPPRTERHPDFGPRQESPTTD  272

Query  419   PPAEEVEGGKKERYGSL----WSDVQVKCEEYPGCLAG-----------------ESQAA  303
                ++ E    E    L     S+ +++ E +   + G                 ESQ  
Sbjct  273   AFDQQSEIRHVEEVQPLCENPGSNDKIEAENHANVMVGNNDNGSQAGDDSKWWDSESQNI  332

Query  302   ADATDIDDFL-LCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN---------I  153
              D   + + L LC+E + S    N  +N  TS     +   A   S             +
Sbjct  333   LDTQQLAEALTLCEEFLNSQSDGN--ANDGTSKGKPGLSDYARLGSEHLKKDLEECQMLV  390

Query  152   ADLVNLELDSAPEFSLQDLPFGSQDSI  72
              D  N+ELD+ PEF L  L F SQDS 
Sbjct  391   HDPANIELDTPPEFGLSQLEFNSQDSF  417



>ref|XP_006437738.1| hypothetical protein CICLE_v10031598mg [Citrus clementina]
 gb|ESR50978.1| hypothetical protein CICLE_v10031598mg [Citrus clementina]
Length=432

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 170/392 (43%), Positives = 218/392 (56%), Gaps = 48/392 (12%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNCHH+IDNSDV+ EWPG P GVKF+PSD E++ HL AK G     PH F+DEFIP
Sbjct  36    TKACPNCHHVIDNSDVAHEWPGLPRGVKFDPSDQEIVWHLLAKAGLEGLNPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D GICYTHP+NLPG+K+DGS+ HFFYR  KAY+TGTRKRRKI+ +       VRWH
Sbjct  96    TVDQDGGICYTHPQNLPGVKQDGSAAHFFYRAIKAYSTGTRKRRKINGDD---FGEVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK VM +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG +EDEK+  YV+SK
Sbjct  153   KTGRTKPVMLDGVQKGCKKIMVLYMSMVRGGKAEKTNWVMHQYHLGTEEDEKDDNYVISK  212

Query  581   IYYqqqqqk---QTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALS  420
             I+YQQQQ K   +   +  ES    IP+  P TP +  P+PPR            +    
Sbjct  213   IFYQQQQAKYGDKIEQDILESTGAIIPKVDPVTPKSVTPDPPRTERHPDFGPRQESPTTD  272

Query  419   PPAEEVEGGKKERYGSL----WSDVQVKCEEYPGCLAGESQAAADATD------------  288
                ++ E    E    L     S+ +++ E +   + G +   + A D            
Sbjct  273   AFDQQSEIRHVEELQPLCENPGSNDKIEAENHANMMVGNNDNGSQAGDDRKWWDSESQNG  332

Query  287   -----------IDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----  156
                         +   LC+E + S    N  +N  TS     +   A   S         
Sbjct  333   LSQNILDTQQLAEALTLCEEFLNSQSDGN--ANDGTSKGKPGLSDYARLGSEHLKKDLEE  390

Query  155   ----IADLVNLELDSAPEFSLQDLPFGSQDSI  72
                 + D  N+ELD+ PEF L  L F SQDS 
Sbjct  391   CQMLVHDPANIELDTPPEFGLSQLEFNSQDSF  422



>ref|XP_009115341.1| PREDICTED: NAC domain-containing protein 8-like [Brassica rapa]
Length=451

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 178/439 (41%), Positives = 240/439 (55%), Gaps = 78/439 (18%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++ASS +++   + +   TR CPNC H+IDN+D   +WPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASSHSDSHQVVWNSNPTRHCPNCSHVIDNNDEVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TGT
Sbjct  76    LAKSGLLGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKHDGTVSHFFHRAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMTA  489
             QYHLG DEDEKEG YVVSKI+YQQ          +     +D+   +  P+A P TP   
Sbjct  189   QYHLGTDEDEKEGDYVVSKIFYQQPAVLKQGGGDKAGDDVSDDIFAATTPKADPVTPKLF  248

Query  488   IPNPPRAAG--ETPLSCDDYNAA----LSPPAEEV-------------------------  402
              P PP+A G    P   DDY AA    L+  +E V                         
Sbjct  249   TPEPPQAVGVCSDPHFADDYVAAPEVSLAEISEAVYMEDEVQGVQRNHERTSSEDEPAPE  308

Query  401   -------------EGGKKERYGSLWSDVQVKCEEYPGCL-AGESQAAADATDIDDFL-LC  267
                          +G +KE      ++ + + EE P  L +G SQ   D+  + + L LC
Sbjct  309   TGIENRENEIMVYDGEEKENGKEDGNEGENQAEEDPNWLDSGGSQFILDSQQLVEALSLC  368

Query  266   DEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----------IADLVNLELDSA  120
             D+++   D N   +N   S N  P   +  +   + +           + D  N++LD+ 
Sbjct  369   DDLLQDRDENT--NNGGGSRNKQPCFGDYAHLGGTEDFKMDLEDCQKLVLDPSNIDLDTP  426

Query  119   PEFSLQDLPFGSQDSISSW  63
             PEF L  L FGSQ+S  +W
Sbjct  427   PEFRLSQLEFGSQESFLAW  445



>ref|XP_010695823.1| PREDICTED: NAC domain-containing protein 8 [Beta vulgaris subsp. 
vulgaris]
Length=429

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 174/401 (43%), Positives = 227/401 (57%), Gaps = 63/401 (16%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             TR CP+C H IDNSDV+ EWPG P GVKF+P+D ++++HL AK G G+ +PH F+DEFIP
Sbjct  36    TRLCPSCQHTIDNSDVAQEWPGLPRGVKFDPTDQDIIQHLYAKAGIGDEKPHPFVDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+  ++GICYTHP+NLPG+K+DGS+ HFF+R  KAY TGTRKRRKI  +    +  VRWH
Sbjct  96    TVNEEDGICYTHPKNLPGVKQDGSASHFFHRAIKAYNTGTRKRRKIHGDK---LGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V  NGVQKGCKK+MVLY ST KG KP KTNWVMHQYHLG +EDEK+G YV+SK
Sbjct  153   KTGRTKPVFLNGVQKGCKKIMVLYVSTAKGGKPEKTNWVMHQYHLGTEEDEKDGEYVISK  212

Query  581   IYYqqqqqkQTTDNAGE--SDIPQAIPTTP-------------MTAIPNPPRAAG-----  462
             ++YQQQQQ + +D   E  SD+   I   P              + +   PR        
Sbjct  213   VFYQQQQQVKQSDKTVECISDVADDIVAKPDPVTPKPETPEPPRSDMRLDPREEASVCID  272

Query  461   -----------------ETPLSCDDYNAALS--PPAEEVEGGKKERYGSLWSDVQVKCEE  339
                              ET +S DD NAA    P  E  +         L  D +V  EE
Sbjct  273   SIAQNLDMGFASEVKQPETYISTDDDNAAFENHPGPEACD--------ELLCDNEVLEEE  324

Query  338   YPGCLAGESQAAADATDIDDFL-LCDEIV--------GSFDFNNLPSNHATSANFNPMPQ  186
             +     GESQ    +  + + L LCDE++        G+ D     S  +  A       
Sbjct  325   W---WDGESQCLITSQQLAEGLSLCDELLQSQSPNRDGNADVVIKRSVLSEYACLGSEDL  381

Query  185   EANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             + +       + D  N+ +D+ P+F L  L FGSQ+S  +W
Sbjct  382   KKDLEECQNLVLDPANINIDTPPDFRLSQLEFGSQESFGTW  422



>ref|XP_011077291.1| PREDICTED: NAC domain-containing protein 8 [Sesamum indicum]
Length=430

 Score =   279 bits (714),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 169/390 (43%), Positives = 221/390 (57%), Gaps = 43/390 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC H+IDNSDV+  WPG P GVKF+PSD +++ HL AK G GNS+PH F+DEFIP
Sbjct  36    TKSCPNCLHVIDNSDVADAWPGLPLGVKFDPSDPDIILHLLAKVGVGNSKPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+  D+GICYTHP NLPG+++DGS  HFF+R  KAY TG+RKRRKI ++    +  VRWH
Sbjct  96    TVNEDDGICYTHPRNLPGVREDGSVSHFFHRAIKAYNTGSRKRRKIHDDE---LGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V  +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG  EDEKEG YV+SK
Sbjct  153   KTGRTKPVFLDGVQKGCKKIMVLYVSPVRGGKAEKTNWVMHQYHLGTGEDEKEGEYVISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPNPPRAAGETPLSCDDYNAA  426
             I+YQQQQ KQ+     E DIP  +        P TP +  P PPR          + ++A
Sbjct  213   IFYQQQQLKQSEKT--EEDIPAEVGTMIPKVDPVTPKSVTPEPPRTETRFLTPVSEQDSA  270

Query  425   LSPPAEEVEGGKKE------------------RYGSLWSDVQVKCEEYPGCLAGESQAAA  300
             L     E EG  +E                      +  +   +  +       ESQ   
Sbjct  271   LRNVEHENEGYMEEVVETPEPPNNQNHCNMENNADQVEDENDDEAADDNKWWEHESQYLL  330

Query  299   DATDIDDFL-LCDEIVGSFDFNNLPSNHATSANFNPMPQE---------ANNTSSSTNIA  150
              +  + + L L DE++ S   N L + +    +  P   +           +     N+A
Sbjct  331   SSQQLVEGLSLVDELLHSQSPNRLETANGQELDAKPRLADYAKLGPEYLKRDLEECQNLA  390

Query  149   -DLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              D  N++LD+ P+F L  L F SQDS  +W
Sbjct  391   SDPANIDLDTPPDFRLSQLEFESQDSYIAW  420



>ref|XP_011008569.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Populus 
euphratica]
Length=423

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 223/399 (56%), Gaps = 60/399 (15%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPT  936
             + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL AK  +G  +PH F+ EFIPT
Sbjct  36    KTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVSDGGIKPHPFIKEFIPT  95

Query  935   LEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHK  756
             ++ D+GICYTHP+NLPG+K+DGS  HFF++  KAY TGTRKRRKI  +       VRWHK
Sbjct  96    VDNDDGICYTHPQNLPGVKQDGSISHFFHKAIKAYNTGTRKRRKIQADD---FGDVRWHK  152

Query  755   TGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             TG+TK V+ +G+QKGCKK+MVLY ST +G K  KTNWVMHQYHLG  EDE++G YVVSKI
Sbjct  153   TGRTKPVILDGIQKGCKKIMVLYMSTVRGGKAEKTNWVMHQYHLGTGEDERDGEYVVSKI  212

Query  578   YYqqqqqkQTTDNAGES---DIPQAI--------PTTPMTAIPNPPRA--------AGET  456
             ++QQQQ      N GE    D+ + +        P TP +  P+PPRA         G+ 
Sbjct  213   FFQQQQA-----NKGEKPEEDLSEIVDDVVAKVDPVTPKSVTPDPPRAERRCQDFEVGQE  267

Query  455   PLSCDDYNAALSPPAE--EVEGGKKERYGSLWSDVQVKCEEYPGCLAG------------  318
               S      A  P  E  EVE   +    S     Q++ E     + G            
Sbjct  268   STSICTDPCAQQPGIECLEVEDNLQHENPSYID--QLETENNVNDMVGDNDNCAGEERKW  325

Query  317   ---ESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATSAN----------FNPMPQEA  180
                ESQ   D+  + + L LC E + S   +     H T AN            P   + 
Sbjct  326   WDSESQQLLDSQQLVEGLSLCAEFLQSQSPDR--GGHGTEANGKTGLSDYALLGPEYLKK  383

Query  179   NNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             +         D  N+ELD+ PEF L  L FGSQDS ++W
Sbjct  384   DLEECQNLELDQANIELDTPPEFRLSQLEFGSQDSSTAW  422



>ref|XP_003614421.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES97379.1| NAC transcription factor-like protein [Medicago truncatula]
Length=442

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 238/428 (56%), Gaps = 72/428 (17%)
 Frame = -1

Query  1172  KVRNASSPA--ENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS     EN       T+ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASGACDPENVTWKSNPTKACPNCQHTIDNSDVVKEWPGLPKGVKFDPSDQEVIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AKCG GNS+PH F+DEFI TLE ++GICYTHP+NLPG+K+DG++ HFF+R  KAY TGT
Sbjct  76    LAKCGVGNSKPHPFVDEFIITLEVNDGICYTHPQNLPGVKQDGNASHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI ++       VRWHKTG+TK V+ NGVQKGCKK+MVLY S+  G K  KTNWVM
Sbjct  136   RKRRKIHDQD---FGDVRWHKTGRTKPVILNGVQKGCKKIMVLYMSSAGGGKAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG +EDEK+G +V+SK++YQQQQ K    +  E DIP+AI        P TP +  
Sbjct  193   HQYHLGTEEDEKDGEFVISKVFYQQQQVK--LGDKDEQDIPEAIEATIAKVDPVTPKSVT  250

Query  485   PNPPRA---------AGETP----LSCDDYNAALSPPAEE--------VEGGKKERY---  378
             P PP             +TP    ++C D    + P  EE        VE  + E     
Sbjct  251   PEPPYTERLYSDVDLGQDTPAIPQMNCLD---EIQPYCEEQAKDDLSMVETERNEGKDNN  307

Query  377   ------GSLW----SDVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSF-----  246
                   G  W     + +   +E       ESQ   D+  + D L LCD+++ S      
Sbjct  308   ENNADDGQKWCEGTDNNENNADEGQKWWDSESQNLLDSQQLVDALSLCDDLLRSQSPTRD  367

Query  245   ----DFNNLPSNHATSANFNP------MPQEANNTSSSTNIADLVNLELDSAPEFSLQDL  96
                 +  N PS  +  A   P      +    N     +N+    N+E D+  EF L  L
Sbjct  368   GKDEEQKNQPS-LSIYAQLGPEHLKKDIEDCQNLVLEPSNVES--NVENDTPSEFRLSQL  424

Query  95    PFGSQDSI  72
              FGSQDS 
Sbjct  425   EFGSQDSF  432



>ref|XP_006362531.1| PREDICTED: NAC domain-containing protein 8-like [Solanum tuberosum]
Length=435

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 230/409 (56%), Gaps = 42/409 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS            T+ CPNC  +IDN+DVS +WPG P GVKF+P+D E++ HL  
Sbjct  16    KIKSASGDPATVNWKSNPTKACPNCQFIIDNNDVSHDWPGLPRGVKFDPTDQEIIWHLLG  75

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K   G+   H F+DEFIPT++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRK
Sbjct  76    KVEGGDRNSHPFIDEFIPTVDEDDGICYTHPQNLPGVKQDGSVSHFFHRAIKAYNTGTRK  135

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  + S     VRWHKTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQ
Sbjct  136   RRKIHGDNS---GDVRWHKTGRTKPVILDGIQRGCKKIMVLYISPSKGGKAEKTNWVMHQ  192

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTD------NAGESDIPQAIPTTPMTAIPNPP  474
             YHLG  EDE+EG YVVSK++YQQQQ KQ            E  + +  P TP +  P PP
Sbjct  193   YHLGTGEDEREGEYVVSKVFYQQQQVKQGEKIEQEFPEDSECMVAKVDPHTPKSVTPEPP  252

Query  473   RAAG-ETPLSCDDYNAALSPPAE--EVEGGKKERYGSL------------------WSDV  357
             R     + +   +  AA SP  +  EVE   ++  GSL                   + V
Sbjct  253   RGERLSSSMDAREQIAASSPINQYHEVEDYVEDDMGSLPEQPENQDQNIENQIDETGTKV  312

Query  356   QVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGS----FDFNNLPSNH------ATS  210
             + +  + P     ESQ   D+  + + L LCD+++ S     D N     H      A  
Sbjct  313   ETETGDDPKWWDSESQYLLDSQQLVEGLSLCDDLLASQSPNRDGNENDQVHKCKPSLADY  372

Query  209   ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             A   P   + +       +AD  N+E+ + P+F L  L FGSQDS  +W
Sbjct  373   ARLGPEDLKKDLEECQQFVADPANIEIGTPPDFRLSQLEFGSQDSYIAW  421



>emb|CDX85002.1| BnaC05g20530D [Brassica napus]
Length=448

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 181/436 (42%), Positives = 246/436 (56%), Gaps = 75/436 (17%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPE-WPGFPAGVKFEPSDVELLEH  1002
             K+++ASS +++   + +   TR CPNCHH+IDN+D   + WPG P GVKF+PSD E++ H
Sbjct  16    KIKSASSHSDSHQVVWNSNPTRHCPNCHHVIDNNDDEVDAWPGLPRGVKFDPSDPEIIWH  75

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TG
Sbjct  76    LLAKSGLLGLSTHPFIDEFIPTVNQDDGICYTHPKNLPGVKHDGTVSHFFHRAIKAYSTG  135

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVM  642
             TRKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVM
Sbjct  136   TRKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKNVKTNWVM  188

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMT  492
             HQYHLG DEDEKEG YVVSKI+YQQ          + ++  +D+   S  P+A P  P  
Sbjct  189   HQYHLGTDEDEKEGDYVVSKIFYQQPAVLKQGGGDKAEQDVSDDIFASATPKADPVIPKL  248

Query  491   AIPNPPRAAGETPLS--CDDY----NAALSPPAE------EVEGGKK--ERYGS------  372
               P PP+A G    S   DDY      +L+  +E      EV+G ++  ER  S      
Sbjct  249   FTPEPPQAVGVCSDSHFADDYAIPQEVSLAEISEAVYMEDEVQGVQRNNERTSSEDEPAP  308

Query  371   ------LWSDVQV--------------KCEEYPGCL-AGESQAAADATDIDDFL-LCDEI  258
                     ++++V              + EE P  L +GESQ   D+  + + L LCD++
Sbjct  309   ETGIENRDNEIKVYDGEEKENGKENEHQAEEDPNWLESGESQFILDSQQLVEALSLCDDL  368

Query  257   VGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----------IADLVNLELDSAPEF  111
             +   D N   +N   S N  P   +      + +           + D  N++LD+ PEF
Sbjct  369   LQDRDENT--NNGGGSRNKQPCFGDYARLGGTEDFKRDLEDCQKLVLDPSNIDLDTPPEF  426

Query  110   SLQDLPFGSQDSISSW  63
              L  L FGSQ+S  +W
Sbjct  427   RLSQLEFGSQESFLAW  442



>ref|XP_003614420.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES97378.1| NAC transcription factor-like protein [Medicago truncatula]
Length=445

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 175/244 (72%), Gaps = 16/244 (7%)
 Frame = -1

Query  1172  KVRNASSPA--ENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS     EN       T+ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASGACDPENVTWKSNPTKACPNCQHTIDNSDVVKEWPGLPKGVKFDPSDQEVIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AKCG GNS+PH F+DEFI TLE ++GICYTHP+NLPG+K+DG++ HFF+R  KAY TGT
Sbjct  76    LAKCGVGNSKPHPFVDEFIITLEVNDGICYTHPQNLPGVKQDGNASHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI ++       VRWHKTG+TK V+ NGVQKGCKK+MVLY S+  G K  KTNWVM
Sbjct  136   RKRRKIHDQD---FGDVRWHKTGRTKPVILNGVQKGCKKIMVLYMSSAGGGKAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG +EDEK+G +V+SK++YQQQQ K    +  E DIP+AI        P TP +  
Sbjct  193   HQYHLGTEEDEKDGEFVISKVFYQQQQVK--LGDKDEQDIPEAIEATIAKVDPVTPKSVT  250

Query  485   PNPP  474
             P PP
Sbjct  251   PEPP  254



>gb|AES62079.2| NAC transcription factor-like protein [Medicago truncatula]
Length=481

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 169/241 (70%), Gaps = 10/241 (4%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K++ AS   E  I +   TR CPNC H+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  18    KIKRASEATEKVIWESNPTRACPNCQHVIDNSDVTQEWPGLPKGVKFDPSDQEIIWHLLA  77

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K GEGN EPH F+DEFI TL+ D+GICYTHP+ LPG+ +DG + HFF+R  KAY TG+RK
Sbjct  78    KVGEGNLEPHPFIDEFISTLQMDDGICYTHPKRLPGVSQDGIASHFFHRAIKAYNTGSRK  137

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK ++ NG+QKGCKK+MVLY T + G K  KTNWVMHQ
Sbjct  138   RRKICGQD---FGDVRWHKTGRTKPILLNGLQKGCKKIMVLYMTLESGGKAEKTNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqk------QTTDNAGESDIPQAIPTTPMTAIPNPP  474
             YHLG  EDEK+G YV+SK++YQQQQ K      Q      E+ + +  P TP +  P PP
Sbjct  195   YHLGRQEDEKDGEYVISKVFYQQQQAKLGEKDDQNVPETTEATVVKVDPVTPNSVTPEPP  254

Query  473   R  471
             R
Sbjct  255   R  255



>ref|XP_006852354.1| hypothetical protein AMTR_s00049p00217400 [Amborella trichopoda]
 gb|ERN13821.1| hypothetical protein AMTR_s00049p00217400 [Amborella trichopoda]
Length=354

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 172/224 (77%), Gaps = 3/224 (1%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDC--GATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KV++A+  +  +I++    A RECPNC++ IDNSDVS EWPG PAGVKF+PSDVELL H
Sbjct  14    RKVKSAAHFSGPQIKEWFGEANRECPNCNYKIDNSDVSLEWPGLPAGVKFDPSDVELLGH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             LA K G G S  H F+DEFIPTLE DEGICYTHP++LPGIK DG+S HFF+RT  AYATG
Sbjct  74    LAGKVGFGGSTAHAFIDEFIPTLENDEGICYTHPKDLPGIKMDGTSIHFFHRTTNAYATG  133

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
             +RKRRKI  E +    HVRWHKTG TK V+ENGV KG KK+MVLY ++ KG KP KTNWV
Sbjct  134   SRKRRKIHRECNWDGGHVRWHKTGTTKVVIENGVPKGRKKIMVLYRNSTKGSKPDKTNWV  193

Query  644   MHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQA  513
             MHQYHLG +E+EK+G +VVSK++YQQQ+Q +  D    S  P A
Sbjct  194   MHQYHLGRNEEEKDGEFVVSKVFYQQQKQLEKCDYEPASQEPDA  237



>ref|NP_001149204.1| ANAC044 [Zea mays]
 ref|XP_008677272.1| PREDICTED: ANAC044 isoform X1 [Zea mays]
 gb|ACG34553.1| ANAC044 [Zea mays]
 gb|AFW62816.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=399

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 228/398 (57%), Gaps = 35/398 (9%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+R A+  A  +I      A RECPNC ++IDNSDV+ +WPG PAGVKF+PS++ELL+H
Sbjct  14    KKIRYANPSANRQISQLIAEARRECPNCSYVIDNSDVAMQWPGLPAGVKFDPSELELLQH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G+S PH+ +DEFIPT++ DEGICY+HPENLPG+K DGS+ HFF+R  KAY  G
Sbjct  74    LEQKVGLGDSRPHVLIDEFIPTIDNDEGICYSHPENLPGMKTDGSNAHFFHRVSKAYGYG  133

Query  821   TRKRRKISN--ETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTN  651
              RKRR+I N  + ++  + VRWHKTG++KA+ +NGV KG KK+MVL+ T + G K  +  
Sbjct  134   QRKRRRIINCSDHTVPDDRVRWHKTGRSKAIYDNGVIKGWKKIMVLHKTLRSGGKRERAK  193

Query  650   WVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQ----TTDNAGESDIPQAI--PTTPMTA  489
             WVMHQYHLG +EDEK+G  VVSKI++Q   +      T     E + P ++  P TP T 
Sbjct  194   WVMHQYHLGKEEDEKDGELVVSKIFFQLANKSMEISETETACEEPEAPASVIGPKTPKTI  253

Query  488   IPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQ--VKCEEYPGCLAGE  315
              P P         +  + +        + EG       SL  D      C      +A E
Sbjct  254   TPQPRHPKSSPCETQQNISIVQDQLLLDSEGEPTMPIVSLEDDAMNPAWC-----AVAEE  308

Query  314   SQAAADATDID----DFLLCDEIVGSFDFNN-LPSNHATSANFNPMPQEANNTSSSTN--  156
              Q   +A+       + LLC E   S ++   LP ++       P+  +  N     N  
Sbjct  309   RQVVGEASRAQSNSVETLLCREDPNSLNYEALLPWDY-------PILSQCRNEMLDGNLN  361

Query  155   ---IADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
                + D  N++L + P+  L D  FGSQ+S+ SWLDR+
Sbjct  362   GYGLPDHHNVDLGTPPDLQLADFQFGSQESLGSWLDRI  399



>ref|XP_008243167.1| PREDICTED: NAC domain-containing protein 8 [Prunus mume]
Length=427

 Score =   276 bits (707),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 176/412 (43%), Positives = 234/412 (57%), Gaps = 48/412 (12%)
 Frame = -1

Query  1172  KVRNASSPAE-NRIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS   +  RI+     TR CPNC + IDNSDV+ EWPG P GVKF+P+D E++ HL
Sbjct  16    KIKSASGTCDPERIKWQSNPTRACPNCQYTIDNSDVAQEWPGLPKGVKFDPTDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G  + +PH F+DEFI T++ DEGIC +HP  LP +K+DGS+ HFF+R  KAY TGT
Sbjct  76    IAKSGAEDLKPHPFIDEFIITVDDDEGICCSHPHKLPSVKQDGSASHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI +        VRWHKTG+TK VM +GVQ+GCKK+MVLY ST  G KP KTNWVM
Sbjct  136   RKRRKIHDGDG----DVRWHKTGRTKPVMLDGVQRGCKKIMVLYMSTVGGGKPKKTNWVM  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG +EDEK+G YV+SKIYYQQQQ KQ   +  + D+P+          P TP +  
Sbjct  192   HQYHLGTEEDEKDGEYVISKIYYQQQQVKQA--DKTDQDLPENFDLVITKVDPVTPKSVT  249

Query  485   PNPPRAAGETPL--------SCDDYNAALSPPAEEV--EGGKKERYGS---------LWS  363
             P PPR     P         + D+ +  +    +EV  E  K + Y           + +
Sbjct  250   PEPPRTTSRDPFPQHPEMDQAEDEVHPEMDHAEDEVHPEFEKPDHYDQHNVENEADEVIN  309

Query  362   DVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFD------FNNLPSN----HA  216
             + +   EE P     ESQ   D+  + + L LCD+++ S         N  P+      A
Sbjct  310   NTENNAEEDPKWWDSESQNLLDSQQLVEGLSLCDDLLQSQSPIRAGHENGEPAQVKPRLA  369

Query  215   TSANFNPMPQEANNTSSSTNIADLVNLEL-DSAPEFSLQDLPFGSQDSISSW  63
               A   P   + +       + D  N+ L D+ P+F L  L FGSQ+S  SW
Sbjct  370   DYAKLGPENLKKDLDECQNIVLDPANIMLEDTPPDFRLSQLEFGSQESFLSW  421



>gb|AFK39167.1| unknown [Medicago truncatula]
Length=445

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 175/244 (72%), Gaps = 16/244 (7%)
 Frame = -1

Query  1172  KVRNASSPA--ENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS     EN       T+ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASGACDPENVTWKSNPTKACPNCQHTIDNSDVVKEWPGLPKGVKFDPSDQEVIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AKCG GNS+PH F+DEFI TLE ++GICYTHP+NLPG+K+DG++ HFF+R  KAY TGT
Sbjct  76    LAKCGVGNSKPHPFVDEFIITLEVNDGICYTHPQNLPGVKQDGNASHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI ++       VRWHKTG+TK V+ NGVQKGCKK++VLY S+  G K  KTNWVM
Sbjct  136   RKRRKIHDQD---FGDVRWHKTGRTKPVILNGVQKGCKKIVVLYMSSAGGGKAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG +EDEK+G +V+SK++YQQQQ K    +  E DIP+AI        P TP +  
Sbjct  193   HQYHLGTEEDEKDGEFVISKVFYQQQQVK--LGDKDEQDIPEAIEATIAKVDPVTPKSVT  250

Query  485   PNPP  474
             P PP
Sbjct  251   PEPP  254



>emb|CDY16138.1| BnaA09g28720D [Brassica napus]
Length=457

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 176/445 (40%), Positives = 239/445 (54%), Gaps = 84/445 (19%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++ASS +++   + +   TR CPNC H+IDN+D   +WPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASSHSDSHQVVWNSNPTRHCPNCSHVIDNNDEVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TGT
Sbjct  76    LAKSGLLGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKHDGTVAHFFHRAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMTA  489
             QYHLG DEDEKEG YVVSKI+YQQ          +     +D+   +  P+A P TP   
Sbjct  189   QYHLGTDEDEKEGDYVVSKIFYQQPAVLKQGGGDKAGDDVSDDIFAATTPKADPVTPKLF  248

Query  488   IPNPPRAAG--ETPLSCDDY----------NAALSPPAEEV-------------------  402
              P PP+A G    P   DDY            +L+  +E V                   
Sbjct  249   TPEPPQAVGVCSDPHFADDYVIPHGYVAAPEVSLAEISEAVYMEDEVQGVQRNHERTSSE  308

Query  401   -------------------EGGKKERYGSLWSDVQVKCEEYPGCL-AGESQAAADATDID  282
                                +G +KE      ++ + + EE P  L +G SQ   D+  + 
Sbjct  309   DEPAPETGIENRENEIMVYDGEEKENGKEDGNEGENQAEEDPNWLDSGGSQFILDSQQLV  368

Query  281   DFL-LCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----------IADLVN  138
             + L LCD+++   D N   +N   S N  P   +  +   + +           + D  N
Sbjct  369   EALSLCDDLLQDRDENT--NNGGGSRNKQPCFGDYAHLGGTEDFKRDLEDCQKLVLDPSN  426

Query  137   LELDSAPEFSLQDLPFGSQDSISSW  63
             ++LD+ PEF L  L FGSQ+S  +W
Sbjct  427   IDLDTPPEFRLSQLEFGSQESFLAW  451



>ref|XP_002454112.1| hypothetical protein SORBIDRAFT_04g024780 [Sorghum bicolor]
 gb|EES07088.1| hypothetical protein SORBIDRAFT_04g024780 [Sorghum bicolor]
Length=399

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 170/395 (43%), Positives = 235/395 (59%), Gaps = 29/395 (7%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+R A+  A  +I++    A RECPNC ++IDNSDV+ +WPG PAGVKF+PS++ELL+H
Sbjct  14    KKIRYAAPSANRQIRELIAEARRECPNCSYVIDNSDVAMQWPGLPAGVKFDPSELELLQH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G S PH+ +DEFIPT++ DEGICY+HPENLPGIK DGS+ HFF+R   AY  G
Sbjct  74    LEQKVGLGGSRPHVLIDEFIPTIDNDEGICYSHPENLPGIKTDGSNAHFFHRVSNAYGCG  133

Query  821   TRKRRKI--SNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTN  651
              RKRR+I   N  ++  EHVRWHKTG++KA+ +NGV KG +K+MVLY ++++G KP + N
Sbjct  134   LRKRRRIINCNNHTVPDEHVRWHKTGRSKAICDNGVIKGWRKIMVLYKASQRGGKPDRAN  193

Query  650   WVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQ----TTDNAGESDIPQAI--PTTPMTA  489
             WVMHQYHLG +EDEK+G  VVSK++ Q   +      T     E D P ++  P TP T 
Sbjct  194   WVMHQYHLGEEEDEKDGELVVSKVFCQLPNKSMEICETETAYEEPDAPASVIGPKTPKTN  253

Query  488   IPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQ  309
              P  PR    +P   +     L    + +   K E    + S            +A E Q
Sbjct  254   APQ-PRHPKNSPCETEQNIPILQ--DQLLLDSKGEPTMPIISLEDDATNPVWCAIAEEQQ  310

Query  308   AAADAT----DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----  156
                +A+    + D+ LLC E     D N+L        ++ P+  +  N     N     
Sbjct  311   VVGEASRAQLNSDEPLLCHE-----DPNSLNDKALLPLDY-PILSQCRNEMLDWNLNGHG  364

Query  155   IADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
             + DL N++L + P+F L D  FGSQ+S+ SWLDR+
Sbjct  365   LPDLHNVDLGTPPDFQLADFQFGSQESLGSWLDRI  399



>ref|XP_009391398.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 228/387 (59%), Gaps = 20/387 (5%)
 Frame = -1

Query  1172  KVRNASSPAE-NRIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS+  + ++++     T+ CP C+H+IDNSDV  EWPG P GVKF+PSD EL+ HL
Sbjct  16    KIKNASATVDPSKVKWISNPTKACPRCNHVIDNSDVVQEWPGLPKGVKFDPSDQELISHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G G+++PH F++EFI T+E ++GICYTHP+ LPG+K+DGS  HFF+RT KAY  GT
Sbjct  76    MAKVGTGDAKPHPFINEFILTVEEEDGICYTHPKKLPGVKQDGSVSHFFHRTFKAYNIGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI N   LV   VRWHKTGKTK V+ +G   GCKK+MVLY ST KGEKP KTNWVM
Sbjct  136   RKRRKI-NTDDLV--DVRWHKTGKTKPVIVDGRHLGCKKIMVLYMSTTKGEKPEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqq--kQTTDNAGESDIPQAIPTTPMTAIPNPPRA  468
             HQYHLG  EDEK+G YVVSKI+YQQQ +   +   + G+ +            +     A
Sbjct  193   HQYHLGTGEDEKDGEYVVSKIFYQQQSKPGDKNGQDLGDKNGQNLTMEIDHNVVTELDPA  252

Query  467   AGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYP----GCLAGESQAAA  300
              G  P S +  ++      E +E    +    L  D      E+P        GESQ   
Sbjct  253   PGAVPGSPEQNSSDKQDHVERLEVISGQSNVHLEGDKPDDQGEHPTEDTKWWEGESQYLL  312

Query  299   DATDI-DDFLLCDEIVGSFDF---NNLPSNHATSANFNPMPQEANNTS----SSTNIADL  144
             D+  + +   +C+E + S        +  ++   +++  M  EA         + +  D 
Sbjct  313   DSQQLAEGIAICEEFLQSQSSCAGEEVKKSNLCLSDYAAMGAEALKMDLEECQNLDSTDH  372

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSW  63
              N+ELD+ P+F L  L FGSQDS  +W
Sbjct  373   ANIELDTPPDFRLSQLEFGSQDSFLAW  399



>ref|XP_003591828.1| NAC domain protein [Medicago truncatula]
Length=553

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 169/241 (70%), Gaps = 10/241 (4%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K++ AS   E  I +   TR CPNC H+IDNSDV+ EWPG P GVKF+PSD E++ HL A
Sbjct  18    KIKRASEATEKVIWESNPTRACPNCQHVIDNSDVTQEWPGLPKGVKFDPSDQEIIWHLLA  77

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K GEGN EPH F+DEFI TL+ D+GICYTHP+ LPG+ +DG + HFF+R  KAY TG+RK
Sbjct  78    KVGEGNLEPHPFIDEFISTLQMDDGICYTHPKRLPGVSQDGIASHFFHRAIKAYNTGSRK  137

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQ  636
             RRKI  +       VRWHKTG+TK ++ NG+QKGCKK+MVLY T + G K  KTNWVMHQ
Sbjct  138   RRKICGQD---FGDVRWHKTGRTKPILLNGLQKGCKKIMVLYMTLESGGKAEKTNWVMHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqk------QTTDNAGESDIPQAIPTTPMTAIPNPP  474
             YHLG  EDEK+G YV+SK++YQQQQ K      Q      E+ + +  P TP +  P PP
Sbjct  195   YHLGRQEDEKDGEYVISKVFYQQQQAKLGEKDDQNVPETTEATVVKVDPVTPNSVTPEPP  254

Query  473   R  471
             R
Sbjct  255   R  255



>ref|XP_009391397.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 170/397 (43%), Positives = 229/397 (58%), Gaps = 30/397 (8%)
 Frame = -1

Query  1172  KVRNASSPAE-NRIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS+  + ++++     T+ CP C+H+IDNSDV  EWPG P GVKF+PSD EL+ HL
Sbjct  16    KIKNASATVDPSKVKWISNPTKACPRCNHVIDNSDVVQEWPGLPKGVKFDPSDQELISHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G G+++PH F++EFI T+E ++GICYTHP+ LPG+K+DGS  HFF+RT KAY  GT
Sbjct  76    MAKVGTGDAKPHPFINEFILTVEEEDGICYTHPKKLPGVKQDGSVSHFFHRTFKAYNIGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI N   LV   VRWHKTGKTK V+ +G   GCKK+MVLY ST KGEKP KTNWVM
Sbjct  136   RKRRKI-NTDDLV--DVRWHKTGKTKPVIVDGRHLGCKKIMVLYMSTTKGEKPEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD-----IPQAIPTTPMT-----  492
             HQYHLG  EDEK+G YVVSKI+YQQQ +    +     D     +   I    +T     
Sbjct  193   HQYHLGTGEDEKDGEYVVSKIFYQQQSKPGDKNGQDLGDKNGQNLTMEIDHNVVTELDPA  252

Query  491   --AIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYP----G  330
               A+P  P           +    +S  +     G +E +  L  D      E+P     
Sbjct  253   PGAVPGSPEQNSSDKQDHVERLEVISGQSNVHHSGDEEHHVHLEGDKPDDQGEHPTEDTK  312

Query  329   CLAGESQAAADATDI-DDFLLCDEIVGSFDF---NNLPSNHATSANFNPMPQEANNTS--  168
                GESQ   D+  + +   +C+E + S        +  ++   +++  M  EA      
Sbjct  313   WWEGESQYLLDSQQLAEGIAICEEFLQSQSSCAGEEVKKSNLCLSDYAAMGAEALKMDLE  372

Query  167   --SSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                + +  D  N+ELD+ P+F L  L FGSQDS  +W
Sbjct  373   ECQNLDSTDHANIELDTPPDFRLSQLEFGSQDSFLAW  409



>ref|XP_009103075.1| PREDICTED: NAC domain-containing protein 8-like [Brassica rapa]
Length=445

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 176/434 (41%), Positives = 229/434 (53%), Gaps = 74/434 (17%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+ +AS P    + +   TR CPNCHH+IDNS    +WPG P GVKF+PSD E++ HL A
Sbjct  16    KILSASDPCPT-VWNTNPTRHCPNCHHVIDNSHEVDDWPGLPRGVKFDPSDPEIIWHLLA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G     PH F+DEFIPT++ D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TGTRK
Sbjct  75    KTGSLGLTPHPFIDEFIPTVDQDDGICYTHPKNLPGVKHDGTMCHFFHRAIKAYSTGTRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQY  633
             RRKI ++    +  VRWHKTG+TK V+ +GVQ+GCKK+MVLY  K      KTNWVMHQY
Sbjct  135   RRKIQDDD---LGDVRWHKTGRTKTVVLDGVQRGCKKIMVLYEGKS----VKTNWVMHQY  187

Query  632   HLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGES-------DI-------PQAIPTTPM  495
             HLG DEDEK+G YVVSKI+YQQ QQ+      G+        DI       P+A P TP 
Sbjct  188   HLGTDEDEKDGQYVVSKIFYQQPQQQGVLKKGGDKAEEEVSEDIFAAATTTPKADPVTPR  247

Query  494   TAIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEE-------Y  336
                P P R A   PL  D + A     A EV   +      +  +VQ   E         
Sbjct  248   LFTPEPSRQA--VPLRSDSHFANDYVTAHEVSLAETSEGMYMEDEVQRNVERPSSEDEPA  305

Query  335   PGCL-----------------------------AGESQAAADATDIDDFL-LCDEI--VG  252
             P  +                             +G SQ   ++  + + L LCD++  VG
Sbjct  306   PETMIHDKEDENDQENKEGEENHQAEEEENLLDSGGSQFILNSQQLVEALALCDDLLQVG  365

Query  251   SFDFNNLPSNHATSANFNPMPQEANNTSSSTN-----------IADLVNLELDSAPEFSL  105
             S D NN            P   +  +   + +           + D  N++LD+ PEF L
Sbjct  366   SQDANNGGGGGGLRNKQQPCFGDYAHLGGTDDFKRDLEDCQKLVLDPCNIDLDTPPEFRL  425

Query  104   QDLPFGSQDSISSW  63
               L FGSQ+S  +W
Sbjct  426   SQLEFGSQESFLAW  439



>gb|ACJ85378.1| unknown [Medicago truncatula]
Length=440

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 175/244 (72%), Gaps = 16/244 (7%)
 Frame = -1

Query  1172  KVRNASSPA--ENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS     EN       T+ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASGACDPENVTWKSNPTKACPNCQHTIDNSDVVKEWPGLPKGVKFDPSDQEVIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AKCG GNS+PH F+DEFI TLE ++GICYTHP+NLPG+K+DG++ HFF+R  KAY TGT
Sbjct  76    LAKCGVGNSKPHPFVDEFIITLEVNDGICYTHPQNLPGVKQDGNASHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI ++       VRWHKTG+TK V+ NGVQKGCKK++VLY S+  G K  KTNWVM
Sbjct  136   RKRRKIHDQD---FGDVRWHKTGRTKPVILNGVQKGCKKIVVLYMSSAGGGKAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG +EDEK+G +V+SK++YQQQQ K    +  E DIP+AI        P TP +  
Sbjct  193   HQYHLGTEEDEKDGEFVISKVFYQQQQVKLG--DKDEQDIPEAIEATIAKVDPGTPKSVT  250

Query  485   PNPP  474
             P PP
Sbjct  251   PEPP  254



>ref|XP_004490275.1| PREDICTED: NAC domain-containing protein 8-like [Cicer arietinum]
Length=426

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 179/411 (44%), Positives = 229/411 (56%), Gaps = 48/411 (12%)
 Frame = -1

Query  1172  KVRNASSPA--ENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+R+AS     EN       ++ CPNC H IDNSDV+ EWPG P GVKF+PSD E++ HL
Sbjct  16    KIRSASGACHPENVTWKSNPSKTCPNCQHAIDNSDVAQEWPGLPKGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G GNS+PH F+DEFI TLE D+GICYTHP+NLPG+ +DG++ HFF+R  KAY TGT
Sbjct  76    LAKVGVGNSKPHPFVDEFITTLEVDDGICYTHPQNLPGVMQDGNASHFFHRAVKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI ++       VRWHKTGKTK V+ NGVQKG KK+MVLY S+  G K  KTNWVM
Sbjct  136   RKRRKIHDQD---FGDVRWHKTGKTKPVILNGVQKGFKKIMVLYMSSVGGGKAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG DE+E +G +VVSK++YQQQQ K    N  E DIP+A         P TP +  
Sbjct  193   HQYHLGTDEEENDGEFVVSKVFYQQQQVKLGDKN--ELDIPEATEATIIKVDPVTPKSVT  250

Query  485   PNPP---RAAGETPLSCDDYNAALSPPA----EEVEGGKKERYGSLWS-----------D  360
             P PP   R   +  L   +  A   PP     +E++   +E      S           D
Sbjct  251   PEPPYNERQYSDVDLG-QETPAIPQPPQMDCLDEIQADCEEHAIDDLSMIETENNEETYD  309

Query  359   VQVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATS  210
              ++  +E       ESQ   D+  + + L LCD+++ S          +  N PS  +  
Sbjct  310   KEINADEGQKWWDSESQNLLDSQQLVEALSLCDDLLHSQSPERDDEHGEHKNQPS-LSVY  368

Query  209   ANFNPMPQEANNTSSSTNIADLVNLELDSAP--EFSLQDLPFGSQDSISSW  63
             A   P   + +       + D  N     AP  E  L  L F SQDS  +W
Sbjct  369   AQLGPEHLKKDIEDCQNLVLDPANTAEHDAPPSELRLSQLEFSSQDSFIAW  419



>ref|XP_004965197.1| PREDICTED: NAC domain-containing protein 8-like [Setaria italica]
Length=418

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 229/405 (57%), Gaps = 45/405 (11%)
 Frame = -1

Query  1172  KVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS P++   Q      ++ECP C H+IDNSDV  +WPG P GVKF+PSD ELL HL
Sbjct  16    KIKNASGPSDPSKQKWMSNPSKECPKCSHVIDNSDVVHQWPGLPKGVKFDPSDQELLWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+   +PH F+DEFIPT+EG++GICYTHP+ LPG+K++GS  HFF+RT +AY TGT
Sbjct  76    LAKHGKSGIKPHPFIDEFIPTVEGEDGICYTHPQKLPGVKQNGSVSHFFHRTFRAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+ +    +  VRWHKTGKTK V+  G   GCKK+MVLY ST KG K  KTNWVM
Sbjct  136   RKRRKINTDD---LADVRWHKTGKTKPVLVEGKHLGCKKIMVLYTSTTKGGKAEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqq--------qqkQTTDN----AGESDIPQ--AIPT  504
             HQYHLG  EDEKEG YVVSK+++QQQ        Q+  T D     A E+DIP    +P+
Sbjct  193   HQYHLGTGEDEKEGEYVVSKLFFQQQFKPGEKNAQELTTADGLESMAAEADIPDFTTLPS  252

Query  503   TPMTAI-----PNPPRAAGETPLSCD---DYNAA----LSPPAEEVEGGK--KERYGSLW  366
               +         NP     +   +C+     NAA    + PP+E+ EGG   + +   LW
Sbjct  253   EELVGTIQEIAQNPDHNPYQVNENCEINIQENAAEETVVLPPSEKPEGGDNPQSQDPKLW  312

Query  365   SDVQVKCEEYPGCLAGESQAAADATDIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQ  186
                     E    L    Q A      D+FLL          +   +     A +  +P 
Sbjct  313   EG------ESQFELLDSQQLAEGLALCDEFLLSQSQTSCGGGDEPRAIKPRLAVYAQLPT  366

Query  185   EANNTS----SSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             E              +D VNLELD+  EF L  + F SQDS ++W
Sbjct  367   EDFKKDLEECQRLEPSDTVNLELDNTTEFRLSQIDF-SQDSFTTW  410



>ref|XP_009336626.1| PREDICTED: NAC domain-containing protein 8 [Pyrus x bretschneideri]
Length=454

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 179/419 (43%), Positives = 227/419 (54%), Gaps = 73/419 (17%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP CH+ IDNSDV+ EWPG P GVKF+P+D E++ HL AK G G+ +PH F+DEFI 
Sbjct  36    TKSCPKCHYTIDNSDVAQEWPGLPKGVKFDPTDQEIIWHLLAKSGVGDQKPHPFIDEFIL  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ DEGIC +HP  LP +K DGS  HFF+R  KAY TGTRKRRKI +        VRWH
Sbjct  96    TVDDDEGICCSHPRKLPNVKLDGSPSHFFHRAIKAYNTGTRKRRKIHDGDG----DVRWH  151

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY ST  G KP KTNWVMHQYHLGI+EDEK+G YV+SK
Sbjct  152   KTGRTKPVILDGVQKGCKKIMVLYMSTVGGGKPVKTNWVMHQYHLGIEEDEKDGEYVISK  211

Query  581   IYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPNPPRA---AGETPLSCD--  441
             IYYQQQ+ KQ   +  + D+P++I        P TP    P PPRA    G+  L  D  
Sbjct  212   IYYQQQEAKQA--DKTDQDVPESIDAVITKVDPVTPKLVTPEPPRAEQKLGDFDLGLDTP  269

Query  440   ----------------------DYNAALSPPAEEVEGGKKERYGSLWSD--VQVKCE---  342
                                   D  +AL     EV   +  R  S   D   Q K E   
Sbjct  270   APARDPFLQYRVEDGAEDEVHPDVASALDEAHTEVNRAEDVRPESEIPDDYDQHKLENQA  329

Query  341   --------------EYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFN----------  237
                           E P     ESQ   D+  + + L LCDE++ S   N          
Sbjct  330   DEVINNTENIDHAQEDPKWWDNESQNLLDSQQLVEGLSLCDELLQSQSPNRGGHENGEQA  389

Query  236   NLPSNHATSANFNPMPQEANNTSSSTNIADLVN-LELDSAPEFSLQDLPFGSQDSISSW  63
             ++    A  A   P   + +  +    + D  N ++LD+ P+F L  L FGSQ+S  SW
Sbjct  390   HVKPRLADYAKLGPEDLKKDLEACQNIVLDPANIMDLDTPPDFRLSQLEFGSQESFLSW  448



>ref|XP_004238966.1| PREDICTED: NAC domain-containing protein 8 [Solanum lycopersicum]
Length=435

 Score =   274 bits (701),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 227/409 (56%), Gaps = 42/409 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+++AS            T+ CPNC  +IDN+DVS +WPG P GVKF+P+D E++ HL  
Sbjct  16    KIKSASGDPATVNWKSNPTKACPNCQFIIDNNDVSHDWPGLPRGVKFDPTDQEIIWHLIG  75

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K   G+   H F+DEFIPT+  D+GICYTHP+NLPG+K+DG   HFF+R  KAY TGTRK
Sbjct  76    KVEGGDRNSHPFIDEFIPTVNEDDGICYTHPQNLPGVKQDGCVAHFFHRAIKAYNTGTRK  135

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI  + S     VRWHKTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQ
Sbjct  136   RRKIHGDNS---GDVRWHKTGRTKPVILDGIQRGCKKIMVLYISPSKGGKAEKTNWVMHQ  192

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTD------NAGESDIPQAIPTTPMTAIPNPP  474
             YHLG  EDE+EG YVVSK++YQQQQ KQ            E  + +  P TP +  P PP
Sbjct  193   YHLGTGEDEREGEYVVSKVFYQQQQVKQGEKIEQEFPEDSECMVAKVDPHTPKSVTPEPP  252

Query  473   RA-------------AGETPLS--------CDDYNAALSPPAEEVEGGKKERYGSLWSDV  357
             R+             A  +P++         +D   AL    E+ +   + +     + +
Sbjct  253   RSDRLSSSMDARQQIAAASPVNQYHEVEDYVEDDMGALPEQPEDQDQNIENQIDETGTKI  312

Query  356   QVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNH----------ATS  210
             + +  + P     ESQ   D+  + + L LCD+++ S   N   + +          A  
Sbjct  313   ETETGDDPKWWDSESQYLLDSQQLVEGLSLCDDLLASQSPNRDGNENDQVQKCRPSLADY  372

Query  209   ANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             A   P   + +       +AD  N+E+ + P+F L  L FGSQDS  +W
Sbjct  373   ARLGPEDLKKDLEECQQFVADPANIEIGTPPDFRLSQLEFGSQDSYIAW  421



>ref|XP_007153341.1| hypothetical protein PHAVU_003G027100g [Phaseolus vulgaris]
 gb|ESW25335.1| hypothetical protein PHAVU_003G027100g [Phaseolus vulgaris]
Length=416

 Score =   273 bits (699),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 170/402 (42%), Positives = 223/402 (55%), Gaps = 39/402 (10%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++ AS   + +  I +   T+ CPNC H IDNSDV+ EWPG P GVKF+PSD E++ HL
Sbjct  16    KIKCASGTCDPKTIIWNSNPTKPCPNCQHDIDNSDVAQEWPGLPKGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G  +S+PH F+DEFI  LE D GICYTHP+NLPGI +DGS+ +FF+R  KAY TG 
Sbjct  76    LAKVGVEDSKPHPFIDEFITNLEEDNGICYTHPQNLPGIMQDGSASYFFHRAIKAYNTGN  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTK-KGEKPGKTNWVM  642
             RKRRKI   TS      RWHKTG+TK ++ NG QKG KK+MVLY    +G K  KTNWVM
Sbjct  136   RKRRKI---TSQDFGDARWHKTGRTKPIVFNGAQKGWKKIMVLYENNGRGGKVEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAG  462
             H+YHLG  EDE +G Y+ SK++YQQQ +    D   + D+P+AI +T +  +PN P    
Sbjct  193   HEYHLGTKEDEHDGEYIFSKVFYQQQVKLGDKD---DQDVPEAIESTIVEVVPNTPNLVT  249

Query  461   ETPLSCDDYNAALSPPAEEVEGGK----------KERYGSLWSDVQ---------VKCEE  339
                L  +  +A L    E  E  +          +E Y  L ++ Q            EE
Sbjct  250   LDALCNERQSADLDQGQETHEIPQLSQMDCLYEIQEDYQELATESQHNEGVDNKESNAEE  309

Query  338   YPGCLAGESQAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMP  189
                    ESQ   D+  + D L LCD+++ S          D  N P   +  A   P  
Sbjct  310   GQKWWDSESQNLLDSQQLVDALSLCDDLLHSQSPSRDGKHEDHKNNPG-LSVYAQLGPEC  368

Query  188   QEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              + +       + D  N+E D++ EF L  L FGSQDS  SW
Sbjct  369   LKKDIEECQNLVNDPANIENDTSSEFRLSQLEFGSQDSFISW  410



>ref|XP_003518686.1| PREDICTED: NAC domain-containing protein 8 [Glycine max]
Length=436

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 167/400 (42%), Positives = 221/400 (55%), Gaps = 54/400 (14%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC H IDN DV+ EWPG P GVKF+PSD E++ HL AK G G+S+ H F+DEFI 
Sbjct  36    TKACPNCQHAIDNGDVAQEWPGLPKGVKFDPSDQEIIWHLLAKVGVGDSKSHPFIDEFIT  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             TLE D+GICYTHP+NLPG+++DGS+ HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  96    TLEVDDGICYTHPQNLPGVRQDGSASHFFHRAIKAYNTGTRKRRKILGQD---FGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG +EDEK+G Y++SK
Sbjct  153   KTGRTKPVVLSGVQKGCKKIMVLYVSNVRGGKAEKTNWVMHQYHLGTEEDEKDGEYIISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI---------------------PTTPMTAIPNPP---  474
             ++YQQQQ K    N  + D+P+A                      P TP    P PP   
Sbjct  213   VFYQQQQVKLGDKN--DQDVPEASEITGPHPGLSVGEEGTIEKVDPVTPKLVTPEPPCNG  270

Query  473   RAAGETPLSCDDYNAALSPPAEEVEGGKKE-------------RYGSLWSDVQVKCEEYP  333
             R   +  L  + +N    P  + ++  + +             ++     D +   E+  
Sbjct  271   RWCADLDLGQETHNVPQPPRMDCLDEIQADCQVLANESSMVETQHNEGMDDKENNAEDGQ  330

Query  332   GCLAGESQAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMPQE  183
                  ESQ   D+  + + L LCD+++ S          D  N P   +  A   P   +
Sbjct  331   KWWDSESQNLLDSQQLVEALSLCDDLLQSQSPSRDGKHEDHKNQPG-LSVYAQLGPEHLK  389

Query  182   ANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              +         +  N+E D+  EF L  L FGSQDS  SW
Sbjct  390   KDIEECQNLALNPANIENDTPSEFQLSQLEFGSQDSFISW  429



>gb|KHN05857.1| NAC domain-containing protein 8 [Glycine soja]
Length=436

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 167/400 (42%), Positives = 221/400 (55%), Gaps = 54/400 (14%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC H IDN DV+ EWPG P GVKF+PSD E++ HL AK G G+S+ H F+DEFI 
Sbjct  36    TKACPNCQHAIDNGDVAQEWPGLPKGVKFDPSDQEIIWHLLAKVGVGDSKSHPFIDEFIT  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             TLE D+GICYTHP+NLPG+++DGS+ HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  96    TLEVDDGICYTHPQNLPGVRQDGSASHFFHRAIKAYNTGTRKRRKILGQD---FGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG +EDEK+G Y++SK
Sbjct  153   KTGRTKPVVLSGVQKGCKKIMVLYVSNVRGGKAEKTNWVMHQYHLGTEEDEKDGEYIISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI---------------------PTTPMTAIPNPP---  474
             ++YQQQQ K    N  + D+P+A                      P TP    P PP   
Sbjct  213   VFYQQQQVKLGDKN--DQDVPEASEITGPHPGLSVGEEGTIEKVDPVTPKLVTPEPPCNG  270

Query  473   RAAGETPLSCDDYNAALSPPAEEVEGGKKE-------------RYGSLWSDVQVKCEEYP  333
             R   +  L  + +N    P  + ++  + +             ++     D +   E+  
Sbjct  271   RWCADLDLGQETHNVPQPPRMDCLDEIQADCQVLANESSMVETQHNEGMDDKENNAEDGQ  330

Query  332   GCLAGESQAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMPQE  183
                  ESQ   D+  + + L LCD+++ S          D  N P   +  A   P   +
Sbjct  331   KWWDSESQNLLDSQQLVEALSLCDDLLQSQSPSRDGKHEDHKNQPG-LSVYAQLGPEHLK  389

Query  182   ANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              +         +  N+E D+  EF L  L FGSQDS  SW
Sbjct  390   KDIEECQNLALNPANIENDTPSEFQLSQLEFGSQDSFISW  429



>ref|XP_009614316.1| PREDICTED: NAC domain-containing protein 8 isoform X3 [Nicotiana 
tomentosiformis]
Length=436

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 223/393 (57%), Gaps = 45/393 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC  +IDN+DVS +WPG P GVKF+P+D E++ HL  K G GN   H F+DEFIP
Sbjct  34    TKACPNCQFIIDNNDVSNDWPGLPRGVKFDPTDQEIIWHLLGKVGVGNWNSHPFIDEFIP  93

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D+GICYTHP+NLPG+++DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  94    TVDEDDGICYTHPQNLPGVQQDGSVSHFFHRAVKAYNTGTRKRRKIHGDN---FGDVRWH  150

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQYHLG  EDE+EG YVVSK
Sbjct  151   KTGRTKPVILDGIQRGCKKIMVLYVSPIKGGKAEKTNWVMHQYHLGTGEDEREGEYVVSK  210

Query  581   IYYqqqqqkQTTDNAGESDIPQ--------AIPTTPMTAIPNPP---------------R  471
             ++YQQQQQ +  +   E ++P+          P TP +  P PP                
Sbjct  211   VFYQQQQQVKQGEKI-EEELPEDSECLVAKVDPHTPKSVTPEPPCGERLSSSMDARQQIA  269

Query  470   AAGETPLS-------CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGES  312
             A+G  P++        +D   AL    E  +   + +     + V  +  + P     ES
Sbjct  270   ASGINPITQFHDVDYIEDDMRALPEQTENQDQIIENQIDETGTKVDNETGDDPKWWDSES  329

Query  311   QAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMPQEANNTSSS  162
             Q   D+  + + L LCD+++ S          D  N   + A  A   P   + +     
Sbjct  330   QYLLDSQQLVEGLSLCDDLLASQSPNRDGNENDKENSKPSLADYAQLGPEDLKKDLEECQ  389

Query  161   TNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
               + D  N+++D+ P+F L  L FGSQDS  +W
Sbjct  390   HLVLDPANIDMDTPPDFRLSQLDFGSQDSYIAW  422



>ref|XP_009614315.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Nicotiana 
tomentosiformis]
Length=436

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 223/393 (57%), Gaps = 45/393 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC  +IDN+DVS +WPG P GVKF+P+D E++ HL  K G GN   H F+DEFIP
Sbjct  34    TKACPNCQFIIDNNDVSNDWPGLPRGVKFDPTDQEIIWHLLGKVGVGNWNSHPFIDEFIP  93

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D+GICYTHP+NLPG+++DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  94    TVDEDDGICYTHPQNLPGVQQDGSVSHFFHRAVKAYNTGTRKRRKIHGDN---FGDVRWH  150

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQYHLG  EDE+EG YVVSK
Sbjct  151   KTGRTKPVILDGIQRGCKKIMVLYVSPIKGGKAEKTNWVMHQYHLGTGEDEREGEYVVSK  210

Query  581   IYYqqqqqkQTTDNAGESDIPQ--------AIPTTPMTAIPNPP---------------R  471
             ++YQQQQQ +  +   E ++P+          P TP +  P PP                
Sbjct  211   VFYQQQQQVKQGEKI-EEELPEDSECLVAKVDPHTPKSVTPEPPCGERLSSSMDARQQIA  269

Query  470   AAGETPLS-------CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGES  312
             A+G  P++        +D   AL    E  +   + +     + V  +  + P     ES
Sbjct  270   ASGINPITQFHDVDYIEDDMRALPEQTENQDQIIENQIDETGTKVDNETGDDPKWWDSES  329

Query  311   QAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMPQEANNTSSS  162
             Q   D+  + + L LCD+++ S          D  N   + A  A   P   + +     
Sbjct  330   QYLLDSQQLVEGLSLCDDLLASQSPNRDGNENDKENSKPSLADYAQLGPEDLKKDLEECQ  389

Query  161   TNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
               + D  N+++D+ P+F L  L FGSQDS  +W
Sbjct  390   HLVLDPANIDMDTPPDFRLSQLDFGSQDSYIAW  422



>ref|NP_564238.2| suppressor of gamma response 1 [Arabidopsis thaliana]
 sp|Q6NQK2.1|NAC8_ARATH RecName: Full=NAC domain-containing protein 8; Short=ANAC008 
[Arabidopsis thaliana]
 gb|AAQ62870.1| At1g25580 [Arabidopsis thaliana]
 dbj|BAD93935.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF00259.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30644.1| suppressor of gamma response 1 [Arabidopsis thaliana]
Length=449

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/435 (40%), Positives = 235/435 (54%), Gaps = 72/435 (17%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+ +AS+ ++ R  +     +R CP C H+IDNSDV  +WPG P GVKF+PSD E++ HL
Sbjct  16    KIMSASASSDPRQVVWKSNPSRHCPKCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGT
Sbjct  76    LAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKSDGTVSHFFHKAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMTA  489
             QYHLGI+EDEKEG YVVSKI+YQQ          + +++ +++   +  P A P TP  A
Sbjct  189   QYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKRGDKAEQEVSEDIFAAVTPTADPVTPKLA  248

Query  488   IPNPP---RAAGETPLSCD-----DYNAA--------------------LSPPAEE----  405
              P P    R   ++ ++ D     DY +A                    + P  E     
Sbjct  249   TPEPRNAVRICSDSHIASDYVTPSDYVSAHEVSLAETSEVMCMEDEVQSIQPNHERPSSG  308

Query  404   ------VEGGKKERYGSLW-----SDVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDE  261
                   +E G KE            D + + EE P      SQ   ++  + + L LCD+
Sbjct  309   PELEHGLENGAKEMLDDKEEQEKDRDNENQGEEDPTWFDSGSQFILNSQQLVEALSLCDD  368

Query  260   IVGSFD---------FNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFS  108
             ++GS D           +     A  A+  P   + +       + D  N+ELD+ PEF 
Sbjct  369   LLGSQDREENTNSGSLKDKQPCIADYAHLGPEDFKRDLEECQKIVLDPSNIELDTPPEFR  428

Query  107   LQDLPFGSQDSISSW  63
             L  L FGSQDS  +W
Sbjct  429   LSQLEFGSQDSFLAW  443



>ref|XP_009614314.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Nicotiana 
tomentosiformis]
Length=440

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 223/393 (57%), Gaps = 45/393 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNC  +IDN+DVS +WPG P GVKF+P+D E++ HL  K G GN   H F+DEFIP
Sbjct  38    TKACPNCQFIIDNNDVSNDWPGLPRGVKFDPTDQEIIWHLLGKVGVGNWNSHPFIDEFIP  97

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D+GICYTHP+NLPG+++DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  98    TVDEDDGICYTHPQNLPGVQQDGSVSHFFHRAVKAYNTGTRKRRKIHGDN---FGDVRWH  154

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQYHLG  EDE+EG YVVSK
Sbjct  155   KTGRTKPVILDGIQRGCKKIMVLYVSPIKGGKAEKTNWVMHQYHLGTGEDEREGEYVVSK  214

Query  581   IYYqqqqqkQTTDNAGESDIPQ--------AIPTTPMTAIPNPP---------------R  471
             ++YQQQQQ +  +   E ++P+          P TP +  P PP                
Sbjct  215   VFYQQQQQVKQGEKI-EEELPEDSECLVAKVDPHTPKSVTPEPPCGERLSSSMDARQQIA  273

Query  470   AAGETPLS-------CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGES  312
             A+G  P++        +D   AL    E  +   + +     + V  +  + P     ES
Sbjct  274   ASGINPITQFHDVDYIEDDMRALPEQTENQDQIIENQIDETGTKVDNETGDDPKWWDSES  333

Query  311   QAAADATDIDDFL-LCDEIVGSF---------DFNNLPSNHATSANFNPMPQEANNTSSS  162
             Q   D+  + + L LCD+++ S          D  N   + A  A   P   + +     
Sbjct  334   QYLLDSQQLVEGLSLCDDLLASQSPNRDGNENDKENSKPSLADYAQLGPEDLKKDLEECQ  393

Query  161   TNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
               + D  N+++D+ P+F L  L FGSQDS  +W
Sbjct  394   HLVLDPANIDMDTPPDFRLSQLDFGSQDSYIAW  426



>gb|AAG50527.1|AC084221_9 unknown protein [Arabidopsis thaliana]
Length=455

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/435 (40%), Positives = 235/435 (54%), Gaps = 72/435 (17%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+ +AS+ ++ R  +     +R CP C H+IDNSDV  +WPG P GVKF+PSD E++ HL
Sbjct  22    KIMSASASSDPRQVVWKSNPSRHCPKCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHL  81

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGT
Sbjct  82    LAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKSDGTVSHFFHKAIKAYSTGT  141

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  142   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  194

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMTA  489
             QYHLGI+EDEKEG YVVSKI+YQQ          + +++ +++   +  P A P TP  A
Sbjct  195   QYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKRGDKAEQEVSEDIFAAVTPTADPVTPKLA  254

Query  488   IPNPP---RAAGETPLSCD-----DYNAA--------------------LSPPAEE----  405
              P P    R   ++ ++ D     DY +A                    + P  E     
Sbjct  255   TPEPRNAVRICSDSHIASDYVTPSDYVSAHEVSLAETSEVMCMEDEVQSIQPNHERPSSG  314

Query  404   ------VEGGKKERYGSLW-----SDVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDE  261
                   +E G KE            D + + EE P      SQ   ++  + + L LCD+
Sbjct  315   PELEHGLENGAKEMLDDKEEQEKDRDNENQGEEDPTWFDSGSQFILNSQQLVEALSLCDD  374

Query  260   IVGSFD---------FNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFS  108
             ++GS D           +     A  A+  P   + +       + D  N+ELD+ PEF 
Sbjct  375   LLGSQDREENTNSGSLKDKQPCIADYAHLGPEDFKRDLEECQKIVLDPSNIELDTPPEFR  434

Query  107   LQDLPFGSQDSISSW  63
             L  L FGSQDS  +W
Sbjct  435   LSQLEFGSQDSFLAW  449



>gb|EMT06396.1| NAC domain-containing protein 8 [Aegilops tauschii]
Length=627

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 172/241 (71%), Gaps = 11/241 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGA--TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +KVRNA   +  +I + GA   RECPNC H+IDNSDV+ +WPG PAGVKF+PSD+ELLEH
Sbjct  14    KKVRNAHC-SNRQISEVGAEACRECPNCKHIIDNSDVAIQWPGLPAGVKFDPSDLELLEH  72

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G S+PHMF+DEFIPT+E D GICY+HPENLPG  KDGSS HFF+    AY  G
Sbjct  73    LEQKIGVGGSKPHMFIDEFIPTVENDAGICYSHPENLPGTNKDGSSAHFFHSISNAYGCG  132

Query  821   TRKRRKISN-ETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYS-TKKGEKPGKTNW  648
              RKRR+ISN + +   EHVRWHKTGK+K V +NGV KG KK++VLY  ++ G KP KT+W
Sbjct  133   QRKRRRISNSDRTTSDEHVRWHKTGKSKPVYDNGVMKGWKKILVLYKGSQTGGKPDKTDW  192

Query  647   VMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD------IPQAIPTTPMTAI  486
             VMHQYHLG++E+EK G +VVSKI+YQ + +      A  ++           P TPMT I
Sbjct  193   VMHQYHLGVEENEKVGEFVVSKIFYQLKTRPVDKSEAEMANEESTAFTASICPKTPMTKI  252

Query  485   P  483
             P
Sbjct  253   P  253



>gb|KDO70105.1| hypothetical protein CISIN_1g014310mg [Citrus sinensis]
Length=424

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 213/379 (56%), Gaps = 43/379 (11%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CPNCHH+IDNSDV+ EWPG P GVKF+PSD E++ HL AK G     PH F+DEFIP
Sbjct  36    TKACPNCHHVIDNSDVAHEWPGLPRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D GICYTHP+NLPG+K+DGS+ HFFYR  KAY+TGTRKRRKI+ +       VRWH
Sbjct  96    TVDQDGGICYTHPQNLPGVKQDGSAAHFFYRAIKAYSTGTRKRRKINGDD---FGEVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK VM +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG +EDEK+  YV+SK
Sbjct  153   KTGRTKPVMLDGVQKGCKKIMVLYMSMVRGGKAEKTNWVMHQYHLGTEEDEKDRDYVISK  212

Query  581   IYYqqqqqk---QTTDNAGESD---IPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALS  420
             I YQQQQ K   +   +  ES    IP+  P TP    P+PPR            +    
Sbjct  213   ISYQQQQAKYGDKIEQDILESTGAIIPKVDPVTPKLVTPDPPRTERHPDFGPRQESPTTD  272

Query  419   PPAEEVEGGKKERYGSL----WSDVQVKCEEYPGCLAG-----------------ESQAA  303
                ++ E    E    L     S+ +++ E +   + G                 ESQ  
Sbjct  273   AFDQQSEIRHVEEVQPLCENPGSNDKIEAENHANVMVGNNDNGSQAGDDSKWWDSESQNI  332

Query  302   ADATDIDDFL-LCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTN---------I  153
              D   + + L LC+E + S    N  +N  TS     +   A   S             +
Sbjct  333   LDTQQLAEALTLCEEFLNSQSDGN--ANDGTSKGKPGLSDYARLGSEHLKKDLEECQMLV  390

Query  152   ADLVNLELDSAPEFSLQDL  96
              D  N+ELD+ PEF L  L
Sbjct  391   HDPANIELDTPPEFGLSQL  409



>ref|XP_008389315.1| PREDICTED: NAC domain-containing protein 8 [Malus domestica]
Length=456

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 228/419 (54%), Gaps = 71/419 (17%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP C + +DNSDV+ EWPG P GVKF+P+D E++ HL AK G G+ +PH F+DEFI 
Sbjct  36    TKSCPKCQYTMDNSDVAQEWPGLPKGVKFDPTDQEIMWHLLAKSGVGDQKPHPFIDEFIL  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ DEGIC +HP  LP +K DGS  HFF+R  KAY TGTRKRRKI +        VRWH
Sbjct  96    TVDDDEGICCSHPRKLPNVKLDGSPSHFFHRAIKAYNTGTRKRRKIHDGDG--DGDVRWH  153

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQ+GCKK+MVLY ST  G KP KTNWVMHQYHLGI+EDEK+G YV+SK
Sbjct  154   KTGRTKPVILDGVQRGCKKIMVLYMSTVXGGKPVKTNWVMHQYHLGIEEDEKDGEYVISK  213

Query  581   IYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPNPPRA---AGETPLSCD--  441
             IYYQQQ+ KQ   +  + D+P++I        P TP  A P PPRA    G+  L  D  
Sbjct  214   IYYQQQEAKQA--DKTDQDVPESIDAVITKVDPVTPKXATPEPPRAERKLGDFXLGLDTP  271

Query  440   ----------------------DYNAALSPPAEEVEGGKKERYGSLWSD--VQVKCE---  342
                                   D ++AL     EV   +  R  S   D   Q K E   
Sbjct  272   APSRDPXLQYREEDGAEDEVRPDVDSALDEVHPEVNRAEDVRPESEIPDDYDQHKVENQA  331

Query  341   --------------EYPGCLAGESQAAADATDIDDFL-LCDEIVGSFDFN----------  237
                           E P     ESQ   D+  + + L LCDE++ S   N          
Sbjct  332   DEVINNTENIDHAQEDPKWWDNESQNLLDSQQLVEGLSLCDELLQSQSPNRGGHENGEQA  391

Query  236   NLPSNHATSANFNPMPQEANNTSSSTNIADLVN-LELDSAPEFSLQDLPFGSQDSISSW  63
             ++    A  A   P   + +  +    + D  N ++LD+ P+F L  L FGSQ+S  SW
Sbjct  392   HVKPRLADYAKLGPEDLKKDLEACQNIVLDPANIMDLDTPPDFRLSQLEFGSQESFLSW  450



>ref|XP_006378502.1| hypothetical protein POPTR_0010s13980g [Populus trichocarpa]
 gb|ERP56299.1| hypothetical protein POPTR_0010s13980g [Populus trichocarpa]
Length=302

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 164/233 (70%), Gaps = 13/233 (6%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPT  936
             + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL AK  +G  +PH F+ EFIPT
Sbjct  36    KTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVSDGGIKPHPFIKEFIPT  95

Query  935   LEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHK  756
             ++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWHK
Sbjct  96    VDNDDGICYTHPQNLPGVKQDGSISHFFHRAIKAYNTGTRKRRKIQGDN---FGDVRWHK  152

Query  755   TGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             TG+TK V+ +G+QKGCKK+MVLY ST +G K  KTNWVMHQYHLG  EDE++G YVVSKI
Sbjct  153   TGRTKPVILDGIQKGCKKIMVLYMSTVRGGKAEKTNWVMHQYHLGTSEDERDGEYVVSKI  212

Query  578   YYqqqqqkQTTDNAGESDIPQAI-----PTTPMTAIPNPPRAAGETPLSCDDY  435
             +YQQQ  K        S+I   +     P TP +  P+PPRA       C D+
Sbjct  213   FYQQQANKGEKPEEDLSEIVDDVVAKVDPVTPKSVTPDPPRAERR----CQDF  261



>gb|KFK44551.1| hypothetical protein AALP_AA1G271400 [Arabis alpina]
Length=458

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 181/443 (41%), Positives = 243/443 (55%), Gaps = 80/443 (18%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS+ ++ R  + +   +R CPNCHH+IDNSD   +WPG P GVKF+PSD E++ HL
Sbjct  17    KIKSASASSDPRQVVWNSNPSRHCPNCHHVIDNSDEVDDWPGLPRGVKFDPSDPEIIWHL  76

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT++ D+GICYTHP+NLPG+K DG+  HFF+R  KAY TGT
Sbjct  77    LAKTGLLGLSSHPFIDEFIPTVDQDDGICYTHPKNLPGVKHDGTVSHFFHRAIKAYNTGT  136

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++    +  VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  137   RKRRKIHDDD---IGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  189

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTD--NAGESDI---------PQAIPTTPMT  492
             QYHLG DEDEKEG YVVSKI+YQQ QQ+      + GE ++         P+A P TP  
Sbjct  190   QYHLGTDEDEKEGDYVVSKIFYQQPQQQAIAKQGDKGEQEVSEDIFSAMTPKADPVTPKL  249

Query  491   AIPNPPRAAGETPLS--CDDY----NAALSPPA------------EEVEG----------  396
               P P +A      S   DDY    N   +P              +EV+G          
Sbjct  250   FTPEPQQAVRLYSDSHFADDYATSHNYVTAPEISLAETSEAMYIEDEVQGIQRNPERPSS  309

Query  395   ------------GKKERYGSLW---------SDVQVKCEEYPGCL-AGESQAAADATDID  282
                         G + R   +           + + + EE P  L +G SQ   D+  + 
Sbjct  310   EDEPEPEPEPEPGIENRVSEMIDGNEDREKDKNDENQGEEDPNWLDSGGSQFILDSQQLV  369

Query  281   DFL-LCDEI--VGSFDFNN----LPSNHATSANFNPMPQE---ANNTSSSTNIADLVNLE  132
             + L LCD++  VGS +  N    L +     A++  +  E    +       + D  N+E
Sbjct  370   EALSLCDDLLQVGSQENTNNGGGLRNKQPCFADYAHLGTEDFKRDLEDCQKIVLDPSNIE  429

Query  131   LDSAPEFSLQDLPFGSQDSISSW  63
             LD+ PEF L  L FGSQ+S  +W
Sbjct  430   LDTPPEFRLSQLEFGSQESFLAW  452



>ref|XP_006307460.1| hypothetical protein CARUB_v10009087mg [Capsella rubella]
 gb|EOA40358.1| hypothetical protein CARUB_v10009087mg [Capsella rubella]
Length=457

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 177/444 (40%), Positives = 236/444 (53%), Gaps = 82/444 (18%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+ +AS+ ++ R  +     TR CPNC H+IDNSDV  +WPG P GVKF+PSD E++ HL
Sbjct  16    KIMSASAGSDPRQVVWKSNPTRHCPNCRHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGT
Sbjct  76    LAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++    +  VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---LGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMTA  489
             QYHLGI+EDEKEG YVVSKI+YQQ          + +++ ++    +  P+A P TP  A
Sbjct  189   QYHLGIEEDEKEGDYVVSKIFYQQPQQQVVKQGDKAEQEVSEEIFAATTPKADPVTPKLA  248

Query  488   IPNPPRA---------------------AGETPLS-------CDDYNAALSPPAEE----  405
              P P  A                     A E  L+        +D   ++ P  E     
Sbjct  249   TPEPRHAVRLCSASHIANDYVTPHSYVTAPEVSLAETSEVMYMEDEVQSIQPNHERPSSA  308

Query  404   ------------VEGGKKERYGSLW-----SDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                         +E G KE            D + + EE P      SQ   ++  + + 
Sbjct  309   DEPEPDPEPEHGLENGAKEIIDDKEEQDRDRDDEHQAEEEPTWFDSGSQFILNSQQLVEA  368

Query  275   L-LCDEI--VGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADL----------VNL  135
             L LCD++  VGS D     +N  +  N  P   +  +  +     DL           N+
Sbjct  369   LSLCDDLLQVGSQDREE-NTNSGSLKNKQPCFADYAHLGTEDFKRDLEECQKIVLDPSNI  427

Query  134   ELDSAPEFSLQDLPFGSQDSISSW  63
             ELD+ PEF L  L FGSQDS  +W
Sbjct  428   ELDTPPEFRLSQLEFGSQDSFLAW  451



>ref|XP_006378501.1| hypothetical protein POPTR_0010s13980g [Populus trichocarpa]
 gb|ERP56298.1| hypothetical protein POPTR_0010s13980g [Populus trichocarpa]
Length=423

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 161/222 (73%), Gaps = 9/222 (4%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPT  936
             + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL AK  +G  +PH F+ EFIPT
Sbjct  36    KTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVSDGGIKPHPFIKEFIPT  95

Query  935   LEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHK  756
             ++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWHK
Sbjct  96    VDNDDGICYTHPQNLPGVKQDGSISHFFHRAIKAYNTGTRKRRKIQGDN---FGDVRWHK  152

Query  755   TGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             TG+TK V+ +G+QKGCKK+MVLY ST +G K  KTNWVMHQYHLG  EDE++G YVVSKI
Sbjct  153   TGRTKPVILDGIQKGCKKIMVLYMSTVRGGKAEKTNWVMHQYHLGTSEDERDGEYVVSKI  212

Query  578   YYqqqqqkQTTDNAGESDIPQAI-----PTTPMTAIPNPPRA  468
             +YQQQ  K        S+I   +     P TP +  P+PPRA
Sbjct  213   FYQQQANKGEKPEEDLSEIVDDVVAKVDPVTPKSVTPDPPRA  254



>ref|XP_009356240.1| PREDICTED: NAC domain-containing protein 8-like [Pyrus x bretschneideri]
Length=455

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 173/245 (71%), Gaps = 19/245 (8%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP C H IDNSDV+ EWPG P GVKF+P+D E++ HL AK G G+ +PH F+DEFI 
Sbjct  36    TKACPKCQHTIDNSDVAQEWPGLPKGVKFDPTDQEIIWHLIAKSGVGDRKPHPFIDEFIL  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ DEGIC +HP  LP +K DGS+ HFF+R  KAY TGTRKRRKI +        VRWH
Sbjct  96    TVDDDEGICCSHPRKLPSVKLDGSASHFFHRAIKAYNTGTRKRRKIHDGDG----DVRWH  151

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQ+GCKK+MVLY ST +GEKP KTNWVMHQYHLG++EDEK+G YV+SK
Sbjct  152   KTGRTKPVILDGVQRGCKKIMVLYMSTVRGEKPVKTNWVMHQYHLGVEEDEKDGEYVISK  211

Query  581   IYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPNPPRAAGETPLSCDDYNAA  426
             IYYQQQ+ K+   +  + D+P++I        P TP    P PPRA  E  L   D++  
Sbjct  212   IYYQQQEGKEA--DKTDQDVPESIDAVITKVDPVTPKLVTPEPPRA--ERKLG--DFDLG  265

Query  425   LSPPA  411
             L  PA
Sbjct  266   LDTPA  270



>ref|XP_010477912.1| PREDICTED: NAC domain-containing protein 8 [Camelina sativa]
Length=455

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 235/441 (53%), Gaps = 78/441 (18%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+ +AS+ ++ R  +     TR CPNC H+IDNSDV  +WPG P GVKF+PSD E++ HL
Sbjct  16    KIMSASAGSDPRKVVWKSNPTRHCPNCRHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGT
Sbjct  76    LAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTD-NAGESDIPQAI---------PTTPMTA  489
             QYHLGI+EDEKEG YVVSKI+YQQ QQ      +  E ++ + I         P TP   
Sbjct  189   QYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKQGDKAEQEVSEEIFAVMNPTVDPVTPKMV  248

Query  488   IPNPPRAAGETPLS--CDDY----------NAALSPPAE------EVEGGKK--ERYGSL  369
              P P  A      S   +DY          + +L+  +E      EV+  +   ER  S 
Sbjct  249   TPEPQHAVQLCSDSHFANDYVTPHSYVTAQDVSLAETSEVMYMEDEVQSSQANLERPSSA  308

Query  368   WS---------------------------DVQVKCEEYPGCLAGESQAAADATDIDDFL-  273
             +                            D + + EE P      SQ   ++  + + L 
Sbjct  309   YEPEPEPEPGLENGAKETIDDKEEQEKDRDDENEAEEQPTWFDSGSQFILNSQQLVEALS  368

Query  272   LCDEI--VGSFDFN------NLPSNHATSANFNPMPQE---ANNTSSSTNIADLVNLELD  126
             LCD+I  VGS D        +L       A++  +  E    +       + D  N+ELD
Sbjct  369   LCDDILLVGSQDREENTNSGSLKDKQPCFADYAHLGTEDFKRDLEECQKIVLDPSNIELD  428

Query  125   SAPEFSLQDLPFGSQDSISSW  63
             + PEF L  L FGSQDS  +W
Sbjct  429   TPPEFRLSQLEFGSQDSFLAW  449



>ref|XP_010550156.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Tarenaya 
hassleriana]
Length=369

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 173/387 (45%), Positives = 219/387 (57%), Gaps = 43/387 (11%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NAS  +  +++DCGA  ECPNC H IDN +V   WPG P GVKFEP+D E++EHL 
Sbjct  14    RKVKNASVSSALQLKDCGAYIECPNCTHRIDNGNVLMPWPGLPKGVKFEPTDEEIIEHLE  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG   SEPH+ L+EFI  +  D GI YTHPENLPG  KDG S  FF++T +AY TG R
Sbjct  74    AKCGIDGSEPHVLLEEFIRAVTEDVGINYTHPENLPGANKDGVSVFFFHKTVQAYGTGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+I+  TS+  E VRWHKTG+TK VM NGVQKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  134   KRRRIT-PTSVNDEPVRWHKTGRTKHVMLNGVQKGCKKIMVLYKSARKGSKPEKSNWVLH  192

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI------PQAIPTTPMTAIP--  483
             QYHLG + +E  G YV+SK+ YQQQ+Q +      E          QA P TP T  P  
Sbjct  193   QYHLGTEGNEI-GEYVISKVMYQQQKQGEKNVEEEEVPEEGECSGAQASPRTPKTFTPAQ  251

Query  482   -NPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQA  306
               P  +      + DD    +    E +E   +  +GS                AGE+ A
Sbjct  252   LRPVSSIAGDEEAFDDTKMVV----EGLENIPEASFGS----------------AGETAA  291

Query  305   AADATDIDDFLLCDEIVGSFDFNNLPSNHATS--ANFNPMPQEANNTSSSTNIADLVNLE  132
               D       L C E + +    N P  +  S   N   +  E    S +  I+DL N +
Sbjct  292   VEDPD-----LKCKESIEASALWNNPEENPNSGLGNSQNVCGELEIGSGNFAISDLENAD  346

Query  131   LDSAPEFSLQDLPFGSQDSISSWLDRL  51
             L S PEF    L   SQDS+ +WL  L
Sbjct  347   LGSPPEF----LSLASQDSLLNWLGWL  369



>ref|XP_009770387.1| PREDICTED: NAC domain-containing protein 8 isoform X3 [Nicotiana 
sylvestris]
Length=440

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 221/398 (56%), Gaps = 50/398 (13%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP C  +IDN+DVS +WPG P GVKF+P+D E++ HL  K   G+   H F+DEFIP
Sbjct  33    TKACPKCQFIIDNNDVSNDWPGLPRGVKFDPTDQEIIWHLLGKVEVGSRSSHPFIDEFIP  92

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  93    TVDEDDGICYTHPQNLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKIHGDN---FGDVRWH  149

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQYHLG  EDE+EG YVVSK
Sbjct  150   KTGRTKPVILDGIQRGCKKIMVLYISPVKGGKAEKTNWVMHQYHLGTGEDEREGEYVVSK  209

Query  581   IYYqqqqqkQTTDNAGESDIPQ--------AIPTTPMTAIPNPPR---------------  471
             ++YQQQQQ +  D   E ++P+          P TP +  P PPR               
Sbjct  210   VFYQQQQQVKQGDKI-EQELPEDADYLVAKVDPHTPKSVTPEPPRGERISSSMDARQQIA  268

Query  470   AAGETPLS-------CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGES  312
             A+  +P +        +D   AL    E  +   + +     + V  +  + P     ES
Sbjct  269   ASSISPTTQYHDVDYTEDDMGALPYQTENQDQIIENQIDEDGTKVDNETGDDPKWWDSES  328

Query  311   QAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATSAN--------------FNPMPQEAN  177
             Q   D+  + + L LCD+++ S   N    ++ T  N                P   + +
Sbjct  329   QYLLDSQQLVEGLSLCDDLLASQSPNRDEHDNDTDKNKEKKCKPSLADYAQLGPEDLKKD  388

Query  176   NTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                    + D  N+++D+ P+F L  L FGSQDS  +W
Sbjct  389   LEECQHLVLDPANIDMDTPPDFRLSQLEFGSQDSYIAW  426



>ref|XP_009770386.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Nicotiana 
sylvestris]
Length=441

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 221/398 (56%), Gaps = 50/398 (13%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP C  +IDN+DVS +WPG P GVKF+P+D E++ HL  K   G+   H F+DEFIP
Sbjct  34    TKACPKCQFIIDNNDVSNDWPGLPRGVKFDPTDQEIIWHLLGKVEVGSRSSHPFIDEFIP  93

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  94    TVDEDDGICYTHPQNLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKIHGDN---FGDVRWH  150

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQYHLG  EDE+EG YVVSK
Sbjct  151   KTGRTKPVILDGIQRGCKKIMVLYISPVKGGKAEKTNWVMHQYHLGTGEDEREGEYVVSK  210

Query  581   IYYqqqqqkQTTDNAGESDIPQ--------AIPTTPMTAIPNPPR---------------  471
             ++YQQQQQ +  D   E ++P+          P TP +  P PPR               
Sbjct  211   VFYQQQQQVKQGDKI-EQELPEDADYLVAKVDPHTPKSVTPEPPRGERISSSMDARQQIA  269

Query  470   AAGETPLS-------CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGES  312
             A+  +P +        +D   AL    E  +   + +     + V  +  + P     ES
Sbjct  270   ASSISPTTQYHDVDYTEDDMGALPYQTENQDQIIENQIDEDGTKVDNETGDDPKWWDSES  329

Query  311   QAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATSAN--------------FNPMPQEAN  177
             Q   D+  + + L LCD+++ S   N    ++ T  N                P   + +
Sbjct  330   QYLLDSQQLVEGLSLCDDLLASQSPNRDEHDNDTDKNKEKKCKPSLADYAQLGPEDLKKD  389

Query  176   NTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                    + D  N+++D+ P+F L  L FGSQDS  +W
Sbjct  390   LEECQHLVLDPANIDMDTPPDFRLSQLEFGSQDSYIAW  427



>ref|XP_009770385.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Nicotiana 
sylvestris]
Length=444

 Score =   266 bits (681),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 221/398 (56%), Gaps = 50/398 (13%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             T+ CP C  +IDN+DVS +WPG P GVKF+P+D E++ HL  K   G+   H F+DEFIP
Sbjct  37    TKACPKCQFIIDNNDVSNDWPGLPRGVKFDPTDQEIIWHLLGKVEVGSRSSHPFIDEFIP  96

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T++ D+GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  97    TVDEDDGICYTHPQNLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKIHGDN---FGDVRWH  153

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +G+Q+GCKK+MVLY S  KG K  KTNWVMHQYHLG  EDE+EG YVVSK
Sbjct  154   KTGRTKPVILDGIQRGCKKIMVLYISPVKGGKAEKTNWVMHQYHLGTGEDEREGEYVVSK  213

Query  581   IYYqqqqqkQTTDNAGESDIPQ--------AIPTTPMTAIPNPPR---------------  471
             ++YQQQQQ +  D   E ++P+          P TP +  P PPR               
Sbjct  214   VFYQQQQQVKQGDKI-EQELPEDADYLVAKVDPHTPKSVTPEPPRGERISSSMDARQQIA  272

Query  470   AAGETPLS-------CDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGES  312
             A+  +P +        +D   AL    E  +   + +     + V  +  + P     ES
Sbjct  273   ASSISPTTQYHDVDYTEDDMGALPYQTENQDQIIENQIDEDGTKVDNETGDDPKWWDSES  332

Query  311   QAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATSAN--------------FNPMPQEAN  177
             Q   D+  + + L LCD+++ S   N    ++ T  N                P   + +
Sbjct  333   QYLLDSQQLVEGLSLCDDLLASQSPNRDEHDNDTDKNKEKKCKPSLADYAQLGPEDLKKD  392

Query  176   NTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                    + D  N+++D+ P+F L  L FGSQDS  +W
Sbjct  393   LEECQHLVLDPANIDMDTPPDFRLSQLEFGSQDSYIAW  430



>ref|XP_010551309.1| PREDICTED: NAC domain-containing protein 8 isoform X3 [Tarenaya 
hassleriana]
Length=451

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 171/255 (67%), Gaps = 19/255 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K  +ASS  +        TR CPNCHH+IDNSDV  +WPG P GVKF+PSD E++ HL A
Sbjct  11    KSASASSNPQKVAWKSNPTRHCPNCHHVIDNSDVVGDWPGLPRGVKFDPSDQEIIWHLQA  70

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G     PH F+DEFIPT++ D+GICYTHP+NLPG+K+DG   HFF+R+ KAY TGTRK
Sbjct  71    KVGLPGLRPHPFIDEFIPTVDEDDGICYTHPKNLPGVKQDGLVSHFFHRSIKAYNTGTRK  130

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQY  633
             RRKI ++       VRWHKTG+TK V+ +GVQKGCKK+MVLY    G K GKTNWVMHQY
Sbjct  131   RRKIHDDD---FGDVRWHKTGRTKPVIVDGVQKGCKKIMVLY----GGKSGKTNWVMHQY  183

Query  632   HLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI--------PQAIPTTPMTAIPNP  477
             HLG +EDEK+G YVVSKI+YQQQQQ        E+++        PQ  P TP    P P
Sbjct  184   HLGTEEDEKDGEYVVSKIFYQQQQQSVKQVGKAEAEVTEDIFAVTPQVDPVTPKLVTPEP  243

Query  476   PRAAGETPLSCDDYN  432
               A      +C D++
Sbjct  244   RHAE----RNCSDFH  254



>ref|XP_010551308.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Tarenaya 
hassleriana]
Length=458

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 171/255 (67%), Gaps = 19/255 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K  +ASS  +        TR CPNCHH+IDNSDV  +WPG P GVKF+PSD E++ HL A
Sbjct  18    KSASASSNPQKVAWKSNPTRHCPNCHHVIDNSDVVGDWPGLPRGVKFDPSDQEIIWHLQA  77

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G     PH F+DEFIPT++ D+GICYTHP+NLPG+K+DG   HFF+R+ KAY TGTRK
Sbjct  78    KVGLPGLRPHPFIDEFIPTVDEDDGICYTHPKNLPGVKQDGLVSHFFHRSIKAYNTGTRK  137

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQY  633
             RRKI ++       VRWHKTG+TK V+ +GVQKGCKK+MVLY    G K GKTNWVMHQY
Sbjct  138   RRKIHDDD---FGDVRWHKTGRTKPVIVDGVQKGCKKIMVLY----GGKSGKTNWVMHQY  190

Query  632   HLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI--------PQAIPTTPMTAIPNP  477
             HLG +EDEK+G YVVSKI+YQQQQQ        E+++        PQ  P TP    P P
Sbjct  191   HLGTEEDEKDGEYVVSKIFYQQQQQSVKQVGKAEAEVTEDIFAVTPQVDPVTPKLVTPEP  250

Query  476   PRAAGETPLSCDDYN  432
               A      +C D++
Sbjct  251   RHAE----RNCSDFH  261



>ref|XP_010551307.1| PREDICTED: NAC domain-containing protein 8 isoform X1 [Tarenaya 
hassleriana]
Length=462

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 178/271 (66%), Gaps = 22/271 (8%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K  +ASS  +        TR CPNCHH+IDNSDV  +WPG P GVKF+PSD E++ HL A
Sbjct  22    KSASASSNPQKVAWKSNPTRHCPNCHHVIDNSDVVGDWPGLPRGVKFDPSDQEIIWHLQA  81

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G     PH F+DEFIPT++ D+GICYTHP+NLPG+K+DG   HFF+R+ KAY TGTRK
Sbjct  82    KVGLPGLRPHPFIDEFIPTVDEDDGICYTHPKNLPGVKQDGLVSHFFHRSIKAYNTGTRK  141

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQY  633
             RRKI ++       VRWHKTG+TK V+ +GVQKGCKK+MVLY    G K GKTNWVMHQY
Sbjct  142   RRKIHDDD---FGDVRWHKTGRTKPVIVDGVQKGCKKIMVLY----GGKSGKTNWVMHQY  194

Query  632   HLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI--------PQAIPTTPMTAIPNP  477
             HLG +EDEK+G YVVSKI+YQQQQQ        E+++        PQ  P TP    P P
Sbjct  195   HLGTEEDEKDGEYVVSKIFYQQQQQSVKQVGKAEAEVTEDIFAVTPQVDPVTPKLVTPEP  254

Query  476   PRAAGETPLSCDDYN---AALSPPAEEVEGG  393
               A      +C D++    +++  A+  E G
Sbjct  255   RHAE----RNCSDFHFLTKSVTAHAQTAESG  281



>ref|XP_008361739.1| PREDICTED: NAC domain-containing protein 8-like [Malus domestica]
Length=456

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 173/251 (69%), Gaps = 19/251 (8%)
 Frame = -1

Query  1136  IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMF  957
             I     T+ CP C H IDNSDV+ EWPG P GVKF+P+D E++ HL AK G G+ +PH F
Sbjct  30    IWQSNPTKACPKCQHTIDNSDVAQEWPGLPKGVKFDPTDQEIIWHLIAKSGVGDRKPHPF  89

Query  956   LDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVM  777
             +DEFI  ++ DEGIC +HP  LP +K DGS+ HFF+R  KAY TGTRKRRKI +      
Sbjct  90    IDEFILXVDDDEGICCSHPRKLPSVKLDGSASHFFHRAIKAYNTGTRKRRKIHDGDG---  146

Query  776   EHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEG  600
               VRWHKTG+TK V+ +GVQ+GCKK+MVLY ST +G KP KTNWVMHQYHLG++EDEK+G
Sbjct  147   -DVRWHKTGRTKPVILDGVQRGCKKIMVLYMSTXRGGKPVKTNWVMHQYHLGVEEDEKDG  205

Query  599   GYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAIPNPPRAAGETPLSC  444
              YV+SKIYYQQQ+ K+   +  + D+P++I        P TP +  P PPRA  E  L  
Sbjct  206   EYVISKIYYQQQEAKEA--DKTDQDVPESIDAVITKVDPVTPKSVTPEPPRA--ERKLG-  260

Query  443   DDYNAALSPPA  411
              D++  L  PA
Sbjct  261   -DFDXXLDTPA  270



>ref|XP_011008576.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Populus 
euphratica]
Length=418

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 171/399 (43%), Positives = 219/399 (55%), Gaps = 65/399 (16%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPT  936
             + CPNCHH+IDNSDV  EWPG P GVKF+PSD E++ HL AK  +G  +PH F+ EFIPT
Sbjct  36    KTCPNCHHVIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVSDGGIKPHPFIKEFIPT  95

Query  935   LEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHK  756
             ++ D+GICYTHP+NLPG+K+DGS  HFF++  KAY TGTRKRRKI  +       VRWHK
Sbjct  96    VDNDDGICYTHPQNLPGVKQDGSISHFFHKAIKAYNTGTRKRRKIQADD---FGDVRWHK  152

Query  755   TGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             TG+TK V+ +G+QKGCKK+MVLY ST +G K  KTNWVMHQYHLG  EDE++G YVVSKI
Sbjct  153   TGRTKPVILDGIQKGCKKIMVLYMSTVRGGKAEKTNWVMHQYHLGTGEDERDGEYVVSKI  212

Query  578   YYqqqqqkQTTDNAGES---DIPQAI--------PTTPMTAIPNPPRA--------AGET  456
             ++QQQQ      N GE    D+ + +        P TP +  P+PPRA         G+ 
Sbjct  213   FFQQQQA-----NKGEKPEEDLSEIVDDVVAKVDPVTPKSVTPDPPRAERRCQDFEVGQE  267

Query  455   PLSCDDYNAALSPPAE--EVEGGKKERYGSLWSDVQVKCEEYPGCLAG------------  318
               S      A  P  E  EVE   +    S     Q++ E     + G            
Sbjct  268   STSICTDPCAQQPGIECLEVEDNLQHENPSYID--QLETENNVNDMVGDNDNCAGEERKW  325

Query  317   ---ESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATSAN----------FNPMPQEA  180
                ESQ   D+  + + L LC E + S   +     H T AN            P   + 
Sbjct  326   WDSESQQLLDSQQLVEGLSLCAEFLQSQSPDR--GGHGTEANGKTGLSDYALLGPEYLKK  383

Query  179   NNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
             +         D  N+ELD+ PEF L  L     DS ++W
Sbjct  384   DLEECQNLELDQANIELDTPPEFRLSQL-----DSSTAW  417



>ref|XP_004297143.1| PREDICTED: NAC domain-containing protein 8-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 171/239 (72%), Gaps = 10/239 (4%)
 Frame = -1

Query  1172  KVRNASSPAENRIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             K+R+AS+    RI+     TR CPNC + IDNSDVS EWPG P GVKF+P+D E++ HL 
Sbjct  16    KIRSASASDPGRIKWQSNPTRACPNCQYTIDNSDVSQEWPGLPKGVKFDPTDQEIIWHLL  75

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AK G G+  PH F+D FI   +GD+G+  +HP+ LPGIK+DGS  HFF+   KAY TGTR
Sbjct  76    AKTGAGDLRPHPFIDAFITDFDGDDGVLCSHPKKLPGIKQDGSVSHFFHVAIKAYNTGTR  135

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRRKI ++       +RWHKTG+TK V+ +GVQ+GCKK+MVLY ST KG K  KTNWVMH
Sbjct  136   KRRKIHDDD---YGDIRWHKTGRTKPVILDGVQRGCKKIMVLYTSTAKGGKAEKTNWVMH  192

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQ---TTDNAGESDIP--QAIPTTPMTAIPNP  477
             QYHLG DEDEKEG YV+SKIYYQQQQ KQ   T  N+ ES  P  QA P TP + IP+P
Sbjct  193   QYHLGTDEDEKEGEYVISKIYYQQQQVKQADKTDQNSPESSDPVIQADPVTPKSVIPDP  251



>ref|XP_006655990.1| PREDICTED: NAC domain-containing protein 8-like [Oryza brachyantha]
Length=414

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 171/403 (42%), Positives = 226/403 (56%), Gaps = 47/403 (12%)
 Frame = -1

Query  1172  KVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS   +   Q      T+ CP C+H+IDNSDV  +WPG P GVKF+P+D ELL HL
Sbjct  16    KIKNASVSVDPSKQKWVSNPTKACPKCNHIIDNSDVVHQWPGLPRGVKFDPTDQELLWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+  ++PH F++EFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TGT
Sbjct  76    LAKHGKVGAKPHPFIEEFIPTVEEDDGICYTHPQKLPGVKRDGSVSHFFHRTFKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+ +    +  VRWHKTGKTK V+ +G   GCKK+MVLY ST KG KP KTNWVM
Sbjct  136   RKRRKINTDD---LGDVRWHKTGKTKPVVVDGKHLGCKKIMVLYISTVKGGKPEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqq-------qqkQTTDNAGESDIPQAIPTTPMTAIP  483
             HQYHLG  EDE EG YVVSK++YQQQ        Q  T+  A ES + + +P  P   + 
Sbjct  193   HQYHLGTGEDEVEGQYVVSKLFYQQQFKPGEKNAQDITSAYALESIVTEDLPYIPPLPLE  252

Query  482   NPPRAAGETPLSCD--------------DYNAALSPPAEEVEGGKKERYGSLWSDVQVKC  345
                    E P   +              D NA     AE+V     E+      D     
Sbjct  253   EHVYTNQEVPEKSETITDQGKETSEINNDDNA-----AEDVVHMSTEKP----EDGDNPS  303

Query  344   EEYPGCLAGESQAAADATDI-DDFLLCDEIVGSFDFNNLPSNHATS-----ANFNPMPQE  183
              + P    GESQ   D+  + D+  +CDE + S    +   +         A +  +P+E
Sbjct  304   SQDPKWWEGESQFLFDSQQLADNLAICDEFLQSQSQTSCGGDEPDKIKPRLAVYAQLPKE  363

Query  182   ANNTS----SSTNIADLVNLELDSAPEFSLQDLPFGSQDSISS  66
                         + +D  N++LD+A EF L  + F SQDS ++
Sbjct  364   DLKKDLEECQKLDPSDSANVDLDNASEFRLSQIEF-SQDSFTT  405



>ref|XP_007222098.1| hypothetical protein PRUPE_ppa005648mg [Prunus persica]
 gb|EMJ23297.1| hypothetical protein PRUPE_ppa005648mg [Prunus persica]
Length=449

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 176/434 (41%), Positives = 235/434 (54%), Gaps = 70/434 (16%)
 Frame = -1

Query  1172  KVRNASSPAE-NRIQ-DCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS   +  RI+     TR CPNC + IDNSDV+ EWPG P GVKF+P+D E++ HL
Sbjct  16    KIKSASGTCDPERIKWQSNPTRACPNCQYTIDNSDVAQEWPGLPKGVKFDPTDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G  + + H F+DEFI T++ DEGIC +HP  LP +K+DGS+ HFF+R  KAY TGT
Sbjct  76    IAKSGAEDLKSHPFIDEFIITVDDDEGICCSHPHKLPSVKQDGSASHFFHRAIKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI +        VRWHKTG+TK VM +GVQ+GCKK+MVLY ST  G KP KTNWVM
Sbjct  136   RKRRKIHDGDG----DVRWHKTGRTKPVMLDGVQRGCKKIMVLYMSTVGGGKPKKTNWVM  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--------PTTPMTAI  486
             HQYHLG +EDEK+G YV+SKIYYQQQQ KQ   +  + DIP+          P TP +  
Sbjct  192   HQYHLGTEEDEKDGEYVISKIYYQQQQVKQA--DKTDQDIPEGFDLVITEVDPVTPKSVT  249

Query  485   PNPPRA---------AGETPLSC----------DDYNAALSPPAEEV-------------  402
             P PPR            +TP +           D+ +  +    +EV             
Sbjct  250   PEPPRTERKLADFDLGQDTPATSRDPFPQHHAEDEVHPKMDHAEDEVHPEMDHAEDEVHP  309

Query  401   EGGKKERYGS---------LWSDVQVKCEEYPGCLAGESQAAADATDIDDFL-LCDEIVG  252
             E  K + Y           + ++ +   +E P     ESQ   D+  + + L LCD+++ 
Sbjct  310   EIEKPDHYDQHNVENEADEVINNTENNAQEDPKWWDSESQNLLDSQQLVEGLSLCDDLLQ  369

Query  251   SFD------FNNLPS----NHATSANFNPMPQEANNTSSSTNIADLVNLEL-DSAPEFSL  105
             S         N  P+      A  A   P   + +       + D  N+ L D+ P+F L
Sbjct  370   SQSPIRTGHENGEPARVKPRLADYAKLGPENLKKDLEECQNIVLDPANIMLEDTPPDFRL  429

Query  104   QDLPFGSQDSISSW  63
               L FGSQ+S  SW
Sbjct  430   SQLEFGSQESFLSW  443



>ref|XP_010262846.1| PREDICTED: NAC domain-containing protein 8-like [Nelumbo nucifera]
Length=492

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 175/242 (72%), Gaps = 12/242 (5%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++AS+  + R        TR CP C+H+IDN+D++ +WPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASATCDPRNIKWKSNPTRACPKCNHIIDNNDITQQWPGLPRGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G    +PH F+DEFIPT++ D+GICYTHP+NLPG+K+DGS  HFF+R  +AY+TGT
Sbjct  76    LAKVGASGVKPHPFIDEFIPTVDEDDGICYTHPQNLPGVKQDGSVSHFFHRAIRAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI ++    +  VRWHKTG+TK V+ +GVQ+GCKK+MVLY S  +G KP KTNWVM
Sbjct  136   RKRRKILDDD---LGDVRWHKTGRTKPVILDGVQRGCKKIMVLYMSMARGGKPEKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGES-DIPQAI-----PTTPMTAIPN  480
             HQYHLG  EDEK+G +V+SKI+YQQQ ++       +  DI +AI     P TP +  P+
Sbjct  193   HQYHLGTGEDEKDGEFVISKIFYQQQAKQGDKIEGDQPLDIAEAIVAKVDPVTPKSVTPD  252

Query  479   PP  474
             PP
Sbjct  253   PP  254



>gb|AFN55266.1| NAC domain protein [Tamarix hispida]
Length=450

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 229/410 (56%), Gaps = 62/410 (15%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA----AKCGEGNSEPHMFLDE  948
             R CP C+H+IDNSDV+ +WPG P GVKF+PSD EL+  L+    AK G+G+ +PH F++E
Sbjct  37    RACPKCNHVIDNSDVTEDWPGLPRGVKFDPSDQELIWRLSGIYIAKSGQGDQKPHPFIEE  96

Query  947   FIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHV  768
             F+PTL+G++GICYTHP+NLPG+K+DGS+ HFF+R  KAY TGTRKRRKI ++       V
Sbjct  97    FVPTLDGEDGICYTHPQNLPGVKQDGSASHFFHRAVKAYNTGTRKRRKIQDDDHY---DV  153

Query  767   RWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYV  591
             RWHKTG+TK V     Q+GCKK+MVLY ST KG K  KTNWVMHQYHLG  E+EK+G +V
Sbjct  154   RWHKTGRTKPVFLGSEQRGCKKIMVLYASTVKGGKSEKTNWVMHQYHLGTGEEEKDGEFV  213

Query  590   VSKIYYqqqqqkQTTDNAG----ESDIPQAI-------PTTPMTAIPNP--PRAAGETP-  453
             +SK++YQQ QQ+   D+       +D+  AI       P TP + IP P   R +   P 
Sbjct  214   ISKVFYQQLQQQGKADDKNLESISNDVSVAIEAVGRVDPVTPKSVIPGPRTERRSSYEPR  273

Query  452   ----LSCDDYN--------AALSPPAEEVEGGKKERYGSLWSDVQVK------CEEYPGC  327
                 +SC D          A +  P  E  G + E       D + K        E    
Sbjct  274   EQPIVSCSDSVGQEHAIGLADIVQPEPERHGHEIESGPENHPDEEAKDPDNDEAGEDTNW  333

Query  326   LAGESQAAADATDIDDFL-LCDEIV--------------------GSFDFNNLPSNHATS  210
                +SQ   ++  + + L LCD+++                    G  D+  L + H  +
Sbjct  334   WDSQSQYLINSQQLVEGLSLCDDLLQSQSPNGDGNENAAVNNKKPGLSDYVRLGTEHFKN  393

Query  209   ANFNPMPQEANNTSSSTNIA-DLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                     + +++    N+  D  N+E+D+ P+F L  L FGSQDS  +W
Sbjct  394   DLRECQNLDKSDSQECQNLEFDPANIEIDTPPDFRLSQLEFGSQDSYVAW  443



>gb|KFK37625.1| hypothetical protein AALP_AA3G007500 [Arabis alpina]
Length=365

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 216/373 (58%), Gaps = 27/373 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  + ++I+DCGA  +CP C + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASVSSASQIKDCGAYVDCPRCSYRIDNSNVLAPWPGLPKGVKFEPADEDIIEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G S+PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++  +AY TG RK
Sbjct  75    KCGIGGSQPHVLIEEFIRPVTEDVGINYTHPKNLPGANKDGVSVFFFHKMVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T L  E VRWHKTG+TKAV  NG+Q+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTCLDEEPVRWHKTGRTKAVFLNGIQRGCKKIMVLYKSARKGSKPEKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG  E E+ G YVVSK+ YQQQ+  +  D  GES   ++ P TP T  P PPR     
Sbjct  194   YHLGT-EGEEIGDYVVSKVTYQQQKIVEVPDE-GESSGVRSGPRTPKTNTPQPPRPVDSL  251

Query  455   PLSCDDYNAALSPP-AEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDD  279
                 + ++  L  P  E +E   +     +WS      E+Y   L             +D
Sbjct  252   AGDEEAFDDKLFDPFGEGLENIPEAVLEKMWSKKARMEEDYVVNLN------------ED  299

Query  278   FLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQD  99
              L C+E   S + +++  N     N N             +I DL N +L + P+     
Sbjct  300   NLTCNE---SIEASSVWENQTLLPNPN---LGTIGEMDGFSITDLENADLGTPPDL----  349

Query  98    LPFGSQDSISSWL  60
             L   SQ+S+ +W 
Sbjct  350   LTLASQESLLNWF  362



>gb|KDO49049.1| hypothetical protein CISIN_1g0213532mg [Citrus sinensis]
Length=313

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 196/327 (60%), Gaps = 37/327 (11%)
 Frame = -1

Query  962  MFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSL  783
            MF+DEFIPT+EGD+GICYTHPENLPG KKDGSS HFF+RT  AYATG RKRRKI +E SL
Sbjct  1    MFIDEFIPTIEGDQGICYTHPENLPGAKKDGSSVHFFHRTTNAYATGQRKRRKIQSEHSL  60

Query  782  VMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEK  606
              EHVRWHKTGKTK V+ENG+QKGC+K+MVLY STKKG KP K+NWVMHQYHLG DEDEK
Sbjct  61   NEEHVRWHKTGKTKPVIENGIQKGCRKIMVLYKSTKKGTKPDKSNWVMHQYHLGTDEDEK  120

Query  605  EGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPN-PPRAAGET---------  456
            +  YVVSK++YQQ +Q        E ++   I   P   IP+  PR              
Sbjct  121  DDEYVVSKVFYQQTKQP-------EKNVDSPIIEVPDNLIPDSSPRTPLTNPPNPPRPGK  173

Query  455  PLSCDDY---NAALSPPAEEVEGGKKERYGSLWSDVQVKCEE---YPGCLAGESQAAADA  294
             + CDD    N   S   E +   +     S      VK E+   Y  CLAGES+   D 
Sbjct  174  SMVCDDVADDNTLKSSAQEPLHVAE----ASHVPQPAVKLEDDQGYITCLAGESE-PQDI  228

Query  293  TD------IDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE  132
             D       D  LLC E + S  F+ + +N + +  F+       N S+   IADL NLE
Sbjct  229  GDPGLDGIYDSLLLCKEDISSKVFSGV-NNVSYADIFHNAHHMKGNDSAPCGIADLENLE  287

Query  131  LDSAPEFSLQDLPFGSQDSISSWLDRL  51
             D+ P+  L DL F S +SI  WLDR+
Sbjct  288  FDTPPDSHLADLQF-SDESILGWLDRI  313



>emb|CDY20528.1| BnaC07g11950D [Brassica napus]
Length=461

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 169/262 (65%), Gaps = 26/262 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+  AS P    + +   TR CPNCHHLIDNS    +WPG P GVKF+PS+ E++ HL A
Sbjct  16    KILCASDPCRT-VWNTNPTRHCPNCHHLIDNSHEVDDWPGLPRGVKFDPSNPEIIWHLLA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G     PH F+DEFIPT++ D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TGTRK
Sbjct  75    KTGSLGLTPHPFIDEFIPTVDQDDGICYTHPKNLPGVKHDGTMSHFFHRAIKAYSTGTRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQY  633
             RRKI ++    +  VRWHKTG+TK V+ +GVQ+GCKK+MVLY  K      KTNWVMHQY
Sbjct  135   RRKIHDDD---LGDVRWHKTGRTKTVVLDGVQRGCKKIMVLYEGKS----VKTNWVMHQY  187

Query  632   HLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD----------------IPQAIPTT  501
             HLG DEDEK+G YVVSKI+YQQ QQ+      G+ D                 P+A P T
Sbjct  188   HLGTDEDEKDGEYVVSKIFYQQPQQQGVLKKGGDKDKAEEEVSEDIFAAATTTPKADPVT  247

Query  500   PMTAIPNPPRAAGETPLSCDDY  435
             P    P P R A   PL  D +
Sbjct  248   PRLFTPEPSRQA--VPLCSDSH  267



>ref|XP_002890682.1| ANAC008 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66941.1| ANAC008 [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 162/243 (67%), Gaps = 17/243 (7%)
 Frame = -1

Query  1163  NASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCG  984
             +ASS     +     TR CPNC H+IDNSDV  +WPG P GVKF+PSD E++ HL AK G
Sbjct  21    SASSDPRQVVWKSNPTRHCPNCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHLLAKSG  80

Query  983   EGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRK  804
                   H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGTRKRRK
Sbjct  81    LSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGTRKRRK  140

Query  803   ISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQYHLG  624
             I ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMHQYHLG
Sbjct  141   IHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMHQYHLG  193

Query  623   IDEDEKEGGYVVSKIYYqqqqqkQT-----TDNAGESDI-----PQAIPTTPMTAIPNPP  474
             I+EDEKEG YVVSKI+YQQ QQ         D     DI     P+A P TP  A P P 
Sbjct  194   IEEDEKEGDYVVSKIFYQQPQQLVVKQGDKVDQDVSEDIFAAMTPKADPVTPKLATPEPR  253

Query  473   RAA  465
              A 
Sbjct  254   HAV  256



>ref|XP_004135409.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus]
Length=475

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 162/224 (72%), Gaps = 12/224 (5%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             ++ CPNC H IDNSDV  EWPG P GVKF+PSD E++ HL AK G G S PH F+DEFIP
Sbjct  36    SKSCPNCQHTIDNSDVVQEWPGLPRGVKFDPSDQEIIWHLLAKVGIGGSRPHPFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+  D+GICYTHP+ LPG+K+DGS  HFF+R  KAY TGTRKRRKI+++       VRWH
Sbjct  96    TVFEDDGICYTHPQKLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKITDDD---FGDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY S  KG +  KTNWVMHQYHLG +EDE++G YV+SK
Sbjct  153   KTGRTKPVVIDGVQKGCKKIMVLYMSFAKGGRAEKTNWVMHQYHLGTEEDERDGEYVISK  212

Query  581   IYYqqqqqkQTTDNAGESDIPQAI------PTTPMTAIPNPPRA  468
             I++QQQ  KQ      E + P+ I      P TP +A P PPR 
Sbjct  213   IFHQQQNVKQG--EIIEQEAPEIIDTIKVDPHTPKSATPEPPRV  254



>gb|AAG50802.1|AC079281_4 hypothetical protein [Arabidopsis thaliana]
Length=276

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 163/243 (67%), Gaps = 17/243 (7%)
 Frame = -1

Query  1163  NASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCG  984
             +ASS     +     +R CP C H+IDNSDV  +WPG P GVKF+PSD E++ HL AK G
Sbjct  4     SASSDPRQVVWKSNPSRHCPKCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHLLAKSG  63

Query  983   EGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRK  804
                   H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGTRKRRK
Sbjct  64    LSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKSDGTVSHFFHKAIKAYSTGTRKRRK  123

Query  803   ISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQYHLG  624
             I ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMHQYHLG
Sbjct  124   IHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMHQYHLG  176

Query  623   IDEDEKEGGYVVSKIYYqq----------qqqkQTTDNAGESDIPQAIPTTPMTAIPNPP  474
             I+EDEKEG YVVSKI+YQQ          + +++ +++   +  P A P TP  A P P 
Sbjct  177   IEEDEKEGDYVVSKIFYQQPQQLVVKRGDKAEQEVSEDIFAAVTPTADPVTPKLATPEPR  236

Query  473   RAA  465
              A 
Sbjct  237   NAV  239



>ref|XP_006415888.1| hypothetical protein EUTSA_v10007551mg [Eutrema salsugineum]
 gb|ESQ34241.1| hypothetical protein EUTSA_v10007551mg [Eutrema salsugineum]
Length=467

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 165/245 (67%), Gaps = 20/245 (8%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS+ ++ R  +     TR CPNCHH+IDNS+   +WPG P GVKF+PSD E++ HL
Sbjct  16    KIKNASASSDPRQVVYSSNPTRHCPNCHHVIDNSNEVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TGT
Sbjct  76    LAKSGSSGLTSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHRAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESD-----------IPQAIPTTPMT  492
             QYHLG DEDEKEG YVVSKI+YQQ QQ+       + +            P+A P TP  
Sbjct  189   QYHLGTDEDEKEGDYVVSKIFYQQPQQQVAVKQGDKDEQEVSEDIFAAMTPKADPVTPKL  248

Query  491   AIPNP  477
               P P
Sbjct  249   FTPEP  253



>emb|CDY51128.1| BnaA07g37110D [Brassica napus]
Length=701

 Score =   266 bits (680),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 172/259 (66%), Gaps = 12/259 (5%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K+ +AS P    + +   TR CPNCHH+IDN     +WPG P GVKF+PSD E++ HL A
Sbjct  283   KILSASDPCPT-VWNTNPTRHCPNCHHVIDNGHEVDDWPGLPRGVKFDPSDPEIIWHLLA  341

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G     PH F+DEFIPT++ D+GICYTHP+NLPG+K DG+  HFF+R  KAY+TGTRK
Sbjct  342   KTGSLGLAPHPFIDEFIPTVDQDDGICYTHPKNLPGVKHDGTMSHFFHRAIKAYSTGTRK  401

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQY  633
             RRKI ++    +  +RWHKTG+TK V+ +GVQ+GCKK+MVLY  K      KTNWVMHQY
Sbjct  402   RRKIQDDD---LGDMRWHKTGRTKTVVLDGVQRGCKKIMVLYEGKS----VKTNWVMHQY  454

Query  632   HLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI--PTTPMTAIPNPPRAAGE  459
             HLG DEDEK+G YVVSKI+YQQQ   +   +  E ++ + I  P TP    P P R A  
Sbjct  455   HLGTDEDEKDGQYVVSKIFYQQQGVLKKGGDKAEEEVSEDIFDPVTPRLFTPEPSRQA--  512

Query  458   TPLSCDDYNAALSPPAEEV  402
              PL  D + A     A EV
Sbjct  513   VPLRSDSHFANDYVTAHEV  531



>ref|NP_001169606.1| uncharacterized protein LOC100383487 [Zea mays]
 gb|ACN34245.1| unknown [Zea mays]
Length=399

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 168/391 (43%), Positives = 234/391 (60%), Gaps = 21/391 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+R  +  A + I +    A RECPNC ++IDNSDV+ +WPG PAGVKF+PS++ELLEH
Sbjct  14    KKIRYTNPGASHHISELVAEARRECPNCSYIIDNSDVAMQWPGLPAGVKFDPSELELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G+S PH+ +DEFIPT++ DEGICY+HPENLPG+K DGS+ HFF+R  KAY  G
Sbjct  74    LEQKVGLGDSRPHVLIDEFIPTIDNDEGICYSHPENLPGMKTDGSNAHFFHRVSKAYGCG  133

Query  821   TRKRRKISN--ETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYS-TKKGEKPGKTN  651
              RKRR+  N  + ++  EHVRWHKTG++KA+ ENGV KG KK+MVLY  +++G KP + N
Sbjct  134   QRKRRRTINCSDHTVSDEHVRWHKTGRSKAIYENGVIKGWKKIMVLYKISQRGRKPDRAN  193

Query  650   WVMHQYHLGIDEDEKEGGYVVSKIYYq----qqqqkQTTDNAGESDIPQAI--PTTPMTA  489
             WVMHQYHLG +EDEK+G  VVSKI+ Q      +  +T     E   P ++  P TP T 
Sbjct  194   WVMHQYHLGEEEDEKDGELVVSKIFCQLPNKSMEISETETAYEEPGAPASVIGPKTPKTV  253

Query  488   IPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQ  309
              P  PR    +P  C+   +      + +  G+ E    + S            +A E Q
Sbjct  254   TPQ-PRHPKNSP--CETEQSIFILQDQLLLDGEDEPTMPIVSLADDAMNPAWCAVAEEEQ  310

Query  308   AAADA----TDIDDFLLCDEIVGSF-DFNNLPSNHATSANFNPMPQEANNTSSSTNIADL  144
                +A    ++ D+ LLC E   S  D   LP ++   +      +  +   +   + DL
Sbjct  311   VVGEASRAQSNSDEPLLCREDPNSLNDEALLPWDYPILSQCR--SEIFDRNLNGYGLPDL  368

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              N++L + P+  L D  FGSQ+S+ SWLDR+
Sbjct  369   HNVDLGTPPDLQLADFQFGSQESLGSWLDRI  399



>gb|AFT82664.1| NAC13 NAC type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW72128.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=399

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 168/391 (43%), Positives = 234/391 (60%), Gaps = 21/391 (5%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+R  +  A + I +    A RECPNC ++IDNSDV+ +WPG PAGVKF+PS++ELLEH
Sbjct  14    KKIRYTNPGANHHISELVAEARRECPNCSYIIDNSDVAMQWPGLPAGVKFDPSELELLEH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K G G+S PH+ +DEFIPT++ DEGICY+HPENLPG+K DGS+ HFF+R  KAY  G
Sbjct  74    LEQKVGLGDSRPHVLIDEFIPTIDNDEGICYSHPENLPGMKTDGSNAHFFHRVSKAYGCG  133

Query  821   TRKRRKISN--ETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYS-TKKGEKPGKTN  651
              RKRR+  N  + ++  EHVRWHKTG++KA+ ENGV KG KK+MVLY  +++G KP + N
Sbjct  134   QRKRRRTINCSDHTVSDEHVRWHKTGRSKAIYENGVIKGWKKIMVLYKISQRGRKPDRAN  193

Query  650   WVMHQYHLGIDEDEKEGGYVVSKIYYq----qqqqkQTTDNAGESDIPQAI--PTTPMTA  489
             WVMHQYHLG +EDEK+G  VVSKI+ Q      +  +T     E   P ++  P TP T 
Sbjct  194   WVMHQYHLGEEEDEKDGELVVSKIFCQLPNKSMEISETETAYEEPGAPASVIGPKTPKTV  253

Query  488   IPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQ  309
              P  PR    +P  C+   +      + +  G+ E    + S            +A E Q
Sbjct  254   TPQ-PRHPKNSP--CETEQSIFILQDQLLLDGEDEPTMPIVSLADDAMNPAWCAVAEEEQ  310

Query  308   AAADA----TDIDDFLLCDEIVGSF-DFNNLPSNHATSANFNPMPQEANNTSSSTNIADL  144
                +A    ++ D+ LLC E   S  D   LP ++   +      +  +   +   + DL
Sbjct  311   VVGEASRAQSNSDEPLLCREDPNSLNDEALLPWDYPILSQCR--SEIFDRNLNGYGLPDL  368

Query  143   VNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
              N++L + P+  L D  FGSQ+S+ SWLDR+
Sbjct  369   HNVDLGTPPDLQLADFQFGSQESLGSWLDRI  399



>ref|XP_010499089.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Camelina 
sativa]
Length=457

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 166/248 (67%), Gaps = 19/248 (8%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+ NAS+ ++ R  +     TR CPNC H+IDNSDV  +WPG P GVKF+PSD E++ HL
Sbjct  16    KIMNASAGSDPRQVVWKSNPTRHCPNCRHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGT
Sbjct  76    LAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTD-NAGESDI---------PQAIPTTPMTA  489
             QYHLGI+EDEKEG YVVSKI+YQQ QQ      +  E ++         P+  P TP   
Sbjct  189   QYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKQGDKAEQEVSEEIFAVMTPKVDPVTPKLV  248

Query  488   IPNPPRAA  465
              P P  A 
Sbjct  249   TPEPRDAV  256



>ref|NP_001146652.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|ACL54469.1| unknown [Zea mays]
 gb|AFW76917.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=413

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 169/406 (42%), Positives = 225/406 (55%), Gaps = 52/406 (13%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDC--GATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS  ++   Q      ++ECP C H+IDNSDV  +WPG P GVKF+PSD EL+ HL
Sbjct  16    KIKNASGSSDPSKQKWIGNPSKECPKCSHVIDNSDVVHQWPGLPKGVKFDPSDQELIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+   +PH F+DEFIPT+E DEGICYTHP+ LPG+K++GS  HFF+RT KAY TGT
Sbjct  76    MAKHGKSGIKPHPFIDEFIPTVEEDEGICYTHPQKLPGVKQNGSVSHFFHRTFKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRR+I+ + +     VRWHKTG TK V+ +G   GCKK+MVLY S  KG K  KTNWV+
Sbjct  136   RKRRRINTDDA----DVRWHKTGNTKPVLVDGKHLGCKKIMVLYISPLKGGKAEKTNWVI  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqq--------qqkQTTDN----AGESDIPQ--AIPT  504
             HQYHLG  EDE++G YVVSKI++QQQ        Q+  T+D+    A ES++P    +PT
Sbjct  192   HQYHLGTGEDERDGEYVVSKIFFQQQFKPRDKNAQELTTSDDLESMAAESNLPDFTTLPT  251

Query  503   -----TPMTAIPNPPRAAGETPLSCD---DYNAALSPPAEEVEGGK--KERYGSLWS-DV  357
                  T    + NP     +   +C+   +    L P  +  + G   + +   LW  D 
Sbjct  252   DKHVGTVQEVVHNPEHNLYQLNRNCEINIEETVVLPPSVKTTKDGDNLQSQDQKLWEGDS  311

Query  356   QVKCEEYPGCLAGESQAAADATDIDDFLLCDEIV----GSFDFNNLPS----NHATSANF  201
             Q +       L    Q A      D+FLL         G       P      H ++ +F
Sbjct  312   QFE-------LLDSQQLAEGLALCDEFLLSQSQTSCGGGDEPRETKPCLAAYAHLSAEDF  364

Query  200   NPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQDSISSW  63
                 +E      + N     NLELD+  EF L  + F SQDS  +W
Sbjct  365   KKDLEECQRLEPTDN----TNLELDNTDEFRLSQIEF-SQDSFMTW  405



>ref|XP_010550157.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Tarenaya 
hassleriana]
Length=354

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 165/367 (45%), Positives = 209/367 (57%), Gaps = 39/367 (11%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV+NAS  +  +++DCGA  ECPNC H IDN +V   WPG P GVKFEP+D E++EHL 
Sbjct  14    RKVKNASVSSALQLKDCGAYIECPNCTHRIDNGNVLMPWPGLPKGVKFEPTDEEIIEHLE  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG   SEPH+ L+EFI  +  D GI YTHPENLPG  KDG S  FF++T +AY TG R
Sbjct  74    AKCGIDGSEPHVLLEEFIRAVTEDVGINYTHPENLPGANKDGVSVFFFHKTVQAYGTGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+I+  TS+  E VRWHKTG+TK VM NGVQKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  134   KRRRIT-PTSVNDEPVRWHKTGRTKHVMLNGVQKGCKKIMVLYKSARKGSKPEKSNWVLH  192

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI------PQAIPTTPMTAIP--  483
             QYHLG + +E  G YV+SK+ YQQQ+Q +      E          QA P TP T  P  
Sbjct  193   QYHLGTEGNEI-GEYVISKVMYQQQKQGEKNVEEEEVPEEGECSGAQASPRTPKTFTPAQ  251

Query  482   -NPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQA  306
               P  +      + DD    +    E +E   +  +GS                AGE+ A
Sbjct  252   LRPVSSIAGDEEAFDDTKMVV----EGLENIPEASFGS----------------AGETAA  291

Query  305   AADATDIDDFLLCDEIVGSFDFNNLPSNHATS--ANFNPMPQEANNTSSSTNIADLVNLE  132
               D       L C E + +    N P  +  S   N   +  E    S +  I+DL N +
Sbjct  292   VEDPD-----LKCKESIEASALWNNPEENPNSGLGNSQNVCGELEIGSGNFAISDLENAD  346

Query  131   LDSAPEF  111
             L S PEF
Sbjct  347   LGSPPEF  353



>ref|XP_010227769.1| PREDICTED: NAC domain-containing protein 8 [Brachypodium distachyon]
Length=481

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 6/203 (3%)
 Frame = -1

Query  1172  KVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++N S   +   Q      T+ECP C H+IDNSDV  +WPG P GVKF+PSD ELL HL
Sbjct  16    KIKNVSGSMDLSKQKWVSNPTKECPRCSHIIDNSDVVHQWPGLPKGVKFDPSDQELLSHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK  +  +EPH F+DEFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TGT
Sbjct  76    LAKHDKAGAEPHPFIDEFIPTVEEDDGICYTHPQKLPGLKQDGSVSHFFHRTYKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRR+I+      +  VRWHKTGKTK VM +G   GCKK+MVLY ST KG KP KTNWVM
Sbjct  136   RKRRRINTGD---LADVRWHKTGKTKPVMVDGKHLGCKKIMVLYMSTVKGGKPKKTNWVM  192

Query  641   HQYHLGIDEDEKEGGYVVSKIYY  573
             HQYHLG  EDE+ G YVVSK+++
Sbjct  193   HQYHLGTGEDEQNGEYVVSKLFF  215



>gb|KHN37822.1| NAC domain-containing protein 8, partial [Glycine soja]
Length=451

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 211/373 (57%), Gaps = 40/373 (11%)
 Frame = -1

Query  1076  DVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPE  897
             +V+ EWPG P GVKF+PSD E++ HL AK G GNS+PH F+DEFI +LE D+GICYTHP+
Sbjct  77    EVAQEWPGLPLGVKFDPSDQEIIWHLLAKVGAGNSKPHPFIDEFITSLEVDDGICYTHPQ  136

Query  896   NLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQ  717
             +LPG+K+DGS+ H F+R  KAY TG+RKRRKI  +       VRWHKTG+TK V+ NGVQ
Sbjct  137   HLPGVKQDGSASHLFHRAIKAYNTGSRKRRKICGQD---FGDVRWHKTGRTKPVILNGVQ  193

Query  716   KGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDN  540
             KGCKK+MVLY S  +G KP KTNWVMHQYHLG +EDEK+G YV+SK++YQQQQ K     
Sbjct  194   KGCKKIMVLYISPVRGGKPEKTNWVMHQYHLGTEEDEKDGEYVISKVFYQQQQVKF--GE  251

Query  539   AGESDIPQAI--------PTTPMTAIPNPPRAAGE---TPLSCDDYNAALSPPAEEVEGG  393
              G+ DIP+          P TP +  P PPR         L  + ++    P  + +E  
Sbjct  252   KGDQDIPEITEATTVKVDPVTPKSVTPEPPRIENRWSNLDLGQESHHIPQHPQTDCLEDL  311

Query  392   KKERYGSLWSDVQV--------------KCEEYPGCLAGESQAAADATD-IDDFLLCDEI  258
             + +       D+ +                EE       ESQ    +   ++   LCD++
Sbjct  312   QADCEDLAKDDLLIVETENNEGIDNIENNAEEDSKWWDSESQNLLSSQQLVEALFLCDDL  371

Query  257   VGSF-------DFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAP-EFSLQ  102
             + S        + +  PS+ +  AN  P   + +       + D  N+  ++ P EF L 
Sbjct  372   LQSQSPKRDGENEHKKPSSLSVYANLGPEHLKKDIEECQNLVLDTANVVPETPPSEFQLS  431

Query  101   DLPFGSQDSISSW  63
              L F SQDS  SW
Sbjct  432   QLDFSSQDSFVSW  444



>gb|ABR16510.1| unknown [Picea sitchensis]
Length=395

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 219/400 (55%), Gaps = 49/400 (12%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             K++N +   EN      A   CPNC++ ID+S V+ EWPG PAGVKF+PS+ +LL HLAA
Sbjct  15    KIKNPTQIIENENGRNDANIACPNCNYQIDDSHVTQEWPGLPAGVKFDPSEEQLLRHLAA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             K G GN+ PH  +++FI TLE  +GICYTHPENLPG+K+DGS  HFF+RT KAY TGTRK
Sbjct  75    KVGIGNARPHSLINDFILTLEEVDGICYTHPENLPGVKQDGSYSHFFHRTTKAYTTGTRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVL-YSTKKGEKPGKTNWVMHQ  636
             RR+I        +  RWHKTG TK V ENG Q GCKK+M L  ++ KG KP KTNWVMHQ
Sbjct  135   RRRI--------DKFRWHKTGSTKKVYENGEQIGCKKIMGLEMTSAKGSKPEKTNWVMHQ  186

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTP-------MTAIPNP  477
             YHLG ++DEKEG +VVSKI Y+            +S IPQ    T              P
Sbjct  187   YHLGTEDDEKEGEFVVSKIKYKT-----------DSGIPQEDAGTSNGKGDPPTPTTSTP  235

Query  476   PRAAGETPLSCDD------YNAALSPPAEEVEGG--KKERYGSLWSDVQVKCEEYPGCLA  321
             P+   E   +C D         A SP A +++    +  +      D Q    +      
Sbjct  236   PQPPPEKQYTCFDRIEEEHLFCASSPQAADLDATIHRPSKPNETECDGQTYLPDATSLWV  295

Query  320   GESQAAADATD-IDDFLLCDEIV-------GSFDFNNLPS-NHATSANFNPMPQEANNTS  168
             GESQ   D+ + +     C EI+        +   NN+P  +       N + +E + +S
Sbjct  296   GESQYFEDSQEQMVGLFSCQEILENQSCQENAEGTNNIPGLSDCGRIGGNTLGKEMHQSS  355

Query  167   SSTNIADLVNLELDSAPEFSLQDLP-FGSQDSISSWLDRL  51
                   DL N++ D+ P+  + D   FGSQ+S+S WL+  
Sbjct  356   ----YCDLENIDFDTPPDGPILDYSQFGSQESLSGWLNNF  391



>ref|XP_010932620.1| PREDICTED: NAC domain-containing protein 8 isoform X2 [Elaeis 
guineensis]
Length=361

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/359 (44%), Positives = 217/359 (60%), Gaps = 30/359 (8%)
 Frame = -1

Query  1073  VSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPEN  894
             V  EWPG P GVKF+PSD ELL HL AK G+G+++PH F++EFIPT+E  +GICYTHP+ 
Sbjct  4     VVQEWPGLPRGVKFDPSDQELLWHLLAKVGQGDAKPHPFINEFIPTVEEGDGICYTHPQK  63

Query  893   LPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQK  714
             LPG+K+DGS  HFF+RT KAY TGTRKRRKI+++    +  VRWHKTGKTK V+ +G  +
Sbjct  64    LPGVKQDGSVSHFFHRTFKAYNTGTRKRRKINSDD---LGDVRWHKTGKTKPVIMDGKHQ  120

Query  713   GCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNA  537
             GCKK+MVLY ST KGEKP KTNWVMHQYHLG  EDEK+G YVVSKI+Y  QQQ +  D  
Sbjct  121   GCKKIMVLYMSTIKGEKPEKTNWVMHQYHLGTGEDEKDGEYVVSKIFY--QQQSKPGDKN  178

Query  536   GES---DIPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLW  366
             G+    +I +A+    +  + NP   + E  +   D   +    +++V+   + R     
Sbjct  179   GQDLTLEIVEAV-VAEVDPVANPKSVSSECHVGKQDPAHSPEQTSDQVKMYHENRVEE--  235

Query  365   SDVQVKCEEY-------PGCLA---GESQAAADATDI-DDFLLCDEIV---GSFDFNNLP  228
              +  ++CE++        G L    GESQ   D+  + +   +CDE +    S   +   
Sbjct  236   HNAPLECEKFDDQDNHPTGDLKWWEGESQFLLDSQQLAEGIAICDEFLLSQSSCGGDEAK  295

Query  227   SNHATSANFNPMPQE--ANNTSSSTNIA--DLVNLELDSAPEFSLQDLPFGSQDSISSW  63
              +    +++  M  E    +  +  N++  D  N+ELD   +F L  L FGSQDS  +W
Sbjct  296   KSRPRLSDYAHMGAEDLKKDLEACQNLSNYDRSNIELDPPQDFRLSQLEFGSQDSFLAW  354



>gb|EPS60726.1| hypothetical protein M569_14078, partial [Genlisea aurea]
Length=230

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 153/204 (75%), Gaps = 7/204 (3%)
 Frame = -1

Query  1172  KVRNASS---PAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             K+R+AS    P E   +    T+ CP+C ++IDNSDV   WPG P GVKF+PSD E++ H
Sbjct  19    KIRSASGSLDPGEINWKS-NPTKPCPSCQYVIDNSDVIEVWPGLPRGVKFDPSDQEIIWH  77

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L AK G+ N +PH F+DEFIPT+E ++GICYTHP+NLPG+K+DGS+ HFF+R  KAYATG
Sbjct  78    LLAKVGDDNLKPHPFIDEFIPTVEEEDGICYTHPQNLPGVKQDGSASHFFHRAVKAYATG  137

Query  821   TRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWV  645
             TRKRRKI          VRWHKTG+TK V  +G+QKGCKK+MVLY S+ KG K  KTNWV
Sbjct  138   TRKRRKIQGIED--TGDVRWHKTGRTKPVNLDGLQKGCKKIMVLYLSSAKGGKAEKTNWV  195

Query  644   MHQYHLGIDEDEKEGGYVVSKIYY  573
             MHQYHLG  EDE++G YV+SK++Y
Sbjct  196   MHQYHLGTGEDERDGEYVISKVFY  219



>ref|XP_010499091.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Camelina 
sativa]
Length=440

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 164/245 (67%), Gaps = 19/245 (8%)
 Frame = -1

Query  1163  NASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAK  990
             NAS+ ++ R  +     TR CPNC H+IDNSDV  +WPG P GVKF+PSD E++ HL AK
Sbjct  2     NASAGSDPRQVVWKSNPTRHCPNCRHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHLLAK  61

Query  989   CGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKR  810
              G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGTRKR
Sbjct  62    SGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGTRKR  121

Query  809   RKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQYH  630
             RKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMHQYH
Sbjct  122   RKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMHQYH  174

Query  629   LGIDEDEKEGGYVVSKIYYqqqqqkQTTD-NAGESDI---------PQAIPTTPMTAIPN  480
             LGI+EDEKEG YVVSKI+YQQ QQ      +  E ++         P+  P TP    P 
Sbjct  175   LGIEEDEKEGDYVVSKIFYQQPQQLVVKQGDKAEQEVSEEIFAVMTPKVDPVTPKLVTPE  234

Query  479   PPRAA  465
             P  A 
Sbjct  235   PRDAV  239



>ref|XP_010460359.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Camelina 
sativa]
Length=459

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 150/202 (74%), Gaps = 9/202 (4%)
 Frame = -1

Query  1172  KVRNASSPAENR--IQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+ +AS+ ++ R  +     TR CPNC H+IDNSDV  EWPG P GVKF+PSD E++ HL
Sbjct  16    KIMSASAGSDPRQVVWKSNPTRHCPNCRHVIDNSDVVDEWPGLPRGVKFDPSDPEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGT
Sbjct  76    LAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYY  573
             QYHLGI+EDEKEG YVVSKI+Y
Sbjct  189   QYHLGIEEDEKEGDYVVSKIFY  210



>gb|EYU22627.1| hypothetical protein MIMGU_mgv1a0074222mg, partial [Erythranthe 
guttata]
Length=278

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 158/225 (70%), Gaps = 14/225 (6%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             ++ CPNC ++IDNSDV+  WPG P GVKF+P+D E++ HL AK G  N  PH F+DEFIP
Sbjct  36    SKSCPNCQYVIDNSDVAHAWPGLPRGVKFDPTDQEIIWHLIAKAGVENLTPHAFIDEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+   +GICYTHP+NLPG+K+DGS  HFF+R  KAY TGTRKRRKI  +       VRWH
Sbjct  96    TVHESDGICYTHPQNLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKIHGDDC---GDVRWH  152

Query  758   KTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSK  582
             KTG+TK V+ +GVQKGCKK+MVLY S  +G K  KTNWVMHQYHLG  EDE EG YV+SK
Sbjct  153   KTGRTKPVLLDGVQKGCKKIMVLYISPVRGGKAEKTNWVMHQYHLGTGEDEMEGEYVISK  212

Query  581   IYY---------qqqqqkQTTDNAGESDIPQAI-PTTPMTAIPNP  477
             ++Y          ++ +++  DN  +++I   + P TP +A P P
Sbjct  213   VFYQQQQQQVKVIEKSEEEEEDNISDNNIIAKVDPVTPKSATPEP  257



>gb|AIZ68167.1| NAC domain-containing protein 8 isoform X2 [Galtonia saundersiae]
Length=449

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 151/197 (77%), Gaps = 5/197 (3%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             ++ CP C+++IDNSDV  EWPG P GVKF+PSD ELL HL AK G GN   H F++EFIP
Sbjct  36    SKACPKCNYIIDNSDVVQEWPGLPQGVKFDPSDQELLGHLLAKVGRGNVRVHPFINEFIP  95

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNE----TSLVMEH  771
             T+E D+GICYTHP+ LPG+K DGS  HFF+RT KAY +GTRKRRKI  +    T  +   
Sbjct  96    TVEEDDGICYTHPQKLPGVKFDGSISHFFHRTYKAYNSGTRKRRKIQRDEHEITGGLSGD  155

Query  770   VRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGGY  594
             VRWHKTGKTK V+ +GV  GCKK+MVLYS+ KKG KP KTNWVMHQYHLG  EDEK+G +
Sbjct  156   VRWHKTGKTKPVLIDGVHVGCKKIMVLYSSLKKGGKPEKTNWVMHQYHLGTGEDEKDGEF  215

Query  593   VVSKIYYqqqqqkQTTD  543
             VVSKI+YQQQQ  + +D
Sbjct  216   VVSKIFYQQQQFLKPSD  232



>ref|XP_010460360.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Camelina 
sativa]
Length=442

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 140/182 (77%), Gaps = 7/182 (4%)
 Frame = -1

Query  1118  TRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIP  939
             TR CPNC H+IDNSDV  EWPG P GVKF+PSD E++ HL AK G      H F+DEFIP
Sbjct  19    TRHCPNCRHVIDNSDVVDEWPGLPRGVKFDPSDPEIIWHLLAKSGLSGLSSHPFIDEFIP  78

Query  938   TLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWH  759
             T+  D+GICYTHP+NLPG+K DG+  HFF++  KAY+TGTRKRRKI ++       VRWH
Sbjct  79    TVNQDDGICYTHPKNLPGVKNDGTVSHFFHKAIKAYSTGTRKRRKIHDDD---FGDVRWH  135

Query  758   KTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             KTG+TK V+ +GVQ+GCKK+MVLY    G K  KTNWVMHQYHLGI+EDEKEG YVVSKI
Sbjct  136   KTGRTKPVVLDGVQRGCKKIMVLY----GGKAVKTNWVMHQYHLGIEEDEKEGDYVVSKI  191

Query  578   YY  573
             +Y
Sbjct  192   FY  193



>ref|XP_006653523.1| PREDICTED: NAC domain-containing protein 8-like [Oryza brachyantha]
Length=357

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 170/258 (66%), Gaps = 9/258 (3%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDC--GATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+RNA+     ++ D   GA RECPNC   IDNSDV+ +WP FP GVKF+PSD+ELL HL
Sbjct  16    KIRNATQLLSCKLGDLVPGAWRECPNCKCHIDNSDVTLQWPEFPDGVKFDPSDIELLGHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
               K   GN  P   +D FIPTLE  EGICYTHPENLPGIK DGSS HFF+R   AY +G 
Sbjct  76    EKKINLGN--PQGLIDHFIPTLEEVEGICYTHPENLPGIKMDGSSSHFFHRISNAYGSGQ  133

Query  818   RKRRKISNET-SLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVM  642
             RKRRKIS+   S   E++RWHKTGK+K +  NGV+KG KK++VLY   K +K  + NWVM
Sbjct  134   RKRRKISHHKHSASDENIRWHKTGKSKEIYHNGVKKGWKKILVLYKGSKRDKIEQANWVM  193

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTT---DNAGESDIPQAIPTTPMTAIPNPPR  471
             HQY+LG++EDEK G +VV K+++Q   ++  T   D+  E+     + + P+T I NPP+
Sbjct  194   HQYNLGVEEDEKNGEFVVCKVFFQSSSKQTCTPEMDSVTETSDALTVRSDPITPITNPPQ  253

Query  470   AAGETPLSCD-DYNAALS  420
                     CD + N  +S
Sbjct  254   PLYPVNSPCDTEQNVTIS  271



>gb|EPS68229.1| hypothetical protein M569_06541, partial [Genlisea aurea]
Length=295

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 9/203 (4%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             +KV++A  P   +I+DCGA R CPNCH+LIDNSDVS +WPG PAGVKF+PSDVELL+HLA
Sbjct  15    KKVKDAGLPQAYQIKDCGANRRCPNCHYLIDNSDVSDDWPGLPAGVKFDPSDVELLDHLA  74

Query  995   AK-CGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
             AK  G  + +PH+F+DEFIPT++GDEGICYTHPE LPG KKDGSS HFF++   AY +G 
Sbjct  75    AKHGGSEDLDPHVFIDEFIPTIDGDEGICYTHPEKLPGAKKDGSSIHFFHKISNAYGSGP  134

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVME-NGVQKGCKKVMVLY----STKKGEKPGKT  654
             RKRR+I+ + S+V   VRWHKTG+TK + + NG  +G KK+MVLY          KP + 
Sbjct  135   RKRRRINGQESVV---VRWHKTGRTKPIADSNGNLRGFKKIMVLYSSSKGGGGRSKPDRC  191

Query  653   NWVMHQYHLGIDEDEKEGGYVVS  585
             NWVMHQYH+G  EDE  G YV S
Sbjct  192   NWVMHQYHIGKSEDESTGEYVPS  214



>gb|EAZ00449.1| hypothetical protein OsI_22469 [Oryza sativa Indica Group]
Length=464

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 165/402 (41%), Positives = 222/402 (55%), Gaps = 41/402 (10%)
 Frame = -1

Query  1172  KVRNASSP--AENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS    A         T+ CP C+H+IDNSDV  +WPG P GVKF+P+D ELL HL
Sbjct  62    KIKNASGSVDASKHKWVSNPTKACPRCNHIIDNSDVVHQWPGLPRGVKFDPTDQELLWHL  121

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+  ++ H F+DEFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TG 
Sbjct  122   LAKHGKVGAKAHPFIDEFIPTVEEDDGICYTHPQKLPGVKQDGSVSHFFHRTFKAYNTGI  181

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+      +  VRWHKTGKTK V+ +G   GCKK MVLY ST KG KP KTNWVM
Sbjct  182   RKRRKINTGD---LADVRWHKTGKTKPVVVDGKHLGCKKFMVLYMSTMKGGKPEKTNWVM  238

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqq-------qqkQTTDNAGESDIPQAIPTTPMTAIP  483
             HQYHLG  EDE EG YVVSK+ +QQQ        Q  T+ +A ES + + +P  P   +P
Sbjct  239   HQYHLGTGEDEVEGQYVVSKLLFQQQFKPGEKNAQDLTSADALESIVAEDLPNIP--PLP  296

Query  482   NPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCE----------EYP  333
                       L   + +  ++   +E      E   ++   V +  E          + P
Sbjct  297   LEEHVFTNQELEVLEKSETITDQGKETSEINNED-NAVEDVVHMATEKPEDGDNPSSQDP  355

Query  332   GCLAGESQAAADATDI-DDFLLCDEIV----------GSFDFNNLPSNHATSANFNPMPQ  186
                 GESQ   D+  + ++  +CDE +          G  + + +    A  A   P+  
Sbjct  356   KWWEGESQFLLDSQQLAENLAICDEFLQSQSQTSCGGGDDETDKIKPRLAVYAQL-PVED  414

Query  185   EANNTSSSTNI--ADLVNLELDSAPEFSLQDLPFGSQDSISS  66
                +      +  +D  NLEL++A EF L  + F SQDS ++
Sbjct  415   LKKDLEECQRLDPSDGTNLELENASEFRLSQIEF-SQDSFTT  455



>ref|XP_010523400.1| PREDICTED: NAC domain-containing protein 8-like [Tarenaya hassleriana]
Length=451

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 169/237 (71%), Gaps = 14/237 (6%)
 Frame = -1

Query  1172  KVRNASSP--AENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K+++ASS    +N       +R CPNC H+IDN+DV  +WPG P GVKF+PSD E++ HL
Sbjct  16    KIKSASSSYNPQNFAGKSNPSRHCPNCDHVIDNTDVVDDWPGLPRGVKFDPSDQEIIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G      H F+DEFIPT++ D+GICYTHP+NLPG+K+DGS  HFF+R+ KAY+TGT
Sbjct  76    QAKVGLSGLSSHPFIDEFIPTVDEDDGICYTHPKNLPGVKQDGSVSHFFHRSIKAYSTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTKKGEKPGKTNWVMH  639
             RKRRKI ++       VRWHKTG+TK V+ +GVQ+GCKK+MVLY    G K GKTNWVMH
Sbjct  136   RKRRKIHDDD---FGDVRWHKTGRTKPVILDGVQRGCKKIMVLY----GGKSGKTNWVMH  188

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI----PTTPMTAIPN  480
             QYHLG +EDEKE  YVVSKI+Y QQQQ+Q    A + ++P+ I    PT   T  PN
Sbjct  189   QYHLGTEEDEKEREYVVSKIFY-QQQQQQVGKAAEQEEVPKEIFAMTPTKADTVSPN  244



>gb|EEE65492.1| hypothetical protein OsJ_20915 [Oryza sativa Japonica Group]
Length=464

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 164/401 (41%), Positives = 221/401 (55%), Gaps = 39/401 (10%)
 Frame = -1

Query  1172  KVRNASSP--AENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS    A         T+ CP C+H+IDNSDV  +WPG P GVKF+P+D ELL HL
Sbjct  62    KIKNASGSVDASKHKWVSNPTKACPRCNHIIDNSDVVHQWPGLPRGVKFDPTDQELLWHL  121

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+  ++ H F+DEFIPT+E D+GICYTHP+ LPG+K+DGS  HFF+RT KAY TG 
Sbjct  122   LAKHGKVGAKAHPFIDEFIPTVEEDDGICYTHPQKLPGVKQDGSVSHFFHRTFKAYNTGI  181

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+      +  VRWHKTGKT+ V+ +G   GCKK MVLY ST KG KP KTNWVM
Sbjct  182   RKRRKINTGD---LADVRWHKTGKTRPVVVDGKHLGCKKFMVLYMSTMKGGKPEKTNWVM  238

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqq-------qqkQTTDNAGESDIPQAIPTTPMTAIP  483
             HQYHLG  EDE EG YVVSK+ +QQQ        Q  T+ +A ES + + +P  P   +P
Sbjct  239   HQYHLGTGEDEVEGQYVVSKLLFQQQFKPGEKNAQDLTSADALESIVAEDLPNIP--PLP  296

Query  482   NPPRAAGETPLSCDDYNAALSPPAEEV-----EGGKKERYGSLWS----DVQVKCEEYPG  330
                       L   + +  ++   +E      E    E    + +    D      + P 
Sbjct  297   LEEHVFTNQELEVLEKSETITDQGKETSEINNEDNAVEDVAHMATEKPEDGDNPSSQDPK  356

Query  329   CLAGESQAAADATDI-DDFLLCDEIV----------GSFDFNNLPSNHATSANFNPMPQE  183
                GESQ   D+  + ++  +CDE +          G  + + +    A  A   P+   
Sbjct  357   WWEGESQFLLDSQQLAENLAICDEFLQSQSQTSCGGGDDETDKIKPRLAVYAQL-PVEDL  415

Query  182   ANNTSSSTNI--ADLVNLELDSAPEFSLQDLPFGSQDSISS  66
               +      +  +D  NLEL++A EF L  + F SQDS ++
Sbjct  416   KKDLEECQRLDPSDGTNLELENASEFRLSQIEF-SQDSFTT  455



>ref|XP_010435643.1| PREDICTED: NAC domain-containing protein 8-like isoform X3 [Camelina 
sativa]
Length=363

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 160/375 (43%), Positives = 218/375 (58%), Gaps = 27/375 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASLSSAFQIQDCGAHIQCPNCSYRIDNSNVLLPWPGLPKGVKFEPTDEDIVEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G+S+PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  75    KCGLGDSQPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK V  NGVQ GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTLVNDEPVRWHKTGRTKPVFLNGVQSGCKKIMVLYKSARKGSKPVKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG  E ++ G YVVSKI YQQQ+     +N+G    P+   T   T        AG+ 
Sbjct  194   YHLGT-EGKEIGDYVVSKITYQQQKLGDEGENSGGRGGPRTPKTNTPTPPRPVESVAGDE  252

Query  455   PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                  D +   +P  E ++   +   G +WS      E+Y   L+            +D 
Sbjct  253   --EAFDDSKMFAPFMEGLDSIPEAALGKMWSKKARMDEDYVVNLS------------EDS  298

Query  275   LLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDL  96
             L C+E   S + +++  N     N +     A       +I+DL N +L + P+F    L
Sbjct  299   LTCNE---SIEASSIWENQVLPPNPS---LGAIGELDGFSISDLENADLGTPPDF----L  348

Query  95    PFGSQDSISSWLDRL  51
                SQ+S+ +W+  L
Sbjct  349   SLASQESLLNWIGWL  363



>ref|XP_002436832.1| hypothetical protein SORBIDRAFT_10g009670 [Sorghum bicolor]
 gb|EER88199.1| hypothetical protein SORBIDRAFT_10g009670 [Sorghum bicolor]
Length=454

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 151/203 (74%), Gaps = 7/203 (3%)
 Frame = -1

Query  1172  KVRNASSPAENRIQD--CGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS  ++   Q      ++ECP C H+IDNSDV   WPG P GVKF+PSD EL+ HL
Sbjct  16    KIKNASGSSDPSKQKWISNPSKECPKCSHVIDNSDVVHHWPGLPKGVKFDPSDQELIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+ + +PH F+DEFIPT+E DEGICYTHP+ LPG+K++GS  HFF+RT KAY TGT
Sbjct  76    LAKHGKSDIKPHPFIDEFIPTVEEDEGICYTHPQKLPGVKQNGSVSHFFHRTFKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRRKI+     V   VRWHKTGKTK V+ +G Q G KK+MVLY S  KG K  KTNWVM
Sbjct  136   RKRRKINT----VDADVRWHKTGKTKPVLLDGKQLGSKKIMVLYMSPAKGGKAEKTNWVM  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYY  573
             HQYHLGI EDE++G YVVSK+++
Sbjct  192   HQYHLGIGEDERDGEYVVSKLFF  214



>ref|XP_010496288.1| PREDICTED: NAC domain-containing protein 8-like [Camelina sativa]
 ref|XP_010496289.1| PREDICTED: NAC domain-containing protein 8-like [Camelina sativa]
Length=363

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 217/376 (58%), Gaps = 29/376 (8%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASLSSAFQIQDCGAHIQCPNCSYRIDNSNVLLPWPGLPKGVKFEPTDEDIVEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G+S+PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  75    KCGLGDSQPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK V  NGVQ GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTLVNDEPVRWHKTGRTKPVFLNGVQSGCKKIMVLYKSARKGSKPVKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG  E ++ G YVVSKI YQQQ+     +N+G    P+   T   T        AG+ 
Sbjct  194   YHLGT-EGKEIGDYVVSKITYQQQKLGDEGENSGGRGGPRTPKTNTPTPPRPVESVAGDE  252

Query  455   PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                  D +   +P  E ++   +   G +WS      E+Y   L+            +D 
Sbjct  253   --EAFDDSKMFAPFMEGLDSIPEAALGKMWSKKARMDEDYVVNLS------------EDS  298

Query  275   LLCDEIVGSFDFNNLPSNHATSANFNPMPQEAN-NTSSSTNIADLVNLELDSAPEFSLQD  99
             L C+E   S + +++  N        P P           +I+DL N +L + P+F    
Sbjct  299   LTCNE---SIEASSIWENQV----LPPNPSLGTIGELDGFSISDLENADLGTPPDF----  347

Query  98    LPFGSQDSISSWLDRL  51
             L   SQ+S+ +W+  L
Sbjct  348   LSLASQESLLNWIGWL  363



>ref|XP_004955196.1| PREDICTED: NAC domain-containing protein 8-like [Setaria italica]
Length=454

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/383 (39%), Positives = 222/383 (58%), Gaps = 27/383 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRI--QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS P ++     +   T+ECP C+H+IDNSD+  EWPG P GVKF+PSD ELL HL
Sbjct  63    KIKNASGPTQHTTYTWNSNPTKECPKCNHIIDNSDIVDEWPGLPKGVKFDPSDQELLWHL  122

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+   +PH F+DEFIPT++ +EG+CY HP+ LPG+K+DGS  HFF+RT KAY+TGT
Sbjct  123   LAKIGKVGVKPHPFIDEFIPTIDSNEGLCYIHPQKLPGVKQDGSVSHFFHRTFKAYSTGT  182

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYSTK-KGEKPGKTNWVM  642
             +KRRKI N   LV   VRW+KTGKTK V+  G   GCKK+MV+Y++  KG K  KTNWVM
Sbjct  183   KKRRKI-NTDELV--EVRWNKTGKTKPVVIGGTHLGCKKIMVMYASNIKGGKQEKTNWVM  239

Query  641   HQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAI----------PTTPMT  492
             HQYH+G  EDEK+G +VVSK++YQQQ +    ++ G  ++ + +          P    +
Sbjct  240   HQYHVGTGEDEKDGEFVVSKLFYQQQPKAVEKNSEGMVELLEPVYAAVDLAACPPLMDWS  299

Query  491   AIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERY--GSLWSDVQVKCEEYPGCLAG  318
             A+P     + +  +   ++N+  +    EV+  +   +       D      E P    G
Sbjct  300   ALPFEEGNSNQETVQKSEHNSDQTNSHCEVKDKEDTNHPASEKVEDQDSHPSEDPKWWEG  359

Query  317   ESQAAADATDIDDFL-LCDEIVGSFDFNNLPSNHATS----ANFNPMP----QEANNTSS  165
             ESQ   ++  + + + +CDE + S + +      + S    A +  +P    ++      
Sbjct  360   ESQFLMNSQQLAECMSICDEFLQSQNSSGSGDEPSKSRPCLAEYAQLPADDLKKDLEECQ  419

Query  164   STNIADLVNLELDSAPEFSLQDL  96
               + +D  N+E +  PEF L  L
Sbjct  420   KLDDSDNTNMEPECTPEFRLSQL  442



>gb|AFW76919.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=303

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 150/203 (74%), Gaps = 7/203 (3%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDC--GATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS   +   Q      ++ECP C H+IDNSDV  +WPG P GVKF+PSD EL+ HL
Sbjct  16    KIKNASGSLDPSKQKWIGNPSKECPKCSHVIDNSDVVHQWPGLPKGVKFDPSDQELIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+   +PH F+DEFIPT+E DEGICYTHP+ LPG+K++GS  HFF+RT KAY TGT
Sbjct  76    MAKHGKSGIKPHPFIDEFIPTVEEDEGICYTHPQKLPGVKQNGSVSHFFHRTFKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRR+I+ + +     VRWHKTGKTK V+ +G   GCKK+MVLY S  KG K  KTNWV+
Sbjct  136   RKRRRINTDDA----DVRWHKTGKTKPVLVDGKHLGCKKIMVLYISPLKGGKAEKTNWVI  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYY  573
             HQYHLG  EDE++G YVVSK+++
Sbjct  192   HQYHLGTGEDERDGEYVVSKLFF  214



>ref|NP_196953.1| NAC domain containing protein 85 [Arabidopsis thaliana]
 emb|CAB87788.1| putative protein [Arabidopsis thaliana]
 gb|AED92040.1| NAC domain containing protein 85 [Arabidopsis thaliana]
Length=350

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 212/360 (59%), Gaps = 36/360 (10%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             + V+NAS  +  +I+DCGA   C NC + IDNS+V   WPG P GVKFEP+D E++EHL 
Sbjct  17    RNVKNASLSSALQIKDCGAYINCFNCSYRIDNSNVLTPWPGLPKGVKFEPTDEEVIEHLE  76

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG    +PH+ + +FI ++  D GI YTHP+NLPG+ KDG+S  FF +T  AY  G R
Sbjct  77    AKCGIDGLKPHLLIQDFICSVTQDVGINYTHPQNLPGVSKDGTSVFFFNKTAHAYQNGQR  136

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+I+  TSL  + VRWHKTG+TK VM NG+QKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  137   KRRRIT-PTSLKDDTVRWHKTGQTKPVMLNGIQKGCKKIMVLYKSARKGFKPEKSNWVLH  195

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPR---A  468
             QYHLG +E E  G YVVSKI YQQ +Q++ T +  ES   +  P+TP T+     R   +
Sbjct  196   QYHLGTEEGEI-GEYVVSKITYQQPKQQEKTIDESESSGVRGGPSTPKTSTITQVRPVIS  254

Query  467   AGETPLSC-DDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADAT  291
               E  ++  DD    L   AE +E  ++   GS    +              ++   + +
Sbjct  255   VDEDEIAFDDDSKMVLDSYAEGLENIQEASSGSTSDKI--------------AKVGGNVS  300

Query  290   DIDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEF  111
              I+D L+  +I  S    ++P NH             +  S + +++DL N EL + P+ 
Sbjct  301   VIEDNLMSKKIEAS----SIP-NHGN----------VDYGSGNFSVSDLENAELGTLPDL  345



>gb|KHN27473.1| NAC domain-containing protein 8 [Glycine soja]
Length=306

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 193/312 (62%), Gaps = 18/312 (6%)
 Frame = -1

Query  962  MFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSL  783
            MF+ EFIPTLEG+ GICYTHP+NLPG K DGSS HFF++T  AYATG RKRRKI ++  +
Sbjct  1    MFIHEFIPTLEGELGICYTHPQNLPGAKTDGSSVHFFHKTVNAYATGPRKRRKIHHQDGM  60

Query  782  VMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEK  606
              EHVRWHKTG+TKAV+E+GV KG KK+MVLY  +KKG KP KTNWVMHQYHLG +EDEK
Sbjct  61   TEEHVRWHKTGRTKAVIEDGVHKGFKKIMVLYIRSKKGSKPYKTNWVMHQYHLGSEEDEK  120

Query  605  EGGYVVSKIYYqqqqqkQTT-DNAGESDIPQAIPTTPMTAIPNPPRAAGETPLSCDDY--  435
            +  YVVSKI+YQ+Q+  +   +N    D   A    P T  PNPP         CDD   
Sbjct  121  DDEYVVSKIFYQRQKHSEKNEENTVVEDSNIAAQAGPRTPKPNPPTRPCTG--KCDDNFD  178

Query  434  -NAALS--PPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDFLLCD  264
             N  LS    A+ + G   E +   +       ++ P  LAGESQA  D   ++D LLC 
Sbjct  179  ENELLSFIQDAKPIPG---ESHAPPYDVQDEDNKDDPAWLAGESQADFDG--LEDILLCK  233

Query  263  EIVGS---FDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLP  93
            +++ S    + + L S +  +AN    P   +N  +S  ++ L  LE D+ P+F L +L 
Sbjct  234  DMLDSSSLLNHSGLSSTYNANANKLVTPG-TDNDYASYGVSVLDTLEFDTPPDFDLSNLQ  292

Query  92   FGSQDSISSWLD  57
            FGSQDS   W+D
Sbjct  293  FGSQDSTLQWID  304



>gb|AFN55269.1| NAC domain-containing protein [Tamarix hispida]
Length=441

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 158/222 (71%), Gaps = 12/222 (5%)
 Frame = -1

Query  1115  RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPT  936
             R CP C H+IDNSDV  EWPG P GVKF+PSD E++ HL AK G G+ +PH F+DEFIPT
Sbjct  37    RACPKCDHVIDNSDVIQEWPGLPRGVKFDPSDQEIIWHLLAKSGCGDQKPHSFIDEFIPT  96

Query  935   LEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHK  756
             L G++GICYTHP+NLPG+K+DGS+ HFF+R+ KAY TGTRKRRKI ++    +  VRWHK
Sbjct  97    LNGEDGICYTHPQNLPGVKQDGSTSHFFHRSVKAYNTGTRKRRKIHDDD---LGDVRWHK  153

Query  755   TGKTKAVMENGVQKGCKKVMVLYSTKKGEKPG-KTNWVMHQYHLGIDEDEKEGGYVVSKI  579
             TGKT ++     Q+GCKK+MVLY+   G     KTNW +HQYHLG +E+EK+G +V+SK+
Sbjct  154   TGKTASIFLGSEQRGCKKIMVLYAKPVGGGTSVKTNWKLHQYHLGTEEEEKDGEFVISKV  213

Query  578   YYqqqqqkQTTDNAGES---DIPQAI-----PTTPMTAIPNP  477
             +Y QQQQ +T +   ES   D+   +     P TP +  P P
Sbjct  214   FYDQQQQAKTNEKNLESILNDVNDEVAVKVDPVTPKSVTPKP  255



>ref|XP_003581357.1| PREDICTED: NAC domain-containing protein 8-like [Brachypodium 
distachyon]
Length=362

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 161/237 (68%), Gaps = 10/237 (4%)
 Frame = -1

Query  1154  SPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGN  975
             SP E       A RECPNC   IDN DVS +WPG PAGVKF+PSD+ELL HL AK G GN
Sbjct  29    SPFEIEKLVAEAWRECPNCKCRIDN-DVSSQWPGLPAGVKFDPSDLELLTHLEAKVGLGN  87

Query  974   SEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRK-IS  798
             S  H+ +D+FIPT+E  EGICYTHPENLPGIK DG++ +FF+    AY  G RKRRK +S
Sbjct  88    SASHILIDDFIPTIEEIEGICYTHPENLPGIKIDGTNSYFFHTISNAYDVGQRKRRKVVS  147

Query  797   NETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY--STKKGEKPGKTNWVMHQYHLG  624
             ++ ++  E +RWHKTGK++++ ENGV KG KK++VLY  S KKG    KTNW MHQYHLG
Sbjct  148   SDHTVRDEPIRWHKTGKSRSISENGVVKGWKKILVLYIGSKKKGADIYKTNWTMHQYHLG  207

Query  623   IDEDEKEGGYVVSKIYYqqqqqkQ------TTDNAGESDIPQAIPTTPMTAIPNPPR  471
             ++EDEK G  VVSKI++Q +  K         D   +S   +  PTTPMT  P P R
Sbjct  208   VEEDEKHGELVVSKIFWQLRSNKTRKSQIYVVDEEYDSVAGEIDPTTPMTNPPQPRR  264



>ref|XP_006289216.1| hypothetical protein CARUB_v10002665mg [Capsella rubella]
 gb|EOA22114.1| hypothetical protein CARUB_v10002665mg [Capsella rubella]
Length=362

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 159/217 (73%), Gaps = 3/217 (1%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             + V+NAS  +  +I+DCGA   CPNC + +DNS+V P WPG P GVKFEP+D E++EHL 
Sbjct  17    RNVKNASVSSSLQIKDCGAYINCPNCSYPVDNSNVLPPWPGLPKGVKFEPTDEEVIEHLE  76

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG    +PH+ + +FI ++  D GI YTHP+NLPG+ KDG+S  FF +T  AY  G R
Sbjct  77    AKCGIDGLKPHLLIQDFICSVTQDVGINYTHPQNLPGVSKDGTSVFFFNKTAHAYQNGQR  136

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+++  TSL  E VRWHKTG+TK VM NGVQKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  137   KRRRVT-PTSLTDESVRWHKTGQTKPVMVNGVQKGCKKIMVLYKSARKGLKPEKSNWVLH  195

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGES  528
             QYHLG +E E  G +VVSKI YQ+Q+Q + T +  ES
Sbjct  196   QYHLGTEEGEI-GEFVVSKITYQKQKQWEKTIDESES  231



>ref|XP_006408528.1| hypothetical protein EUTSA_v10022099mg, partial [Eutrema salsugineum]
 gb|ESQ49981.1| hypothetical protein EUTSA_v10022099mg, partial [Eutrema salsugineum]
Length=345

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 150/201 (75%), Gaps = 3/201 (1%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +I+DCGA+  CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASVSSAVQIKDCGASINCPNCSYRIDNSNVLVPWPGLPKGVKFEPTDEDIIEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             +CG G SEPH+ ++EFI  +  D GI YTHPENLPG  KDG S  FF++T +AY TG RK
Sbjct  75    QCGVGGSEPHVLIEEFIRPVTEDVGINYTHPENLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T L  E VRWHKTG+TK V+ +GVQ+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTCLSEEPVRWHKTGRTKPVLLDGVQRGCKKIMVLYKSARKGSKPEKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYY  573
             YHLG + +E  G YVVSKI Y
Sbjct  194   YHLGTEGNEI-GDYVVSKITY  213



>ref|XP_010485395.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Camelina 
sativa]
Length=362

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 159/379 (42%), Positives = 217/379 (57%), Gaps = 36/379 (9%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CP+C + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASLSSAFQIQDCGAHIQCPSCSYRIDNSNVLLPWPGLPKGVKFEPTDEDIIEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G+S PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  75    KCGLGDSLPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK V  NG+Q+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTLVNDEPVRWHKTGRTKPVFLNGLQRGCKKIMVLYKSARKGSKPVKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG  E ++ G YVVSKI YQQQ+     +++G    P    T   T        AG+ 
Sbjct  194   YHLGT-EGKEIGDYVVSKITYQQQKLGDEGESSGVRGGPTTPKTNTPTPPRPVEGVAGDE  252

Query  455   PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                  D +    P  E ++   +   G +WS      E+Y   L+            +D 
Sbjct  253   --EAFDDSKMFDPFMEGLDSIPEAALGKMWSKKARMDEDYVVNLS------------EDS  298

Query  275   LLCDEIVGSFDFNN--LPSN--HATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFS  108
             L C+E + +  + N  LP N    T   F+             +I+DL N +L + P+F 
Sbjct  299   LTCNESIEASVWENQVLPPNPSLGTIGEFDGF-----------SISDLENADLGTPPDF-  346

Query  107   LQDLPFGSQDSISSWLDRL  51
                L   SQ+S+ +W+  L
Sbjct  347   ---LSLASQESLLNWIGWL  362



>ref|XP_002873670.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49929.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=365

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 214/376 (57%), Gaps = 34/376 (9%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             + V+NAS  +  +I+DC A   CPNC++ +DN ++   WPG P GVKFEP+D E++EHL 
Sbjct  17    RNVKNASVSSALQIKDCEAYINCPNCYYRVDNRNLLTPWPGLPKGVKFEPTDEEVIEHLE  76

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG    +PH+ + +FI ++  D GI YTHP+NLPG+ KDG+S  FF +T  AY  G R
Sbjct  77    AKCGIDGLKPHLLIQDFICSVTQDVGINYTHPQNLPGVNKDGTSVFFFNKTAHAYQNGLR  136

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+I+  TSL  E VRWHKTG+TK V+ NGVQKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  137   KRRRIT-PTSLKDESVRWHKTGQTKPVIVNGVQKGCKKIMVLYKSARKGFKPEKSNWVLH  195

Query  638   QYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQA---IPTTPMTAIPNPPRA  468
             QYHLG +E E  G YVVSKI YQQ +Q + T +  ES   +     P T       P  +
Sbjct  196   QYHLGTEEGEI-GEYVVSKITYQQPKQWEKTMDESESSGARGGPTTPKTTTPTQAKPVIS  254

Query  467   AGETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATD  288
               E  ++ DD        AE  +  ++  YGS  SD               +Q A + + 
Sbjct  255   VDEDDIAYDDTKMVHDTFAEGQDNIQEASYGST-SDRG-------------AQVAGNLSV  300

Query  287   IDDFLLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFS  108
             I+D L+  +I  S        N+            A+  S + ++ DL N +L + P+F 
Sbjct  301   IEDNLVSKKIEASSSLVEKNLNYGN----------ADIGSGNFSMTDLENADLGTLPDF-  349

Query  107   LQDLPFGSQDSISSWL  60
                    S+DS+ +WL
Sbjct  350   ---FSLASEDSLLNWL  362



>ref|XP_010485394.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Camelina 
sativa]
Length=391

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 159/379 (42%), Positives = 217/379 (57%), Gaps = 36/379 (9%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CP+C + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  44    KVKNASLSSAFQIQDCGAHIQCPSCSYRIDNSNVLLPWPGLPKGVKFEPTDEDIIEFLEA  103

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G+S PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  104   KCGLGDSLPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  163

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK V  NG+Q+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  164   RRKIT-PTLVNDEPVRWHKTGRTKPVFLNGLQRGCKKIMVLYKSARKGSKPVKSNWVLHQ  222

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG  E ++ G YVVSKI YQQQ+     +++G    P    T   T        AG+ 
Sbjct  223   YHLGT-EGKEIGDYVVSKITYQQQKLGDEGESSGVRGGPTTPKTNTPTPPRPVEGVAGDE  281

Query  455   PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                  D +    P  E ++   +   G +WS      E+Y   L+            +D 
Sbjct  282   --EAFDDSKMFDPFMEGLDSIPEAALGKMWSKKARMDEDYVVNLS------------EDS  327

Query  275   LLCDEIVGSFDFNN--LPSN--HATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFS  108
             L C+E + +  + N  LP N    T   F+             +I+DL N +L + P+F 
Sbjct  328   LTCNESIEASVWENQVLPPNPSLGTIGEFDGF-----------SISDLENADLGTPPDF-  375

Query  107   LQDLPFGSQDSISSWLDRL  51
                L   SQ+S+ +W+  L
Sbjct  376   ---LSLASQESLLNWIGWL  391



>gb|AFW62815.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=348

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/359 (41%), Positives = 203/359 (57%), Gaps = 33/359 (9%)
 Frame = -1

Query  1064  EWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPG  885
             +WPG PAGVKF+PS++ELL+HL  K G G+S PH+ +DEFIPT++ DEGICY+HPENLPG
Sbjct  2     QWPGLPAGVKFDPSELELLQHLEQKVGLGDSRPHVLIDEFIPTIDNDEGICYSHPENLPG  61

Query  884   IKKDGSSGHFFYRTKKAYATGTRKRRKISN--ETSLVMEHVRWHKTGKTKAVMENGVQKG  711
             +K DGS+ HFF+R  KAY  G RKRR+I N  + ++  + VRWHKTG++KA+ +NGV KG
Sbjct  62    MKTDGSNAHFFHRVSKAYGYGQRKRRRIINCSDHTVPDDRVRWHKTGRSKAIYDNGVIKG  121

Query  710   CKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQ----TT  546
              KK+MVL+ T + G K  +  WVMHQYHLG +EDEK+G  VVSKI++Q   +      T 
Sbjct  122   WKKIMVLHKTLRSGGKRERAKWVMHQYHLGKEEDEKDGELVVSKIFFQLANKSMEISETE  181

Query  545   DNAGESDIPQAI--PTTPMTAIPNPPRAAGETPLSCDDYNAALSPPAEEVEGGKKERYGS  372
                 E + P ++  P TP T  P P         +  + +        + EG       S
Sbjct  182   TACEEPEAPASVIGPKTPKTITPQPRHPKSSPCETQQNISIVQDQLLLDSEGEPTMPIVS  241

Query  371   LWSDVQ--VKCEEYPGCLAGESQAAADATDID----DFLLCDEIVGSFDFNN-LPSNHAT  213
             L  D      C      +A E Q   +A+       + LLC E   S ++   LP ++  
Sbjct  242   LEDDAMNPAWC-----AVAEERQVVGEASRAQSNSVETLLCREDPNSLNYEALLPWDY--  294

Query  212   SANFNPMPQEANNTSSSTN-----IADLVNLELDSAPEFSLQDLPFGSQDSISSWLDRL  51
                  P+  +  N     N     + D  N++L + P+  L D  FGSQ+S+ SWLDR+
Sbjct  295   -----PILSQCRNEMLDGNLNGYGLPDHHNVDLGTPPDLQLADFQFGSQESLGSWLDRI  348



>ref|XP_010435640.1| PREDICTED: NAC domain-containing protein 8-like isoform X1 [Camelina 
sativa]
 ref|XP_010435642.1| PREDICTED: NAC domain-containing protein 8-like isoform X2 [Camelina 
sativa]
Length=363

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 216/375 (58%), Gaps = 27/375 (7%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASLSSAFQIQDCGAHIQCPNCSYRIDNSNVLLPWPGLPKGVKFEPTDEDIIEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G+S PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  75    KCGLGDSLPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK V  NG+Q+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTLVNDEPVRWHKTGRTKPVFLNGLQRGCKKIMVLYKSARKGSKPVKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG  E E+ G YVVSKI YQQQ+     +++G    P+   T   T        A + 
Sbjct  194   YHLGT-EGEEIGDYVVSKITYQQQKLGDEGESSGVRGGPRTPKTNTPTPPRPVEGVARDE  252

Query  455   PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                  D +    P  E ++   +   G +WS      E+Y   L+            +D 
Sbjct  253   --EAFDDSKMFDPFMEGLDSIPEAALGKMWSKKARMDEDYVVNLS------------EDS  298

Query  275   LLCDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDL  96
             L C+E   S + +++  N     N +     A       +I+DL N +L + P+F    L
Sbjct  299   LTCNE---SIEASSIWENQVLPPNPS---LGAIGELDGFSISDLENADLGTPPDF----L  348

Query  95    PFGSQDSISSWLDRL  51
                SQ+S+ +W+  L
Sbjct  349   SLASQESLLNWIGWL  363



>ref|XP_006297963.1| hypothetical protein CARUB_v10014004mg [Capsella rubella]
 gb|EOA30861.1| hypothetical protein CARUB_v10014004mg [Capsella rubella]
Length=366

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 151/201 (75%), Gaps = 3/201 (1%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASLSSALQIQDCGAHIKCPNCSYRIDNSNVLLPWPGLPKGVKFEPTDEDIIEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G+S+PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  75    KCGLGDSQPHVLIEEFIRPVIEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK VM NG+Q+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTLVNDEPVRWHKTGRTKPVMLNGIQRGCKKIMVLYKSARKGSKPEKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYY  573
             YHLG  E ++ G YVVSKI Y
Sbjct  194   YHLGT-EGQEIGDYVVSKITY  213



>ref|XP_010525257.1| PREDICTED: NAC domain-containing protein 8-like [Tarenaya hassleriana]
Length=401

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 206/375 (55%), Gaps = 47/375 (13%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             +DCGA  ECPNC H IDN++V   WPG P GVKFEP+D E++EHL AKCG    EPH+ L
Sbjct  60    KDCGAYIECPNCTHRIDNTNVLMPWPGLPKGVKFEPTDEEIIEHLEAKCGIDGLEPHVLL  119

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             +EFI  +  D GI YTHPENLPG  KDG S  FF++T +AY TG RKRR+I+  T L  E
Sbjct  120   EEFIRPVTEDVGINYTHPENLPGANKDGVSIFFFHKTVQAYGTGQRKRRRIT-PTGLNDE  178

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
              VRWHKTG+TK VM NGVQKGCKK+MVLY S +KG KP K+NWV+HQYHLG + ++  G 
Sbjct  179   PVRWHKTGRTKPVMLNGVQKGCKKIMVLYKSARKGSKPEKSNWVLHQYHLGTEGNDI-GE  237

Query  596   YVVSKIYYqqqqqkQTT------------DNAGESDIPQAIPTTPMTAIPNPPRAAGETP  453
             YV+SKI YQQQ+  +                A  S       T       N     GE  
Sbjct  238   YVISKISYQQQKHGEKNVGEEEVPEEGEHSRAHGSPRTPNTKTPTPPRPVNTISGVGE--  295

Query  452   LSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDFL  273
                 D    L P  + +E   +    S WS   V+               ++   I+D L
Sbjct  296   --AFDATKMLDPLVQGLENIPEASSESTWSAGAVE--------------DSNMNRIEDNL  339

Query  272   LCDEIVGSFDFNNLPSNHATSAN-FNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDL  96
              C E +      + P++   +AN F  +  E+ N +    I+DL N +L S PEF    L
Sbjct  340   KCKEHI-----EDNPTSGVENANLFGELELESGNFA----ISDLENADLGSPPEF----L  386

Query  95    PFGSQDSISSWLDRL  51
                SQDS+ +WL  L
Sbjct  387   SLASQDSLLNWLGWL  401



>ref|NP_186809.1| NAC domain containing protein 44 [Arabidopsis thaliana]
 gb|AAF01544.1|AC009325_14 hypothetical protein [Arabidopsis thaliana]
 gb|AEE73694.1| NAC domain containing protein 44 [Arabidopsis thaliana]
Length=370

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 150/201 (75%), Gaps = 3/201 (1%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA  +CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  15    KVKNASLSSALQIQDCGAHIKCPNCTYRIDNSNVLIPWPGLPKGVKFEPTDEDIIEFLEA  74

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G SEPH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  75    KCGIGGSEPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  134

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK VM +GVQ+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  135   RRKIT-PTLVNDEPVRWHKTGRTKPVMLSGVQRGCKKIMVLYKSARKGTKPEKSNWVLHQ  193

Query  635   YHLGIDEDEKEGGYVVSKIYY  573
             YHLG  E ++ G YVVSKI Y
Sbjct  194   YHLGT-EGKEIGDYVVSKITY  213



>ref|XP_006828400.1| hypothetical protein AMTR_s00060p00054700 [Amborella trichopoda]
 gb|ERM95816.1| hypothetical protein AMTR_s00060p00054700 [Amborella trichopoda]
Length=404

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/398 (39%), Positives = 212/398 (53%), Gaps = 61/398 (15%)
 Frame = -1

Query  1073  VSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPEN  894
             V+ +WPG P GVKF+PSD ELL HLAAK G   ++ H F+DEFI TL  ++GICYTHP+ 
Sbjct  2     VTQDWPGLPRGVKFDPSDQELLGHLAAKVGVDGAKLHPFIDEFIMTLYEEDGICYTHPQK  61

Query  893   LPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQK  714
             LPG+K+DGS  HFF+RT KAY +GTRKRRKI N  +     VRWHKTGKT+ V+ +GV +
Sbjct  62    LPGVKQDGSVCHFFHRTVKAYNSGTRKRRKILNHLNPCSGDVRWHKTGKTRQVIVDGVHR  121

Query  713   GCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqq--kQTTD  543
             GCKK+MVLY ST KG KP KTNWVMHQYHLG ++DEK+G +VVSK+ YQQQ +  ++   
Sbjct  122   GCKKIMVLYMSTGKGGKPEKTNWVMHQYHLGTEDDEKDGDFVVSKVLYQQQLKPCEKNDQ  181

Query  542   NAGESDIPQAI----PTTPMTAIPNPPRAAGETP---------LSCDDYNAALSPPAEEV  402
             +  E   P ++    P TP+  +P P R + + P           C++ +A +  P    
Sbjct  182   DMPEETAPTSVDPVDPVTPVAMVPGPFRPSKQQPDIDSLQEPKSVCEESSAQVIDPDTTG  241

Query  401   E--GGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATD-IDDFLLCDEIVGS------  249
             E     +  +     D ++          GESQ   D+   +D   LCDEI+        
Sbjct  242   ENCASSQPHWDENVEDQEINSVGDSKWWEGESQFLLDSQQLLDGLYLCDEILQGQSLRED  301

Query  248   ----------FDFNNLPSNH------------------------ATSANFNPMPQEANNT  171
                        ++ N+ + H                            N    P + + +
Sbjct  302   DRSKKVVPCLSEYTNIGAAHLKKDLESCQNLSQSELPKIEFDQPGLRLNQLDTPLDFHLS  361

Query  170   SSSTNIADLVNLELDSAPEFSLQ--DLPFGSQDSISSW  63
                T  +DL   +LD+ P+F L   DLP GSQDS   W
Sbjct  362   QLDTPPSDLRLSQLDTPPDFRLSQLDLPSGSQDSFLGW  399



>ref|XP_002884273.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60532.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=357

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 148/201 (74%), Gaps = 3/201 (1%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  +IQDCGA   CPNC + IDNS+V   WPG P GVKFEP+D +++E L A
Sbjct  16    KVKNASLSSALQIQDCGAHINCPNCSYRIDNSNVLIPWPGLPKGVKFEPADEDIIEFLEA  75

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G S PH+ ++EFI  +  D GI YTHP+NLPG  KDG S  FF++T +AY TG RK
Sbjct  76    KCGIGGSAPHVLIEEFIRPVTEDVGINYTHPQNLPGANKDGVSVFFFHKTVQAYGTGQRK  135

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T +  E VRWHKTG+TK V+ NGVQ+GCKK+MVLY S +KG KP K+NWV+HQ
Sbjct  136   RRKIT-PTLVNDEPVRWHKTGRTKPVLLNGVQRGCKKIMVLYKSARKGSKPEKSNWVLHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYY  573
             YHLG  E ++ G YVVSKI Y
Sbjct  195   YHLGT-EGKEIGDYVVSKITY  214



>ref|XP_008354424.1| PREDICTED: NAC domain-containing protein 8-like, partial [Malus 
domestica]
Length=344

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    NS+ H  +
Sbjct  23    QMCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>gb|EMT26627.1| NAC domain-containing protein 8 [Aegilops tauschii]
Length=350

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 203/369 (55%), Gaps = 57/369 (15%)
 Frame = -1

Query  1121  ATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFI  942
             A  ECPNC H IDN DVS +WPG P GVKF+P+D+ELL HL  K G   S  H+ +D+FI
Sbjct  25    AEMECPNCEHRIDNCDVSSQWPGLPIGVKFDPTDLELLGHLEGKIGRAVS--HVLIDDFI  82

Query  941   PTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISN-ETSLVMEHVR  765
             PT+E  EGICYTHPENLPG+K DG + HFF++   AY  GTRKRRKISN + ++  EH+R
Sbjct  83    PTIEMAEGICYTHPENLPGVKLDGIASHFFHKICNAYDVGTRKRRKISNSDYNVCDEHLR  142

Query  764   WHKTGKTKAVME-NGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVV  588
             WHKTGK++ +++ NG  KG KK+MVL   K G K  KTNW MHQYHLG+DE+EK+G  VV
Sbjct  143   WHKTGKSRHILDNNGDIKGWKKIMVL--RKGGYKAEKTNWTMHQYHLGVDENEKDGELVV  200

Query  587   SKIYYqqqqqkQ------TTDNAGESDIPQAIPTTPMTAIPNPPRAAGETPLSCDDYNAA  426
              K+++Q   +K         D   +S   +  PTTPMT  P P R  G            
Sbjct  201   CKVFFQLPSEKAGQCVMFAVDEESDSFAVKIDPTTPMTYPPQPCRPNGS-----------  249

Query  425   LSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDFLLCDEIVGSF  246
                P E  +  ++E +    S V+   E     LAG S  A     IDD  L        
Sbjct  250   ---PFETGQNQEEEEF--RLSAVRGAAE----WLAGTSSHA-----IDDVALP-------  288

Query  245   DFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLE----LDSAPEF-SLQDLPFGSQ  81
             D +  PS   T       P  A        + D   L+      + P+F SL DLP GS 
Sbjct  289   DLDEHPSRGGT-------PDAAYPEKQHLPLVDTDTLQGCPDAGTPPDFSSLADLPIGSL  341

Query  80    DSISSWLDR  54
             DS  +WLD+
Sbjct  342   DSF-NWLDQ  349



>gb|AFN55278.1| NAC domain-containing protein [Tamarix hispida]
Length=295

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 182/313 (58%), Gaps = 27/313 (9%)
 Frame = -1

Query  962  MFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSL  783
            MF+DEFIPT++ ++GICYTHP++LPG KKDGSS HFF++T  AYA+G RKRRKI  E+  
Sbjct  1    MFIDEFIPTIDTEKGICYTHPKDLPGAKKDGSSIHFFHKTTNAYASGRRKRRKI--ESDK  58

Query  782  VMEHVRWHKTGKTKAVMENGVQKGCKKVMVLYS-TKKGEKPGKTNWVMHQYHLGIDEDEK  606
            + E VRWHKTGKTK V+ENG+ KGCKK+MVLY  +KKG KP +++WVMHQYHLG  EDE 
Sbjct  59   MGETVRWHKTGKTKPVVENGIHKGCKKIMVLYKGSKKGAKPERSHWVMHQYHLGTIEDEN  118

Query  605  EGGYVVSKIYYqqqqqkQTTDN--AGESDIPQ-AIPTTPMTAIPNPPRAAGETPLSCDDY  435
            EG YVVSKI +Q  +Q + T    A E  +P  +I   P T  P PP+     P     Y
Sbjct  119  EGEYVVSKIIHQPPKQSEDTGAAVAEEESLPLVSISAGPETPNPCPPKPGNSFP----SY  174

Query  434  NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYP----GCLAGESQAAADATD-IDDFLL  270
            +A +    E++     E     W          P      LAGESQA    TD +DD LL
Sbjct  175  DANV----EDLPLSAMEDPAVFWEGYHTPSNAQPNEELAPLAGESQAVNFDTDVVDDSLL  230

Query  269  CDEIVGSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPF  90
            C EI  S               F     +           DLVNLELD++P+F L DL F
Sbjct  231  CKEIFSSC--------APLDGGFPSSLDDITAGRYCDGFNDLVNLELDTSPDFQLADLQF  282

Query  89   GSQDSISSWLDRL  51
             SQDSI   LDRL
Sbjct  283  SSQDSIFDLLDRL  295



>gb|EMS58331.1| NAC domain-containing protein 8 [Triticum urartu]
Length=306

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 152/210 (72%), Gaps = 11/210 (5%)
 Frame = -1

Query  1139  RIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHM  960
             ++++  A  ECPNC + IDN+DV  +WPG PAGVKF+P+D+ELLEHL  K G   S  H+
Sbjct  26    QVEELLAWMECPNCKYRIDNTDVLSQWPGLPAGVKFDPTDLELLEHLEGKVGRAAS--HV  83

Query  959   FLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLV  780
              +D+FIPT+   +GICYTHPENLPGIK DGS+GHFF++   AY  G RKRRKISN    V
Sbjct  84    LIDDFIPTIGEAQGICYTHPENLPGIKMDGSTGHFFHKVSNAYVVGKRKRRKISNSDHTV  143

Query  779   M-EHVRWHKTGKTKAVME-NGVQKGCKKVMVLY--STKKGEKPGKTNWVMHQYHLGIDED  612
               E++RWHKTGK++++++ NGV KG KK++VLY    K G K  KTNW MHQYHLG+D+D
Sbjct  144   CDENIRWHKTGKSRSILDNNGVIKGWKKILVLYIGYRKGGGKTEKTNWRMHQYHLGVDQD  203

Query  611   EKEGGYVVSKIYYqqqqqkQTTDNAGESDI  522
             EK+   VVSK++YQ Q       NAG+S +
Sbjct  204   EKQEELVVSKVFYQVQSM-----NAGQSLV  228



>ref|XP_009134601.1| PREDICTED: NAC domain-containing protein 8 [Brassica rapa]
Length=358

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 152/378 (40%), Positives = 214/378 (57%), Gaps = 39/378 (10%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAA  993
             KV+NAS  +  + +DCGA+ +CPNC+H IDN++V   WPG P GVKFEP+D +++E L A
Sbjct  16    KVKNASLSSALQTRDCGASIQCPNCYHRIDNTNVLVPWPGLPKGVKFEPTDADIIEFLEA  75

Query  992   KCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRK  813
             KCG G SEPH+ ++EFI  +  D GI YTHP+NLPG  KDG S  F ++T +AY TG RK
Sbjct  76    KCGIGGSEPHVLIEEFIRPVTEDVGINYTHPKNLPGTNKDGVSAFFVHKTVQAYGTGQRK  135

Query  812   RRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQ  636
             RRKI+  T L  E VRWHKTG+ K V  NGV +GCKK+MVLY S +KG KP K+ WV+HQ
Sbjct  136   RRKIT-PTCLNEEPVRWHKTGRNKHVFLNGVNRGCKKIMVLYKSARKGSKPEKSKWVLHQ  194

Query  635   YHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAGET  456
             YHLG + +E  G YVVSK+ YQ+++ K   +++G    P    T   T        AG+ 
Sbjct  195   YHLGTEGNEI-GEYVVSKVTYQKEKVKDEGESSGVRGGPTTPMTNTPTPPRPVDGGAGDG  253

Query  455   PLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAAADATDIDDF  276
                 DD      P  E ++   +    +LWS    + EE    L+            +D 
Sbjct  254   EAFDDD--KMFDPFYEGLDSIPE---AALWSKKARREEEVGVNLS------------EDN  296

Query  275   LLCDEIVGS---FDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSL  105
             L C+E + +   ++ N +            +P  +        ++DL N++L + P+F  
Sbjct  297   LTCNESIEASSPWEKNQI------------LPNPSLGELDGFALSDLENVDLGTPPDF--  342

Query  104   QDLPFGSQDSISSWLDRL  51
               L   SQDS+ +W+  L
Sbjct  343   --LTLASQDSLMNWMGWL  358



>gb|EMS59187.1| NAC domain-containing protein 8 [Triticum urartu]
Length=359

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 154/228 (68%), Gaps = 12/228 (5%)
 Frame = -1

Query  1121  ATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFI  942
             A  ECPNC H IDNSDVS +WPG P GVKF+P+D+ELL HL  K G   S  H+ +D+FI
Sbjct  46    AGMECPNCEHRIDNSDVSSQWPGLPIGVKFDPTDLELLGHLEGKIGRAMS--HVLIDDFI  103

Query  941   PTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISN-ETSLVMEHVR  765
             PT+E  EGICYTHPENLPG++ DG + HFF++   AY  GTRKRRKISN + ++  EH+R
Sbjct  104   PTIEMAEGICYTHPENLPGVRLDGVASHFFHKICNAYDVGTRKRRKISNSDYNVCDEHLR  163

Query  764   WHKTGKTKAVME-NGVQKGCKKVMVLYSTKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVV  588
             WHKTGK++ +++ NG  KG KK+MVL   K G K  KTNW MHQYHLG+DE+EK+G  VV
Sbjct  164   WHKTGKSRHILDNNGDIKGWKKIMVL--RKGGYKAEKTNWTMHQYHLGVDENEKDGELVV  221

Query  587   SKIYYqq------qqqkQTTDNAGESDIPQAIPTTPMTAIPNPPRAAG  462
              K+++Q       Q      D   +S   +  PTTPMT  P P R  G
Sbjct  222   CKVFFQLPSEKAGQSVMFAVDEESDSFAVKIDPTTPMTYAPQPCRPNG  269



>ref|XP_007160268.1| hypothetical protein PHAVU_002G307000g [Phaseolus vulgaris]
 gb|ESW32262.1| hypothetical protein PHAVU_002G307000g [Phaseolus vulgaris]
Length=447

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGTQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_004978080.1| PREDICTED: NAC domain-containing protein 8-like [Setaria italica]
Length=386

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/390 (40%), Positives = 213/390 (55%), Gaps = 33/390 (8%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGAT--RECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEH  1002
             +K+RNA+     R+ +  A    +CPNC   ID SDVS  WP  PAGVKF+PSD+ELL+H
Sbjct  14    KKIRNATQLISLRLGELVAEPYIKCPNCKCGIDTSDVSLVWPALPAGVKFDPSDLELLQH  73

Query  1001  LAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATG  822
             L  K    NS  H  +DEFIPT+E  EGICYTHP+NLP IK DGSS HFF+R   AY  G
Sbjct  74    LQGKSNLPNSTSHALIDEFIPTIEEMEGICYTHPKNLPDIKMDGSSLHFFHRVSNAYGCG  133

Query  821   TRKRRKIS-NETSLVMEHVRWHKTGKTKAVM-ENGVQKGCKKVMVLY--STKKGEKPGKT  654
              RKRRKIS ++ S+  E +RWHKTG ++A+  E+GV+KG KK++VLY  S + G K  + 
Sbjct  134   HRKRRKISGDDDSVFDERIRWHKTGASRAIYDEDGVKKGWKKILVLYRGSRRGGSKIDRD  193

Query  653   NWVMHQYHLGIDEDEKEGGYVVSKIYYqqqqqkQTTDNAGESDI---PQAIPTTPMTAIP  483
             NWVMHQYHLG DEDE +G  V+SK++YQ   +K      G+ ++   P A    P T + 
Sbjct  194   NWVMHQYHLGADEDEPDGELVISKVFYQLPSKKNDKSEMGDVELESEPSAAKIDPRTPMI  253

Query  482   NPPRAA--GETPLSCDDYNAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQ  309
             +PP++     +P   D Y           +  ++E   +    V+V+  E   C A  ++
Sbjct  254   HPPQSCLPNNSPCDTDQYTPN--------QVDQQEECSTSVCPVKVEAAE---CSAWSAE  302

Query  308   AAADATDIDDFLLCDEIVGSFDFNNL-PSNHATSANFNPMPQEANNTSSSTNIADL-VNL  135
              +  A  + +    DE     D  +  P   A      P+P + +NT     + +L    
Sbjct  303   LSP-AVVVANLPAWDEPGQPRDTTDPDPEPEA------PIPVDGSNTDPFHGLPELDTTF  355

Query  134   ELDSAPE--FSLQDLPFGSQDSISSWLDRL  51
                  P    SL D+  GSQDS   WLD  
Sbjct  356   PCLGTPSDCISLADIQLGSQDSFRGWLDSF  385



>ref|XP_010424091.1| PREDICTED: NAC domain-containing protein 8-like [Camelina sativa]
Length=346

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             + ++NA   +   I++CGA+  CPNC + +DNS+V   WPG P GVKFEP+D E++EHL 
Sbjct  14    RNIKNAPVSSALHIKECGASINCPNCSYRVDNSNVLAPWPGLPKGVKFEPTDEEVIEHLE  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG    +PH+ + +FI ++  D GI YTHP+NLPG+ KDG+S  FF +T  AY  G R
Sbjct  74    AKCGIDGLKPHLLIQDFICSVTEDVGINYTHPQNLPGVNKDGTSVFFFNKTAHAYQNGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+++  T+L  E VRWHKTG+TK V+ NGVQKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  134   KRRRVT-PTNLTDESVRWHKTGQTKPVIINGVQKGCKKIMVLYKSARKGLKPVKSNWVLH  192

Query  638   QYHLGIDEDEKEGGYVVSKIYY  573
             QYHLG +E E  G +VVSKI Y
Sbjct  193   QYHLGTEEGEI-GEFVVSKIIY  213



>ref|XP_010453573.1| PREDICTED: NAC domain-containing protein 8-like [Camelina sativa]
Length=346

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  1175  QKVRNASSPAENRIQDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLA  996
             + ++NA   +   I++CGA+  CPNC + +DNS+V   WPG P GVKFEP+D E +EHL 
Sbjct  14    RNIKNAPVSSALHIKECGASINCPNCSYSVDNSNVLAPWPGLPKGVKFEPTDEEAIEHLE  73

Query  995   AKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTR  816
             AKCG    +PH+ + +FI ++  D GI YTHP+NLPG+ KDG+S  FF +T  AY  G R
Sbjct  74    AKCGIDGLKPHLLIQDFIRSVTQDVGINYTHPQNLPGVNKDGTSVFFFNKTAHAYQNGQR  133

Query  815   KRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMH  639
             KRR+++  T+L  E VRWHKTG+TK V+ NGVQKGCKK+MVLY S +KG KP K+NWV+H
Sbjct  134   KRRRVT-PTNLTDESVRWHKTGQTKPVIINGVQKGCKKIMVLYKSARKGLKPEKSNWVLH  192

Query  638   QYHLGIDEDEKEGGYVVSKIYY  573
             QYHLG +E E  G +VVSKI Y
Sbjct  193   QYHLGTEEGEI-GEFVVSKITY  213



>ref|XP_007141005.1| hypothetical protein PHAVU_008G159200g [Phaseolus vulgaris]
 gb|ESW12999.1| hypothetical protein PHAVU_008G159200g [Phaseolus vulgaris]
Length=310

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 191/316 (60%), Gaps = 18/316 (6%)
 Frame = -1

Query  962  MFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSL  783
            MF++EFI TLEGD+GICYTHPENL G KKDGS  HFF+RT  AYATG RKRRKI ++  +
Sbjct  1    MFINEFITTLEGDQGICYTHPENLQGAKKDGSYFHFFHRTINAYATGQRKRRKIHHQQGV  60

Query  782  VMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEK  606
              EH RWHKTGKTKA++ENG+ KG KK+MVL+  +K G KP K+NWVMHQYHLG +EDEK
Sbjct  61   TEEHWRWHKTGKTKAIIENGICKGFKKIMVLHVRSKSGFKPYKSNWVMHQYHLGTEEDEK  120

Query  605  EGGYVVSKIYYqqqqqkQTTDNAGESDIPQAIPTTP----MTAIPNPPRAAGETPLSCDD  438
            EG YVVSKI+YQQQ++ +  ++    + P  I +          P  P  AG +   CDD
Sbjct  121  EGEYVVSKIFYQQQKKTEKNEDNPMVEDPDNIVSRTGPRTPKPNPPNPPRAGNSA-DCDD  179

Query  437  Y--NAALSPPAEEVEGGKKERYGSLWSDVQVKCEEYPGCLAGESQAA--ADATDIDDFLL  270
            Y       P A++ +    E    +  +  +    +   LAGESQA    +   +DD LL
Sbjct  180  YIDETVPLPSAQDTKAILGESLAPISDNHDLDSSAW---LAGESQAVEHIEYDGLDDILL  236

Query  269  CDEIVGSFDFNN---LPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQD  99
            C EI+ S    N   L S++     F    Q A N + S  I+ L  LELD+ P+F L +
Sbjct  237  CKEILDSSALLNDSGLDSSNLYDLAFYD-NQMARNDNESCGISVLDTLELDT-PDFDLSN  294

Query  98   LPFGSQDSISSWLDRL  51
              F SQDSI  W+ RL
Sbjct  295  FNFCSQDSILQWMGRL  310



>gb|KHN03216.1| NAC domain-containing protein 8 [Glycine soja]
Length=422

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_006572929.1| PREDICTED: uncharacterized protein LOC100795246 isoform X5 [Glycine 
max]
Length=448

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_006572925.1| PREDICTED: uncharacterized protein LOC100795246 isoform X1 [Glycine 
max]
 ref|XP_006572926.1| PREDICTED: uncharacterized protein LOC100795246 isoform X2 [Glycine 
max]
 ref|XP_006572927.1| PREDICTED: uncharacterized protein LOC100795246 isoform X3 [Glycine 
max]
 ref|XP_006572928.1| PREDICTED: uncharacterized protein LOC100795246 isoform X4 [Glycine 
max]
Length=451

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_008649295.1| PREDICTED: uncharacterized protein LOC103629975 isoform X2 [Zea 
mays]
Length=854

 Score =   246 bits (629),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 150/203 (74%), Gaps = 7/203 (3%)
 Frame = -1

Query  1172  KVRNASSPAENRIQDC--GATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHL  999
             K++NAS   +   Q      ++ECP C H+IDNSDV  +WPG P GVKF+PSD EL+ HL
Sbjct  16    KIKNASGSLDPSKQKWIGNPSKECPKCSHVIDNSDVVHQWPGLPKGVKFDPSDQELIWHL  75

Query  998   AAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGT  819
              AK G+   +PH F+DEFIPT+E DEGICYTHP+ LPG+K++GS  HFF+RT KAY TGT
Sbjct  76    MAKHGKSGIKPHPFIDEFIPTVEEDEGICYTHPQKLPGVKQNGSVSHFFHRTFKAYNTGT  135

Query  818   RKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQKGCKKVMVLY-STKKGEKPGKTNWVM  642
             RKRR+I+ + +     VRWHKTGKTK V+ +G   GCKK+MVLY S  KG K  KTNWV+
Sbjct  136   RKRRRINTDDA----DVRWHKTGKTKPVLVDGKHLGCKKIMVLYISPLKGGKAEKTNWVI  191

Query  641   HQYHLGIDEDEKEGGYVVSKIYY  573
             HQYHLG  EDE++G YVVSK+++
Sbjct  192   HQYHLGTGEDERDGEYVVSKLFF  214


 Score =   229 bits (584),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 202/366 (55%), Gaps = 41/366 (11%)
 Frame = -1

Query  1073  VSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPEN  894
             V  +WPG P GVKF+PSD EL+ HL AK G+   +PH F+DEFIPT+E DEGICYTHP+ 
Sbjct  493   VVHQWPGLPKGVKFDPSDQELIWHLMAKHGKSGIKPHPFIDEFIPTVEEDEGICYTHPQK  552

Query  893   LPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQK  714
             LPG+K++GS  HFF+RT KAY TGTRKRR+I+ + +     VRWHKTGKTK V+ +G   
Sbjct  553   LPGVKQNGSVSHFFHRTFKAYNTGTRKRRRINTDDA----DVRWHKTGKTKPVLVDGKHL  608

Query  713   GCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYYqqq--------q  561
             GCKK+MVLY S  KG K  KTNWV+HQYHLG  EDE++G YVVSK+++QQQ        Q
Sbjct  609   GCKKIMVLYISPLKGGKAEKTNWVIHQYHLGTGEDERDGEYVVSKLFFQQQFKPGDKNAQ  668

Query  560   qkQTTDN----AGESDIPQ--AIPT-----TPMTAIPNPPRAAGETPLSCD---DYNAAL  423
             +  T+D+    A ES++P    +PT     T    + NP     +   +C+   +    L
Sbjct  669   ELTTSDDLESMAAESNLPDFTTLPTDKHVGTVQEVVHNPEHNLYQLNRNCEISIEETVVL  728

Query  422   SPPAEEVEGGK--KERYGSLW-SDVQVKCEEYPGCLAGESQAAADATDIDDFLLCDEIV-  255
              P  +  + G   + +   LW  D Q +       L    Q A      D+FLL      
Sbjct  729   PPSVKTTKDGDNLQSQDQKLWEGDSQFE-------LLDSQQLAEGLALCDEFLLSQSQTS  781

Query  254   --GSFDFNNLPSNHATSANFNPMPQEANNTSSSTNIADLVNLELDSAPEFSLQDLPFGSQ  81
               G  +        A  A+ +    + +         D  NLELD+  EF L  + F SQ
Sbjct  782   CGGGDEPRETKPCLAAYAHLSAEDFKKDLECQRLEPTDNTNLELDNTDEFRLSQIEF-SQ  840

Query  80    DSISSW  63
             DS  +W
Sbjct  841   DSFMTW  846


 Score =   219 bits (558),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 5/168 (3%)
 Frame = -1

Query  1073  VSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFLDEFIPTLEGDEGICYTHPEN  894
             V  +WPG P GVKF+PSD EL+ HL AK G+   +PH F+DEFIPT+E DEGICYTHP+ 
Sbjct  272   VVHQWPGLPKGVKFDPSDQELIWHLMAKHGKSGIKPHPFIDEFIPTVEEDEGICYTHPQK  331

Query  893   LPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVMEHVRWHKTGKTKAVMENGVQK  714
             LPG+K++GS  HFF+RT KAY TGTRKRR+I+ + +     VRWHKTGKTK V+ +G   
Sbjct  332   LPGVKQNGSVSHFFHRTFKAYNTGTRKRRRINTDDA----DVRWHKTGKTKPVLVDGKHL  387

Query  713   GCKKVMVLY-STKKGEKPGKTNWVMHQYHLGIDEDEKEGGYVVSKIYY  573
             GCKK+MVLY S  KG K  KTNWV+HQYHLG  EDE++G YVVSK+++
Sbjct  388   GCKKIMVLYISPLKGGKAEKTNWVIHQYHLGAGEDERDGEYVVSKLFF  435



>gb|AIA57514.1| NAC domain-containing protein, partial [Boehmeria nivea]
Length=260

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP C H ++     P+W G PAGVKF+P+D EL+EHL AK  + + + H  +
Sbjct  26    QMCGS-KHCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEDKDIKSHPLI  81

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  82    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  141

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG Q+GCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  142   ETRWHKTGKTRPVMVNGKQRGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  201

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  202   LVVSKIFY  209



>ref|XP_004513073.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-like isoform X3 [Cicer 
arietinum]
Length=355

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 136/189 (72%), Gaps = 6/189 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+   CP+C H   N +  P+W G PAGVKF+P+D EL+EHL AK      + H  +
Sbjct  24    QLCGSNH-CPSCGH---NFESKPDWLGLPAGVKFDPTDQELIEHLEAKVEAKKMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVM-  777
             DEFIPT+EG++GICYTHPE LPG+ KDG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTKDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQQG  139

Query  776   EHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEG  600
                RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG
Sbjct  140   GETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEG  199

Query  599   GYVVSKIYY  573
               VVSKI+Y
Sbjct  200   ELVVSKIFY  208



>ref|XP_006584802.1| PREDICTED: uncharacterized protein LOC100799291 isoform X1 [Glycine 
max]
 ref|XP_006584803.1| PREDICTED: uncharacterized protein LOC100799291 isoform X2 [Glycine 
max]
Length=452

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+E+EG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQYEEEREGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_007152951.1| hypothetical protein PHAVU_004G174000g [Phaseolus vulgaris]
 ref|XP_007152952.1| hypothetical protein PHAVU_004G174000g [Phaseolus vulgaris]
 ref|XP_007152953.1| hypothetical protein PHAVU_004G174000g [Phaseolus vulgaris]
 gb|ESW24945.1| hypothetical protein PHAVU_004G174000g [Phaseolus vulgaris]
 gb|ESW24946.1| hypothetical protein PHAVU_004G174000g [Phaseolus vulgaris]
 gb|ESW24947.1| hypothetical protein PHAVU_004G174000g [Phaseolus vulgaris]
Length=448

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>gb|AHJ79166.1| NAC domain protein NAC25 [Gossypium hirsutum]
Length=321

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  23    QLCGS-KHCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+  DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTTDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_009352582.1| PREDICTED: uncharacterized protein LOC103943930 isoform X2 [Pyrus 
x bretschneideri]
Length=490

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_010541001.1| PREDICTED: uncharacterized protein LOC104814586 [Tarenaya hassleriana]
Length=462

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 6/189 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP+C H +D     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  23    QLCGSMK-CPSCGHKLDGK---PDWVGLPAGVKFDPTDQELIEHLEAKVSAKDIKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGS  138

Query  773   -HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEG  600
                RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+E+EG
Sbjct  139   GETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGTHEEEREG  198

Query  599   GYVVSKIYY  573
               VVSKI+Y
Sbjct  199   ELVVSKIFY  207



>emb|CDP03230.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 146/207 (71%), Gaps = 10/207 (5%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP C H +D     P+W G PAGVKF+P+D EL+EHL AK     S+ H  +
Sbjct  28    QLCGS-KHCPGCGHKLDGK---PDWVGLPAGVKFDPTDQELIEHLEAKVEGKESKSHPLI  83

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  84    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  143

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  144   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  203

Query  596   YVVSKIYYqqqqqk-----QTTDNAGE  531
              VVSKI+YQ Q ++     + T NAGE
Sbjct  204   LVVSKIFYQTQPRQCNWTERATTNAGE  230



>gb|KHN16660.1| NAC domain-containing protein 8 [Glycine soja]
Length=451

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+E+EG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQYEEEREGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>gb|KCW79603.1| hypothetical protein EUGRSUZ_C00958 [Eucalyptus grandis]
Length=483

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H +D     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  26    QICGS-KQCPGCGHKLDGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMKSHPLI  81

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  82    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  141

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  142   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  201

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  202   LVVSKIFY  209



>gb|KHN40359.1| NAC domain-containing protein 8 [Glycine soja]
Length=446

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL EHL AK    N + H  +
Sbjct  24    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELTEHLEAKVEAKNMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSKHFFHRPSKAYTTGTRKRRKIQNECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_006583563.1| PREDICTED: uncharacterized protein LOC100791884 isoform X1 [Glycine 
max]
 ref|XP_006583564.1| PREDICTED: uncharacterized protein LOC100791884 isoform X2 [Glycine 
max]
 ref|XP_006583565.1| PREDICTED: uncharacterized protein LOC100791884 isoform X3 [Glycine 
max]
 ref|XP_006583566.1| PREDICTED: uncharacterized protein LOC100791884 isoform X4 [Glycine 
max]
Length=447

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL EHL AK    N + H  +
Sbjct  25    QLCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELTEHLEAKVEAKNMKSHPLI  80

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  81    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSKHFFHRPSKAYTTGTRKRRKIQNECDLQGG  140

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  141   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  200

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  201   LVVSKIFY  208



>ref|XP_010047652.1| PREDICTED: uncharacterized protein LOC104436544 [Eucalyptus grandis]
 ref|XP_010047653.1| PREDICTED: uncharacterized protein LOC104436544 [Eucalyptus grandis]
 ref|XP_010047654.1| PREDICTED: uncharacterized protein LOC104436544 [Eucalyptus grandis]
 ref|XP_010047655.1| PREDICTED: uncharacterized protein LOC104436544 [Eucalyptus grandis]
 ref|XP_010047656.1| PREDICTED: uncharacterized protein LOC104436544 [Eucalyptus grandis]
 ref|XP_010047657.1| PREDICTED: uncharacterized protein LOC104436544 [Eucalyptus grandis]
 gb|KCW79601.1| hypothetical protein EUGRSUZ_C00958 [Eucalyptus grandis]
 gb|KCW79602.1| hypothetical protein EUGRSUZ_C00958 [Eucalyptus grandis]
Length=486

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H +D     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  26    QICGS-KQCPGCGHKLDGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMKSHPLI  81

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  82    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  141

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  142   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  201

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  202   LVVSKIFY  209



>ref|XP_009352580.1| PREDICTED: uncharacterized protein LOC103943930 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009352581.1| PREDICTED: uncharacterized protein LOC103943930 isoform X1 [Pyrus 
x bretschneideri]
Length=496

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>gb|AGS08757.1| NAC domain protein [Malus hupehensis]
Length=435

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H  +     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGHKFEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_010267099.1| PREDICTED: uncharacterized protein LOC104604461 isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGHKLERK---PDWLGLPAGVKFDPTDQELIEHLEAKVEGKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   DTRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_010267098.1| PREDICTED: uncharacterized protein LOC104604461 isoform X2 [Nelumbo 
nucifera]
Length=428

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGHKLERK---PDWLGLPAGVKFDPTDQELIEHLEAKVEGKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   DTRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_010267095.1| PREDICTED: uncharacterized protein LOC104604461 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267096.1| PREDICTED: uncharacterized protein LOC104604461 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267097.1| PREDICTED: uncharacterized protein LOC104604461 isoform X1 [Nelumbo 
nucifera]
Length=431

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGHKLERK---PDWLGLPAGVKFDPTDQELIEHLEAKVEGKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   DTRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_009789699.1| PREDICTED: NAC domain-containing protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=396

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 6/189 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKC-GEGNSEPHMF  957
             Q CG+ ++CP C   +D     P+W G PAGVKF+P+D EL+EHL AK   +  S+ H  
Sbjct  27    QLCGS-KQCPGCGQKLDGK---PDWVGLPAGVKFDPTDQELIEHLEAKVVSKKESKSHPL  82

Query  956   LDEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVM  777
             +DEFIPT+EG++GICYTHPE LPG+ KDG S HFF+R  KAY TGTRKRRKI  E  L  
Sbjct  83    IDEFIPTIEGEDGICYTHPEKLPGVTKDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQG  142

Query  776   EHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEG  600
                RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG +E+E+EG
Sbjct  143   GETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQNEEEREG  202

Query  599   GYVVSKIYY  573
               VVSKI+Y
Sbjct  203   ELVVSKIFY  211



>ref|XP_010526422.1| PREDICTED: uncharacterized protein LOC104803997 isoform X2 [Tarenaya 
hassleriana]
Length=471

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP+C H +D     P+W G PAGVKF+P+D EL+EHL AK    +++ H  +
Sbjct  22    QLCGS-KKCPSCGHKLDGK---PDWVGLPAGVKFDPTDQELIEHLGAKVLAKDTKSHPLI  77

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  +   
Sbjct  78    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDIQGS  137

Query  773   -HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEG  600
                RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+E+EG
Sbjct  138   GETRWHKTGKTRPVMINGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGTHEEEREG  197

Query  599   GYVVSKIYY  573
               VVSKI+Y
Sbjct  198   ELVVSKIFY  206



>ref|XP_010526421.1| PREDICTED: uncharacterized protein LOC104803997 isoform X1 [Tarenaya 
hassleriana]
Length=472

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP+C H +D     P+W G PAGVKF+P+D EL+EHL AK    +++ H  +
Sbjct  22    QLCGS-KKCPSCGHKLDGK---PDWVGLPAGVKFDPTDQELIEHLGAKVLAKDTKSHPLI  77

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI NE  +   
Sbjct  78    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQNECDIQGS  137

Query  773   -HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEG  600
                RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+E+EG
Sbjct  138   GETRWHKTGKTRPVMINGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGTHEEEREG  197

Query  599   GYVVSKIYY  573
               VVSKI+Y
Sbjct  198   ELVVSKIFY  206



>ref|XP_002514192.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48146.1| conserved hypothetical protein [Ricinus communis]
Length=460

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  23    QLCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVVAKDMKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_007012972.1| NAC domain containing protein 75 isoform 1 [Theobroma cacao]
 ref|XP_007012973.1| NAC domain containing protein 75 isoform 1 [Theobroma cacao]
 ref|XP_007012974.1| NAC domain containing protein 75 isoform 1 [Theobroma cacao]
 gb|EOY30591.1| NAC domain containing protein 75 isoform 1 [Theobroma cacao]
 gb|EOY30592.1| NAC domain containing protein 75 isoform 1 [Theobroma cacao]
 gb|EOY30593.1| NAC domain containing protein 75 isoform 1 [Theobroma cacao]
Length=461

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  23    QLCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_007012975.1| NAC domain containing protein 75 isoform 4 [Theobroma cacao]
 gb|EOY30594.1| NAC domain containing protein 75 isoform 4 [Theobroma cacao]
Length=462

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  23    QLCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_010244406.1| PREDICTED: uncharacterized protein LOC104588253 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244407.1| PREDICTED: uncharacterized protein LOC104588253 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244409.1| PREDICTED: uncharacterized protein LOC104588253 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244410.1| PREDICTED: uncharacterized protein LOC104588253 isoform X1 [Nelumbo 
nucifera]
Length=435

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C   ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGQKLERK---PDWLGLPAGVKFDPTDQELIEHLEAKVAGKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   DTRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_011007272.1| PREDICTED: uncharacterized protein LOC105113004 isoform X4 [Populus 
euphratica]
Length=402

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +   H  +
Sbjct  24    QLCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMRSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  +P KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRRPEKTNWVMHQYHLGQLEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_011007271.1| PREDICTED: uncharacterized protein LOC105113004 isoform X3 [Populus 
euphratica]
Length=442

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +   H  +
Sbjct  24    QLCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMRSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  +P KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRRPEKTNWVMHQYHLGQLEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



>ref|XP_010244411.1| PREDICTED: uncharacterized protein LOC104588253 isoform X2 [Nelumbo 
nucifera]
Length=434

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C   ++     P+W G PAGVKF+P+D EL+EHL AK    +S+ H  +
Sbjct  23    QMCGS-KQCPGCGQKLERK---PDWLGLPAGVKFDPTDQELIEHLEAKVAGKDSKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   DTRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_004135810.1| PREDICTED: uncharacterized protein LOC101216381 [Cucumis sativus]
Length=492

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  39    QMCGS-KHCPGCGHKLEGR---PDWVGLPAGVKFDPTDQELIEHLEAKVKSKDMKSHPLI  94

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  95    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  154

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  155   ETRWHKTGKTRPVMANGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  214

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  215   LVVSKIFY  222



>ref|XP_004158457.1| PREDICTED: uncharacterized LOC101216381 [Cucumis sativus]
Length=493

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  39    QMCGS-KHCPGCGHKLEGR---PDWVGLPAGVKFDPTDQELIEHLEAKVKSKDMKSHPLI  94

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  95    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  154

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  155   ETRWHKTGKTRPVMANGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  214

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  215   LVVSKIFY  222



>gb|KGN66194.1| hypothetical protein Csa_1G575100 [Cucumis sativus]
Length=494

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ + CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  39    QMCGS-KHCPGCGHKLEGR---PDWVGLPAGVKFDPTDQELIEHLEAKVKSKDMKSHPLI  94

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  95    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  154

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  155   ETRWHKTGKTRPVMANGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  214

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  215   LVVSKIFY  222



>ref|XP_010656246.1| PREDICTED: NAC domain-containing protein 8 isoform X3 [Vitis 
vinifera]
 emb|CAN61437.1| hypothetical protein VITISV_033770 [Vitis vinifera]
 emb|CBI27975.3| unnamed protein product [Vitis vinifera]
Length=454

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    + + H  +
Sbjct  23    QMCGS-KQCPGCGHKLE---TKPDWLGLPAGVKFDPTDQELIEHLEAKVEAKDMKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQLEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_007201969.1| hypothetical protein PRUPE_ppa004775mg [Prunus persica]
 gb|EMJ03168.1| hypothetical protein PRUPE_ppa004775mg [Prunus persica]
Length=492

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +++ H  +
Sbjct  23    QMCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEGKDTKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_008242461.1| PREDICTED: uncharacterized protein LOC103340794 [Prunus mume]
Length=488

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+ ++CP C H ++     P+W G PAGVKF+P+D EL+EHL AK    +++ H  +
Sbjct  23    QLCGS-KQCPGCGHKLEGK---PDWLGLPAGVKFDPTDQELIEHLEAKVEGKDTKSHPLI  78

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF+R  KAY TGTRKRRKI  E  L   
Sbjct  79    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHRPSKAYTTGTRKRRKIQTECDLQGG  138

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  139   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  198

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  199   LVVSKIFY  206



>ref|XP_004513071.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004513072.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-like isoform X2 [Cicer 
arietinum]
Length=418

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 136/189 (72%), Gaps = 6/189 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG+   CP+C H   N +  P+W G PAGVKF+P+D EL+EHL AK      + H  +
Sbjct  24    QLCGSNH-CPSCGH---NFESKPDWLGLPAGVKFDPTDQELIEHLEAKVEAKKMKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVM-  777
             DEFIPT+EG++GICYTHPE LPG+ KDG S HFF+R  KAY TGTRKRRKI NE  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTKDGLSRHFFHRPSKAYTTGTRKRRKIQNECDLQQG  139

Query  776   EHVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEG  600
                RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG
Sbjct  140   GETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEG  199

Query  599   GYVVSKIYY  573
               VVSKI+Y
Sbjct  200   ELVVSKIFY  208



>ref|XP_011078231.1| PREDICTED: uncharacterized protein LOC105162027 isoform X3 [Sesamum 
indicum]
Length=466

 Score =   236 bits (601),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1133  QDCGATRECPNCHHLIDNSDVSPEWPGFPAGVKFEPSDVELLEHLAAKCGEGNSEPHMFL  954
             Q CG +++CP C H+++     P+W G PAGVKF+P+D EL++HL AK     S+ H  +
Sbjct  24    QLCG-SKQCPGCGHMLEGK---PDWVGLPAGVKFDPTDQELIDHLEAKVEGKESKSHPLI  79

Query  953   DEFIPTLEGDEGICYTHPENLPGIKKDGSSGHFFYRTKKAYATGTRKRRKISNETSLVME  774
             DEFIPT+EG++GICYTHPE LPG+ +DG S HFF++T K Y TGTRKRRKI  E  L   
Sbjct  80    DEFIPTIEGEDGICYTHPEKLPGVTRDGLSRHFFHKTSKDYTTGTRKRRKIQTECDLQGG  139

Query  773   HVRWHKTGKTKAVMENGVQKGCKKVMVLYST-KKGEKPGKTNWVMHQYHLGIDEDEKEGG  597
               RWHKTGKT+ VM NG QKGCKK++VLY+   K  KP KTNWVMHQYHLG  E+EKEG 
Sbjct  140   ETRWHKTGKTRPVMVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLGQHEEEKEGE  199

Query  596   YVVSKIYY  573
              VVSKI+Y
Sbjct  200   LVVSKIFY  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2881079744160