BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c864_g2_i1 len=649 path=[1655:0-648]

Length=649
                                                                      Score     E

ref|XP_009771308.1|  PREDICTED: ethylene-responsive transcription...    163   2e-45   
ref|XP_011093328.1|  PREDICTED: ethylene-responsive transcription...    160   2e-44   
ref|XP_009613128.1|  PREDICTED: ethylene-responsive transcription...    160   3e-44   
ref|XP_011089857.1|  PREDICTED: ethylene-responsive transcription...    160   3e-44   
ref|XP_009613551.1|  PREDICTED: ethylene-responsive transcription...    160   3e-44   
ref|XP_006364331.1|  PREDICTED: ethylene-responsive transcription...    154   2e-42   
ref|XP_010661364.1|  PREDICTED: ethylene-responsive transcription...    154   4e-42   
ref|XP_009791350.1|  PREDICTED: ethylene-responsive transcription...    152   2e-41   
gb|EYU31917.1|  hypothetical protein MIMGU_mgv1a014733mg                149   3e-41   
ref|XP_004229764.1|  PREDICTED: ethylene-responsive transcription...    152   4e-41   
ref|XP_006347933.1|  PREDICTED: ethylene-responsive transcription...    150   8e-41   
gb|KHN43745.1|  Ethylene-responsive transcription factor ERF034         147   9e-41   
gb|AHB33875.1|  ERF transcription factor 04                             152   1e-40   
ref|XP_007134514.1|  hypothetical protein PHAVU_010G054000g             151   1e-40   
ref|XP_009628141.1|  PREDICTED: ethylene-responsive transcription...    150   1e-40   
gb|KDP28842.1|  hypothetical protein JCGZ_14613                         149   2e-40   
ref|XP_011032938.1|  PREDICTED: ethylene-responsive transcription...    150   4e-40   
ref|XP_003521085.1|  PREDICTED: ethylene-responsive transcription...    149   6e-40   
ref|XP_010258834.1|  PREDICTED: ethylene-responsive transcription...    149   8e-40   
ref|XP_010264429.1|  PREDICTED: ethylene-responsive transcription...    146   2e-39   
gb|ABQ62972.1|  TINY-like protein                                       146   6e-39   Populus trichocarpa [western balsam poplar]
gb|ACU24100.1|  unknown                                                 146   6e-39   Glycine max [soybeans]
gb|KHN34489.1|  Ethylene-responsive transcription factor ERF034         145   7e-39   
ref|XP_006375232.1|  hypothetical protein POPTR_0014s05500g             146   7e-39   
ref|XP_006345609.1|  PREDICTED: ethylene-responsive transcription...    144   7e-39   
emb|CDP09462.1|  unnamed protein product                                146   1e-38   
ref|XP_002511623.1|  Transcriptional factor TINY, putative              145   1e-38   Ricinus communis
ref|XP_003530164.1|  PREDICTED: ethylene-responsive transcription...    147   2e-38   
ref|XP_010264388.1|  PREDICTED: ethylene-responsive transcription...    144   4e-38   
ref|XP_007140776.1|  hypothetical protein PHAVU_008G141000g             144   8e-38   
gb|ADJ67431.1|  ethylene response factor 2                              143   9e-38   
ref|XP_007052232.1|  Integrase-type DNA-binding superfamily prote...    143   1e-37   
ref|XP_009400894.1|  PREDICTED: ethylene-responsive transcription...    141   3e-37   
ref|XP_002301249.2|  hypothetical protein POPTR_0002s14210g             142   3e-37   Populus trichocarpa [western balsam poplar]
gb|ABQ62971.1|  TINY-like protein                                       140   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006368997.1|  hypothetical protein POPTR_0001s15550g             140   4e-37   
ref|XP_010056415.1|  PREDICTED: ethylene-responsive transcription...    141   7e-37   
ref|XP_004240059.1|  PREDICTED: ethylene-responsive transcription...    139   2e-36   
ref|XP_007155687.1|  hypothetical protein PHAVU_003G222600g             138   2e-36   
ref|XP_004512200.1|  PREDICTED: ethylene-responsive transcription...    138   2e-36   
ref|XP_003626728.1|  Ethylene-responsive transcription factor TINY      137   2e-36   
ref|XP_008232393.1|  PREDICTED: ethylene-responsive transcription...    139   3e-36   
gb|ABQ62974.1|  TINY-like protein                                       139   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009401144.1|  PREDICTED: ethylene-responsive transcription...    138   4e-36   
ref|XP_004301177.1|  PREDICTED: ethylene-responsive transcription...    137   5e-36   
ref|XP_007218799.1|  hypothetical protein PRUPE_ppa009812mg             138   6e-36   
ref|XP_003611338.1|  Ethylene-responsive transcription factor TINY      135   7e-36   
ref|XP_003516798.1|  PREDICTED: ethylene-responsive transcription...    137   8e-36   
ref|XP_007039780.1|  Integrase-type DNA-binding superfamily prote...    136   1e-35   
ref|XP_002303364.1|  hypothetical protein POPTR_0003s07700g             136   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011001450.1|  PREDICTED: ethylene-responsive transcription...    137   2e-35   
ref|XP_004301176.1|  PREDICTED: ethylene-responsive transcription...    134   2e-35   
gb|AAX23704.1|  HvCBF7                                                  135   3e-35   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003635248.1|  PREDICTED: ethylene-responsive transcription...    134   5e-35   
ref|XP_010544587.1|  PREDICTED: ethylene-responsive transcription...    135   6e-35   
ref|XP_003622605.1|  Ethylene-responsive transcription factor ERF034    134   6e-35   
ref|XP_008238439.1|  PREDICTED: ethylene-responsive transcription...    135   8e-35   
ref|XP_004510113.1|  PREDICTED: ethylene-responsive transcription...    133   2e-34   
ref|XP_008356544.1|  PREDICTED: ethylene-responsive transcription...    134   2e-34   
ref|XP_007038336.1|  Ethylene response factor 2                         134   2e-34   
ref|XP_010919644.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    134   2e-34   
emb|CDX71804.1|  BnaC08g30700D                                          133   2e-34   
ref|XP_011016474.1|  PREDICTED: ethylene-responsive transcription...    133   3e-34   
ref|XP_008347085.1|  PREDICTED: ethylene-responsive transcription...    133   4e-34   
ref|XP_004508937.1|  PREDICTED: ethylene-responsive transcription...    132   5e-34   
emb|CDY41162.1|  BnaA09g38530D                                          132   5e-34   
ref|XP_009116730.1|  PREDICTED: ethylene-responsive transcription...    132   5e-34   
ref|XP_007209502.1|  hypothetical protein PRUPE_ppa010340mg             132   7e-34   
ref|XP_006445373.1|  hypothetical protein CICLE_v10021740mg             132   7e-34   
gb|AGB05623.1|  DREB4A family transcription factor 2                    130   1e-33   
ref|XP_009387933.1|  PREDICTED: ethylene-responsive transcription...    130   1e-33   
emb|CBI16632.3|  unnamed protein product                                137   2e-33   
ref|XP_011031921.1|  PREDICTED: ethylene-responsive transcription...    130   2e-33   
gb|KFK36467.1|  hypothetical protein AALP_AA4G128400                    129   4e-33   
ref|XP_011048423.1|  PREDICTED: ethylene-responsive transcription...    130   4e-33   
gb|KDP39899.1|  hypothetical protein JCGZ_03430                         130   4e-33   
ref|XP_007010564.1|  Ethylene response factor 2                         131   4e-33   
ref|XP_002880148.1|  hypothetical protein ARALYDRAFT_483623             131   4e-33   
ref|XP_006397675.1|  hypothetical protein EUTSA_v10001792mg             131   5e-33   
emb|CDX98416.1|  BnaC06g17770D                                          130   5e-33   
ref|XP_009400694.1|  PREDICTED: ethylene-responsive transcription...    130   6e-33   
ref|XP_004162335.1|  PREDICTED: ethylene-responsive transcription...    129   6e-33   
ref|XP_004492188.1|  PREDICTED: ethylene-responsive transcription...    129   6e-33   
ref|XP_008448820.1|  PREDICTED: ethylene-responsive transcription...    128   8e-33   
emb|CDX79619.1|  BnaC03g19550D                                          128   9e-33   
ref|XP_008803818.1|  PREDICTED: ethylene-responsive transcription...    130   1e-32   
gb|EPS69678.1|  hypothetical protein M569_05091                         125   1e-32   
ref|XP_010524419.1|  PREDICTED: ethylene-responsive transcription...    130   1e-32   
ref|XP_006477148.1|  PREDICTED: ethylene-responsive transcription...    130   1e-32   
gb|KDO61381.1|  hypothetical protein CISIN_1g023148mg                   129   1e-32   
gb|KDO61382.1|  hypothetical protein CISIN_1g023148mg                   129   2e-32   
ref|XP_009133039.1|  PREDICTED: ethylene-responsive transcription...    127   2e-32   
ref|XP_004252501.1|  PREDICTED: dehydration-responsive element-bi...    125   2e-32   
gb|KDO61383.1|  hypothetical protein CISIN_1g023148mg                   128   2e-32   
ref|XP_006440269.1|  hypothetical protein CICLE_v10024602mg             129   2e-32   
ref|XP_002876560.1|  hypothetical protein ARALYDRAFT_486521             128   3e-32   
ref|NP_001235341.1|  dehydration-responsive element binding prote...    127   3e-32   
ref|NP_182021.1|  ethylene-responsive transcription factor ERF034       129   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597699.1|  Ethylene-responsive transcription factor TINY      126   4e-32   
ref|XP_009104264.1|  PREDICTED: ethylene-responsive transcription...    127   5e-32   
emb|CDX67829.1|  BnaA07g18690D                                          127   5e-32   
ref|XP_006402577.1|  hypothetical protein EUTSA_v10006200mg             127   6e-32   
ref|XP_010516772.1|  PREDICTED: ethylene-responsive transcription...    125   6e-32   
ref|XP_004147220.1|  PREDICTED: ethylene-responsive transcription...    126   6e-32   
gb|KEH36063.1|  AP2 domain class transcription factor                   125   6e-32   
gb|ACJ84469.1|  unknown                                                 125   7e-32   Medicago truncatula
ref|XP_003549925.1|  PREDICTED: ethylene-responsive transcription...    126   8e-32   
gb|ABR16697.1|  unknown                                                 127   8e-32   Picea sitchensis
gb|KFK37291.1|  hypothetical protein AALP_AA4G238300                    127   1e-31   
ref|XP_010509574.1|  PREDICTED: ethylene-responsive transcription...    125   1e-31   
gb|AFG61639.1|  hypothetical protein 0_14481_01                         124   1e-31   
gb|AAM64613.1|  putative AP2 domain transcription factor                127   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008646010.1|  PREDICTED: ethylene-responsive transcription...    127   1e-31   
ref|XP_010518106.1|  PREDICTED: ethylene-responsive transcription...    127   2e-31   
ref|XP_009143083.1|  PREDICTED: ethylene-responsive transcription...    127   2e-31   
ref|NP_181113.1|  ethylene-responsive transcription factor ERF038       124   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AFG61640.1|  hypothetical protein 0_14481_01                         123   2e-31   
emb|CDX74699.1|  BnaA05g04450D                                          126   2e-31   
ref|XP_006295043.1|  hypothetical protein CARUB_v10024111mg             124   2e-31   
ref|XP_004501158.1|  PREDICTED: dehydration-responsive element-bi...    124   2e-31   
gb|ABK28523.1|  unknown                                                 124   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193408.1|  ethylene-responsive transcription factor ERF039       124   2e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18963.1|  BnaC04g03870D                                          126   2e-31   
ref|XP_009344189.1|  PREDICTED: ethylene-responsive transcription...    126   2e-31   
ref|XP_007157270.1|  hypothetical protein PHAVU_002G056800g             124   2e-31   
ref|XP_002868104.1|  hypothetical protein ARALYDRAFT_493200             123   3e-31   
ref|XP_010434773.1|  PREDICTED: ethylene-responsive transcription...    123   3e-31   
ref|XP_008369428.1|  PREDICTED: ethylene-responsive transcription...    125   3e-31   
ref|XP_006282732.1|  hypothetical protein CARUB_v10005867mg             123   3e-31   
ref|XP_008462760.1|  PREDICTED: ethylene-responsive transcription...    125   3e-31   
ref|XP_010440105.1|  PREDICTED: ethylene-responsive transcription...    123   3e-31   
gb|AES90882.2|  ethylene response factor                                125   4e-31   
gb|EAZ16971.1|  hypothetical protein OsJ_32455                          125   4e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004161329.1|  PREDICTED: dehydration-responsive element-bi...    125   5e-31   
emb|CDY09667.1|  BnaC07g33940D                                          123   5e-31   
ref|XP_009136807.1|  PREDICTED: ethylene-responsive transcription...    122   6e-31   
ref|XP_003608685.1|  Ethylene-responsive transcription factor TINY      125   6e-31   
ref|XP_009133691.1|  PREDICTED: ethylene-responsive transcription...    125   6e-31   
ref|XP_010677077.1|  PREDICTED: ethylene-responsive transcription...    124   7e-31   
ref|XP_002879568.1|  hypothetical protein ARALYDRAFT_482537             122   7e-31   
ref|NP_001239694.1|  dehydration-responsive element-binding prote...    122   7e-31   
ref|NP_001241356.1|  dehydration-responsive element-binding prote...    123   7e-31   
ref|XP_004148719.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    124   7e-31   
ref|XP_004307005.1|  PREDICTED: ethylene-responsive transcription...    125   7e-31   
gb|KDO49961.1|  hypothetical protein CISIN_1g0410151mg                  123   8e-31   
ref|XP_010104873.1|  Dehydration-responsive element-binding prote...    124   8e-31   
gb|ACU23160.1|  unknown                                                 122   8e-31   Glycine max [soybeans]
gb|KDP34150.1|  hypothetical protein JCGZ_07721                         124   9e-31   
ref|XP_009368950.1|  PREDICTED: ethylene-responsive transcription...    124   9e-31   
ref|XP_010089277.1|  Ethylene-responsive transcription factor           124   9e-31   
gb|KFK22266.1|  hypothetical protein AALP_AAs66747U002200               122   9e-31   
emb|CDY72344.1|  BnaCnng77210D                                          122   9e-31   
ref|XP_006359467.1|  PREDICTED: dehydration-responsive element-bi...    123   9e-31   
ref|XP_010102390.1|  Dehydration-responsive element-binding prote...    124   1e-30   
ref|XP_010053505.1|  PREDICTED: ethylene-responsive transcription...    123   1e-30   
ref|XP_006414307.1|  hypothetical protein EUTSA_v10026276mg             122   1e-30   
gb|KFK35254.1|  hypothetical protein AALP_AA5G261400                    124   1e-30   
ref|XP_010469178.1|  PREDICTED: ethylene-responsive transcription...    124   1e-30   
gb|AEM63548.1|  dehydration-responsive element-binding protein DREB1    123   1e-30   
ref|XP_006837306.1|  hypothetical protein AMTR_s00111p00051610          126   1e-30   
ref|XP_010508227.1|  PREDICTED: ethylene-responsive transcription...    124   1e-30   
gb|EPS67314.1|  hypothetical protein M569_07461                         121   1e-30   
ref|XP_009145506.1|  PREDICTED: ethylene-responsive transcription...    122   1e-30   
gb|KHN34916.1|  Dehydration-responsive element-binding protein 3        122   1e-30   
ref|XP_010413552.1|  PREDICTED: ethylene-responsive transcription...    124   1e-30   
emb|CDX83411.1|  BnaA03g20950D                                          124   1e-30   
ref|XP_009617333.1|  PREDICTED: ethylene-responsive transcription...    123   2e-30   
ref|XP_004136219.1|  PREDICTED: ethylene-responsive transcription...    123   2e-30   
emb|CDP09993.1|  unnamed protein product                                122   2e-30   
ref|XP_010506433.1|  PREDICTED: ethylene-responsive transcription...    124   2e-30   
ref|NP_001047629.1|  Os02g0657000                                       122   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010505090.1|  PREDICTED: ethylene-responsive transcription...    122   2e-30   
ref|XP_008796155.1|  PREDICTED: ethylene-responsive transcription...    123   2e-30   
ref|XP_004170993.1|  PREDICTED: ethylene-responsive transcription...    121   2e-30   
ref|XP_008466061.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-30   
ref|XP_009780384.1|  PREDICTED: dehydration-responsive element-bi...    123   2e-30   
ref|XP_010691437.1|  PREDICTED: ethylene-responsive transcription...    123   2e-30   
ref|XP_009596664.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-30   
ref|XP_006340419.1|  PREDICTED: ethylene-responsive transcription...    121   2e-30   
ref|XP_010249578.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-30   
gb|EYU20436.1|  hypothetical protein MIMGU_mgv1a024757mg                122   2e-30   
ref|XP_008460188.1|  PREDICTED: ethylene-responsive transcription...    122   3e-30   
ref|XP_004953340.1|  PREDICTED: ethylene-responsive transcription...    123   3e-30   
dbj|BAJ87193.1|  predicted protein                                      123   3e-30   
gb|AAX28965.1|  TmCBF7                                                  123   3e-30   Triticum monococcum [einkorn wheat]
ref|XP_009142308.1|  PREDICTED: ethylene-responsive transcription...    123   3e-30   
ref|XP_006359762.1|  PREDICTED: dehydration-responsive element-bi...    121   3e-30   
ref|NP_001047627.1|  Os02g0656600                                       123   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EPS69652.1|  hypothetical protein M569_05115                         120   3e-30   
ref|XP_006410739.1|  hypothetical protein EUTSA_v10017258mg             121   3e-30   
ref|XP_003538748.1|  PREDICTED: dehydration-responsive element-bi...    121   4e-30   
ref|XP_004165656.1|  PREDICTED: ethylene-responsive transcription...    122   4e-30   
ref|XP_004245167.1|  PREDICTED: dehydration-responsive element-bi...    121   4e-30   
ref|XP_006421614.1|  hypothetical protein CICLE_v10006536mg             122   4e-30   
emb|CDX95624.1|  BnaC03g25050D                                          123   4e-30   
gb|KHN15832.1|  Dehydration-responsive element-binding protein 3        121   4e-30   
ref|XP_002516502.1|  Transcriptional factor TINY, putative              122   4e-30   Ricinus communis
gb|AID55125.1|  ethylene responsive factor 20                           119   5e-30   
ref|XP_002987168.1|  hypothetical protein SELMODRAFT_26604              120   5e-30   
ref|XP_009389773.1|  PREDICTED: ethylene-responsive transcription...    121   5e-30   
ref|XP_006399666.1|  hypothetical protein EUTSA_v10015895mg             122   6e-30   
ref|XP_007012129.1|  Integrase-type DNA-binding superfamily protein     122   6e-30   
ref|NP_001151300.1|  dehydration-responsive element-binding prote...    122   6e-30   Zea mays [maize]
ref|XP_004140628.1|  PREDICTED: ethylene-responsive transcription...    121   6e-30   
ref|XP_010449723.1|  PREDICTED: ethylene-responsive transcription...    120   6e-30   
ref|XP_010692104.1|  PREDICTED: ethylene-responsive transcription...    123   6e-30   
emb|CDY42937.1|  BnaA01g18170D                                          120   6e-30   
ref|XP_006294983.1|  hypothetical protein CARUB_v10024051mg             120   7e-30   
ref|XP_011004731.1|  PREDICTED: dehydration-responsive element-bi...    121   8e-30   
ref|XP_002324799.1|  hypothetical protein POPTR_0018s00270g             121   8e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006294662.1|  hypothetical protein CARUB_v10023699mg             122   8e-30   
ref|XP_009138144.1|  PREDICTED: ethylene-responsive transcription...    121   9e-30   
gb|KFK32565.1|  hypothetical protein AALP_AA6G259700                    120   9e-30   
ref|XP_010538410.1|  PREDICTED: ethylene-responsive transcription...    119   1e-29   
ref|XP_002454537.1|  hypothetical protein SORBIDRAFT_04g032940          120   1e-29   Sorghum bicolor [broomcorn]
ref|XP_010688291.1|  PREDICTED: ethylene-responsive transcription...    122   1e-29   
emb|CDY27827.1|  BnaC09g28540D                                          120   1e-29   
ref|XP_010049108.1|  PREDICTED: ethylene-responsive transcription...    121   1e-29   
ref|XP_011091185.1|  PREDICTED: ethylene-responsive transcription...    121   1e-29   
ref|XP_010429589.1|  PREDICTED: ethylene-responsive transcription...    120   1e-29   
ref|XP_008437812.1|  PREDICTED: ethylene-responsive transcription...    120   1e-29   
ref|XP_007161494.1|  hypothetical protein PHAVU_001G073800g             120   1e-29   
emb|CDP08151.1|  unnamed protein product                                121   1e-29   
ref|XP_010472602.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_006490227.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_006476039.1|  PREDICTED: dehydration-responsive element-bi...    120   2e-29   
ref|XP_003635442.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
emb|CDY13503.1|  BnaA03g52210D                                          120   2e-29   
ref|XP_008646011.1|  PREDICTED: ethylene-responsive transcription...    121   2e-29   
ref|XP_004235656.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_006450687.1|  hypothetical protein CICLE_v10009370mg             120   2e-29   
ref|NP_191608.1|  ethylene-responsive transcription factor ERF035       120   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008378086.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_009397875.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_010646855.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_010417360.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_002873522.1|  hypothetical protein ARALYDRAFT_487996             120   2e-29   
ref|XP_009125819.1|  PREDICTED: dehydration-responsive element-bi...    120   2e-29   
ref|XP_009767580.1|  PREDICTED: dehydration-responsive element-bi...    119   2e-29   
ref|XP_010254012.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
gb|AAW28084.1|  transcription factor DREBIII-1                          119   2e-29   Brassica napus [oilseed rape]
ref|XP_009398119.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_011012511.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   
ref|XP_002283864.1|  PREDICTED: ethylene-responsive transcription...    120   2e-29   Vitis vinifera
emb|CBI23469.3|  unnamed protein product                                120   2e-29   
emb|CDX85705.1|  BnaA02g01080D                                          120   3e-29   
ref|XP_010062516.1|  PREDICTED: ethylene-responsive transcription...    120   3e-29   
ref|XP_009776195.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-29   
ref|XP_003529759.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-29   
gb|KCW79144.1|  hypothetical protein EUGRSUZ_C00590                     118   3e-29   
ref|XP_006289586.1|  hypothetical protein CARUB_v10003136mg             119   3e-29   
ref|XP_010419734.1|  PREDICTED: dehydration-responsive element-bi...    120   3e-29   
ref|XP_006653648.1|  PREDICTED: ethylene-responsive transcription...    119   3e-29   
ref|XP_010098118.1|  Ethylene-responsive transcription factor TINY      120   3e-29   
emb|CDX97125.1|  BnaC09g45000D                                          120   3e-29   
ref|XP_009602025.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-29   
ref|XP_004291182.1|  PREDICTED: dehydration-responsive element-bi...    120   3e-29   
emb|CDX69746.1|  BnaA10g20950D                                          120   3e-29   
ref|XP_002303301.1|  hypothetical protein POPTR_0003s04920g             119   3e-29   Populus trichocarpa [western balsam poplar]
gb|AFW72636.1|  putative AP2/EREBP transcription factor superfami...    120   3e-29   
ref|XP_011004913.1|  PREDICTED: ethylene-responsive transcription...    119   3e-29   
ref|XP_009121933.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-29   
ref|XP_004150289.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-29   
emb|CDY32094.1|  BnaC04g44720D                                          118   3e-29   
emb|CBI29555.3|  unnamed protein product                                120   4e-29   
ref|XP_004172022.1|  PREDICTED: dehydration-responsive element-bi...    119   4e-29   
ref|XP_010660384.1|  PREDICTED: ethylene-responsive transcription...    119   4e-29   
ref|XP_003542090.1|  PREDICTED: dehydration-responsive element-bi...    119   4e-29   
ref|XP_008348502.1|  PREDICTED: ethylene-responsive transcription...    119   4e-29   
emb|CDY72553.1|  BnaAnng41450D                                          118   4e-29   
ref|XP_009141508.1|  PREDICTED: ethylene-responsive transcription...    118   4e-29   
ref|XP_002298236.1|  hypothetical protein POPTR_0001s18800g             119   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002976278.1|  hypothetical protein SELMODRAFT_26594              117   4e-29   
ref|XP_010512376.1|  PREDICTED: ethylene-responsive transcription...    120   4e-29   
emb|CDY66961.1|  BnaC09g50850D                                          119   4e-29   
gb|AGE97368.1|  ethylene response factor 13                             120   4e-29   
gb|ACI95260.1|  dehydration-responsive element binding protein          118   4e-29   Aloe vera [acibar]
ref|XP_010454922.1|  PREDICTED: ethylene-responsive transcription...    119   4e-29   
ref|XP_006353483.1|  PREDICTED: ethylene-responsive transcription...    120   5e-29   
ref|XP_002280555.2|  PREDICTED: dehydration-responsive element-bi...    120   5e-29   
ref|XP_009801170.1|  PREDICTED: dehydration-responsive element-bi...    118   5e-29   
ref|XP_008445017.1|  PREDICTED: ethylene-responsive transcription...    119   5e-29   
ref|XP_010421439.1|  PREDICTED: ethylene-responsive transcription...    119   5e-29   
ref|XP_009391523.1|  PREDICTED: ethylene-responsive transcription...    119   5e-29   
ref|XP_009367456.1|  PREDICTED: ethylene-responsive transcription...    119   5e-29   
ref|XP_008458661.1|  PREDICTED: dehydration-responsive element-bi...    119   5e-29   
ref|XP_006291643.1|  hypothetical protein CARUB_v10017799mg             120   6e-29   
emb|CDX84176.1|  BnaC04g09380D                                          118   6e-29   
gb|ABA54282.1|  transcription factor DREBIII-4                          118   6e-29   
ref|XP_010915419.1|  PREDICTED: dehydration-responsive element-bi...    119   6e-29   
ref|XP_010248418.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    122   6e-29   
emb|CAH67502.1|  OSIGBa0134H18.4                                        120   6e-29   
ref|XP_009399816.1|  PREDICTED: ethylene-responsive transcription...    119   6e-29   
gb|ABA54281.1|  transcription factor DREBIII-3                          118   6e-29   
gb|KFK25419.1|  hypothetical protein AALP_AA8G112500                    119   6e-29   
gb|KHM98729.1|  Dehydration-responsive element-binding protein 3        117   6e-29   
ref|XP_009143633.1|  PREDICTED: ethylene-responsive transcription...    118   6e-29   
ref|XP_006343055.1|  PREDICTED: dehydration-responsive element-bi...    119   6e-29   
ref|XP_009413850.1|  PREDICTED: dehydration-responsive element-bi...    119   6e-29   
ref|XP_009140700.1|  PREDICTED: ethylene-responsive transcription...    118   6e-29   
ref|XP_007024262.1|  Integrase-type DNA-binding superfamily protein     119   7e-29   
ref|XP_010493837.1|  PREDICTED: ethylene-responsive transcription...    118   7e-29   
emb|CAN72553.1|  hypothetical protein VITISV_015791                     119   7e-29   
ref|XP_008220077.1|  PREDICTED: dehydration-responsive element-bi...    119   8e-29   
gb|EPS64897.1|  hypothetical protein M569_09882                         118   8e-29   
ref|XP_009151103.1|  PREDICTED: ethylene-responsive transcription...    118   8e-29   
ref|XP_004139438.1|  PREDICTED: dehydration-responsive element-bi...    119   8e-29   
gb|ABA54280.1|  transcription factor DREBIII-2                          117   8e-29   
ref|NP_196720.1|  dehydration-responsive element-binding protein 3      118   8e-29   
ref|XP_006451256.1|  hypothetical protein CICLE_v10009138mg             119   8e-29   
ref|XP_008795185.1|  PREDICTED: dehydration-responsive element-bi...    119   9e-29   
ref|XP_007013070.1|  Integrase-type DNA-binding superfamily protein     119   9e-29   
ref|NP_001234759.1|  dehydration responsive element binding protein     119   1e-28   
ref|XP_002324441.2|  hypothetical protein POPTR_0018s09270g             119   1e-28   
ref|XP_002976414.1|  hypothetical protein SELMODRAFT_104978             117   1e-28   
gb|KDO66509.1|  hypothetical protein CISIN_1g041119mg                   119   1e-28   
gb|ABO48369.1|  TINY-like protein 2                                     119   1e-28   
ref|XP_011078266.1|  PREDICTED: ethylene-responsive transcription...    119   1e-28   
ref|XP_010542218.1|  PREDICTED: ethylene-responsive transcription...    118   1e-28   
ref|XP_009353569.1|  PREDICTED: ethylene-responsive transcription...    118   1e-28   
ref|XP_009782186.1|  PREDICTED: ethylene-responsive transcription...    119   1e-28   
ref|XP_003546954.1|  PREDICTED: ethylene-responsive transcription...    117   1e-28   
ref|XP_006394830.1|  hypothetical protein EUTSA_v10004870mg             118   1e-28   
gb|KDP33726.1|  hypothetical protein JCGZ_07297                         118   1e-28   
ref|XP_002454993.1|  hypothetical protein SORBIDRAFT_03g002630          118   1e-28   
emb|CDY45018.1|  BnaA08g12010D                                          117   1e-28   
ref|NP_197953.1|  ethylene-responsive transcription factor TINY         117   1e-28   
ref|XP_006412430.1|  hypothetical protein EUTSA_v10026204mg             117   1e-28   
ref|XP_008228463.1|  PREDICTED: ethylene-responsive transcription...    118   1e-28   
emb|CDX72373.1|  BnaC07g43950D                                          118   1e-28   
ref|XP_002454539.1|  hypothetical protein SORBIDRAFT_04g032960          119   1e-28   
ref|XP_002514246.1|  Transcriptional factor TINY, putative              119   1e-28   
gb|KFK27825.1|  hypothetical protein AALP_AA8G434600                    117   1e-28   
ref|XP_010542217.1|  PREDICTED: ethylene-responsive transcription...    118   1e-28   
ref|XP_009111677.1|  PREDICTED: ethylene-responsive transcription...    117   1e-28   
emb|CDY19794.1|  BnaA09g04470D                                          117   1e-28   
ref|XP_003626994.1|  Ethylene-responsive transcription factor TINY      117   1e-28   
gb|EYU29281.1|  hypothetical protein MIMGU_mgv1a024895mg                118   1e-28   
ref|XP_010668364.1|  PREDICTED: dehydration-responsive element-bi...    119   1e-28   
gb|KHN04233.1|  Dehydration-responsive element-binding protein 3        117   1e-28   
ref|XP_009108829.1|  PREDICTED: ethylene-responsive transcription...    117   2e-28   
ref|XP_006381752.1|  hypothetical protein POPTR_0006s17670g             119   2e-28   
ref|XP_002987250.1|  hypothetical protein SELMODRAFT_125385             116   2e-28   
ref|XP_008678900.1|  PREDICTED: ethylene-responsive transcription...    118   2e-28   
emb|CDX80539.1|  BnaC07g29050D                                          117   2e-28   
ref|XP_008775170.1|  PREDICTED: ethylene-responsive transcription...    117   2e-28   
ref|XP_007225774.1|  hypothetical protein PRUPE_ppa009533mg             119   2e-28   
ref|XP_002991098.1|  hypothetical protein SELMODRAFT_71661              115   2e-28   
ref|XP_011009351.1|  PREDICTED: ethylene-responsive transcription...    119   2e-28   
ref|NP_001237808.1|  TINY                                               118   2e-28   
gb|AGE97369.1|  ethylene response factor 14                             118   2e-28   
gb|ABQ62966.1|  TINY-like protein                                       119   2e-28   
ref|XP_007215988.1|  hypothetical protein PRUPE_ppa011735mg             116   2e-28   
emb|CDY35334.1|  BnaA04g15130D                                          117   2e-28   
gb|KCW79102.1|  hypothetical protein EUGRSUZ_C00546                     117   2e-28   
ref|XP_010910974.1|  PREDICTED: ethylene-responsive transcription...    117   2e-28   
ref|XP_004134290.1|  PREDICTED: ethylene-responsive transcription...    117   2e-28   
ref|XP_009380474.1|  PREDICTED: ethylene-responsive transcription...    117   2e-28   
ref|XP_009384462.1|  PREDICTED: ethylene-responsive transcription...    117   2e-28   
ref|XP_010526108.1|  PREDICTED: ethylene-responsive transcription...    118   3e-28   
gb|ADE41137.1|  AP2 domain class transcription factor                   117   3e-28   
ref|XP_002278906.1|  PREDICTED: dehydration-responsive element-bi...    117   3e-28   
ref|XP_009799693.1|  PREDICTED: ethylene-responsive transcription...    117   3e-28   
ref|XP_006289163.1|  hypothetical protein CARUB_v10002601mg             117   3e-28   
ref|NP_001053487.1|  Os04g0550200                                       117   3e-28   
ref|XP_009588133.1|  PREDICTED: ethylene-responsive transcription...    117   3e-28   
ref|NP_001053486.1|  Os04g0549700                                       118   3e-28   
emb|CAH67505.1|  OSIGBa0134H18.7                                        117   3e-28   
ref|XP_004241746.1|  PREDICTED: dehydration-responsive element-bi...    116   3e-28   
ref|XP_007137220.1|  hypothetical protein PHAVU_009G109600g             116   3e-28   
ref|XP_009409377.1|  PREDICTED: ethylene-responsive transcription...    118   3e-28   
ref|XP_004510292.1|  PREDICTED: ethylene-responsive transcription...    116   3e-28   
gb|EPS62061.1|  hypothetical protein M569_12735                         114   3e-28   
emb|CDX77012.1|  BnaC04g38070D                                          116   4e-28   
ref|XP_008810659.1|  PREDICTED: ethylene-responsive transcription...    116   4e-28   
ref|XP_007135647.1|  hypothetical protein PHAVU_010G146600g             116   4e-28   
gb|ADE41141.1|  AP2 domain class transcription factor                   117   4e-28   
ref|XP_011072408.1|  PREDICTED: dehydration-responsive element-bi...    116   4e-28   
ref|XP_009421285.1|  PREDICTED: ethylene-responsive transcription...    116   4e-28   
ref|XP_009404533.1|  PREDICTED: ethylene-responsive transcription...    116   4e-28   
ref|XP_006853624.1|  hypothetical protein AMTR_s00056p00064760          118   4e-28   
ref|XP_010047241.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    117   4e-28   
ref|NP_565609.3|  ethylene-responsive transcription factor ERF042       116   4e-28   
ref|NP_001105081.1|  DREB-like protein                                  117   5e-28   
ref|XP_009596026.1|  PREDICTED: dehydration-responsive element-bi...    115   5e-28   
gb|AAM80485.1|AF493799_1  DRE binding factor 2                          117   5e-28   
gb|AET05216.2|  ethylene response factor                                116   6e-28   
ref|XP_008353703.1|  PREDICTED: ethylene-responsive transcription...    116   6e-28   
ref|XP_010925663.1|  PREDICTED: ethylene-responsive transcription...    117   6e-28   
ref|XP_011048337.1|  PREDICTED: ethylene-responsive transcription...    117   7e-28   
gb|ACF74280.1|  DREB-like protein                                       115   7e-28   
ref|XP_004503470.1|  PREDICTED: dehydration-responsive element-bi...    116   7e-28   
ref|NP_195006.1|  ethylene-responsive transcription factor ERF043       115   7e-28   
ref|XP_009377993.1|  PREDICTED: ethylene-responsive transcription...    116   7e-28   
ref|XP_002878890.1|  transcription factor                               115   7e-28   
gb|EYU27280.1|  hypothetical protein MIMGU_mgv1a026082mg                114   7e-28   
ref|XP_008393869.1|  PREDICTED: dehydration-responsive element-bi...    116   7e-28   
ref|XP_010437852.1|  PREDICTED: ethylene-responsive transcription...    115   8e-28   
gb|ACB45091.1|  CBF1-2 fusion protein                                   115   8e-28   
ref|XP_007202464.1|  hypothetical protein PRUPE_ppa010130mg             116   8e-28   
ref|XP_009620060.1|  PREDICTED: ethylene-responsive transcription...    117   8e-28   
ref|XP_009381193.1|  PREDICTED: dehydration-responsive element-bi...    115   1e-27   
emb|CAW30732.1|  TINY transcription factor                              115   1e-27   
ref|XP_008242523.1|  PREDICTED: dehydration-responsive element-bi...    116   1e-27   
ref|XP_006282817.1|  hypothetical protein CARUB_v10006567mg             115   1e-27   
ref|XP_004953342.1|  PREDICTED: ethylene-responsive transcription...    115   1e-27   
ref|XP_003551139.1|  PREDICTED: dehydration-responsive element-bi...    115   1e-27   
gb|EAY95076.1|  hypothetical protein OsI_16892                          114   1e-27   
ref|XP_009350478.1|  PREDICTED: ethylene-responsive transcription...    115   1e-27   
ref|XP_010277347.1|  PREDICTED: ethylene-responsive transcription...    114   1e-27   
ref|XP_004302874.1|  PREDICTED: dehydration-responsive element-bi...    116   1e-27   
ref|XP_002869242.1|  hypothetical protein ARALYDRAFT_913157             115   1e-27   
emb|CDY49324.1|  BnaC03g66900D                                          114   1e-27   
ref|NP_001065380.1|  Os10g0560700                                       116   1e-27   
emb|CBI30255.3|  unnamed protein product                                114   2e-27   
ref|XP_003517069.1|  PREDICTED: dehydration-responsive element-bi...    114   2e-27   
ref|XP_002515992.1|  Transcriptional factor TINY, putative              115   2e-27   
ref|XP_008794173.1|  PREDICTED: dehydration-responsive element-bi...    115   2e-27   
ref|XP_003630740.1|  Ethylene-responsive transcription factor TINY      116   2e-27   
ref|NP_001147713.1|  dehydration-responsive element-binding prote...    116   2e-27   
ref|XP_006465666.1|  PREDICTED: ethylene-responsive transcription...    115   2e-27   
ref|XP_010933634.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    115   2e-27   
emb|CDP03277.1|  unnamed protein product                                116   2e-27   
emb|CAH67503.1|  OSIGBa0134H18.5                                        115   2e-27   
ref|XP_010240211.1|  PREDICTED: ethylene-responsive transcription...    116   2e-27   
gb|KDO56992.1|  hypothetical protein CISIN_1g038538mg                   115   2e-27   
ref|XP_003531655.2|  PREDICTED: dehydration-responsive element-bi...    116   2e-27   
gb|AIZ97485.1|  CBF-like protein CBF7                                   115   2e-27   
ref|XP_006426907.1|  hypothetical protein CICLE_v10027587mg             115   2e-27   
ref|XP_008646012.1|  PREDICTED: ethylene-responsive transcription...    114   2e-27   
ref|XP_010915977.1|  PREDICTED: ethylene-responsive transcription...    114   3e-27   
ref|XP_009610624.1|  PREDICTED: ethylene-responsive transcription...    115   3e-27   
ref|XP_002446898.1|  hypothetical protein SORBIDRAFT_06g024530          116   3e-27   
ref|XP_010047704.1|  PREDICTED: ethylene-responsive transcription...    115   3e-27   
ref|XP_010915978.1|  PREDICTED: ethylene-responsive transcription...    114   3e-27   
emb|CDO97995.1|  unnamed protein product                                115   3e-27   
gb|ACB45088.1|  CRT binding factor 2                                    114   3e-27   
ref|XP_009352529.1|  PREDICTED: ethylene-responsive transcription...    115   3e-27   
ref|NP_001274158.1|  uncharacterized protein LOC101781338               115   3e-27   
ref|XP_004287458.1|  PREDICTED: dehydration-responsive element-bi...    114   3e-27   
ref|XP_004976435.1|  PREDICTED: ethylene-responsive transcription...    114   3e-27   
gb|EMT14137.1|  Ethylene-responsive transcription factor ERF034         112   3e-27   
ref|XP_006356143.1|  PREDICTED: ethylene-responsive transcription...    113   3e-27   
ref|XP_006653649.1|  PREDICTED: ethylene-responsive transcription...    115   3e-27   
emb|CDX75287.1|  BnaA01g04150D                                          113   4e-27   
ref|XP_007150657.1|  hypothetical protein PHAVU_005G170600g             113   4e-27   
ref|XP_007160302.1|  hypothetical protein PHAVU_002G310200g             114   4e-27   
ref|XP_008678901.1|  PREDICTED: ethylene-responsive transcription...    114   4e-27   
dbj|BAK05071.1|  predicted protein                                      115   4e-27   
ref|XP_010051579.1|  PREDICTED: ethylene-responsive transcription...    114   4e-27   
ref|XP_008783177.1|  PREDICTED: ethylene-responsive transcription...    113   5e-27   
ref|XP_003537044.2|  PREDICTED: ethylene-responsive transcription...    113   5e-27   
ref|XP_003533400.1|  PREDICTED: ethylene-responsive transcription...    114   5e-27   
ref|NP_001042318.1|  Os01g0200600                                       113   5e-27   
ref|XP_004953341.1|  PREDICTED: dehydration-responsive element-bi...    114   5e-27   
gb|KEH27173.1|  AP2 domain class transcription factor                   113   5e-27   
ref|XP_010095372.1|  Dehydration-responsive element-binding prote...    114   6e-27   
ref|XP_002528595.1|  Dehydration-responsive element-binding prote...    112   6e-27   
ref|XP_010432660.1|  PREDICTED: ethylene-responsive transcription...    113   6e-27   
ref|XP_004976433.1|  PREDICTED: ethylene-responsive transcription...    115   6e-27   
ref|XP_011093630.1|  PREDICTED: ethylene-responsive transcription...    114   6e-27   
gb|ADE41132.1|  AP2 domain class transcription factor                   114   6e-27   
ref|XP_002322550.1|  hypothetical protein POPTR_0016s02010g             113   6e-27   
ref|XP_010447343.1|  PREDICTED: ethylene-responsive transcription...    113   6e-27   
gb|KFK29897.1|  hypothetical protein AALP_AA7G192600                    113   6e-27   
ref|XP_009408707.1|  PREDICTED: ethylene-responsive transcription...    113   7e-27   
ref|XP_002283401.3|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    114   7e-27   
ref|XP_009408899.1|  PREDICTED: ethylene-responsive transcription...    113   7e-27   
ref|XP_006355509.1|  PREDICTED: ethylene-responsive transcription...    114   7e-27   
ref|XP_008362954.1|  PREDICTED: ethylene-responsive transcription...    114   7e-27   
gb|EAZ31548.1|  hypothetical protein OsJ_15691                          113   8e-27   
ref|NP_001234123.1|  CBF1 protein                                       112   8e-27   
gb|EMT23855.1|  Ethylene-responsive transcription factor ERF034         114   8e-27   
emb|CAD41607.2|  OSJNBb0034G17.3                                        113   8e-27   
emb|CDX68891.1|  BnaC01g05620D                                          112   8e-27   
ref|XP_009365379.1|  PREDICTED: ethylene-responsive transcription...    112   9e-27   
ref|XP_007152902.1|  hypothetical protein PHAVU_004G169800g             112   9e-27   
ref|XP_009125436.1|  PREDICTED: ethylene-responsive transcription...    112   1e-26   
ref|XP_009785489.1|  PREDICTED: ethylene-responsive transcription...    113   1e-26   
ref|XP_009388688.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
gb|EYU30725.1|  hypothetical protein MIMGU_mgv1a011460mg                114   1e-26   
gb|ACB45080.1|  CRT binding factor 2                                    112   1e-26   
ref|XP_003530573.1|  PREDICTED: dehydration-responsive element-bi...    112   1e-26   
gb|ABU55665.1|  CBF1-like protein                                       110   1e-26   
gb|EAY72915.1|  hypothetical protein OsI_00788                          112   1e-26   
gb|ABO48363.1|  C-repeat binding facor 1                                111   2e-26   
dbj|BAE17131.1|  LhCBF1                                                 112   2e-26   
ref|XP_008374052.1|  PREDICTED: ethylene-responsive transcription...    110   2e-26   
gb|ACB45079.1|  CRT binding factor 1                                    112   2e-26   
gb|AFQ59977.1|  CRT/DRE binding factor 1                                112   2e-26   
emb|CDY30151.1|  BnaC05g37110D                                          112   2e-26   
gb|AGE97371.1|  ethylene response factor 16                             112   2e-26   
ref|XP_009146154.1|  PREDICTED: ethylene-responsive transcription...    112   2e-26   
ref|NP_001236885.1|  uncharacterized protein LOC100527241               111   3e-26   
ref|XP_008359485.1|  PREDICTED: ethylene-responsive transcription...    111   3e-26   
gb|KDP37273.1|  hypothetical protein JCGZ_06329                         112   3e-26   
ref|XP_006406852.1|  hypothetical protein EUTSA_v10022278mg             112   3e-26   
emb|CAN71903.1|  hypothetical protein VITISV_035581                     113   3e-26   
ref|XP_010686196.1|  PREDICTED: dehydration-responsive element-bi...    111   3e-26   
ref|XP_008787070.1|  PREDICTED: dehydration-responsive element-bi...    109   3e-26   



>ref|XP_009771308.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nicotiana sylvestris]
Length=278

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 116/165 (70%), Gaps = 15/165 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPT EMAARAHDVAALAIKG+SA LNFPHLA  LPRPAS
Sbjct  111  WGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSAYLNFPHLADQLPRPAS  170

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPR------------AADNTQQHLLTTNVVDD  324
            TSPKDIQAAAA AA +TF   ++  D  + +            A +NTQ+ L + ++  D
Sbjct  171  TSPKDIQAAAANAATSTFLEKNSVRDEVESQIKLHSSHSSMNLALENTQELLNSPSIDHD  230

Query  325  DIVFDLPDLSL--VSGMDDEYGQISPSPLAGNNAG-FQLDEPFLW  450
            D  FDLPDL++  V   D     IS   LAG ++G F+L+EPFLW
Sbjct  231  DTFFDLPDLTIDQVDQNDRYQYPISTWQLAGADSGIFRLEEPFLW  275



>ref|XP_011093328.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Sesamum 
indicum]
Length=252

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFPHLAH LPRPAS
Sbjct  94   WGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGESAYLNFPHLAHQLPRPAS  153

Query  181  TSPKDIQaaaaraaaTTFPSTDA--GEDGAQPRAADNTQQHLLTTNVV-DDDIVFDLPDL  351
            T+PKDIQAA+A+AAA TF S +A      +     +N ++   + ++  DDD  FDLPDL
Sbjct  154  TTPKDIQAASAKAAAYTFISAEAEPSSHSSTNLELENIEESSTSASMAHDDDTFFDLPDL  213

Query  352  SLVSGMDDE---YGQISPSPLAGNNAGFQLDEPFLW  450
            SL S        Y   S   LAG + GF+L++PF W
Sbjct  214  SLDSTDHSSPYCYNFASSWQLAGADVGFRLEDPFPW  249



>ref|XP_009613128.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nicotiana tomentosiformis]
Length=270

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 114/167 (68%), Gaps = 18/167 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT +MAARAHDVAALAIKG SA LNFPHLAH LPRPAS
Sbjct  101  WGKWVSEIREPRKKSRIWLGTYPTAQMAARAHDVAALAIKGDSAYLNFPHLAHQLPRPAS  160

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRA-------------ADNTQQHLLTTNVVD  321
             SPKDIQ AAA AAA TFP  +  E  A+P               ++NTQ+   + +  D
Sbjct  161  ASPKDIQTAAAFAAAITFPDENE-EIRAEPSRVELRSCHSSTNLLSENTQELPNSFSRED  219

Query  322  DDIVFDLPDLSL-VSGMDDEYGQISPS--PLAGNNAG-FQLDEPFLW  450
            DD  FDLPDLS+ V+  +D Y     +   L G++   F+L+EPFLW
Sbjct  220  DDTFFDLPDLSIDVADQNDRYCCTMSTWQQLVGDDTTVFRLEEPFLW  266



>ref|XP_011089857.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Sesamum 
indicum]
Length=286

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 114/170 (67%), Gaps = 22/170 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WG+WV EIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP LA +LPRP S
Sbjct  116  WGRWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGQSAYLNFPQLAQYLPRPTS  175

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAA---------------DNTQQHLLTTNV  315
            T+PKDIQAAAA+AAA TFP  +  + GA+P+ +               DN Q+   + + 
Sbjct  176  TAPKDIQAAAAKAAAATFPE-ETSQCGAEPQLSESKLPSSQSSTNLTLDNMQESSNSASA  234

Query  316  V--DDDIVFDLPDLSLVSGMDDEYGQI---SPSPLAGNNAGFQLDEPFLW  450
               DDD  FDLPDLSL S  D   G     S   LAG + GF+L++PFLW
Sbjct  235  AHHDDDTFFDLPDLSL-SSTDHSNGYCYYASSWQLAGADVGFRLEDPFLW  283



>ref|XP_009613551.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nicotiana tomentosiformis]
Length=284

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 118/166 (71%), Gaps = 16/166 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPT EMAARAHDVAALAIKG+SA LNFPHLA  LPRPA+
Sbjct  116  WGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSAYLNFPHLADQLPRPAT  175

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPR-------------AADNTQQHLLTTNVVD  321
            TSPKDIQAAAA+AAA+TF   ++  D A+               A++N Q+ L + ++  
Sbjct  176  TSPKDIQAAAAKAAASTFLEENSLRDEAESSQIKLHNSHSSTNLASENAQELLNSPSMDH  235

Query  322  DDIVFDLPDLSL--VSGMDDEYGQISPSPLAGNNAG-FQLDEPFLW  450
            DD  FDLPDLS+  V   D     IS   LAG ++G F+L+EPFLW
Sbjct  236  DDTFFDLPDLSIDQVDQNDRYQYPISTWQLAGADSGVFRLEEPFLW  281



>ref|XP_006364331.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Solanum tuberosum]
Length=235

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 107/153 (70%), Gaps = 3/153 (2%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTY T EMAARAHDVAALAIKGHSA LNFP+LA  LPRP S
Sbjct  81   WGKWVSEIREPRKKSRIWLGTYLTAEMAARAHDVAALAIKGHSAYLNFPYLADQLPRPTS  140

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-DDIVFDLPDLSL  357
              PKDIQ AAA+AAAT+F    A     +  ++ ++ +  +T+ + D DD  F+LPDLS+
Sbjct  141  NYPKDIQIAAAKAAATSFSGNKAESSHIKLHSSSSSTETFITSPLTDKDDTFFNLPDLSI  200

Query  358  --VSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
              V  +D     IS   L G + GF  +EPFLW
Sbjct  201  NKVDQIDSYCYPISTWHLPGTDVGFWPEEPFLW  233



>ref|XP_010661364.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Vitis vinifera]
Length=255

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG S  LNFP LAH LPRPAS
Sbjct  98   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGSSPHLNFPELAHALPRPAS  157

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE-DGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
            TSPKDIQAAAA AA TTF   D  E +   P +++NT +   +T+V +DD  FDLPD+ +
Sbjct  158  TSPKDIQAAAAEAANTTFSQPDETEVEAEHPVSSENTLESSNSTSVDNDDAFFDLPDI-V  216

Query  358  VSGMD---DEYGQISP---SPLAGNNAGFQ-LDEPFLW  450
            +  MD   D +         P  G +  F+ ++EPFLW
Sbjct  217  MDVMDLTGDRFCYYYYPLWQPAGGADNIFRPVEEPFLW  254



>ref|XP_009791350.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Nicotiana 
sylvestris]
Length=274

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 107/166 (64%), Gaps = 16/166 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT +MAARAHDVAALAIKG SA LNFPH AH LP P S
Sbjct  105  WGKWVSEIREPRKKSRIWLGTYPTAQMAARAHDVAALAIKGDSAYLNFPHFAHLLPCPTS  164

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRA---ADNTQQHLLTTNVV---------DD  324
            TSPKDIQ AAA+AA  TFP  +        R    + ++  +L   N+          DD
Sbjct  165  TSPKDIQTAAAKAATITFPEENEEIRAETSRVELPSCHSSTNLFLENIKELPNSLSREDD  224

Query  325  DIVFDLPDLSL-VSGMDDEYGQISPS---PLAGNNAGFQLDEPFLW  450
            D  FDLPDLS+ V   +D Y     +   P+  +  GF+L+EPFLW
Sbjct  225  DTFFDLPDLSIDVVDQNDRYWCTMSTWQQPVGADITGFRLEEPFLW  270



>gb|EYU31917.1| hypothetical protein MIMGU_mgv1a014733mg [Erythranthe guttata]
Length=180

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 111/171 (65%), Gaps = 24/171 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFPHLA +LPRPAS
Sbjct  10   WGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGQSAYLNFPHLAEYLPRPAS  69

Query  181  TSPKDIQ-aaaaraaaTTFPS--TDAGEDGAQPRAADNTQQHLLTTNVVD----------  321
            T+PKDIQ AAA  AAA  FP   + + ++ A+P  +     H  +TN+ +          
Sbjct  70   TAPKDIQAAAAEAAAAAAFPEEISRSSDEQAEPSQSKLASSH-SSTNLQETSNSASTAHE  128

Query  322  -DDIVFDLPDLSLVSGMDDEYGQISPS-------PLAGNNAGFQLDEPFLW  450
             DD  FDLPDLSL  G  D  G             LAG +A F+L++PFLW
Sbjct  129  ADDTFFDLPDLSL--GGSDHSGNGYSYYASSSSWQLAGADACFRLEDPFLW  177



>ref|XP_004229764.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Solanum lycopersicum]
Length=274

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 115/165 (70%), Gaps = 16/165 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFPHLA  LPRPAS
Sbjct  108  WGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALAIKGDSAYLNFPHLADQLPRPAS  167

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQ-----------PRAADNTQQHLLTTNVVDDD  327
             SPKDIQAAAA+AAA +    +   + +Q             A+DN Q+ L + ++  DD
Sbjct  168  ASPKDIQAAAAKAAAASIFLEENSVESSQLTGLHSSHSSTNLASDNVQELLNSPSMDHDD  227

Query  328  IVFDLPDLSLVSGMD--DEYGQ-ISPSPLAGNNAG-FQLDEPFLW  450
              FDLPDL ++  +D  D Y   +S   LAG ++G F+LDEPFLW
Sbjct  228  PFFDLPDL-IIDRLDQNDRYQYPVSTWQLAGADSGMFRLDEPFLW  271



>ref|XP_006347933.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Solanum tuberosum]
Length=260

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFPHLA  LPRPAS
Sbjct  101  WGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALAIKGDSAYLNFPHLADQLPRPAS  160

Query  181  TSPKDIQaaaaraaaTTF---PSTDAGEDGAQPRAADNTQQHLLTTNVVD-DDIVFDLPD  348
            TSPKDIQAAAA+AAA        +   E  +   + +   Q LL +  +D DD  FDLPD
Sbjct  161  TSPKDIQAAAAKAAAANIFLEEKSQLTELHSSHSSTNLASQELLNSPSMDHDDPFFDLPD  220

Query  349  LSL--VSGMDDEYGQISPSPLAGNNAG-FQLDEPFLW  450
            L++  V   D     IS   LAG ++G F+LDEPFLW
Sbjct  221  LTIDRVDQNDRYQYPISTWQLAGADSGMFRLDEPFLW  257



>gb|KHN43745.1| Ethylene-responsive transcription factor ERF034 [Glycine soja]
Length=168

 Score =   147 bits (372),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 107/164 (65%), Gaps = 16/164 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LA  LPRPAS
Sbjct  4    WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRPAS  63

Query  181  TSPKDIQaaaaraaaTTFPSTD--------------AGEDGAQPRAADNTQQHLLTTNVV  318
            TSPKDIQAAA++AA T F                  A ++ +   + DNTQ+   + +  
Sbjct  64   TSPKDIQAAASKAANTAFEVVKHCQITEEQEQEQNQAEQETSSTLSMDNTQEPSSSHSTN  123

Query  319  DDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            DDD +FDLPD  L    ++     S   L   ++GF+L+E F W
Sbjct  124  DDDTLFDLPD--LFPDGNNGLCSFSSWHLCAVDSGFRLEESFFW  165



>gb|AHB33875.1| ERF transcription factor 04 [Coffea arabica]
Length=311

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 115/179 (64%), Gaps = 31/179 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFPHLAH LPRPA+
Sbjct  132  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPHLAHELPRPAT  191

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDD------------  324
            TSPKDIQAAAA+AAA TFP  + G   A+P  A+ T  H  T   + +            
Sbjct  192  TSPKDIQAAAAKAAAATFPGENGGGAEAEPIQAELTNCHSSTDFSLHNMQESSNSPSTDD  251

Query  325  ---DIVFDLPDLSL-VSGMDDE-------------YGQISPSPLAGNNAGFQLDEPFLW  450
               D  FDLPDLS  V+G  D              + Q+ P+P A     F+L+EPFLW
Sbjct  252  DIDDTFFDLPDLSFDVTGATDHLDGFNCFHGSSSWWPQLHPAPAA--EPVFRLEEPFLW  308



>ref|XP_007134514.1| hypothetical protein PHAVU_010G054000g [Phaseolus vulgaris]
 gb|ESW06508.1| hypothetical protein PHAVU_010G054000g [Phaseolus vulgaris]
Length=283

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 105/166 (63%), Gaps = 21/166 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LA  LPRPA+
Sbjct  120  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRPAT  179

Query  181  TSPKDIQaaaaraaaTTFP---------------STDAGEDGAQPRAADNTQQHLLTTNV  315
            TSPKDIQAAAA+AA T+F                   A    +   + DNTQ+   + + 
Sbjct  180  TSPKDIQAAAAKAANTSFELVKHCQIEDEEEGEEPNQAEHASSSTLSMDNTQESSSSHST  239

Query  316  VDDDIVFDLPDLSLVSGMDDEYGQISPS-PLAGNNAGFQLDEPFLW  450
             DDD +FDLPDL       D+    S S  L    +GF+L+E   W
Sbjct  240  NDDDTLFDLPDL-----FPDQLCSYSSSWHLCAVGSGFRLEESLFW  280



>ref|XP_009628141.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Nicotiana tomentosiformis]
Length=263

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 115/171 (67%), Gaps = 23/171 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTY T EMAARAHDVAALAIKGHSA LNFP+LA+ LPRPAS
Sbjct  94   WGKWVSEIREPRKKSRIWLGTYRTAEMAARAHDVAALAIKGHSAYLNFPYLANQLPRPAS  153

Query  181  TSPKDIQaaaaraaaTTFPS------TDAGEDGAQP-----------RAADNTQQHLLTT  309
            TSPKDIQ AAA+AAATTFP        ++  + + P            +++N Q+ + + 
Sbjct  154  TSPKDIQIAAAKAAATTFPEEEMKSRAESSHEISSPMEPHSSCSSTDLSSENNQEFVKSP  213

Query  310  NVVDDDIVFDLPDLSLVSGMDDEYGQIS-PSPL---AGNNAGFQLDEPFLW  450
            +   DD  F+LPDLS      D+ G+ S P+      G + GF L+EPFL+
Sbjct  214  STDKDDTFFNLPDLSF--NEVDQIGRYSDPNSTWLQVGADVGFWLEEPFLF  262



>gb|KDP28842.1| hypothetical protein JCGZ_14613 [Jatropha curcas]
Length=247

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 7/156 (4%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG+SA LNFP L H LPRP +
Sbjct  90   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSAYLNFPELVHELPRPVT  149

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAAD-NTQQHLLTTNVVD-DDIVFDLPDLS  354
             SPKDIQAAAA+AA +         +  Q  +++ NT   +  +N  + DD +FDLPDL 
Sbjct  150  KSPKDIQAAAAKAALSETTQFQLQAEAHQLISSNTNTTSAMDNSNTQESDDTLFDLPDL-  208

Query  355  LVSGMD---DEYGQISPS-PLAGNNAGFQLDEPFLW  450
             + G+D   + + Q SPS  L   + GF+++EP++W
Sbjct  209  FIDGVDLKSNGFCQYSPSWHLCTADTGFRVEEPYIW  244



>ref|XP_011032938.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Populus 
euphratica]
Length=299

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 109/168 (65%), Gaps = 17/168 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREP+KKSRIWLGTYPT EMAARAHDVA+LAIKG SA LNFP L   LPRP S
Sbjct  133  WGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVASLAIKGGSAYLNFPELVDELPRPLS  192

Query  181  TSPKDIQaaaaraaaTTFPST---DAGEDGAQPR----------AADNTQQHLLTTNVVD  321
             SPKDIQAAAA+AAA +FP T   DA  D +             A  NTQ+   + +   
Sbjct  193  KSPKDIQAAAAKAAAASFPETRHCDAEADLSHAELNVSNLSDNLAMYNTQESSSSPSTDV  252

Query  322  DDIVFDLPDLSLVSGMDDEYGQISPSP---LAGNNAGFQLDEPFLW*H  456
            DD +FDLPDL  + G++   G    SP   L   + GF+L+EPFLW H
Sbjct  253  DDKLFDLPDL-FIDGVNHSDGFCYYSPPWQLCSADTGFRLEEPFLWEH  299



>ref|XP_003521085.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Glycine max]
Length=287

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 107/164 (65%), Gaps = 16/164 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LA  LPRPAS
Sbjct  123  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRPAS  182

Query  181  TSPKDIQaaaaraaaTTFP--------------STDAGEDGAQPRAADNTQQHLLTTNVV  318
            TSPKDIQAAA++AA T F                  A ++ +   + DNTQ+   + +  
Sbjct  183  TSPKDIQAAASKAANTAFEVVKHCQITEEQEQEQNQAEQETSSTLSMDNTQEPSSSHSTN  242

Query  319  DDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            DDD +FDLPD  L    ++     S   L   ++GF+L+E F W
Sbjct  243  DDDTLFDLPD--LFPDGNNGLCSFSSWHLCAVDSGFRLEESFFW  284



>ref|XP_010258834.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nelumbo nucifera]
Length=275

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 111/176 (63%), Gaps = 26/176 (15%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL +KG SA LNFP  AH LPRPAS
Sbjct  98   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTVKGKSAYLNFPERAHELPRPAS  157

Query  181  TSPKDIQaaaaraaaTTF---PSTDAGEDGAQPRAADN-------TQQHLLTTNVVD---  321
            +SPKDIQAAAA+AAA TF   PS  + E  A+   ++        T    LTT   D   
Sbjct  158  SSPKDIQAAAAKAAAATFGEHPSRSSHEADAEGEPSEPEPESLPITHSPSLTTTSADTQE  217

Query  322  ----------DDIVFDLPD--LSLVSGMDDEYGQISPSPLAGN-NAGFQLDEPFLW  450
                      D + FDLPD  L L S   D +G  SP    G  + GFQ++EPFLW
Sbjct  218  FSVSPSTDEEDSLFFDLPDLFLDLSSNQIDRFGFCSPLLSPGEADFGFQMEEPFLW  273



>ref|XP_010264429.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nelumbo nucifera]
Length=225

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 113/176 (64%), Gaps = 20/176 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAALAIKG++A LNFP LAH LPRPAS
Sbjct  50   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALAIKGNAAFLNFPELAHELPRPAS  109

Query  181  TSPKDIQaaaaraaaTTF---------PSTDAGE-DGAQPRAADNTQQHLLT-----TNV  315
             S KDIQAAAA+AAA TF          + D GE  G++   +D+   +  +        
Sbjct  110  LSHKDIQAAAAKAAAATFDKQPASCEVETEDQGERSGSKFPISDSPSLNFTSDDDAGVRS  169

Query  316  VDDDIVFDLPDLSLVSGMDDEYGQISPSPL--AGNNAGFQLDEPFL---W*HVLFL  468
             D+D +FDLPDL +           S S +  A NN G Q+DEPFL   + H  FL
Sbjct  170  TDEDALFDLPDLVIDQTTTPNMFDFSSSLMSPAANNFGLQMDEPFLLWEYDHTEFL  225



>gb|ABQ62972.1| TINY-like protein [Populus trichocarpa]
Length=269

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 106/170 (62%), Gaps = 21/170 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP L   LPRP S
Sbjct  99   WGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGGSAYLNFPELVDELPRPLS  158

Query  181  TSPKDIQaaaaraaaTTFPSTDAG-----------------EDGAQPRAADNTQQHLLTT  309
             SPKDIQAAAA+AAA +FP T                     + +   A DN Q+   + 
Sbjct  159  KSPKDIQAAAAKAAAASFPETRHCEAEAEAEADMSHAELNVSNLSDNLAMDNIQESSSSP  218

Query  310  NVVDDDIVFDLPDLSLVSGMDDEYGQISPSP---LAGNNAGFQLDEPFLW  450
            +   DD +FDLPDL  + G++   G    SP   L   + GF+L+EPFLW
Sbjct  219  STDVDDKLFDLPDL-FIDGVNHSDGFCYYSPPWQLCSADTGFRLEEPFLW  267



>gb|ACU24100.1| unknown [Glycine max]
Length=287

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 106/164 (65%), Gaps = 16/164 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LA  LPRPAS
Sbjct  123  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRPAS  182

Query  181  TSPKDIQaaaaraaaTTFP--------------STDAGEDGAQPRAADNTQQHLLTTNVV  318
            TSPKDIQAAA++AA T F                  A ++ +   + DNTQ+   + +  
Sbjct  183  TSPKDIQAAASKAANTAFEVVKHCQITEEQEQEQNQAEQETSSTLSMDNTQEPSSSHSTN  242

Query  319  DDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            DDD +FDLPD  L    ++     S       ++GF+L+E F W
Sbjct  243  DDDTLFDLPD--LFPDGNNGLCSFSSWHWCAVDSGFRLEESFFW  284



>gb|KHN34489.1| Ethylene-responsive transcription factor ERF034 [Glycine soja]
Length=266

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 104/163 (64%), Gaps = 14/163 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LA  LPRP S
Sbjct  102  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRPVS  161

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE-------------DGAQPRAADNTQQHLLTTNVVD  321
            TSPKDIQAAAA+AA T F      +               +   + DN Q+   + + +D
Sbjct  162  TSPKDIQAAAAKAANTAFEEVRHCQITEEEAEQNQAEQASSSTLSMDNPQEPSSSHSTID  221

Query  322  DDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            DD +FDLPDL    G +      S   L   ++GF+L+E F +
Sbjct  222  DDTLFDLPDL-FPDGNNGLCSFSSSWHLCAVDSGFRLEESFFY  263



>ref|XP_006375232.1| hypothetical protein POPTR_0014s05500g [Populus trichocarpa]
 gb|ABQ62973.1| TINY-like protein [Populus trichocarpa]
 gb|ERP53029.1| hypothetical protein POPTR_0014s05500g [Populus trichocarpa]
Length=269

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 106/170 (62%), Gaps = 21/170 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP L   LPRP S
Sbjct  99   WGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGGSAYLNFPELVDELPRPLS  158

Query  181  TSPKDIQaaaaraaaTTFPSTDAG-----------------EDGAQPRAADNTQQHLLTT  309
             SPKDIQAAAA+AAA +FP T                     + +   A DN Q+   + 
Sbjct  159  KSPKDIQAAAAKAAAASFPETRHCEAEAEAEADMSHAELNVSNLSDNLAMDNIQESSSSP  218

Query  310  NVVDDDIVFDLPDLSLVSGMDDEYGQISPSP---LAGNNAGFQLDEPFLW  450
            +   DD +FDLPDL  + G++   G    SP   L   + GF+L+EPFLW
Sbjct  219  STDVDDKLFDLPDL-FIDGVNHSDGFCYYSPPWQLCSADTGFRLEEPFLW  267



>ref|XP_006345609.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Solanum tuberosum]
Length=203

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 107/168 (64%), Gaps = 18/168 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT +MAARAHDVAALAIKG SA LNFPHL    PRPAS
Sbjct  35   WGKWVSEIREPKKKSRIWLGTYPTAQMAARAHDVAALAIKGCSAHLNFPHLVDQYPRPAS  94

Query  181  TSPKDIQaaaaraaaTTFPSTD------AGEDGAQPRAA--------DNTQQHLLTTNVV  318
            T  KDIQAAAA+AAA  FP  D         D  + R          +NT++ L + +  
Sbjct  95   TCHKDIQAAAAKAAAIPFPEEDEEEEDRVESDQVELRNCHSSTNLFLENTKESLNSPSRE  154

Query  319  DDDIVFDLPDLS--LVSGMDDEYGQISP--SPLAGNNAGFQLDEPFLW  450
            DDD  FDLPDLS  +V   +  +  +S     +  +   ++LDEPFLW
Sbjct  155  DDDTFFDLPDLSIDMVDQTNSYWCTMSTWQQLIGADTTVYRLDEPFLW  202



>emb|CDP09462.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 113/179 (63%), Gaps = 31/179 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LAH LPRPA+
Sbjct  117  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPRLAHELPRPAT  176

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDD------------  324
            TSPKDIQAAAA+AAA TFP  + G   A+P  A+ T  H  T   + +            
Sbjct  177  TSPKDIQAAAAKAAAATFPGENGGGAEAEPIQAELTNCHSSTDFSLHNMQESSNSASTDD  236

Query  325  ---DIVFDLPDLSL-VSGMDDE-------------YGQISPSPLAGNNAGFQLDEPFLW  450
               D  FDLPDLS  V+G  D              + Q+  +P A     F+L+EPFLW
Sbjct  237  DIDDTFFDLPDLSFDVTGATDHLDGFNCFHGSSSWWPQLHLAPAA--EPVFRLEEPFLW  293



>ref|XP_002511623.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF50292.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=276

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 114/177 (64%), Gaps = 23/177 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG+SA LNFP LA  LPRPA+
Sbjct  101  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSAYLNFPELALGLPRPAT  160

Query  181  TSPKDIQaaaaraa------aTTFPSTDAG---EDGAQPRAADNTQQHLLTTNVV-----  318
             +PKDIQ AAA+AA        T    +AG    +G+     DNT++   + +       
Sbjct  161  KAPKDIQVAAAKAATAVNFLEKTQSDVEAGMSQAEGSSSLVIDNTRESTSSPSTATTIAT  220

Query  319  ----DDDIVFDLPDLSLVSGMD---DEYGQISPS-PLAGNNAGFQLDEPFLW*HVLF  465
                 DD +FDLPDL  V G+D   +++   SPS  L   + GF+L+EP+LW +  +
Sbjct  221  TSNDSDDTLFDLPDL-FVEGIDRHKNDFLHYSPSWQLCAADTGFRLEEPYLWEYCNY  276



>ref|XP_003530164.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Glycine max]
Length=363

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 104/163 (64%), Gaps = 14/163 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP LA  LPRP S
Sbjct  199  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRPVS  258

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE-------------DGAQPRAADNTQQHLLTTNVVD  321
            TSPKDIQAAAA+AA T F      +               +   + DN Q+   + + +D
Sbjct  259  TSPKDIQAAAAKAANTAFEEVRHCQITEEEAEQNQAEQASSSTLSMDNPQEPSSSHSTID  318

Query  322  DDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            DD +FDLPDL    G +      S   L   ++GF+L+E F +
Sbjct  319  DDTLFDLPDL-FPDGNNGLCSFSSSWHLCAVDSGFRLEESFFY  360



>ref|XP_010264388.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Nelumbo 
nucifera]
Length=282

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 110/169 (65%), Gaps = 20/169 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG+SA LNFP LAH LPRPAS
Sbjct  105  WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGNSAYLNFPELAHELPRPAS  164

Query  181  TSPKDIQaaaaraaaTTFPSTDAG---EDGAQPR-------AADNTQQHLLTTN------  312
            +SPKDIQAAAA+AAA TF     G   E  AQ +        +D +  H  T++      
Sbjct  165  SSPKDIQAAAAKAAAATFDKQATGREVETEAQSKRSKPGFPISDYSPIHTTTSDDTPEFS  224

Query  313  ---VVDDDIVFDLPDLSLVSGMDDEYGQISPSPLA-GNNAGFQLDEPFL  447
                 D++ +FDLPDL L   +       S S L+ G + G ++DEP L
Sbjct  225  ISPSTDEETLFDLPDLFLDHTISPNRFDFSLSLLSPGADLGLRMDEPLL  273



>ref|XP_007140776.1| hypothetical protein PHAVU_008G141000g [Phaseolus vulgaris]
 gb|ESW12770.1| hypothetical protein PHAVU_008G141000g [Phaseolus vulgaris]
Length=309

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 110/181 (61%), Gaps = 32/181 (18%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA LAIKGHSA LNFP+LA  LPRP +
Sbjct  127  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVATLAIKGHSAYLNFPNLAQDLPRPIT  186

Query  181  TSPKDIQaaaaraaaTTF--------------------------PSTDAGEDGAQPRAA-  279
            TSPKDIQAAAA+AA+T F                           ST+A +  A+  ++ 
Sbjct  187  TSPKDIQAAAAKAASTFFDDDKHCEAEKDEENHAEQASSSTLRMDSTEAEQVQAKQASSF  246

Query  280  ----DNTQQHLLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
                DNTQ    + +  DDD +FDLPDL    G +  +   S   L   ++GF+ +E  L
Sbjct  247  TLSMDNTQGSSTSHSTADDDTLFDLPDL-FPDGNNGLFSNSSSWRLCAVDSGFRHEEQLL  305

Query  448  W  450
            W
Sbjct  306  W  306



>gb|ADJ67431.1| ethylene response factor 2 [Actinidia deliciosa]
Length=264

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 107/166 (64%), Gaps = 25/166 (15%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAA AIKG SA LNFP LAH LPRPA+
Sbjct  106  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAARAIKGKSAYLNFPELAHELPRPAT  165

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE-DGAQPRAA---------------DNTQQHLLTTN  312
            TSPKDIQAAAA AAA+ F    +GE   A+P  A               + TQ+ + + +
Sbjct  166  TSPKDIQAAAAMAAASLF----SGEATRAEPSRAGLPCSHSSTTLSSSENTTQESVNSPS  221

Query  313  VVDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
              DDD  FDLPDLS     D      S   LA +   F+LD+PF W
Sbjct  222  NHDDDTFFDLPDLS-----DGCCYYASSWQLAASELSFRLDDPFSW  262



>ref|XP_007052232.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96389.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=310

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 111/174 (64%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP LA  LPRPA 
Sbjct  135  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGRSAYLNFPELAKDLPRPAG  194

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDG---------------------AQPRAADNTQQH  297
            TSPKDIQAAA++AAA+TF  T                           +Q  A+DN Q+ 
Sbjct  195  TSPKDIQAAASQAAASTFLKTRRCNIEAEAEAEAEVGPSQEELPVSHLSQTSASDNVQES  254

Query  298  LLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSP---LAGNNAGFQLDEPFLW  450
              + ++ DDD +FDLPDL ++   D   G  S S    +   +AGF+L+EPF W
Sbjct  255  SSSPSIDDDDTLFDLPDL-MIDATDRSDGFCSYSSTWQICAVDAGFRLEEPFSW  307



>ref|XP_009400894.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=244

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 104/162 (64%), Gaps = 16/162 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKG SA LNFP L   LPRPAS
Sbjct  86   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGQSAHLNFPELTAQLPRPAS  145

Query  181  TSPKDIQaaaaraaaT--------TFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVF  336
             SPKDIQAAA  AA T           S  +G D A+P  + +      T++  +DD +F
Sbjct  146  ASPKDIQAAAMLAAVTFCATGLTPCTSSECSGADHAEPPISRSPAS--TTSSSDNDDALF  203

Query  337  DLPDLSLVSGMDDEYGQISPS---PLAGNN-AGFQLDEPFLW  450
            DLPDL L   + + +   S S   P A  +   F++DEPFLW
Sbjct  204  DLPDLCL--DLREGFCYSSSSSWLPCADEDYVEFRVDEPFLW  243



>ref|XP_002301249.2| hypothetical protein POPTR_0002s14210g [Populus trichocarpa]
 gb|EEE80522.2| hypothetical protein POPTR_0002s14210g [Populus trichocarpa]
Length=272

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 106/165 (64%), Gaps = 16/165 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP  AH LP P S
Sbjct  107  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGGSAYLNFPEFAHELPPPLS  166

Query  181  TSPKDIQaaaaraaaTTFPSTDAG------------EDGAQPRAADNTQQHLLTTNVVDD  324
             SPKDIQAAAA+AAA +F  T                + +   A DNTQ+   + +   D
Sbjct  167  KSPKDIQAAAAKAAAASFTETRYCEGEGGGEAELNVSNLSDSLAMDNTQESSSSPSTDSD  226

Query  325  DIVFDLPDLSLVSGM--DDEYGQISPS-PLAGNNAGFQLDEPFLW  450
            D +FDLPDL  + G+   D +   S S  L   + GF+L EPFLW
Sbjct  227  DTLFDLPDL-FIDGVHHSDGFCYYSSSWQLCAADTGFRLGEPFLW  270



>gb|ABQ62971.1| TINY-like protein [Populus trichocarpa]
Length=221

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 107/166 (64%), Gaps = 18/166 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+PKKKSRIWLGT+PTPEMAARAHDVAAL IKGHSA LNFP +AH  PRPAS
Sbjct  50   WGKWVSEIRQPKKKSRIWLGTFPTPEMAARAHDVAALTIKGHSAHLNFPEIAHEFPRPAS  109

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGA------------QPRAADNTQQHLLTTNVVD-  321
            +SPKDIQAAAA AA  +  ++  G +                 A++ TQ++ L++ + D 
Sbjct  110  SSPKDIQAAAALAATLSCKTSQKGRETEAEDELMLPHSPDSTLASNETQEYSLSSPLRDD  169

Query  322  -DDIVFDLPDLSLVSGMDDEYGQISPSPLAG---NNAGF-QLDEPF  444
             DD   DLPD+       DE+  +S   L G   ++ GF   +EPF
Sbjct  170  GDDTFIDLPDILQDQYQFDEFCYLSSWQLVGPETSDIGFWHHEEPF  215



>ref|XP_006368997.1| hypothetical protein POPTR_0001s15550g [Populus trichocarpa]
 gb|ERP65566.1| hypothetical protein POPTR_0001s15550g [Populus trichocarpa]
Length=252

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 107/166 (64%), Gaps = 18/166 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+PKKKSRIWLGT+PTPEMAARAHDVAAL IKGHSA LNFP LAH  PRPAS
Sbjct  81   WGKWVSEIRQPKKKSRIWLGTFPTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  140

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGA------------QPRAADNTQQHLLTTNVVD-  321
            +SPKDIQAAAA AA  +  ++  G +                 A++ TQ++ L++ + D 
Sbjct  141  SSPKDIQAAAALAATLSCKTSPKGRETEAEDELMLPHSPDSTLASNETQEYSLSSPLRDD  200

Query  322  -DDIVFDLPDLSLVSGMDDEYGQISPSPLAG---NNAGF-QLDEPF  444
             DD   DLPD+       DE+  +S   L G   ++ GF   +EPF
Sbjct  201  GDDTFIDLPDILQDQYQFDEFCYLSSWQLVGPETSDIGFWHQEEPF  246



>ref|XP_010056415.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Eucalyptus 
grandis]
 gb|KCW73138.1| hypothetical protein EUGRSUZ_E01593 [Eucalyptus grandis]
Length=289

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 111/167 (66%), Gaps = 22/167 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP LA  LPRPAS
Sbjct  122  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGSSAVLNFPELAPELPRPAS  181

Query  181  TSPKDIQaaaaraaaTT--FPSTDAGED---GAQPRAADNTQQHLLTTNVV---------  318
            TSPKDIQ AAA+AAA+    PS    ED   GA PR  D +++ L  TN           
Sbjct  182  TSPKDIQEAAAKAAASFAPLPSERGAEDDGTGANPR-RDTSERSLSDTNSSQESTNCSSN  240

Query  319  -DDDIVFDLPDLSLVSGMDDEYGQISPS---PLAGNNAGFQLDEPFL  447
             ++D +FDLPDL +     + +G   PS    +   ++G +L+EP+L
Sbjct  241  DNEDALFDLPDLCV--DQPNGFG-FCPSLSWQVCAADSGSRLEEPYL  284



>ref|XP_004240059.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Solanum lycopersicum]
Length=253

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 104/168 (62%), Gaps = 18/168 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT +MAARAHDVAALAIKG SA LNFPHL    P PAS
Sbjct  85   WGKWVSEIREPKKKSRIWLGTYPTAQMAARAHDVAALAIKGCSAHLNFPHLVDQYPHPAS  144

Query  181  TSPKDIQaaaaraaaTTFP------STDAGEDGAQPRAA--------DNTQQHLLTTNVV  318
            T  KDIQAAAA+AAA  FP            D  + R          +N ++ L + +  
Sbjct  145  TCHKDIQAAAAKAAAIPFPEEDEEEEDQIESDQVELRNCHPSTNLFLENAKESLNSPSRE  204

Query  319  DDDIVFDLPDLSL--VSGMDDEYGQISP--SPLAGNNAGFQLDEPFLW  450
            DDD  FDLPDLS+  V   +  +  +S     +  +   ++LDEPFLW
Sbjct  205  DDDTFFDLPDLSIDVVDQTNSYWCTMSTWQQLIGADTMVYRLDEPFLW  252



>ref|XP_007155687.1| hypothetical protein PHAVU_003G222600g [Phaseolus vulgaris]
 gb|ESW27681.1| hypothetical protein PHAVU_003G222600g [Phaseolus vulgaris]
Length=230

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTP+MAARAHDVAAL IKG SA LNFP LA  LPRPA+
Sbjct  77   WGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAFLNFPELAAELPRPAT  136

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL-  357
             SPKDIQ AAA+AAA  F       +    R    +     ++   +DD   DLPDLS  
Sbjct  137  NSPKDIQVAAAKAAALDFNHRSHEAESELSRGGSISNSSSNSSLKGEDDTFMDLPDLSPD  196

Query  358  VSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            +S   DE+   S   + G   GF+L+EPFLW
Sbjct  197  LSHGADEFHYSSAWLVTGPELGFRLEEPFLW  227



>ref|XP_004512200.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=225

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 105/158 (66%), Gaps = 16/158 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAA AIKG SA LNFP LA HLPRPA+
Sbjct  69   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAAQAIKGSSAYLNFPELADHLPRPAT  128

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVV---DDDIVFDLPDL  351
            TSPKDIQ  AA A A T       ++  Q +A DN +    T+N     +DD  FDLPDL
Sbjct  129  TSPKDIQ--AAAAKAATMGYLHETQNYYQAQAHDNKK----TSNSCLRDEDDTFFDLPDL  182

Query  352  SL-VSGMDDEYGQIS---PSPLAGN---NAGFQLDEPF  444
             + ++    E+   S   P  +AG    ++GF L+E F
Sbjct  183  LVDLNNSSREFNNASTSMPWVVAGAEHPDSGFGLNETF  220



>ref|XP_003626728.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
 gb|AET01204.1| ethylene response factor [Medicago truncatula]
Length=207

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 98/153 (64%), Gaps = 11/153 (7%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGK+V EIREPKKKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP L   LP+P S
Sbjct  60   WGKFVCEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELVQQLPKPIS  119

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDL---  351
            TS KDIQAAAA+AA T F         A+P   ++      T    DD  +FDLPDL   
Sbjct  120  TSTKDIQAAAAKAANTVFV--------AEPIQEEHFSSSSSTFTNNDDATLFDLPDLFPD  171

Query  352  SLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
               +G+     + S   L   ++GF+L+EP  W
Sbjct  172  DGNNGLCSYSSKNSSWYLCAVDSGFRLEEPSFW  204



>ref|XP_008232393.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Prunus 
mume]
Length=272

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 108/177 (61%), Gaps = 27/177 (15%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP LA  LP+P S
Sbjct  94   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGASAFLNFPELAQTLPQPDS  153

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE-------DGAQPRAA-------------DNTQQHL  300
             SPKDIQAAAA+AAA    +++  +       + A+P +              DN     
Sbjct  154  KSPKDIQAAAAKAAAAAADASEEKQIICETEAEEAEPSSKVKLPMSSNSTLSMDNINAQE  213

Query  301  LTTNVV----DDDIVFDLPDLSL--VSGMDD-EYGQISPSPLAGNNAGFQLDEPFLW  450
             T+       DDD +FDLPDL +   +G D   Y   S   L   + GF+L++PFLW
Sbjct  214  STSTCASTDYDDDKLFDLPDLFMDGTNGSDQFCYSTSSTWHLCAADTGFRLEDPFLW  270



>gb|ABQ62974.1| TINY-like protein [Populus trichocarpa]
Length=272

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 105/164 (64%), Gaps = 16/164 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP  AH LP P S
Sbjct  107  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGGSAYLNFPEFAHELPPPLS  166

Query  181  TSPKDIQaaaaraaaTTFPSTDAG------------EDGAQPRAADNTQQHLLTTNVVDD  324
             SPKDIQAAAA+AAA +F  T                + +   A DNTQ+   + +   D
Sbjct  167  KSPKDIQAAAAKAAAASFTETRYCEGEGGGEAELNVSNLSDSLAMDNTQESSSSPSTDSD  226

Query  325  DIVFDLPDLSLVSGM--DDEYGQISPS-PLAGNNAGFQLDEPFL  447
            D +FDLPDL  + G+   D +   S S  L   + GF+L EPFL
Sbjct  227  DTLFDLPDL-FIDGVHHSDGFCYYSSSWQLCAADTGFRLGEPFL  269



>ref|XP_009401144.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Musa 
acuminata subsp. malaccensis]
Length=255

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 107/160 (67%), Gaps = 17/160 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG SA LNFP LA  LPRPA+
Sbjct  100  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGQSAHLNFPELAAELPRPAT  159

Query  181  TSPKDIQaaaaraaaTTF--PSTDAGEDGAQPRAADNTQQHLLTTNVV-DDDIVFDLPDL  351
             +PKD+QAAAA AAA TF  P T      +Q  A D  +Q   TT    DDD +FDLPDL
Sbjct  160  AAPKDVQAAAALAAAATFCGPCTT-----SQCSAPDQAEQPDPTTPPSGDDDALFDLPDL  214

Query  352  SLVSGMDDEYGQISPSPLAG-------NNAGFQLDEPFLW  450
             L  G+ + +   S S  +        +   F+++EPFLW
Sbjct  215  FL--GLREGFCYSSSSSSSAWLPSTEEDGVEFRIEEPFLW  252



>ref|XP_004301177.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=225

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 105/162 (65%), Gaps = 16/162 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  67   WGKWVSEIREPRKKSRIWLGTFETPEMAARAHDVAALTIKGSSAYLNFPELAQELPRPAS  126

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD---DDIVFDLPDL  351
            +SPKDIQAAAA+AAA ++P+     +  +P  A   +    T+ + D   DD  +DLPDL
Sbjct  127  SSPKDIQAAAAKAAALSYPNCRNSHETHEPEEARPCRDSSSTSPLSDEHNDDTFYDLPDL  186

Query  352  SLVSGM---DDEYGQISPSPLAGN------NAGFQLDEPFLW  450
             +  G    D EY      P+A        +   +++E FLW
Sbjct  187  LIDVGQYHGDHEYY----FPVAATWQLDPMDTILRMEESFLW  224



>ref|XP_007218799.1| hypothetical protein PRUPE_ppa009812mg [Prunus persica]
 gb|EMJ19998.1| hypothetical protein PRUPE_ppa009812mg [Prunus persica]
Length=276

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 105/176 (60%), Gaps = 26/176 (15%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP LA  LP+P S
Sbjct  99   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGASAFLNFPELAQTLPQPDS  158

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE-------DGAQPRAA-------------DNTQQHL  300
             SPKDIQAAAA+AA     +++  +       + A+P +              DN     
Sbjct  159  KSPKDIQAAAAKAAKAAADASEEKQIICETEAEEAEPSSKVKLPMSSNSTLSMDNINAQE  218

Query  301  LTTNVV----DDDIVFDLPDLSL--VSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
             T+       DDD +FDLPDL +   +G D      S   L   + GF+L +PFLW
Sbjct  219  STSTCASTDYDDDKLFDLPDLFMDGTNGSDQFCYSSSTWHLCAADTGFRLGDPFLW  274



>ref|XP_003611338.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
 gb|AES94296.1| ethylene response factor [Medicago truncatula]
Length=181

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 95/156 (61%), Gaps = 18/156 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAA AIKG SA LNFP LA  LPRP +
Sbjct  36   WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAAQAIKGSSAYLNFPELAQQLPRPTT  95

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-DDIVFDLPDLSL  357
             SPKDIQ  AA A A T  S    +D          Q H +   + D DD  +DLPDL L
Sbjct  96   NSPKDIQ--AAAAKAATMGSLHEAQD----------QDHDIQETLNDEDDTFYDLPDLLL  143

Query  358  VSGM-DDEYGQISPSPLAGN----NAGFQLDEPFLW  450
             S     E+   S S L       N  F LDEPF W
Sbjct  144  DSNKSSSEFHYSSMSWLVAGAEYPNPSFGLDEPFPW  179



>ref|XP_003516798.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Glycine max]
 gb|KHN23919.1| Ethylene-responsive transcription factor ERF034 [Glycine soja]
Length=263

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 110/180 (61%), Gaps = 31/180 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALA+KGHSA LNFP+LA  LPRP +
Sbjct  82   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAVKGHSAFLNFPNLAQDLPRPTT  141

Query  181  TSPKDIQaaaaraaaTTF------------------------PSTDAGEDGA------QP  270
            TSPKDIQAAAA+AA TTF                        PST    D +      Q 
Sbjct  142  TSPKDIQAAAAKAATTTFFDDEIVNHCQAEKAEQNHGEQQASPSTLCMMDNSTEAEQIQA  201

Query  271  RAADNTQQHLLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
              A +TQ+   + +  D++ +FDLPDL    G    +   S   L   ++GF+L+E FLW
Sbjct  202  EQASSTQESSSSHSTADEETLFDLPDL-FPDGNSGLFSYSSCWHLCAVDSGFRLEEQFLW  260



>ref|XP_007039780.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY24281.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=237

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 105/167 (63%), Gaps = 17/167 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKG SA LNFP +AH LPRP S
Sbjct  68   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGKSAYLNFPEIAHELPRPVS  127

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE------DGAQPRA------ADNTQQHLLTTNVVDD  324
             SPKDIQAAAA+AA   +P +   E      D   PR+      + +TQ    +  + +D
Sbjct  128  ASPKDIQAAAAKAATLNYPKSHEVEAELSQVDQMFPRSPASTVTSHDTQDSSSSPLINND  187

Query  325  DIVFDLPDLSLVSG--MDDEYGQIS---PSPLAGNNAGFQLDEPFLW  450
            D   DLPDL L     +D+ +G +S   P+       GF  +EP LW
Sbjct  188  DAFIDLPDLLLDMNHQIDEFWGSLSWQLPATDDPVENGFGYEEPCLW  234



>ref|XP_002303364.1| hypothetical protein POPTR_0003s07700g [Populus trichocarpa]
 gb|ABQ62970.1| TINY-like protein [Populus trichocarpa]
 gb|EEE78343.1| hypothetical protein POPTR_0003s07700g [Populus trichocarpa]
Length=225

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 109/169 (64%), Gaps = 19/169 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+PKKKSRIWLGT+ TPEMAARAHDVAAL IKGHSA LNFP LAH  PRPAS
Sbjct  48   WGKWVSEIRQPKKKSRIWLGTFSTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  107

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQ------PR------AADNTQQHLLTT--NVV  318
            +SPKDIQAAAA AA  +  ++  G +         PR      A++ TQ++ L +     
Sbjct  108  SSPKDIQAAAALAATLSCKTSQKGRETEAEAELMLPRSLDSTLASNETQEYSLNSPLRDD  167

Query  319  DDDIVFDLPD-LSLVSGMDDEYGQISPSPLAG---NNAGF-QLDEPFLW  450
            DDD   DLPD L  +S   DE+  +SP    G   ++ GF   +EP LW
Sbjct  168  DDDTFIDLPDILQGISHQFDEFCYLSPWQPVGTETSDVGFWHHEEPSLW  216



>ref|XP_011001450.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Populus euphratica]
Length=253

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 17/153 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+PKKKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LAH  PRPAS
Sbjct  81   WGKWVSEIRQPKKKSRIWLGTFPTPEMAARAHDVAALTIKGSSAHLNFPELAHEFPRPAS  140

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE--------------DGAQPRAADNTQQHLLTTNVV  318
            +SPKDIQAAAA AAA +  ++  G               D     A++ TQ++ L++ + 
Sbjct  141  SSPKDIQAAAALAAALSCKTSQKGRETEAEDELMLPHSPDSTLAVASNETQEYSLSSPLR  200

Query  319  D--DDIVFDLPDLSLVSGMDDEYGQISPSPLAG  411
            D  DD   DLPD+ L     DE+  +S   L G
Sbjct  201  DDGDDTFIDLPDI-LQDHQFDEFCYLSSWQLVG  232



>ref|XP_004301176.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=187

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 105/167 (63%), Gaps = 29/167 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAAL IKG SA LNFP LA  LPR AS
Sbjct  32   WGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALTIKGRSAHLNFPELAQELPRAAS  91

Query  181  TSPKDIQaaaaraaaTTFPST--------------DAGEDGAQPRAADNTQQHLLTTNVV  318
            +SPKDIQAAAA+AAA ++PS               +A E  A+P A D++      +  +
Sbjct  92   SSPKDIQAAAAKAAALSYPSCSSTVSSSSSSSSSHEAQEHYAEP-AQDSS-----PSETI  145

Query  319  DDDIVFDLPDLSLVSG---MDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            +DD  FDLPDL L  G    DD Y        +  +    L+EPFLW
Sbjct  146  NDDTFFDLPDLLLDVGHYRSDDAYC------FSIVDTSISLEEPFLW  186



>gb|AAX23704.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
 gb|AAX23705.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
 gb|AAX23706.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
 gb|AAX28954.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 103/167 (62%), Gaps = 23/167 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAALAIKG +A LNFP LAH LPRPA+
Sbjct  57   WGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGRAAHLNFPDLAHELPRPAT  116

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDD---DIVFDLPDL  351
             +PKD+QAAAA AA+  FP++      A  +  D  + +  + +   D   D +FDLPDL
Sbjct  117  AAPKDVQAAAALAASADFPASATATANAGAKNPDGPEPNAASASTPPDTAEDALFDLPDL  176

Query  352  -------------SLVSGMDDEYGQISPSPLAGNNAG-FQLDEPFLW  450
                         S  S  DD+         AG  AG F+L+EP  W
Sbjct  177  LFDLRHGPPSCQVSCASTWDDDVA------FAGPGAGVFRLEEPLQW  217



>ref|XP_003635248.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Vitis vinifera]
Length=225

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 103/170 (61%), Gaps = 20/170 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLG++ TPEMAARAHDVAALAIKGHSA LNFP LAH  PRP +
Sbjct  56   WGKWVSEIREPRKKSRIWLGSFATPEMAARAHDVAALAIKGHSAHLNFPELAHQFPRPET  115

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQ------PRAADNTQQHLL-------TTNVVD  321
             SP+DI+AAAA+AA  T P      D A+      P +  NT            T    D
Sbjct  116  KSPEDIRAAAAKAAMFTHPRRREEADQAEVVGCHSPSSTSNTSCDDTKEPPPSPTVTTAD  175

Query  322  DDIVFDLPDL--SLVSG--MDDEYGQISPSPL---AGNNAGFQLDEPFLW  450
            D   FDLPDL  +L++   M D + Q    PL      +  F L+EP LW
Sbjct  176  DGTFFDLPDLFPNLITDHQMTDIFCQSIMWPLPEVESVDMDFYLEEPLLW  225



>ref|XP_010544587.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Tarenaya hassleriana]
Length=274

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 105/178 (59%), Gaps = 29/178 (16%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG  A LNFP L+  LPRPAS
Sbjct  95   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTGAFLNFPELSGELPRPAS  154

Query  181  TSPKDIQaaaaraaaTTF----PSTDAGEDGAQPRAA--------------DNTQQH---  297
            TSPKDIQAAA +AAA T+     + D G    +P                 D T      
Sbjct  155  TSPKDIQAAAGKAAAATWHDLGQNGDEGSSKTEPSGGVMYAVQSSSSLVSSDTTTYESSL  214

Query  298  ----LLTTNVVDDDIVFDLPDLSLVSGM--DDEYGQISPS-PLAGNNAGFQLDEPFLW  450
                  T    D+D +FDLPDL    G+  +D +   S +  L    + F+L+EPFLW
Sbjct  215  ISSASSTDKEGDEDTLFDLPDL-FTDGLTRNDAFCYYSSTWQLCAAESVFRLEEPFLW  271



>ref|XP_003622605.1| Ethylene-responsive transcription factor ERF034 [Medicago truncatula]
 gb|AES78823.1| AP2/ERF domain transcription factor [Medicago truncatula]
Length=235

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 103/160 (64%), Gaps = 15/160 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP+LA +LPRP++
Sbjct  69   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPNLAQNLPRPST  128

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAA-------DNTQQHLLTTNVVD------  321
            TSPKDIQ AAA+AAA  F      +D  Q + +       DN Q+   ++          
Sbjct  129  TSPKDIQVAAAKAAAIVFEEIKEDQDQDQDQVSFSTLSSIDNVQESNSSSPSTTATTNDD  188

Query  322  -DDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDE  438
             DD +FDLPDL    G +      S   L   ++G +L+E
Sbjct  189  IDDTLFDLPDL-FPDGKNGILSYYSSWHLCAVDSGLRLEE  227



>ref|XP_008238439.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Prunus 
mume]
Length=253

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 101/166 (61%), Gaps = 24/166 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  93   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGRSAVLNFPELAQELPRPAS  152

Query  181  TSPKDIQaaaaraaaTTFP-----------STDA---GEDGAQPRAADNTQQHLLTTNVV  318
             S KDIQAAAA+AAA  +P             DA    E     +A  +TQ    + +  
Sbjct  153  ASAKDIQAAAAKAAALNYPISCSSSSSSSREADAETEAELSQHRQAVHDTQDSSTSPSTN  212

Query  319  DDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEP--FLW  450
            +DD  FDLPDL L  G   ++G     P         L+EP  FLW
Sbjct  213  NDDTFFDLPDLLLDFGHHRDHGFCFSVPW--------LEEPNNFLW  250



>ref|XP_004510113.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=210

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 79/121 (65%), Gaps = 30/121 (25%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG+SA LNFP LA  LP+P S
Sbjct  78   WGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSAYLNFPQLAKQLPKPIS  137

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNT----QQHLLTTNVVDDDIVFDLPD  348
            TSPKDIQ                    A  +AA+NT    QQH       DD  +FDLPD
Sbjct  138  TSPKDIQF-------------------AAAKAANNTSFDSQQH-------DDSTLFDLPD  171

Query  349  L  351
            L
Sbjct  172  L  172



>ref|XP_008356544.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Malus domestica]
Length=278

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 106/172 (62%), Gaps = 23/172 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA LAIKG SA LNFP LA  LP+P S
Sbjct  106  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVATLAIKGVSAYLNFPELAQALPQPDS  165

Query  181  TSPKDIQaaaaraaaTTFPS-------TDAGEDGAQPR-------AADNTQQHLLT----  306
             SPKDIQAAAA+AAA    +        +A    A+P+          N Q+   T    
Sbjct  166  KSPKDIQAAAAKAAAAAASASEDKQLICEAETKEAEPKLPISTNSTLSNAQESSSTCASG  225

Query  307  TNVVDDDIVFDLPDLSLVSGMD--DEYGQISPSP--LAGNNAGFQLDEPFLW  450
            +   DD+ +FDLPDL  + G D  D +   S S   L   + GF+L +PFLW
Sbjct  226  STDYDDEKLFDLPDL-FMDGKDGSDNFCNYSSSTWHLCAADTGFRLGDPFLW  276



>ref|XP_007038336.1| Ethylene response factor 2 [Theobroma cacao]
 gb|EOY22837.1| Ethylene response factor 2 [Theobroma cacao]
Length=287

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 101/165 (61%), Gaps = 15/165 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVA++AIKG+SA LNFP  AH LPRPAS
Sbjct  121  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVASMAIKGNSAYLNFPESAHELPRPAS  180

Query  181  TSPKDIQaaaaraaaT------------TFPSTD---AGEDGAQPRAADNTQQHLLTTNV  315
            ++ +DIQ AA +AA              T PS D   A +  +    +  TQ    + +V
Sbjct  181  SARRDIQEAANKAAYAMVDQHNAMIEVKTVPSQDEMPAPQSPSSTTMSCETQGSPSSQSV  240

Query  316  VDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
              D + FDLPDLSL +     +G  S    AG +  F+ +E   W
Sbjct  241  DSDSMWFDLPDLSLEANSSHRFGYTSWWQQAGIDIEFKFEETMGW  285



>ref|XP_010919644.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF038 [Elaeis guineensis]
Length=267

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PT EMAARAHDVAAL IKG SA LNFP LA  LPRPA+
Sbjct  109  WGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAALTIKGESAYLNFPELARKLPRPAT  168

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHL------LTTNVVDDDIVFDL  342
            T+PKDIQAAAA AAA TF     G  G+  R A  T           +    D       
Sbjct  169  TAPKDIQAAAALAAAATFGDLSPGSSGSVCRDAVTTTSDSPXPATPSSGANDDALFDLPD  228

Query  343  PDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
              L L  G       + P+P   ++ GF+LDEPFLW
Sbjct  229  LLLDLRDGFCYSSAWLPPAPEEDSSIGFRLDEPFLW  264



>emb|CDX71804.1| BnaC08g30700D [Brassica napus]
Length=248

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 105/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  73   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGYLNFPELSGLLPRPVS  132

Query  181  TSPKDIQaaaaraaaTT------------------FPSTDAGEDGAQPRAADNTQQHLLT  306
             SPKDIQAAAA+AA TT                    + D     +    + +T +   T
Sbjct  133  CSPKDIQAAAAKAAETTWQEPVIHEKLVEELSHYELSTADQSSTSSSFVFSSDTSETSST  192

Query  307  TNVVDDDIVFDLPDLSLVSGMDDE------YGQISPSPLAGNNAGFQLDEPFLW  450
                +++ VFDLPDL    G+ ++      Y  +S   L G++  F+L+EPF W
Sbjct  193  DKESNEETVFDLPDL-FTEGLLNQNDAFRYYDSMSTWQLFGDDVVFRLEEPFTW  245



>ref|XP_011016474.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Populus euphratica]
Length=245

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 93/141 (66%), Gaps = 17/141 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG SA LNFP  AH LP P S
Sbjct  96   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGGSAYLNFPEFAHELPPPLS  155

Query  181  TSPKDIQaaaaraaaTTFPSTDAG------------EDGAQPRAADNTQQHLLTTNVVDD  324
             SPKDIQAAAA+AAA +F  T                + +   A DNTQ+   T +   D
Sbjct  156  KSPKDIQAAAAKAAAASFNETRYCEGEGGGEAELNVSNLSDSLAMDNTQESSSTPSTESD  215

Query  325  DIVFDLPDLSL-----VSGMD  372
            D +FDLPDL +      +GMD
Sbjct  216  DTLFDLPDLFIDGVHHSTGMD  236



>ref|XP_008347085.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Malus domestica]
Length=271

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTY T EMAARAHDVAALAIKG SA LNFP LA  LP+P S
Sbjct  97   WGKWVSEIREPRKKSRIWLGTYQTAEMAARAHDVAALAIKGASAYLNFPELAQALPQPDS  156

Query  181  TSPKDIQaaaaraaaTTFPS---------TDAGEDGAQ---PRAADNTQQHLLTTNV---  315
             SPKDIQAAAA+AA+    +          +A  + A+   P +A++T  +   ++    
Sbjct  157  KSPKDIQAAAAKAASEAAAASASEEKQLICEAETNEAEVKLPMSANSTLSNAQESSSTCA  216

Query  316  -----VDDDIVFDLPDLSLVSGMD--DEYGQISPSP--LAGNNAGFQLDEPFLW  450
                  D++ +FDLPDL ++ G D  D +   S S   L   + GF+L+EPFLW
Sbjct  217  SASTNYDEEQLFDLPDL-VIDGKDGSDNFRYYSSSTWHLCAADTGFRLEEPFLW  269



>ref|XP_004508937.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=231

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 108/154 (70%), Gaps = 8/154 (5%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTP+MAARAHDVAALAIKG SA LNFP LA  LPRPAS
Sbjct  79   WGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALAIKGSSAYLNFPELAAMLPRPAS  138

Query  181  TSPKDIQaaaaraaaTTF--PSTDAG-EDGAQPRAADNTQQHLLTTNVV-DDDIVFDLPD  348
            TSPKDIQAAAA+AAAT +  P+     E  A+P  A ++  H   +++  +DD+  +LPD
Sbjct  139  TSPKDIQAAAAKAAATFYNHPTRQLQLEAEAEPSQASSSSSHNERSSLNGEDDMFLNLPD  198

Query  349  LSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
            LSL    D        +     ++ F+L++ FLW
Sbjct  199  LSL----DYSSSAWLVTGAQHIDSAFRLEDSFLW  228



>emb|CDY41162.1| BnaA09g38530D [Brassica napus]
Length=248

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 105/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  73   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGYLNFPELSGLLPRPVS  132

Query  181  TSPKDIQaaaaraaaTTFP------------------STDAGEDGAQPRAADNTQQHLLT  306
             SPKDIQAAAA+AA TT+                   + D     +    + +T +   T
Sbjct  133  CSPKDIQAAAAKAAETTWKEPVIHEKLVEELSHSELSTADQSSTSSSFIFSSDTSETSST  192

Query  307  TNVVDDDIVFDLPDLSLVSGMDDE------YGQISPSPLAGNNAGFQLDEPFLW  450
                +++ VFDLPDL    G+ ++      Y   S   L G++  F+L+EPF W
Sbjct  193  DKESNEETVFDLPDL-FTEGLLNQNDAFRYYDSTSTWQLFGDDVVFRLEEPFTW  245



>ref|XP_009116730.1| PREDICTED: ethylene-responsive transcription factor ERF035 [Brassica 
rapa]
Length=248

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 104/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  73   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGYLNFPELSGLLPRPVS  132

Query  181  TSPKDIQaaaaraaaTT------------------FPSTDAGEDGAQPRAADNTQQHLLT  306
             SPKDIQAAAA+AA TT                    + D     +    + +T +   T
Sbjct  133  CSPKDIQAAAAKAAETTWQEPVIHEKLVEELSHSELSTADQSSTSSSFIFSSDTSETSST  192

Query  307  TNVVDDDIVFDLPDLSLVSGMDDE------YGQISPSPLAGNNAGFQLDEPFLW  450
                +++ VFDLPDL    G+ ++      Y   S   L G++  F+L+EPF W
Sbjct  193  DKESNEETVFDLPDL-FTEGLLNQNDAFRYYDSTSTWQLFGDDVVFRLEEPFTW  245



>ref|XP_007209502.1| hypothetical protein PRUPE_ppa010340mg [Prunus persica]
 gb|EMJ10701.1| hypothetical protein PRUPE_ppa010340mg [Prunus persica]
Length=253

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 101/166 (61%), Gaps = 24/166 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  93   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGRSAVLNFPELAQELPRPAS  152

Query  181  TSPKDIQaaaaraaaTTFPSTDAGED--------------GAQPRAADNTQQHLLTTNVV  318
             S KDIQAAAA+AAA  +P + +                     +A  +TQ    + +  
Sbjct  153  ASAKDIQAAAAKAAALNYPISCSSSSSSSREAEAETEAELSQHRQAVHDTQDSSTSPSTN  212

Query  319  DDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEP--FLW  450
            +DD+ FDLPDL L  G   ++G     P         L+EP  FLW
Sbjct  213  NDDMFFDLPDLLLDFGHHRDHGFCFSVPW--------LEEPNNFLW  250



>ref|XP_006445373.1| hypothetical protein CICLE_v10021740mg [Citrus clementina]
 ref|XP_006464460.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Citrus sinensis]
 gb|ESR58613.1| hypothetical protein CICLE_v10021740mg [Citrus clementina]
 gb|KDO85585.1| hypothetical protein CISIN_1g024791mg [Citrus sinensis]
Length=262

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 100/180 (56%), Gaps = 33/180 (18%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYP PEMAARAHDVAALAIKG SA LNFP LAH LP P S
Sbjct  83   WGKWVSEIREPRKKSRIWLGTYPIPEMAARAHDVAALAIKGRSAFLNFPLLAHQLPSPLS  142

Query  181  TSPKDIQaaaaraaaTTFPSTD------------------------------AGEDGAQP  270
             SPKDIQAAAA AAA      D                                 +  + 
Sbjct  143  KSPKDIQAAAAEAAAAFQAEPDPLQLPHVRVLSSSSNSNTTTGTTSLLSSDSTNVNTQEL  202

Query  271  RAADNTQQHLLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
             ++ N   HL   +  DDD  FDLPDL  ++G D   G          + GF+L+EPFLW
Sbjct  203  TSSPNDSLHLHHRD--DDDAFFDLPDL-FINGSDHLGGGFCSYLSTSVDTGFRLEEPFLW  259



>gb|AGB05623.1| DREB4A family transcription factor 2 [Euphorbia esula]
Length=211

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 102/160 (64%), Gaps = 14/160 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYP PEMAARAHDVA   IKG+SA LNFP L   LPRP +
Sbjct  55   WGKWVSEIRQPRKKSRIWLGTYPDPEMAARAHDVAEFKIKGNSAHLNFPDLIDKLPRPRT  114

Query  181  TSPKDIQaaaaraaaTTFP---STDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDL  351
            +SPKDIQ AAA AAA+ F    ST   E+   P++ +N Q+ L  ++   DD   DLPDL
Sbjct  115  SSPKDIQEAAAVAAASNFKKLESTAEEEEIVLPQSPEN-QESLSLSSPSRDDTFIDLPDL  173

Query  352  SLVSGMDDEYGQISPSPLAG-------NNAGFQLDEPFLW  450
             L   +   +G      +AG         AGF+ +E FLW
Sbjct  174  LL--DITHNFGDFCWQ-MAGVHDDPSSETAGFRHEEIFLW  210



>ref|XP_009387933.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=228

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 103/162 (64%), Gaps = 18/162 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAA+ IKG SA LNFP LA  LPRPAS
Sbjct  68   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAAMTIKGQSACLNFPELADELPRPAS  127

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-----------DD  327
             +P+ IQAAAA AAATTF     G  G   RA++ + +      +             DD
Sbjct  128  AAPEHIQAAAALAAATTF-----GGRGETTRASEESGRRQAEMPMSRSPAPAALSSDGDD  182

Query  328  IVFDLPDLSL-VSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
             +FDLPDL L VS     +   +PS +  +   F+++EP +W
Sbjct  183  KLFDLPDLPLDVSEGFRSHPSWAPSTVE-DCIQFRVEEPLVW  223



>emb|CBI16632.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   137 bits (344),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG S  LNFP LAH LPRPAS
Sbjct  563  WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGSSPHLNFPELAHALPRPAS  622

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE  255
            TSPKDIQAAAA AA TTF   D  E
Sbjct  623  TSPKDIQAAAAEAANTTFSQPDETE  647



>ref|XP_011031921.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Populus 
euphratica]
Length=226

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 99/147 (67%), Gaps = 15/147 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+PKKKSRIWLGT+ TPEMAARAHDVAAL IKGHSA LNFP LAH  PRPAS
Sbjct  49   WGKWVSEIRQPKKKSRIWLGTFSTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  108

Query  181  TSPKDIQaaaaraaaTTFPSTDAG-EDGAQPR-----------AADNTQQHLLTT--NVV  318
            +SPKDIQAAAA AA  +  +   G E  A+             A++ TQ++ L++     
Sbjct  109  SSPKDIQAAAALAATLSCKTGQKGRETEAEAELMLPCSLDSTLASNETQEYSLSSPLRDD  168

Query  319  DDDIVFDLPD-LSLVSGMDDEYGQISP  396
            DDD   DLPD L  +S   DE+  +SP
Sbjct  169  DDDTFIDLPDILQDISHQFDEFCYLSP  195



>gb|KFK36467.1| hypothetical protein AALP_AA4G128400 [Arabis alpina]
Length=190

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 84/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  53   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  112

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
              PKDIQAAAA AA          E      ++ +T+      N + DD   DLPDL L
Sbjct  113  ADPKDIQAAAAAAAVADM------EVETSSPSSTSTEISSPVMNAIADDAFSDLPDLLL  165



>ref|XP_011048423.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Populus euphratica]
Length=227

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 16/148 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+PKKKSRIWLGT+ TPEMAARAHDVAAL IKGHSA LNFP LAH  PRPAS
Sbjct  49   WGKWVSEIRQPKKKSRIWLGTFSTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  108

Query  181  TSPKDIQaaaaraaaTTFPSTDAG-EDGAQPR-----------AADNTQQHLLTT---NV  315
            +SPKDIQAAAA AA  +  +   G E  A+             A++ TQ++ L++   + 
Sbjct  109  SSPKDIQAAAALAATLSCKTGQKGRETEAEAELMLPCSLDSTLASNETQEYSLSSPLRDD  168

Query  316  VDDDIVFDLPD-LSLVSGMDDEYGQISP  396
             DDD   DLPD L  +S   DE+  +SP
Sbjct  169  DDDDTFIDLPDILQDISHQFDEFCYLSP  196



>gb|KDP39899.1| hypothetical protein JCGZ_03430 [Jatropha curcas]
Length=238

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 87/125 (70%), Gaps = 9/125 (7%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAA  IKGHSA LNFP LAH LPRPAS
Sbjct  76   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAASTIKGHSAHLNFPELAHKLPRPAS  135

Query  181  TSPKDIQaaaaraaaTTFPSTDAGED--------GAQPRAADNTQQHLLTTNVVDDDIVF  336
            +SPKDIQAAAA AAA  + + +   D          +P+  D T+     T   +DD   
Sbjct  136  SSPKDIQAAAALAAALNYQNDNEVADLIISSQLGEPEPQWPDITEAS-HDTQESEDDTFI  194

Query  337  DLPDL  351
            DLPDL
Sbjct  195  DLPDL  199



>ref|XP_007010564.1| Ethylene response factor 2 [Theobroma cacao]
 gb|EOY19374.1| Ethylene response factor 2 [Theobroma cacao]
Length=278

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 98/165 (59%), Gaps = 15/165 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT +MAARAHDVA++ IKG SA LNFP  AH LPRPAS
Sbjct  112  WGKWVSEIREPRKKSRIWLGTFPTADMAARAHDVASMVIKGDSAYLNFPESAHELPRPAS  171

Query  181  TSPKDIQaaaaraaaT------------TFPSTDAG---EDGAQPRAADNTQQHLLTTNV  315
            +S +DIQ AA +AA              T PS D     +  +    +  TQ    + +V
Sbjct  172  SSRRDIQEAANKAAYAMVDQHNAMIEVKTEPSQDEMPVPQSPSTTTMSCETQGSPSSQSV  231

Query  316  VDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
              D + FDLPDLSL +     +G  S    AG +  FQ +E   W
Sbjct  232  DSDSMWFDLPDLSLEANSSHRFGYTSWWQQAGIDTEFQFEETMGW  276



>ref|XP_002880148.1| hypothetical protein ARALYDRAFT_483623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56407.1| hypothetical protein ARALYDRAFT_483623 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 107/183 (58%), Gaps = 34/183 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  104  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPELSGELPRPVT  163

Query  181  TSPKDIQaaaaraa------aTTFPSTDAGE-------------------DGAQPRAADN  285
             SPKDIQAAA+ AA           +++  E                     A  ++ ++
Sbjct  164  NSPKDIQAAASLAAVNWQDPVNDVSNSEVAELAEAEPSRAVVAQLFSSDTSTATTQSQES  223

Query  286  TQQHLLTTNVVDDDI----VFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQLDE  438
            ++    +T+  D D     +FDLPDL    + +   +D +   S +  L G +AGF+L+E
Sbjct  224  SEASCASTSCTDKDSEEEKLFDLPDLFTDENEMMIRNDAFCYYSSTWQLCGADAGFRLEE  283

Query  439  PFL  447
            PF 
Sbjct  284  PFF  286



>ref|XP_006397675.1| hypothetical protein EUTSA_v10001792mg [Eutrema salsugineum]
 gb|ESQ39128.1| hypothetical protein EUTSA_v10001792mg [Eutrema salsugineum]
Length=298

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 106/190 (56%), Gaps = 41/190 (22%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  105  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGATAFLNFPELSGELPRPVT  164

Query  181  TSPKDIQaaaaraa-----aTTFPSTDAGEDGAQPRAAD--------------------N  285
             SPKDIQAAA  AA     + T        DGA+   A+                     
Sbjct  165  NSPKDIQAAATSAAVNWQDSATVSLRVNNSDGAELAEAEPSRAVMAQSLSSSVVCSSDTM  224

Query  286  TQQHLLTTNVV-----------DDDIVFDLPDL----SLVSGMDDEYGQISPS-PLAGNN  417
            TQQ    T+             D++ +FDLPDL    + +   +D +   S +  L G +
Sbjct  225  TQQESSETSCASTTTSFADKDSDEEKLFDLPDLFTDGNEMMIRNDAFCYYSSTWQLCGAD  284

Query  418  AGFQLDEPFL  447
            AGF+L+EPF 
Sbjct  285  AGFRLEEPFF  294



>emb|CDX98416.1| BnaC06g17770D [Brassica napus]
Length=243

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 98/164 (60%), Gaps = 22/164 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  75   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGYLNFPELSGLLPRPVS  134

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRA-----------------ADNTQQHLLTT  309
             SPKDIQAAAA+AA   +      E  A  R+                 + +T   L T 
Sbjct  135  CSPKDIQAAAAKAAEVMWQEPVIDEKLANERSHSELSTAQSSTSSSFVFSSDTIDSLSTD  194

Query  310  NVVDDDIVFDLPDLSLVSGM--DDEYGQISPS---PLAGNNAGF  426
               +++ VFDLPDL +   +  DD +G    +    L G + GF
Sbjct  195  KESNEETVFDLPDLFMEGFLNHDDSFGYYESTTTWQLYGEDVGF  238



>ref|XP_009400694.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Musa acuminata subsp. malaccensis]
Length=246

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 101/157 (64%), Gaps = 22/157 (14%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKG SA LNFP LA  LPRPA+
Sbjct  104  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGQSAHLNFPELAAVLPRPAT  163

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-DDIVFDLPDLSL  357
             +PKDIQAAAA AAA              P  A+    H LTT   D +D +FDLPDL L
Sbjct  164  AAPKDIQAAAALAAAC-------------PGQAEQPVSHSLTTPSSDGEDALFDLPDLFL  210

Query  358  VSGMDDEYGQISPSPLAG------NNAGFQLDEPFLW  450
               + D +   SP P +       +   F+++EPFLW
Sbjct  211  --DLRDAFCHSSPPPSSWLPSTEEDGIVFRVEEPFLW  245



>ref|XP_004162335.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cucumis sativus]
Length=214

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 84/126 (67%), Gaps = 15/126 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ TPEMAARAHDVAA  IKGHSA LNFP LAH LPRPAS
Sbjct  52   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAAKTIKGHSAYLNFPELAHRLPRPAS  111

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-------DDIVFD  339
            +SPKDI+AAAA+AA           D   P A      +   ++ V        DD  FD
Sbjct  112  SSPKDIRAAAAKAALFN--------DEQNPGAKSEMNLNCCGSSAVAVKSGGEIDDTFFD  163

Query  340  LPDLSL  357
            LPDL +
Sbjct  164  LPDLFI  169



>ref|XP_004492188.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=233

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGK+VSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGHSA LNFP+LA +LPRP++
Sbjct  65   WGKYVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPNLAQNLPRPST  124

Query  181  TSPKDIQaaaaraaaTTF  234
            TSPKDIQAAAA+AAAT F
Sbjct  125  TSPKDIQAAAAKAAATIF  142



>ref|XP_008448820.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Cucumis 
melo]
Length=214

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 84/126 (67%), Gaps = 15/126 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ TPEMAARAHDVAA  IKGHSA LNFP LAH LPRPAS
Sbjct  52   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAAKTIKGHSAYLNFPELAHRLPRPAS  111

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-------DDIVFD  339
            +SPKDI+AAAA+AA           D   P A      +   ++ V        DD  FD
Sbjct  112  SSPKDIRAAAAKAALFN--------DEQNPGAKSELNLNCCGSSAVAVKSGGEIDDTFFD  163

Query  340  LPDLSL  357
            LPDL +
Sbjct  164  LPDLFI  169



>emb|CDX79619.1| BnaC03g19550D [Brassica napus]
Length=203

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 96/150 (64%), Gaps = 15/150 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PT EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  64   WGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAALAIKGDSAHLNFPELAYHLPRPAS  123

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL-  357
              PKDIQAAAA AAA+     D G + + P +   T+          DD   DLPDL L 
Sbjct  124  ADPKDIQAAAAEAAASVV--IDMGIETSSP-STGATELSPPAVASTADDAFSDLPDLLLD  180

Query  358  VSGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
            V+  +D + +            F  +EPF 
Sbjct  181  VNHKNDGFWE-----------SFPYEEPFF  199



>ref|XP_008803818.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Phoenix dactylifera]
Length=319

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 97/159 (61%), Gaps = 9/159 (6%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKG SA LNFP LA  LPRPA+
Sbjct  158  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGQSAYLNFPELACKLPRPAT  217

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAA---------DNTQQHLLTTNVVDDDIV  333
            +SPKDIQAAAA AAA TF     G  G+   AA         D+      ++   D    
Sbjct  218  SSPKDIQAAAALAAAATFGDCSPGSCGSVESAACRDEITTTSDSPPPATPSSGNDDALFD  277

Query  334  FDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
                 L L  G       + P+P   +  GF+L+EPFLW
Sbjct  278  LPDLLLDLRDGFCYSSTWLPPAPEEDSTIGFRLEEPFLW  316



>gb|EPS69678.1| hypothetical protein M569_05091, partial [Genlisea aurea]
Length=109

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 79/117 (68%), Gaps = 20/117 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWV EIREPKKKSRIWLGTY T EMAARAHDVAALAIKG SA LNFP LA  LPRPAS
Sbjct  10   WGKWVCEIREPKKKSRIWLGTYETAEMAARAHDVAALAIKGRSAHLNFPALAEELPRPAS  69

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDL  351
            TS +DIQAAAA+AA     S+ +G +                    DDD  FDLPDL
Sbjct  70   TSRRDIQAAAAKAAFIGSESSGSGRE--------------------DDDAFFDLPDL  106



>ref|XP_010524419.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Tarenaya hassleriana]
Length=276

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 104/183 (57%), Gaps = 33/183 (18%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTY T EMAARAHDVAALAIKG +A LNFP L+  LPRPA+
Sbjct  91   WGKWVSEIRQPRKKSRIWLGTYRTAEMAARAHDVAALAIKGSTAYLNFPKLSGELPRPAT  150

Query  181  TSPKDIQaaaaraaaT-----------TFPSTDAGEDGA-------------------QP  270
            TSPKDIQAAAA+AAAT           T  S D+GE                        
Sbjct  151  TSPKDIQAAAAKAAATWHDLTPTADDRTMGSDDSGESETSRAEISAARSSSSLVSSDMMT  210

Query  271  RAADNTQQHLLTTNVVDDDIVFDLPDLSLVSGMDDE---YGQISPSPLAGNNAGFQLDEP  441
            R +  T          ++D +FDLPDL       ++   Y   S   L   ++ F+L+EP
Sbjct  211  RDSSVTSSASSADKDSEEDTLFDLPDLFTDGSTRNDAFCYSYSSTWQLCAADSVFRLEEP  270

Query  442  FLW  450
            FLW
Sbjct  271  FLW  273



>ref|XP_006477148.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Citrus sinensis]
Length=287

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKGHSA LNFP LAH LPRPA+
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAALAIKGHSAYLNFPELAHELPRPAT  142

Query  181  TSPKDIQ  201
            +SPKDIQ
Sbjct  143  SSPKDIQ  149



>gb|KDO61381.1| hypothetical protein CISIN_1g023148mg [Citrus sinensis]
Length=286

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKGHSA LNFP LAH LPRPA+
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAALAIKGHSAYLNFPELAHELPRPAT  142

Query  181  TSPKDIQ  201
            +SPKDIQ
Sbjct  143  SSPKDIQ  149



>gb|KDO61382.1| hypothetical protein CISIN_1g023148mg [Citrus sinensis]
Length=285

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKGHSA LNFP LAH LPRPA+
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAALAIKGHSAYLNFPELAHELPRPAT  142

Query  181  TSPKDIQ  201
            +SPKDIQ
Sbjct  143  SSPKDIQ  149



>ref|XP_009133039.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Brassica rapa]
 emb|CDX84602.1| BnaA03g16280D [Brassica napus]
Length=203

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 95/150 (63%), Gaps = 15/150 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PT EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  64   WGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAALAIKGDSAHLNFPELAYHLPRPAS  123

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL-  357
              PKDIQAAAA AAA+     D         A + +   + +T    DD   DLPDL L 
Sbjct  124  AHPKDIQAAAAEAAASVVIDMDIETSSPSTGATELSPPAVASTA---DDAFSDLPDLFLD  180

Query  358  VSGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
            V+  +D + +            F  +EPF 
Sbjct  181  VNHKNDGFWE-----------SFPYEEPFF  199



>ref|XP_004252501.1| PREDICTED: dehydration-responsive element-binding protein 3 [Solanum 
lycopersicum]
Length=143

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPTPEMAARAHDVAAL+IKG+SA LNFP L   LPRPAS
Sbjct  38   WGKWVSEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGNSAILNFPQLVESLPRPAS  97

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  98   ISPRDVQ  104



>gb|KDO61383.1| hypothetical protein CISIN_1g023148mg [Citrus sinensis]
Length=248

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKGHSA LNFP LAH LPRPA+
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAALAIKGHSAYLNFPELAHELPRPAT  142

Query  181  TSPKDIQ  201
            +SPKDIQ
Sbjct  143  SSPKDIQ  149



>ref|XP_006440269.1| hypothetical protein CICLE_v10024602mg [Citrus clementina]
 gb|ESR53509.1| hypothetical protein CICLE_v10024602mg [Citrus clementina]
Length=293

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKGHSA LNFP LAH LPRPA+
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAALAIKGHSAYLNFPELAHELPRPAT  142

Query  181  TSPKDIQ  201
            +SPKDIQ
Sbjct  143  SSPKDIQ  149



>ref|XP_002876560.1| hypothetical protein ARALYDRAFT_486521 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52819.1| hypothetical protein ARALYDRAFT_486521 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 103/179 (58%), Gaps = 30/179 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  84   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGYLNFPELSGLLPRPVS  143

Query  181  TSPKDIQ-aaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTT----------------  309
             SPKDIQ AA   A ATT+      E  A+P   + +   LL+T                
Sbjct  144  CSPKDIQAAATKAAEATTWQKPIINEKLAEPEGDELSHSELLSTAQSSTSSCFVFSSDTS  203

Query  310  ------NVVDDDIVFDLPDLSLVSGM---DDEYGQISPS---PLAGNNAGFQLDEPFLW  450
                     +++ VFDLPDL    G+   +D +   + +    L G + G + +EPF W
Sbjct  204  ETSSTDKESNEEKVFDLPDL-FTDGLMNQNDAFCLCNGTFTWQLYGEDVGLRFEEPFNW  261



>ref|NP_001235341.1| dehydration-responsive element binding protein 6 [Glycine max]
 gb|ABQ42205.1| dehydration-responsive element binding protein 6 [Glycine max]
Length=230

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 101/164 (62%), Gaps = 17/164 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTP+MAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  67   WGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLNFPELADELPRPAS  126

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNV-----------VDDD  327
            TSPKDIQAAAA+AAA  F       +    RA  ++   +LT              VDD 
Sbjct  127  TSPKDIQAAAAKAAALDFGHRSHDAESELSRAVSSS---ILTQASSSSSNSSSLKGVDDT  183

Query  328  IVFDLPDLSLVSGMDDEYGQISPSPLAGN---NAGFQLDEPFLW  450
             +        +S   DE+   S   +AG      GF+L++PFLW
Sbjct  184  FLDLPDLSLDLSHGADEFHYSSAWLVAGAEHIELGFRLEDPFLW  227



>ref|NP_182021.1| ethylene-responsive transcription factor ERF034 [Arabidopsis 
thaliana]
 sp|Q8LBQ7.2|ERF34_ARATH RecName: Full=Ethylene-responsive transcription factor ERF034 
[Arabidopsis thaliana]
 gb|AAM14835.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAP40391.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAP40485.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 dbj|BAF01461.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEC10488.1| ethylene-responsive transcription factor ERF034 [Arabidopsis 
thaliana]
Length=295

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 106/185 (57%), Gaps = 36/185 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP LA  LPRP +
Sbjct  108  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPKLAGELPRPVT  167

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDG-------AQPRAA-------------------D  282
             SPKDIQAAA+ AA     S +   +        A+P  A                   +
Sbjct  168  NSPKDIQAAASLAAVNWQDSVNDVSNSEVAEIVEAEPSRAVVAQLFSSDTSTTTTTQSQE  227

Query  283  NTQQHLLTTNVVDD-----DIVFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQL  432
             ++    +T+   D     + +FDLPDL    + +   +D +   S +  L G +AGF+L
Sbjct  228  YSEASCASTSACTDKDSEEEKLFDLPDLFTDENEMMIRNDAFCYYSSTWQLCGADAGFRL  287

Query  433  DEPFL  447
            +EPF 
Sbjct  288  EEPFF  292



>ref|XP_003597699.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
 gb|AES67950.1| AP2 domain class transcription factor [Medicago truncatula]
Length=206

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTY TPEMAARAHDVAAL+IKGHSA LNFP +AH LPRP +
Sbjct  49   WGKWVSEIREPRKKSRIWLGTYATPEMAARAHDVAALSIKGHSAILNFPEIAHMLPRPTT  108

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  109  LSPRDIQ  115



>ref|XP_009104264.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Brassica rapa]
Length=243

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 95/164 (58%), Gaps = 22/164 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  75   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGCLNFPELSTLLPRPVS  134

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRA-----------------ADNTQQHLLTT  309
             SPKDIQAAAA+AA   +      E  A  R+                 + +T   L T 
Sbjct  135  CSPKDIQAAAAKAAEVMWQEPVIDEKLANERSYSELSTAQSSTSSSFVFSSDTLDTLSTD  194

Query  310  NVVDDDIVFDLPDLSLVSGMDDE-----YGQISPSPLAGNNAGF  426
               +++ +FDLPDL     M+       Y   +   L G + GF
Sbjct  195  KESNEETMFDLPDLFTEGFMNHNDSFRYYESTTTWQLYGEDVGF  238



>emb|CDX67829.1| BnaA07g18690D [Brassica napus]
Length=243

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 95/164 (58%), Gaps = 22/164 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  75   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGCLNFPELSTLLPRPVS  134

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRA-----------------ADNTQQHLLTT  309
             SPKDIQAAAA+AA   +      E  A  R+                 + +T   L T 
Sbjct  135  CSPKDIQAAAAKAAEVMWQEPVIDEKLANERSYSELSTAQSSTSSSFVFSSDTLDTLSTD  194

Query  310  NVVDDDIVFDLPDLSLVSGMDDE-----YGQISPSPLAGNNAGF  426
               +++ +FDLPDL     M+       Y   +   L G + GF
Sbjct  195  KESNEETMFDLPDLFTEGFMNHNDSFRYYESTTTWQLYGEDVGF  238



>ref|XP_006402577.1| hypothetical protein EUTSA_v10006200mg [Eutrema salsugineum]
 gb|ESQ44030.1| hypothetical protein EUTSA_v10006200mg [Eutrema salsugineum]
Length=248

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 101/180 (56%), Gaps = 31/180 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAI+G+S  LNFP L+  LPRP S
Sbjct  67   WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIRGNSGYLNFPELSGLLPRPVS  126

Query  181  TSPKDIQaaaaraaaTTF--PSTDAGEDGAQPRAADNTQQHLLTTNVV------------  318
            +SPKDIQ AAA+AA  T+  P  D  E   +    D      L+T               
Sbjct  127  SSPKDIQIAAAKAAEATWREPVHDH-EKAKRLMGTDELSHSELSTAQSSASSSVVFSSDT  185

Query  319  -----------DDDIVFDLPDLSLVSGMDDE-----YGQISPSPLAGNNAGFQLDEPFLW  450
                       +++ VFDLPDL     M+       Y   S   L  N+  F+L+EPF W
Sbjct  186  SETSSTHDKESNEETVFDLPDLFTDGLMNQNDAFRYYDDTSTWHLYENDVWFRLEEPFTW  245



>ref|XP_010516772.1| PREDICTED: ethylene-responsive transcription factor ERF038 [Camelina 
sativa]
Length=196

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  54   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  113

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
              PKDIQAAAA AAA      +       P +   T+     T  + DD   DLPDL L
Sbjct  114  ADPKDIQAAAAAAAAAVAIDMEVETSSPSP-SPTVTETSSPGTTAISDDAFSDLPDLLL  171



>ref|XP_004147220.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cucumis sativus]
 gb|KGN55849.1| hypothetical protein Csa_3G019400 [Cucumis sativus]
Length=214

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 83/126 (66%), Gaps = 15/126 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAA  IKGHSA LNFP LAH LPRPAS
Sbjct  52   WGKWVSEIREPKKKSRIWLGTFSTSEMAARAHDVAAKTIKGHSAYLNFPELAHRLPRPAS  111

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVD-------DDIVFD  339
            +SPKDI+AAAA+AA           D   P A      +   ++ V        DD  FD
Sbjct  112  SSPKDIRAAAAKAALFN--------DEQNPGAKSEMNLNCCGSSAVAVKSGGEIDDTFFD  163

Query  340  LPDLSL  357
            LPDL +
Sbjct  164  LPDLFI  169



>gb|KEH36063.1| AP2 domain class transcription factor [Medicago truncatula]
Length=187

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL+IKG +A LNFP LA+ LPRPAS
Sbjct  51   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAILNFPELANLLPRPAS  110

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQ----PRAAD--NTQQHLLTTNVVDDDIVFDL  342
             +P+D+QAAA +AA   FPS+    + ++    PR  +  +  +  +  + +D   +F  
Sbjct  111  LAPRDVQAAANKAAHMEFPSSTTSYELSEIIELPRLGNVGDFGKEFVFMDSIDTSWMFQP  170

Query  343  PDL  351
            P L
Sbjct  171  PCL  173



>gb|ACJ84469.1| unknown [Medicago truncatula]
 gb|AFK43951.1| unknown [Medicago truncatula]
Length=194

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL+IKG +A LNFP LA+ LPRPAS
Sbjct  51   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAILNFPELANLLPRPAS  110

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQ----PRAAD--NTQQHLLTTNVVDDDIVFDL  342
             +P+D+QAAA +AA   FPS+    + ++    PR  +  +  +  +  + +D   +F  
Sbjct  111  LAPRDVQAAANKAAHMEFPSSTTSYELSEIIELPRLGNVGDFGKEFVFMDSIDTSWMFQP  170

Query  343  PDL  351
            P L
Sbjct  171  PCL  173



>ref|XP_003549925.1| PREDICTED: ethylene-responsive transcription factor ERF035 [Glycine 
max]
Length=232

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTP+MAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  70   WGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLNFPELAAKLPRPAS  129

Query  181  TSPKDIQaaaaraaaTTF--PSTDAGEDGAQP-----RAADNTQQHLLTTNVVDDDIVFD  339
            TSPKDIQAAAA+A+A  F   S +A  + +Q      +   ++     +   VDD  +  
Sbjct  130  TSPKDIQAAAAKASALDFGHQSHEAESELSQAVSSSIQTQSSSSSSNSSLKGVDDTFLDL  189

Query  340  LPDLSLVSGMDDEYGQISPSPLAGN---NAGFQLDEPFLW  450
                  +S   DE+   S   +AG      GF+L+EPFLW
Sbjct  190  PDLSLDLSHGADEFHYSSAWLVAGAEHIELGFRLEEPFLW  229



>gb|ABR16697.1| unknown [Picea sitchensis]
Length=247

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 90/147 (61%), Gaps = 30/147 (20%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL +KG SA LNFPHLA  LPRPA+
Sbjct  53   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALTLKGESAILNFPHLASSLPRPAT  112

Query  181  TSPKDIQaaaaraaaT--TFPSTDAGEDGAQPRAADNTQ---------------------  291
             S +DIQ AAA AAA   T    D  ED +   A  NT+                     
Sbjct  113  LSTRDIQEAAAAAAAAFHTPSEEDHNEDRSLDPAVTNTEAVHPESNINEKAAAAAACVSN  172

Query  292  ----QHLLTTN---VVDDDIVFDLPDL  351
                   L+ N   ++DDDI+FDLP+ 
Sbjct  173  SAWISSFLSENESTIIDDDILFDLPNF  199



>gb|KFK37291.1| hypothetical protein AALP_AA4G238300 [Arabis alpina]
Length=291

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 102/190 (54%), Gaps = 43/190 (23%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  100  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGTTAYLNFPELSGELPRPVT  159

Query  181  TSPKDIQ-----------------------------------aaaaraaaTTFPSTDAGE  255
             SPKDIQ                                   A  A++ +  F S    +
Sbjct  160  NSPKDIQAAATAAAINWQDSSINSHGENNSEIAELAEAEPSRAVMAQSNSGVFSSDATTQ  219

Query  256  DGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSLVSG-----MDDEYGQISPS-PLAGNN  417
            + ++   A  T   +   N  +++ +FDLPDL    G      +D +   S +  L G +
Sbjct  220  ESSEASCASTTTLCMDKDN--EEEKLFDLPDLFSDDGNGMMIRNDAFCYYSSAWQLCGAD  277

Query  418  AGFQLDEPFL  447
            AGF+L+EPF 
Sbjct  278  AGFRLEEPFF  287



>ref|XP_010509574.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Camelina sativa]
Length=199

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  56   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  115

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
              PKDIQAAAA AAA      +     +   +   T+        + DD   DLPDL L
Sbjct  116  ADPKDIQAAAAAAAAAVAIDMEVETTSSPSPSPTVTETSSPGMTAISDDAFSDLPDLLL  174



>gb|AFG61639.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61641.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61642.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61643.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61644.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61645.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61646.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61647.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61649.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61650.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61651.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
Length=151

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP +A  LPRPA+
Sbjct  6    WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGKSAFLNFPQIASSLPRPAT  65

Query  181  TSPKDIQ  201
             SPKDIQ
Sbjct  66   LSPKDIQ  72



>gb|AAM64613.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
Length=295

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 107/185 (58%), Gaps = 36/185 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP LA  LPRP +
Sbjct  108  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPKLAGELPRPVT  167

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDG-------AQP-------------------RAAD  282
             SPKDIQAAA+ AA     S +   +        A+P                   ++ +
Sbjct  168  NSPKDIQAAASLAAVNWQDSVNDVSNSEVAEIVEAEPSRTVVAQLFSSDTSTTTTTQSQE  227

Query  283  NTQQHLLTTNVVDD-----DIVFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQL  432
             ++    +T+   D     + +FDLPDL    + +   +D +   S +  L G +AGF+L
Sbjct  228  YSEASCASTSACTDKDSEEEKLFDLPDLFTDENEMMIRNDAFCYYSSTWQLCGADAGFRL  287

Query  433  DEPFL  447
            +EPF 
Sbjct  288  EEPFF  292



>ref|XP_008646010.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Zea mays]
 gb|AFW72635.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05310.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=277

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 102/161 (63%), Gaps = 9/161 (6%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG  A LNFPHLAH LPRPAS
Sbjct  103  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRGAHLNFPHLAHDLPRPAS  162

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADN-------TQQHLLTTNVVDDDIVFD  339
            TSP DIQAAAA+AAA    +    E      A +        +++    +N  +  ++FD
Sbjct  163  TSPADIQAAAAKAAAAAADADVEVEQCESSHAVETPSSSAASSEEVAAASNAEEMSVLFD  222

Query  340  LPDL--SLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW*H  456
            LPDL   L  G+       +P+ +   + G  L EP LW H
Sbjct  223  LPDLLMDLSDGLWSPIWAAAPAAVEEYDGGDSLSEPLLWAH  263



>ref|XP_010518106.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Camelina sativa]
Length=283

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 104/179 (58%), Gaps = 30/179 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  102  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPELSGELPRPVT  161

Query  181  TSPKDIQaaaaraaaT----------------TFPSTDAGEDGAQPRAADNTQQHL----  300
             SPKDIQAAA+ AA                    PS  A    +       +Q+ L    
Sbjct  162  NSPKDIQAAASLAAVNWQDPVNDVEEVAELAEAEPSRAATVISSDTSTTTQSQESLEASC  221

Query  301  -LTTNVVDDD----IVFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQLDEPFL  447
              TT+  D D     +FDLPDL    + +   ++ +   S +  L G +AGF+L+EPF 
Sbjct  222  ASTTSCTDKDNDEEKLFDLPDLFTDENEMMIRNETFCYYSSTWQLCGADAGFRLEEPFF  280



>ref|XP_009143083.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Brassica 
rapa]
Length=282

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 107/190 (56%), Gaps = 44/190 (23%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT +MAARAHDVAALAIKG +A LNFP LA  LPRP +
Sbjct  92   WGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAIKGTTAYLNFPELAGELPRPVT  151

Query  181  TSPKDIQaaaaraaaTTFPS-------TDAGEDG-AQPRAA--------------DNTQQ  294
             SPKDIQAAA  AA     S       +D  E   A+P  A              D   Q
Sbjct  152  NSPKDIQAAATAAAVNWQDSGGLHVDISDITEKTEAEPSGAVMAQSLSDSVVFSSDIITQ  211

Query  295  HL------LTTNVVDDDI----VFDLPDLSLVSGMDDEYGQI---------SPSPLAGNN  417
             L       TT+ VD D     +FDLPD  L +G  +E G I         S   L G +
Sbjct  212  ELSETSCASTTSFVDKDSDEEKLFDLPD--LFNG-GNEIGIIRNDAFWYDSSTWQLCGAD  268

Query  418  AGFQLDEPFL  447
            AGF+L+EPF 
Sbjct  269  AGFRLEEPFF  278



>ref|NP_181113.1| ethylene-responsive transcription factor ERF038 [Arabidopsis 
thaliana]
 sp|Q9ZQP3.1|ERF38_ARATH RecName: Full=Ethylene-responsive transcription factor ERF038 
[Arabidopsis thaliana]
 gb|AAD15445.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAT44912.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABE65886.1| AP2 domain-containing transcription factor [Arabidopsis thaliana]
 gb|ABF83644.1| At2g35700 [Arabidopsis thaliana]
 gb|AEC09146.1| ethylene-responsive transcription factor ERF038 [Arabidopsis 
thaliana]
Length=194

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 90/149 (60%), Gaps = 11/149 (7%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  53   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  112

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSLV  360
              PKDIQAAAA AAA      D       P +   T+        + DD   DLPDL L 
Sbjct  113  ADPKDIQAAAAAAAAAVAIDMDVETSSPSP-SPTVTETSSPAMIALSDDAFSDLPDLLLN  171

Query  361  SGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
               +          + G    F  +EPFL
Sbjct  172  VNHN----------IDGFWDSFPYEEPFL  190



>gb|AFG61640.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61648.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
Length=151

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP +A  LPRPA+
Sbjct  6    WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGKSAFLNFPQIASSLPRPAT  65

Query  181  TSPKDIQ  201
             SPKDIQ
Sbjct  66   LSPKDIQ  72



>emb|CDX74699.1| BnaA05g04450D [Brassica napus]
Length=282

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 105/190 (55%), Gaps = 44/190 (23%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT +MAARAHDVAALAIKG +A LNFP LA  LPRP +
Sbjct  92   WGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAIKGTTAYLNFPELAGELPRPVT  151

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDG--------AQPRAA--------------DNTQQ  294
             SPKDIQAAA  AA     S     D         A+P  A              D   Q
Sbjct  152  NSPKDIQAAATAAAVNWQDSGGLHVDNSDITEKTEAEPSGAVMAQSLSDSAVFSSDIITQ  211

Query  295  HL------LTTNVVDDDI----VFDLPDLSLVSGMDDEYGQI---------SPSPLAGNN  417
             L       TT+ VD D     +FDLPD  L +G  +E G I         S   L G +
Sbjct  212  ELSETSCASTTSFVDKDSDEEKLFDLPD--LFNG-GNEIGIIRNDAFWYDSSTWQLCGAD  268

Query  418  AGFQLDEPFL  447
            AGF+L+EPF 
Sbjct  269  AGFRLEEPFF  278



>ref|XP_006295043.1| hypothetical protein CARUB_v10024111mg [Capsella rubella]
 gb|EOA27941.1| hypothetical protein CARUB_v10024111mg [Capsella rubella]
Length=194

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 81/119 (68%), Gaps = 4/119 (3%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  55   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  114

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
              PKDIQAAAA AAA      +       P   D +     T   + DD   DLPDL L
Sbjct  115  ADPKDIQAAAAAAAAINDMEVETSP-SPSPTVTDTSSP---TMTAISDDAFSDLPDLLL  169



>ref|XP_004501158.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
 ref|XP_004517241.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
Length=171

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL+IKG++A LNFP LA+ LPRPAS
Sbjct  40   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNAAILNFPELANSLPRPAS  99

Query  181  TSPKDIQaaaaraaaTTFPST  243
             +P+D+QAAA +AA   FPS+
Sbjct  100  LAPRDVQAAATKAAHMEFPSS  120



>gb|ABK28523.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 90/149 (60%), Gaps = 11/149 (7%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  53   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  112

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSLV  360
              PKDIQAAAA AAA      D       P +   T+        + DD   DLPDL L 
Sbjct  113  ADPKDIQAAAAAAAAAVAIDMDVETSSPSP-SPTVTETSSPAMIALSDDAFSDLPDLLLN  171

Query  361  SGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
               +          + G    F  +EPFL
Sbjct  172  VNHN----------IDGFWDSFPYEEPFL  190



>ref|NP_193408.1| ethylene-responsive transcription factor ERF039 [Arabidopsis 
thaliana]
 sp|Q9SUK8.1|ERF39_ARATH RecName: Full=Ethylene-responsive transcription factor ERF039 
[Arabidopsis thaliana]
 emb|CAB46040.1| apetala2 domain TINY like protein [Arabidopsis thaliana]
 emb|CAB78717.1| apetala2 domain TINY like protein [Arabidopsis thaliana]
 gb|AAS46629.1| At4g16750 [Arabidopsis thaliana]
 gb|AAT44941.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAW80865.1| At4g16750 [Arabidopsis thaliana]
 gb|AEE83797.1| ethylene-responsive transcription factor ERF039 [Arabidopsis 
thaliana]
Length=179

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  ADPKDIQ  114



>emb|CDY18963.1| BnaC04g03870D [Brassica napus]
Length=283

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 107/190 (56%), Gaps = 44/190 (23%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT +MAARAHDVAALAIKG +A LNFP LA  LPRP +
Sbjct  93   WGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAIKGTTAYLNFPELAGELPRPVT  152

Query  181  TSPKDIQaaaaraaaT-------TFPSTDAGED-GAQPRAA--------------DNTQQ  294
             SPKDIQAAA  AA            ++D  E   A+P  A              D   Q
Sbjct  153  NSPKDIQAAATAAAVNWQDSGGLHVGNSDITEKIEAEPSGAVMAQSLSDSVVFSSDIITQ  212

Query  295  HL------LTTNVVDDDI----VFDLPDLSLVSGMDDEYGQI---------SPSPLAGNN  417
             L       TT+ VD D     +FDLPD  L +G  +E G I         S   L G +
Sbjct  213  ELSETSCASTTSFVDKDSDEEKLFDLPD--LFNG-GNEIGIIRNDTFWYDSSTWQLCGAD  269

Query  418  AGFQLDEPFL  447
            AGF+L+EPF 
Sbjct  270  AGFRLEEPFF  279



>ref|XP_009344189.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Pyrus x bretschneideri]
 ref|XP_009344190.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Pyrus x bretschneideri]
Length=264

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LP PAS
Sbjct  106  WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGRSAVLNFPELAQELPVPAS  165

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE--------------DGAQPRAADNTQQHLLTTNVV  318
              PKDIQ AAA+AAA+T+P+                     A   ++ +       +N  
Sbjct  166  ALPKDIQVAAAKAAASTYPTRSCRSSSLEAEAEAETELISQAVHDSSTHDSSSTSPSNSY  225

Query  319  DDDIVFDLPDLSLVSG  366
            +DD+ FDLPDL L  G
Sbjct  226  NDDMFFDLPDLLLDVG  241



>ref|XP_007157270.1| hypothetical protein PHAVU_002G056800g [Phaseolus vulgaris]
 gb|ESW29264.1| hypothetical protein PHAVU_002G056800g [Phaseolus vulgaris]
Length=187

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA HLPRP +
Sbjct  36   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALTIKGTSAFLNFPELASHLPRPPT  95

Query  181  TSPKDIQ  201
            TSPKDIQ
Sbjct  96   TSPKDIQ  102



>ref|XP_002868104.1| hypothetical protein ARALYDRAFT_493200 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44363.1| hypothetical protein ARALYDRAFT_493200 [Arabidopsis lyrata subsp. 
lyrata]
Length=179

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  ADPKDIQ  114



>ref|XP_010434773.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Camelina sativa]
Length=179

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  VDPKDIQ  114



>ref|XP_008369428.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Malus 
domestica]
Length=259

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LP PAS
Sbjct  101  WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGRSAVLNFPELAQELPVPAS  160

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE--------------DGAQPRAADNTQQHLLTTNVV  318
              PKDIQ AAA+AAA+T+P+                     A   ++ +       +N  
Sbjct  161  ALPKDIQVAAAKAAASTYPTRSCRSSSLEAEAEAETELISQAVHDSSTHDSSSTSPSNSY  220

Query  319  DDDIVFDLPDLSLVSG  366
            +DD+ FDLPDL L  G
Sbjct  221  NDDMFFDLPDLLLDVG  236



>ref|XP_006282732.1| hypothetical protein CARUB_v10005867mg [Capsella rubella]
 gb|EOA15630.1| hypothetical protein CARUB_v10005867mg [Capsella rubella]
Length=176

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  45   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  104

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  105  ADPKDIQ  111



>ref|XP_008462760.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Cucumis melo]
Length=250

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL IKG SA LNFP LAH  PRPAS
Sbjct  62   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGTSAILNFPELAHQFPRPAS  121

Query  181  TSPKDIQ  201
            TSP+D+Q
Sbjct  122  TSPRDVQ  128



>ref|XP_010440105.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Camelina 
sativa]
Length=179

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  ADPKDIQ  114



>gb|AES90882.2| ethylene response factor [Medicago truncatula]
Length=257

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTP+MAARAHDVAAL IKG SA LNFP LA  LPR AS
Sbjct  82   WGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLNFPELAAVLPRAAS  141

Query  181  TSPKDIQaaaaraaaTTF--PSTDAGEDGAQPRAADNTQQHLLTTNVV------------  318
             SPKDIQ AAA+AAAT +    TD  E  A+   +        +++              
Sbjct  142  ASPKDIQVAAAKAAATVYNHAITDQIELEAEAEPSQAVSSSSSSSSSSSSSHNEGSSLKG  201

Query  319  DDDIVFDLPDLSL---VSGMDDEYGQISPSPLAGN---NAGFQLDEPFLW  450
            +DD+  +LPDL+L    SG D  Y   S   + G    ++ F+L++P LW
Sbjct  202  EDDMFLNLPDLTLDLRHSGDDGFYYSSSAWLVNGAQHIDSSFRLEDPILW  251



>gb|EAZ16971.1| hypothetical protein OsJ_32455 [Oryza sativa Japonica Group]
Length=270

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 100/167 (60%), Gaps = 18/167 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAALAIKG +A LNFP LAH LPRPA+
Sbjct  103  WGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGRAAHLNFPDLAHELPRPAT  162

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGA-QPRAADNTQQHLLTTNVVDDDIV--------  333
             +PKD+QAAAA AAA  FP++ A    +  P  +D+      +     D           
Sbjct  163  AAPKDVQAAAALAAAADFPASSANAGASNNPDGSDDASAGSASPPPPPDAADDALFDLPD  222

Query  334  ------FDLPD--LSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
                  +  P   LS  S  +DE G IS +  A     F+L+EP LW
Sbjct  223  LLLDLRYGPPSSGLSCASSWEDEVGLISGAGAAAAGV-FRLEEPLLW  268



>ref|XP_004161329.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cucumis sativus]
 gb|KGN65347.1| hypothetical protein Csa_1G364460 [Cucumis sativus]
Length=250

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL IKG SA LNFP LAH  PRPAS
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGTSAILNFPELAHQFPRPAS  124

Query  181  TSPKDIQ  201
            TSP+D+Q
Sbjct  125  TSPRDVQ  131



>emb|CDY09667.1| BnaC07g33940D [Brassica napus]
Length=181

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA HLPRPAS
Sbjct  48   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAALAIKGSSAHLNFPELACHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  ADPKDIQ  114



>ref|XP_009136807.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Brassica rapa]
 emb|CDX90497.1| BnaA03g42840D [Brassica napus]
Length=177

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA HLPRPAS
Sbjct  48   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELACHLPRPAS  107

Query  181  TSPKDIQ  201
            + PKDIQ
Sbjct  108  SDPKDIQ  114



>ref|XP_003608685.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
Length=290

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTP+MAARAHDVAAL IKG SA LNFP LA  LPR AS
Sbjct  82   WGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLNFPELAAVLPRAAS  141

Query  181  TSPKDIQaaaaraaaTTF--PSTDAGEDGAQPRAADNTQQHLLTTNVV------------  318
             SPKDIQ AAA+AAAT +    TD  E  A+   +        +++              
Sbjct  142  ASPKDIQVAAAKAAATVYNHAITDQIELEAEAEPSQAVSSSSSSSSSSSSSHNEGSSLKG  201

Query  319  DDDIVFDLPDLSL---VSGMDDEYGQISPSPLAGN---NAGFQLDEPFLW  450
            +DD+  +LPDL+L    SG D  Y   S   + G    ++ F+L++P LW
Sbjct  202  EDDMFLNLPDLTLDLRHSGDDGFYYSSSAWLVNGAQHIDSSFRLEDPILW  251



>ref|XP_009133691.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Brassica rapa]
Length=277

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 105/186 (56%), Gaps = 37/186 (20%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA+LAIKG +A LNFP L+  LPRP +
Sbjct  88   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAIKGTTAHLNFPELSGELPRPVT  147

Query  181  TSPKDIQaaa---------araaaTTFPSTDAGE---------------DGAQPRAADNT  288
            +SPKDIQAAA         + A +    ++D  E                G+   ++D  
Sbjct  148  SSPKDIQAAATAAAVNWQDSGANSLRMNNSDVAELAETEPSRVVMAQALSGSVVYSSDVN  207

Query  289  QQHL------LTTNVVD----DDIVFDLPDL---SLVSGMDDEYGQISPSPLAGNNAGFQ  429
             + L       TT+  D    +D +FDLPDL    ++   D      S   L G + GF+
Sbjct  208  TRDLSEISCSSTTSFADKDKEEDKLFDLPDLFSDEMIIRNDAFCYYSSAWQLCGADHGFR  267

Query  430  LDEPFL  447
            L+EPF 
Sbjct  268  LEEPFF  273



>ref|XP_010677077.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Beta 
vulgaris subsp. vulgaris]
Length=241

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 91/139 (65%), Gaps = 12/139 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T +MAARAHDVAALAIKGH+A LNFP LAH LP+PAS
Sbjct  73   WGKWVSEIREPRKKSRIWLGTFATADMAARAHDVAALAIKGHNAYLNFPDLAHQLPKPAS  132

Query  181  TSPKDIQaaaaraaaTTFP-----------STDAGEDGAQPRAADNTQQHLLTTNVVDDD  327
            T+PKDIQ AAA  AA  FP             D+    A   +++       +++  DD 
Sbjct  133  TTPKDIQ-AAAIKAAMDFPGLLQSQPSHSHQADSPATTATSSSSNYDTSSSASSSNFDDT  191

Query  328  IVFDLPDLSLVSGMDDEYG  384
            I F+LPDL L      E+G
Sbjct  192  IFFNLPDLFLDLENAIEFG  210



>ref|XP_002879568.1| hypothetical protein ARALYDRAFT_482537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55827.1| hypothetical protein ARALYDRAFT_482537 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 90/149 (60%), Gaps = 15/149 (10%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  52   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  111

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSLV  360
              PKDIQAAAA AAA      +       P   + +   +     + DD   DLPDL L 
Sbjct  112  ADPKDIQAAAAAAAAAM--DVETSSPSPSPTVTETSSPAM---TALSDDAFSDLPDLLLN  166

Query  361  SGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
               +          + G    F  +EPFL
Sbjct  167  VNHN----------IDGFWDSFPYEEPFL  185



>ref|NP_001239694.1| dehydration-responsive element-binding protein 3-like [Glycine 
max]
 gb|ACJ37436.1| AP2 domain-containing transcription factor 2 [Glycine max]
Length=188

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG +A LNFPHLA+ LPRPAS
Sbjct  37   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGPAAILNFPHLANSLPRPAS  96

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  97   LAPRDVQ  103



>ref|NP_001241356.1| dehydration-responsive element-binding protein 3-like [Glycine 
max]
 gb|ACJ37435.1| AP2 domain-containing transcription factor 1 [Glycine max]
Length=194

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG +A LNFPH A+ LPRPAS
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAILNFPHFANSLPRPAS  102

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  103  LAPRDVQ  109



>ref|XP_004148719.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive element-binding 
protein 3-like [Cucumis sativus]
Length=242

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL IKG SA LNFP LAH  PRPAS
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGTSAILNFPELAHQFPRPAS  124

Query  181  TSPKDIQ  201
            TSP+D+Q
Sbjct  125  TSPRDVQ  131



>ref|XP_004307005.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=274

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 102/178 (57%), Gaps = 29/178 (16%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAA AIKG SA LNFP LA  LP+PAS
Sbjct  96   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAARAIKGASAYLNFPELAQTLPQPAS  155

Query  181  TSPKDIQaaaaraaaTTFPSTDAG-------EDGAQPRAADN---------------TQQ  294
             SPKDIQAAAA+AA+        G       E   QP   +                T  
Sbjct  156  ASPKDIQAAAAKAASALEEMKKCGAEVEEEEEQATQPSKDEETTTTTANTSTSTSNSTAC  215

Query  295  HLLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSP------LAGNNAGFQLDEPFLW  450
               +++V  DD +FDLPDL  + G +  Y     S       L   + GF+L+EPF W
Sbjct  216  SSSSSSVDYDDKLFDLPDL-FMDGTNGSYQFCFSSSSSSSWHLCAADTGFRLEEPFSW  272



>gb|KDO49961.1| hypothetical protein CISIN_1g0410151mg, partial [Citrus sinensis]
Length=198

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLG++PT EMAARAHDVAALAIKGHSA LNFP LA  LPRPAS
Sbjct  69   WGKWVSEIRQPRKKSRIWLGSFPTAEMAARAHDVAALAIKGHSAHLNFPELADELPRPAS  128

Query  181  TSPKDIQ  201
             +PKDIQ
Sbjct  129  AAPKDIQ  135



>ref|XP_010104873.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
 gb|AHJ25983.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC02109.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
Length=271

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 86/137 (63%), Gaps = 22/137 (16%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LPRPA+
Sbjct  88   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGRSAFLNFPELAPELPRPAT  147

Query  181  TSPKDIQaaaaraa-----------------aTTFPSTDAGEDGAQPRAADNTQQHLLTT  309
            +S KDIQ AAA+AA                  TT  S  A      PR  D      + T
Sbjct  148  SSAKDIQIAAAKAAYAYTTTAAIATSTTAAHNTTSFSETADNAHDIPRRDDG-----IVT  202

Query  310  NVVDDDIVFDLPDLSLV  360
               +DD  FDLPDL L+
Sbjct  203  TEENDDAFFDLPDLMLM  219



>gb|ACU23160.1| unknown [Glycine max]
Length=194

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG +A LNFPH A+ LPRPAS
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAILNFPHFANSLPRPAS  102

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  103  LAPRDVQ  109



>gb|KDP34150.1| hypothetical protein JCGZ_07721 [Jatropha curcas]
Length=255

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA+ LPRPAS
Sbjct  60   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELANSLPRPAS  119

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  120  LAPRDVQ  126



>ref|XP_009368950.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Pyrus x bretschneideri]
Length=250

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+P PEMAARAHDVAAL IKG SA LNFP LA  LP PAS
Sbjct  97   WGKWVSEIREPRKKSRIWLGTFPIPEMAARAHDVAALTIKGSSAVLNFPELAQELPIPAS  156

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDG  261
             SPKDIQAAAA+AAA TFPS+   ++ 
Sbjct  157  ASPKDIQAAAAKAAALTFPSSSLEQEA  183



>ref|XP_010089277.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXB37602.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=256

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 101/157 (64%), Gaps = 17/157 (11%)
 Frame = +1

Query  28   EPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPASTSPKDIQaa  207
            EP+KKSRIWLGT PT EMAARAHDVAALAIKG SA LNFP LA  LPRP ST+PKDIQAA
Sbjct  99   EPRKKSRIWLGTSPTAEMAARAHDVAALAIKGASAYLNFPELARDLPRPLSTAPKDIQAA  158

Query  208  aaraaaTTFPST------DAGEDGAQPRAADN---TQQHLLTTNVVD---DDIVFDLPDL  351
            AA AAA +F +T      D  E  A+P  AD+   T Q   ++  +    +D +FDLPDL
Sbjct  159  AALAAAASFDATKSPPHHDPAEAEAEPSRADHLTPTDQESASSPCLSENYEDTLFDLPDL  218

Query  352  SLVSGMDDE---YGQISPS-PLAGNNAGFQLDEPFLW  450
              + G D     +   SPS  L   + G +L+EPFLW
Sbjct  219  -FIGGTDGSNIGFCYYSPSWHLCAADTGLRLEEPFLW  254



>gb|KFK22266.1| hypothetical protein AALP_AAs66747U002200 [Arabis alpina]
Length=182

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  51   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPDLAYHLPRPAS  110

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  111  ADPKDIQ  117



>emb|CDY72344.1| BnaCnng77210D [Brassica napus]
Length=181

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 94/149 (63%), Gaps = 19/149 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELACHLPRPAS  107

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSLV  360
              PKDIQAAAA AA           +   P +  +T    +T++ V DD   DLPDL LV
Sbjct  108  ADPKDIQAAAAAAAV----------EWKAPESPSSTGTSSMTSSSVADDAFSDLPDL-LV  156

Query  361  SGMDDEYGQISPSPLAGNNAGFQLDEPFL  447
               D +        + G    F  +EPF 
Sbjct  157  DANDHK--------VDGFWDSFPYEEPFF  177



>ref|XP_006359467.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum tuberosum]
Length=218

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPTPEMAARAHDVAAL+IKG+SA LNFP L   LPRPAS
Sbjct  47   WGKWVSEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGNSAILNFPQLVESLPRPAS  106

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  107  ISPRDVQ  113



>ref|XP_010102390.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
 gb|AHJ25980.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB93375.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
Length=249

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFPHLA  LPRPAS
Sbjct  75   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPHLAGSLPRPAS  134

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  135  LAPRDVQ  141



>ref|XP_010053505.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Eucalyptus 
grandis]
 gb|KCW77814.1| hypothetical protein EUGRSUZ_D02102 [Eucalyptus grandis]
Length=225

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 100/163 (61%), Gaps = 15/163 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WG+WVSEIREP+KKSRIWLGT+ T EMAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  64   WGRWVSEIREPRKKSRIWLGTFQTAEMAARAHDVAALTIKGRSAHLNFPELAELLPRPAS  123

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDG----AQPRAADNTQQHLLTTNVV------DDDI  330
             S KDIQAAAA AAA +FP  D    G    ++P + + T +   T          +DD 
Sbjct  124  KSAKDIQAAAALAAAISFPRGDGAAAGEAGPSRPHSPNATAESFDTQESASSPLDNEDDT  183

Query  331  VFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQL---DEPFLW  450
              DLPD  L+ G  +   ++  S    +  G +    D+PFLW
Sbjct  184  FIDLPD--LLVGFGNRMEELCMSFAWQDEDGTRFSHGDDPFLW  224



>ref|XP_006414307.1| hypothetical protein EUTSA_v10026276mg [Eutrema salsugineum]
 gb|ESQ55760.1| hypothetical protein EUTSA_v10026276mg [Eutrema salsugineum]
Length=202

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS
Sbjct  50   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPAS  109

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  110  ADPKDIQ  116



>gb|KFK35254.1| hypothetical protein AALP_AA5G261400 [Arabis alpina]
Length=253

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 100/179 (56%), Gaps = 34/179 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+   PRP S
Sbjct  77   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGFLNFPELSGLFPRPVS  136

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTT-----------------  309
             SPKDIQ AAA+AAA T+      E     + AD      L+T                 
Sbjct  137  CSPKDIQIAAAKAAAATWQEPIISE-----KVADELSHSELSTAHESSASCSFMFSSDTS  191

Query  310  ------NVVDDDIVFDLPDL---SLVSGMD--DEYGQISPSPLAG-NNAGFQLDEPFLW  450
                     +++ VFDLPDL    L+S  D    Y       L G  +  F+L+EPF W
Sbjct  192  ETSSTDKESNEETVFDLPDLFTDGLMSQNDAFRYYNNTFTWQLYGEEDLVFRLEEPFTW  250



>ref|XP_010469178.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Camelina sativa]
Length=271

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 107/191 (56%), Gaps = 42/191 (22%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA+LAIKG+S  LNFP L+H LPRP S
Sbjct  79   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAIKGNSGYLNFPELSHLLPRPVS  138

Query  181  TSPKDIQaaaaraaaTTFPSTD-AGEDGAQPR-AADNTQQH-----LLTTNVVD------  321
             SPKDIQAAA +AA  T    + A +DG  P   AD+   H      +TT   D      
Sbjct  139  CSPKDIQAAATKAAEATTWQLEPAIDDGKLPEPEADDELSHSELLSTITTTTADQSSTSS  198

Query  322  --------------------DDIVFDLPDLSLVSGM---DDEY----GQISPSPLAGNNA  420
                                ++ VFDLPDL    G+   +D +    G  +       + 
Sbjct  199  SFVFSSDTSETSSTDKESNEEETVFDLPDL-FTDGLMNRNDAFCLCNGTFTWQLCGEEDV  257

Query  421  GFQL-DEPFLW  450
            GF+  +EPF+W
Sbjct  258  GFRFEEEPFIW  268



>gb|AEM63548.1| dehydration-responsive element-binding protein DREB1 [Solanum 
tuberosum]
 gb|AFV07577.1| AP2 c4 [Solanum tuberosum]
Length=218

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPTPEMAARAHDVAAL+IKG+SA LNFP L   LPRPAS
Sbjct  47   WGKWVSEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGNSAILNFPQLVESLPRPAS  106

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  107  ISPRDVQ  113



>ref|XP_006837306.1| hypothetical protein AMTR_s00111p00051610 [Amborella trichopoda]
 gb|ERN00160.1| hypothetical protein AMTR_s00111p00051610 [Amborella trichopoda]
Length=362

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 11/116 (9%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WG+WVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LPRPAS
Sbjct  92   WGRWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTIKGRSAFLNFPELAAELPRPAS  151

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTT---NVVDDDIVFD  339
             SP+DIQAAAA+AA+++FP          P  A N+   L ++   + V++ I F+
Sbjct  152  ASPRDIQAAAAKAASSSFP--------VSPSKALNSSGMLASSPENSTVENTIRFE  199



>ref|XP_010508227.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Camelina sativa]
Length=285

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 100/185 (54%), Gaps = 36/185 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  98   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPELSGELPRPVT  157

Query  181  TSPKDIQaaaaraaaT----------------TFPSTDA---------------GEDGAQ  267
             SPKDIQAAA+ AA                    PS  A                     
Sbjct  158  NSPKDIQAAASLAAVNWQDPVNDVEEVAELAEAEPSRAATVVSSDTSTTTTTTTTHSQES  217

Query  268  PRAADNTQQHLLTTNVVDDDIVFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQL  432
              A+  +     T    D++ +FDLPDL    + +    D +   S +  L G +AGF+L
Sbjct  218  SEASCASTTSSCTDKYNDEEKLFDLPDLFTDENEMMIRKDAFCYYSSTWQLCGADAGFRL  277

Query  433  DEPFL  447
            +EPF 
Sbjct  278  EEPFF  282



>gb|EPS67314.1| hypothetical protein M569_07461, partial [Genlisea aurea]
Length=157

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGT+PTPEMAARAHDVAA++IKG SA LNFPHLA  LPRPAS
Sbjct  13   WGKWVSEIRQPRKKSRIWLGTFPTPEMAARAHDVAAMSIKGSSAILNFPHLAGVLPRPAS  72

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  73   LSPRDVQ  79



>ref|XP_009145506.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Brassica rapa]
Length=181

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELACHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  ADPKDIQ  114



>gb|KHN34916.1| Dehydration-responsive element-binding protein 3 [Glycine soja]
Length=209

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLG++ TPEMAARAHDVAAL IKG SA LNFP LA HLPRP +
Sbjct  52   WGKWVSEIREPKKKSRIWLGSFSTPEMAARAHDVAALTIKGTSAFLNFPELASHLPRPLT  111

Query  181  TSPKDIQ  201
            TSPKDIQ
Sbjct  112  TSPKDIQ  118



>ref|XP_010413552.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Camelina sativa]
Length=267

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 108/187 (58%), Gaps = 38/187 (20%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA+LAIKG+S  LNFP L+  LPRP S
Sbjct  79   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAIKGNSGYLNFPELSGLLPRPVS  138

Query  181  TSPKDIQaaaaraaaTTF---PSTDAGEDGAQPRAADNTQQHLLTTNVV-----------  318
             SPKDIQAAA +AA TT    P+ D  E   +P A + +   LL+T              
Sbjct  139  CSPKDIQAAATKAAETTTWQEPAID-DEKLPEPEADELSHSELLSTITTTTADQSSTSSS  197

Query  319  -----------------DDDIVFDLPDLSLVSGMD--DEYGQISPS---PLAGNNAGFQL  432
                             +++ VFDLPDL     MD  D +   + +    L G++ G + 
Sbjct  198  FVFSSDTSETSSTDKESNEETVFDLPDLFTDGLMDRNDAFCLCNGTFTWQLYGDDVGLRF  257

Query  433  -DEPFLW  450
             +EPF+W
Sbjct  258  EEEPFIW  264



>emb|CDX83411.1| BnaA03g20950D [Brassica napus]
Length=277

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 104/186 (56%), Gaps = 37/186 (20%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA+LAIKG +A LNFP L+  LPRP +
Sbjct  88   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAIKGTTAHLNFPELSGELPRPVT  147

Query  181  TSPKDIQaaa---------araaaTTFPSTDAGE---------------DGAQPRAADNT  288
            +SPKDIQAAA         + A +    ++D  E                G+   ++D  
Sbjct  148  SSPKDIQAAATAAAVNWQDSGANSLRMNNSDVAELAETEPSRVVMAQALSGSVVYSSDIN  207

Query  289  QQHL------LTTNVVDDD----IVFDLPDL---SLVSGMDDEYGQISPSPLAGNNAGFQ  429
             + L       TT+  D D     +FDLPDL    ++   D      S   L G + GF+
Sbjct  208  TRDLSEISCSSTTSFADKDKEEEKLFDLPDLFSDEMIIRNDAFCYYSSAWQLCGADHGFR  267

Query  430  LDEPFL  447
            L+EPF 
Sbjct  268  LEEPFF  273



>ref|XP_009617333.1| PREDICTED: ethylene-responsive transcription factor TINY [Nicotiana 
tomentosiformis]
Length=243

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P++KSRIWLGTYPTPEMAARAHDVAAL+IKG SA LNFP L   LPRPAS
Sbjct  80   WGKWVSEIRQPRRKSRIWLGTYPTPEMAARAHDVAALSIKGESAILNFPQLVESLPRPAS  139

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  140  VSPRDVQ  146



>ref|XP_004136219.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Cucumis sativus]
 gb|KGN60322.1| AP2 domain class transcription factor [Cucumis sativus]
Length=227

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LAH LPRP S
Sbjct  50   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAHSLPRPVS  109

Query  181  TSPKDIQ  201
             +P+DIQ
Sbjct  110  FAPRDIQ  116



>emb|CDP09993.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAA+AIKGHSA LNFP LAH LPRPAS
Sbjct  55   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAAIAIKGHSAFLNFPDLAHQLPRPAS  114

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  115  KLPKDIQ  121



>ref|XP_010506433.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Camelina sativa]
Length=289

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 100/182 (55%), Gaps = 33/182 (18%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  105  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPELSGELPRPLT  164

Query  181  TSPKDIQaaaa------------------------raaaTTFPSTDAGEDGAQPRAADNT  288
             SPKDIQAAA+                          AAT   S  +           + 
Sbjct  165  NSPKDIQAAASLAAVNWQDPVNDVEEVAELAEAEPSRAATVISSDTSTTTTTTQSQESSE  224

Query  289  QQHLLTTNVVDDD----IVFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQLDEP  441
                 TT+  D D     +FDLPDL    + +   +D +   S +  L G +AGF+L+EP
Sbjct  225  ASCASTTSFTDKDNDEEKLFDLPDLFTDENEMMIRNDAFCYYSSTWQLCGADAGFRLEEP  284

Query  442  FL  447
            F 
Sbjct  285  FF  286



>ref|NP_001047629.1| Os02g0657000 [Oryza sativa Japonica Group]
 emb|CAC39080.1| putative AP2 domain containing protein [Oryza sativa]
 gb|AAP83321.1| putative AP2 domain-containing protein [Oryza sativa Japonica 
Group]
 gb|AAQ24204.1| AP2 domain-containing protein Rap211 [Oryza sativa]
 dbj|BAD25756.1| putative DRE binding factor 2 [Oryza sativa Japonica Group]
 dbj|BAD25685.1| putative DRE binding factor 2 [Oryza sativa Japonica Group]
 dbj|BAF09543.1| Os02g0657000 [Oryza sativa Japonica Group]
 dbj|BAG98540.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 100/167 (60%), Gaps = 18/167 (11%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAALAIKG +A LNFP LAH LPRPA+
Sbjct  58   WGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGRAAHLNFPDLAHELPRPAT  117

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGA-QPRAADNTQQHLLTTNVVDDDIV--------  333
             +PKD+QAAAA AAA  FP++ A    +  P  +D+      +     D           
Sbjct  118  AAPKDVQAAAALAAAADFPASSANAGASNNPDGSDDASAGSASPPPPPDAADDALFDLPD  177

Query  334  ------FDLPD--LSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
                  +  P   LS  S  +DE G IS +  A     F+L+EP LW
Sbjct  178  LLLDLRYGPPSSGLSCASSWEDEVGLISGAGAAAAGV-FRLEEPLLW  223



>ref|XP_010505090.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Camelina sativa]
Length=196

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+ LPRPAS
Sbjct  54   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYQLPRPAS  113

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
              PKDIQAAAA AAA      +       P +   T+        + DD   DLPDL L
Sbjct  114  ADPKDIQAAAAAAAAAVAIDMEVETSSPSP-SPTVTETSSPGMTAISDDAFSDLPDLLL  171



>ref|XP_008796155.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Phoenix dactylifera]
Length=237

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 93/154 (60%), Gaps = 11/154 (7%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA  LPRPA+
Sbjct  89   WGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGQSAHLNFPELAGRLPRPAT  148

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADN----TQQHLLTTNVVDDDIVFDLPD  348
             SPKDIQAAAA AAA  F       D A P A+ +    +  H      + D ++    +
Sbjct  149  ASPKDIQAAAALAAAAAFADCGPCRDAAVPAASRSPATPSSDHDDALFDLPDLLLDLRDE  208

Query  349  LSLVSGMDDEYGQISPSPLAGNNAGFQLDEPFLW  450
                      Y      P   +  GF+L+EPFLW
Sbjct  209  FCY-------YSSTWLPPAEEDANGFRLEEPFLW  235



>ref|XP_004170993.1| PREDICTED: ethylene-responsive transcription factor ERF043-like, 
partial [Cucumis sativus]
Length=188

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGH A LNFP L H LPRPAS
Sbjct  55   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHRAFLNFPQLKHQLPRPAS  114

Query  181  TSPKDI  198
             S KDI
Sbjct  115  LSAKDI  120



>ref|XP_008466061.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cucumis melo]
Length=232

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LAH LPRP S
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAHSLPRPVS  102

Query  181  TSPKDIQ  201
             +P+DIQ
Sbjct  103  LAPRDIQ  109



>ref|XP_009780384.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana sylvestris]
Length=238

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPTPEMAARAHDVAAL+IKG SA LNFP L   LPRPAS
Sbjct  65   WGKWVSEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGESAILNFPQLVESLPRPAS  124

Query  181  TSPKDIQ  201
             SP D+Q
Sbjct  125  VSPTDVQ  131



>ref|XP_010691437.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Beta 
vulgaris subsp. vulgaris]
Length=236

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ TPEMAARAHDVAAL IKG+SA LNFP L+  LPRPAS
Sbjct  72   WGKWVSEIREPKKKSRIWLGTFNTPEMAARAHDVAALCIKGNSAILNFPELSESLPRPAS  131

Query  181  TSPKDIQ  201
            +SP+D+Q
Sbjct  132  SSPRDVQ  138



>ref|XP_009596664.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana tomentosiformis]
Length=196

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPTPEMAARAHDVAAL+IK +S+ LNFPHL + LPRP S
Sbjct  27   WGKWVSEIREPRKKSRIWLGTYPTPEMAARAHDVAALSIKKNSSILNFPHLVNSLPRPVS  86

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  87   LSPRDVQ  93



>ref|XP_006340419.1| PREDICTED: ethylene-responsive transcription factor TINY-like, 
partial [Solanum tuberosum]
Length=180

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ +PEMAARAHDVAAL+IKG +A LNFP LA +LPRPAS
Sbjct  19   WGKWVSEIREPRKKSRIWLGTFSSPEMAARAHDVAALSIKGTAAILNFPKLASYLPRPAS  78

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  79   LSPRDIQ  85



>ref|XP_010249578.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nelumbo nucifera]
Length=237

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRPAS
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAGSLPRPAS  124

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  125  LSPRDVQ  131



>gb|EYU20436.1| hypothetical protein MIMGU_mgv1a024757mg, partial [Erythranthe 
guttata]
Length=226

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAA++IKG SA LNFP LA  LPRPAS
Sbjct  72   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAVSIKGASAILNFPELASALPRPAS  131

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  132  LSPRDIQ  138



>ref|XP_008460188.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Cucumis melo]
Length=202

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 85/132 (64%), Gaps = 22/132 (17%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGH A LNFP L H LPRPAS
Sbjct  50   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHRAFLNFPQLKHQLPRPAS  109

Query  181  TSPKDIQaaaaraaaTTF-PSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDL--  351
             S KDIQAAAA+AAA    P T     G +                 ++   FDLPDL  
Sbjct  110  LSAKDIQAAAAQAAALKHEPETATSCRGEE-----------------EESTWFDLPDLIV  152

Query  352  --SLVSGMDDEY  381
                + G+D+ Y
Sbjct  153  SNGFLLGLDENY  164



>ref|XP_004953340.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Setaria italica]
Length=274

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG +A LNFPHLAH LPRPAS
Sbjct  97   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRAAHLNFPHLAHELPRPAS  156

Query  181  TSPKDIQ  201
             SP DIQ
Sbjct  157  ASPADIQ  163



>dbj|BAJ87193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG SA LNFP LAH LPRP S
Sbjct  106  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRSAHLNFPDLAHELPRPDS  165

Query  181  TSPKDIQ  201
            TSP DIQ
Sbjct  166  TSPADIQ  172



>gb|AAX28965.1| TmCBF7 [Triticum monococcum]
Length=275

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG SA LNFP LAH LPRP S
Sbjct  108  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRSAHLNFPELAHELPRPDS  167

Query  181  TSPKDIQ  201
            TSP DIQ
Sbjct  168  TSPADIQ  174



>ref|XP_009142308.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Brassica rapa]
Length=277

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 88/135 (65%), Gaps = 18/135 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT +MAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  100  WGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAIKGTTAYLNFPELSGELPRPVT  159

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPR--------------AADNTQQHLLTTNVV  318
             SPKDIQAAA  AA     S  A  + A+P               ++D T + +  T+  
Sbjct  160  NSPKDIQAAATAAAVNWQDSDVAALEEAEPSREVMAQSLSGSVVFSSDITTREMSETSCA  219

Query  319  ----DDDIVFDLPDL  351
                D++ +FDLPDL
Sbjct  220  DKESDEEKLFDLPDL  234



>ref|XP_006359762.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum tuberosum]
Length=207

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+P PEMAARAHDVAAL+IKG+SA LNFP LA  LPRPA+
Sbjct  39   WGKWVSEIREPRKKSRIWLGTFPNPEMAARAHDVAALSIKGNSAILNFPELAGLLPRPAT  98

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  99   LSPRDIQ  105



>ref|NP_001047627.1| Os02g0656600 [Oryza sativa Japonica Group]
 emb|CAC39072.1| putative AP2 domain transcription factor [Oryza sativa]
 gb|AAQ23982.1| transcription factor Rap212 [Oryza sativa]
 dbj|BAD25682.1| putative DRE binding factor 2 [Oryza sativa Japonica Group]
 dbj|BAF09541.1| Os02g0656600 [Oryza sativa Japonica Group]
 gb|EEE57510.1| hypothetical protein OsJ_07793 [Oryza sativa Japonica Group]
Length=287

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAALAIKG +A LNFP LAH LPRPAS
Sbjct  107  WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRAAHLNFPSLAHTLPRPAS  166

Query  181  TSPKDIQ  201
            TSP DIQ
Sbjct  167  TSPSDIQ  173



>gb|EPS69652.1| hypothetical protein M569_05115, partial [Genlisea aurea]
Length=175

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGTYPT EMAARAHDVAAL+IKG+SA LNFP L H LPRPAS
Sbjct  25   WGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALSIKGNSAVLNFPQLTHSLPRPAS  84

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  85   LSPRDVQ  91



>ref|XP_006410739.1| hypothetical protein EUTSA_v10017258mg [Eutrema salsugineum]
 gb|ESQ52192.1| hypothetical protein EUTSA_v10017258mg [Eutrema salsugineum]
Length=199

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+H PRPAS
Sbjct  58   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYHFPRPAS  117

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
              PKDIQAAAA AA    P     E  + P            T + DD    DLPDL L
Sbjct  118  ADPKDIQAAAAAAAVAAVPIDMEVETSSSPSPTSTEPSSPAMTEIFDDAFS-DLPDLLL  175



>ref|XP_003538748.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Glycine max]
Length=197

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLG++ TPEMAARAHDVAAL IKG SA LNFP LA HLPRP +
Sbjct  52   WGKWVSEIREPKKKSRIWLGSFSTPEMAARAHDVAALTIKGTSAFLNFPELASHLPRPLT  111

Query  181  TSPKDIQ  201
            TSPKDIQ
Sbjct  112  TSPKDIQ  118



>ref|XP_004165656.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Cucumis sativus]
Length=235

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LAH LPRP S
Sbjct  58   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAHSLPRPVS  117

Query  181  TSPKDIQ  201
             +P+DIQ
Sbjct  118  FAPRDIQ  124



>ref|XP_004245167.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum lycopersicum]
Length=218

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+P PEMAARAHDVAAL+IKG+SA LNFP LA  LPRPA+
Sbjct  40   WGKWVSEIREPRKKSRIWLGTFPNPEMAARAHDVAALSIKGNSAILNFPELAGLLPRPAT  99

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  100  LSPRDIQ  106



>ref|XP_006421614.1| hypothetical protein CICLE_v10006536mg [Citrus clementina]
 gb|ESR34854.1| hypothetical protein CICLE_v10006536mg [Citrus clementina]
Length=230

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLG++PT EMAARAHDVAALAIKGHSA LNFP LA  LPRPAS
Sbjct  69   WGKWVSEIRQPRKKSRIWLGSFPTAEMAARAHDVAALAIKGHSAHLNFPELADELPRPAS  128

Query  181  TSPKDIQ  201
             +PKDIQ
Sbjct  129  AAPKDIQ  135



>emb|CDX95624.1| BnaC03g25050D [Brassica napus]
Length=276

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 105/185 (57%), Gaps = 36/185 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVA+LAIKG +A LNFP L+  LPRP +
Sbjct  88   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAIKGTTAHLNFPELSGELPRPVT  147

Query  181  TSPKDIQaaa---------araaaTTFPSTDAGE---------------DGAQPRAADNT  288
             SPKDIQAAA         + A +    ++D  E                G+   ++D  
Sbjct  148  RSPKDIQAAATAAAVNWQDSGANSLRMNNSDVAELAETEPSRGVMAQSLSGSVVFSSDIN  207

Query  289  QQHLLTTNVV----------DDDIVFDLPDLSLVSGM-DDEYGQISPS-PLAGNNAGFQL  432
             + L  T+            +++ +FDLPDL     + +D +   S +  L G + GF+L
Sbjct  208  TRDLSETSCASTTSFADKDKEEEKLFDLPDLVTDEIIRNDAFSFYSSTWQLCGADHGFRL  267

Query  433  DEPFL  447
            +EPF 
Sbjct  268  EEPFF  272



>gb|KHN15832.1| Dehydration-responsive element-binding protein 3 [Glycine soja]
Length=214

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRP S
Sbjct  58   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAASLPRPVS  117

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  118  LAPRDVQ  124



>ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF45843.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=270

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRPAS
Sbjct  61   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELADSLPRPAS  120

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  121  LAPRDVQ  127



>gb|AID55125.1| ethylene responsive factor 20, partial [Solanum melongena]
Length=161

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+P PEMAARAHDVAAL+IKG+SA LNFP LA  LPRP +
Sbjct  9    WGKWVSEIREPRKKSRIWLGTFPNPEMAARAHDVAALSIKGNSAILNFPELAGLLPRPVT  68

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  69   LSPRDIQ  75



>ref|XP_002987168.1| hypothetical protein SELMODRAFT_26604, partial [Selaginella moellendorffii]
 gb|EFJ11744.1| hypothetical protein SELMODRAFT_26604, partial [Selaginella moellendorffii]
Length=181

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKK+RIWLG++PTPEMAARA+DVAA+++KG  A LNFP  A+ LP+PA 
Sbjct  23   WGKWVSEIREPKKKTRIWLGSFPTPEMAARAYDVAAISLKGPKAVLNFPEFAYSLPQPAM  82

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAAD--------NTQQHLLTTNVVDDDIVF  336
             SPK IQ  AA AAA  F S   G   + P  A          + QH    N VD+D++F
Sbjct  83   VSPKSIQ-QAAAAAALAFSSCSLGTSSSSPTKASYRSSLASSTSSQHEGQVNYVDEDMIF  141

Query  337  DLPDL  351
            ++PD+
Sbjct  142  NMPDV  146



>ref|XP_009389773.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=213

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKK SRIWLGT+PT EMAARAHDVAALAIKG SA LNFP LA  LPRPAS
Sbjct  69   WGKWVSEIREPKKNSRIWLGTFPTAEMAARAHDVAALAIKGRSAYLNFPELASQLPRPAS  128

Query  181  TSPKDIQ  201
            ++PKDIQ
Sbjct  129  STPKDIQ  135



>ref|XP_006399666.1| hypothetical protein EUTSA_v10015895mg [Eutrema salsugineum]
 gb|ESQ41119.1| hypothetical protein EUTSA_v10015895mg [Eutrema salsugineum]
Length=243

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP LA   PRP S
Sbjct  66   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELAESFPRPVS  125

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  126  LSPRDIQ  132



>ref|XP_007012129.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY29748.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=261

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA+ LPRP S
Sbjct  78   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELANSLPRPVS  137

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  138  LAPRDVQ  144



>ref|NP_001151300.1| dehydration-responsive element-binding protein 1B [Zea mays]
 gb|ACG42298.1| dehydration-responsive element-binding protein 1B [Zea mays]
Length=255

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 103/180 (57%), Gaps = 34/180 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG +A LNFP ++H LPR AS
Sbjct  82   WGKWVSEIREPRKKSRIWLGTFDTPEMAARAHDVAALAIKGRAAHLNFPEMSHELPRAAS  141

Query  181  TSPKDIQaaaaraaaTTF-----PSTDAGEDGAQ------PRA-------ADNTQQH---  297
             +P+D++AAAA AAA        P++    DGA+      P A       ADN Q     
Sbjct  142  AAPEDVRAAAALAAAMEMESVAPPTSSESRDGARNDENEGPAASSSSGNDADNAQTEERA  201

Query  298  ------LLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEP-FLW*H  456
                  +L    + +  VF+LPD+ L      E+G   P P          DEP  LW H
Sbjct  202  APSEHSMLADGHILNLAVFELPDVLL------EFGFAPPPPSTSCGYDLSWDEPLLLWEH  255



>ref|XP_004140628.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Cucumis sativus]
 gb|KGN46508.1| hypothetical protein Csa_6G104640 [Cucumis sativus]
Length=213

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKGH A LNFP L H LPRPAS
Sbjct  55   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHRAFLNFPQLKHQLPRPAS  114

Query  181  TSPKDI  198
             S KDI
Sbjct  115  LSAKDI  120



>ref|XP_010449723.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Camelina sativa]
Length=180

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  4    GKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAST  183
            GKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG SA LNFP LA+HLPRPAS 
Sbjct  50   GKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPASA  109

Query  184  SPKDIQ  201
             PKDIQ
Sbjct  110  DPKDIQ  115



>ref|XP_010692104.1| PREDICTED: ethylene-responsive transcription factor ERF035 [Beta 
vulgaris subsp. vulgaris]
Length=308

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP LAH LP+P S
Sbjct  116  WGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALAIKGENAFLNFPELAHLLPQPLS  175

Query  181  TSPKDIQ  201
            TSPKDIQ
Sbjct  176  TSPKDIQ  182



>emb|CDY42937.1| BnaA01g18170D [Brassica napus]
Length=181

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+  PEMAARAHDVAALAIKG SA LNFP LA HLPRPAS
Sbjct  48   WGKWVSEIREPRKKSRIWLGTFSKPEMAARAHDVAALAIKGGSAHLNFPELACHLPRPAS  107

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  108  ADPKDIQ  114



>ref|XP_006294983.1| hypothetical protein CARUB_v10024051mg [Capsella rubella]
 gb|EOA27881.1| hypothetical protein CARUB_v10024051mg [Capsella rubella]
Length=213

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IKG+SA LNFP LA  LPRP S
Sbjct  35   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGNSAILNFPELAEFLPRPIS  94

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  95   MSPQDIQ  101



>ref|XP_011004731.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Populus euphratica]
Length=250

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+ A LNFP LA++LPRPAS
Sbjct  69   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNPAILNFPELANYLPRPAS  128

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  129  LAPRDVQ  135



>ref|XP_002324799.1| hypothetical protein POPTR_0018s00270g [Populus trichocarpa]
 gb|ABQ62969.1| TINY-like protein [Populus trichocarpa]
 gb|EEF03364.1| hypothetical protein POPTR_0018s00270g [Populus trichocarpa]
Length=250

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+ A LNFP LA++LPRPAS
Sbjct  69   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNPAILNFPELANYLPRPAS  128

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  129  LAPRDVQ  135



>ref|XP_006294662.1| hypothetical protein CARUB_v10023699mg [Capsella rubella]
 gb|EOA27560.1| hypothetical protein CARUB_v10023699mg [Capsella rubella]
Length=306

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 102/186 (55%), Gaps = 37/186 (20%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG +A LNFP L+  LPRP +
Sbjct  117  WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPELSGELPRPVT  176

Query  181  TSPKDIQaaaaraaaT-TFPSTDAGEDGA---------QPRA------------------  276
             SPKDIQAAA+ AA     P  DA +             P A                  
Sbjct  177  NSPKDIQAAASLAAVNWQDPVNDADDSEEAAELAEAEPSPAAVVFSSDTSTTTTTTTQSQ  236

Query  277  ----ADNTQQHLLTTNVVDDDIVFDLPDL----SLVSGMDDEYGQISPS-PLAGNNAGFQ  429
                A        T    +++ +FDLPDL    + +   +D +   S +  L G +AGF+
Sbjct  237  ESSEASCASTSCSTDKDNEEEKLFDLPDLFADENEMMIRNDAFCYYSSTWQLCGADAGFR  296

Query  430  LDEPFL  447
            L+EPF 
Sbjct  297  LEEPFF  302



>ref|XP_009138144.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Brassica rapa]
Length=235

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMA RAHDVAAL+IKG SA LNFP L+  LPRPAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPAS  87

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTN  312
             SP+D++AAA +AA   F ST   E       A + Q+    +N
Sbjct  88   LSPRDVRAAATKAALMDFGSTVRSESETSEETAVSGQKSESESN  131



>gb|KFK32565.1| hypothetical protein AALP_AA6G259700 [Arabis alpina]
Length=197

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IKG SA LNFP L+ +LPRP S
Sbjct  32   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGSSAILNFPELSDYLPRPVS  91

Query  181  TSPKDIQaaaaraaaTTF--PSTDAGEDGAQPRA  276
             SP DIQ AA +AA   F  PS  + E     +A
Sbjct  92   LSPSDIQDAANKAALMDFKTPSLTSNETEMNEKA  125



>ref|XP_010538410.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Tarenaya hassleriana]
Length=187

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG  A LNFP LA HLPRP+S
Sbjct  54   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGGAHLNFPELACHLPRPSS  113

Query  181  TSPKDIQ  201
            + PKDI+
Sbjct  114  SDPKDIR  120



>ref|XP_002454537.1| hypothetical protein SORBIDRAFT_04g032940 [Sorghum bicolor]
 gb|EES07513.1| hypothetical protein SORBIDRAFT_04g032940 [Sorghum bicolor]
Length=234

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAALAIKG +A LNFP LA  LPRPA+
Sbjct  63   WGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGRAAHLNFPELAGELPRPAT  122

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGA  264
             +PKD+QAAAA AAA  FP+T A   GA
Sbjct  123  AAPKDVQAAAALAAAADFPATPANAAGA  150



>ref|XP_010688291.1| PREDICTED: ethylene-responsive transcription factor ERF043 [Beta 
vulgaris subsp. vulgaris]
Length=283

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL+IKG SA LNFP LAH LPRP S
Sbjct  58   WGKWVSEIREPRKKSRIWLGTFATPEMAARAHDVAALSIKGTSAVLNFPDLAHSLPRPVS  117

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  118  NSPRDVQ  124



>emb|CDY27827.1| BnaC09g28540D [Brassica napus]
 emb|CDX91203.1| BnaC02g03940D [Brassica napus]
Length=231

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP L    PRP S
Sbjct  68   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELVESFPRPVS  127

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  128  LSPRDIQ  134



>ref|XP_010049108.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Eucalyptus grandis]
 gb|KCW81571.1| hypothetical protein EUGRSUZ_C02928 [Eucalyptus grandis]
Length=258

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFPHLA  LPRP+S
Sbjct  66   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALHIKGSSAFLNFPHLAASLPRPSS  125

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  126  LSPRDVQ  132



>ref|XP_011091185.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Sesamum indicum]
Length=243

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG SA+LNFP LA+  PRP S
Sbjct  76   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGASATLNFPELANAFPRPVS  135

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  136  LSPRDVQ  142



>ref|XP_010429589.1| PREDICTED: ethylene-responsive transcription factor ERF042-like 
[Camelina sativa]
Length=218

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IKG SA LNFP LA  LPRP S
Sbjct  36   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGTSAILNFPELAEFLPRPIS  95

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  96   LSPQDIQ  102



>ref|XP_008437812.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
isoform X1 [Cucumis melo]
 ref|XP_008437813.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
isoform X2 [Cucumis melo]
Length=231

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 111/170 (65%), Gaps = 22/170 (13%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KK+RIWLGTYPTPEMAARAHD AALAIKGHSA LNFP LA  LPRP S
Sbjct  61   WGKWVSEIREPRKKTRIWLGTYPTPEMAARAHDAAALAIKGHSAFLNFPELAQFLPRPLS  120

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLL-----------TTN----V  315
             S KDIQAAAA+AAA TF S    E G +  A + +++ L            +TN    +
Sbjct  121  RSHKDIQAAAAQAAAATFSSGINAESGGE-EAVEESREPLFPGSDGGERTEDSTNSPSTI  179

Query  316  VDDDIVFDLPDLSLVSGMDDEYGQISPSPL-----AGNNAGFQLDEPFLW  450
              D+ +FDLPDL ++   D + G +  S L     A ++ GF+L+EP  W
Sbjct  180  AGDETLFDLPDL-VIGSSDSKDGFVYHSSLWQFCAAADHNGFRLEEPSFW  228



>ref|XP_007161494.1| hypothetical protein PHAVU_001G073800g [Phaseolus vulgaris]
 gb|ESW33488.1| hypothetical protein PHAVU_001G073800g [Phaseolus vulgaris]
Length=244

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRP S
Sbjct  61   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAASLPRPVS  120

Query  181  TSPKDIQaaaaraaaTTFP  237
             +P+D+QAAAA+AA   FP
Sbjct  121  LAPRDVQAAAAKAAHMDFP  139



>emb|CDP08151.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+P+PEMAARAHDVAAL+IKG SA LNFP LA  LPRPAS
Sbjct  80   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGTSAILNFPELAGSLPRPAS  139

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  140  LSPRDVQ  146



>ref|XP_010472602.1| PREDICTED: ethylene-responsive transcription factor ERF042-like 
[Camelina sativa]
Length=217

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IKG SA LNFP LA  LPRP S
Sbjct  35   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGTSAILNFPELAEFLPRPIS  94

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  95   LSPQDIQ  101



>ref|XP_006490227.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Citrus sinensis]
Length=245

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 98/185 (53%), Gaps = 45/185 (24%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLG++PT EMAARAHDVAALAIKGH A LNFP LA  LPRPAS
Sbjct  69   WGKWVSEIRQPRKKSRIWLGSFPTAEMAARAHDVAALAIKGHLAHLNFPELADELPRPAS  128

Query  181  TSPKDIQaaaaraaaTTF---PSTDAGEDGAQPRAADNTQQ-------------------  294
             +PKDIQAAAA+AAA      PS     +  Q    D  +                    
Sbjct  129  AAPKDIQAAAAKAAAAAIFDSPSRIEANNDTQSTCHDENKNSADHHDHSSSDDSDSAWFD  188

Query  295  HLLTTNVVDDDIVFD-LPDLSLVSGMDD------------EYGQISPSPLAGNNAGFQLD  435
            HL   ++  D   FD LPDLSL    D             E+G +          GFQ +
Sbjct  189  HLPDLSLEGDSAWFDHLPDLSLEGDGDKNRFCDSSWWQQAEFGHM----------GFQFE  238

Query  436  EPFLW  450
            E   W
Sbjct  239  ETLCW  243



>ref|XP_006476039.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Citrus sinensis]
 gb|KDO79821.1| hypothetical protein CISIN_1g027107mg [Citrus sinensis]
Length=228

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRP S
Sbjct  52   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELADSLPRPNS  111

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  112  LAPRDVQ  118



>ref|XP_003635442.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Vitis 
vinifera]
Length=231

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKGHSA LNFP LA  LPRPA+
Sbjct  75   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPAT  134

Query  181  TSPKDIQ  201
             SPKDI+
Sbjct  135  ASPKDIR  141



>emb|CDY13503.1| BnaA03g52210D [Brassica napus]
Length=223

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMA RAHDVAAL+IKG SA LNFP L+  LPRPAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPAS  87

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQH  297
             SP+D++AAA +AA   F ST   E       A + Q  
Sbjct  88   LSPRDVRAAATKAALMDFGSTVRSESETSEETAVSGQNK  126



>ref|XP_008646011.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Zea mays]
Length=257

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 100/181 (55%), Gaps = 35/181 (19%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAALAIKG +A LNFP ++H LPR AS
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFDTPEMAARAHDVAALAIKGRAAHLNFPGMSHELPRAAS  142

Query  181  TSPKDIQ----aaaaraaaTTFPSTDAG--------EDGAQPRA-------ADNTQQH--  297
             +P+D++     AAA    +  P T  G        ++  +P A       ADN Q    
Sbjct  143  AAPEDVRAAAALAAAMEMESVAPPTPPGDSSHSARNDENEEPAASSSSGNDADNAQSEEQ  202

Query  298  -------LLTTNVVDDDIVFDLPDLSLVSGMDDEYGQISPSPLAGNNAGFQLDEP-FLW*  453
                   +L    V D  +F+LPD+ L      E+G   P PL         DEP  LW 
Sbjct  203  AAPSEHSVLADGHVLDLALFELPDVLL------EFGFAPPPPLTSCAYDLSWDEPLLLWE  256

Query  454  H  456
            H
Sbjct  257  H  257



>ref|XP_004235656.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Solanum lycopersicum]
Length=249

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAA++IKG+SA LNFPHL   LPRP S
Sbjct  80   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAVSIKGNSAILNFPHLIDSLPRPLS  139

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  140  KSPRDIQ  146



>ref|XP_006450687.1| hypothetical protein CICLE_v10009370mg [Citrus clementina]
 gb|ESR63927.1| hypothetical protein CICLE_v10009370mg [Citrus clementina]
Length=232

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRP S
Sbjct  52   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELADSLPRPNS  111

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  112  LAPRDVQ  118



>ref|NP_191608.1| ethylene-responsive transcription factor ERF035 [Arabidopsis 
thaliana]
 sp|Q9M210.1|ERF35_ARATH RecName: Full=Ethylene-responsive transcription factor ERF035 
[Arabidopsis thaliana]
 emb|CAB81835.1| transcription factor-like protein [Arabidopsis thaliana]
 gb|AAT44915.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABK59687.1| At3g60490 [Arabidopsis thaliana]
 gb|AEE80067.1| ethylene-responsive transcription factor ERF035 [Arabidopsis 
thaliana]
Length=256

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAALAIKG+S  LNFP L+  LPRP S
Sbjct  79   WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSGFLNFPELSGLLPRPVS  138

Query  181  TSPKDIQ  201
             SPKDIQ
Sbjct  139  CSPKDIQ  145



>ref|XP_008378086.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Malus domestica]
 gb|ADE41142.1| AP2 domain class transcription factor [Malus domestica]
Length=252

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP L++ LPRP S
Sbjct  74   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELSNSLPRPVS  133

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  134  LAPRDVQ  140



>ref|XP_009397875.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAA+AIKG SA LNFP LA  LPRPA+
Sbjct  91   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAAMAIKGQSAHLNFPELAAELPRPAT  150

Query  181  TSPKDIQaaaaraaaTTF  234
             SPKDIQAAAA AAA TF
Sbjct  151  ASPKDIQAAAALAAAATF  168



>ref|XP_010646855.1| PREDICTED: ethylene-responsive transcription factor ERF038 [Vitis 
vinifera]
Length=228

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKGHSA LNFP LA  LPRPA+
Sbjct  72   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPAT  131

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE  255
             SPKDI+AAAA+AAA   P++  G+
Sbjct  132  ASPKDIRAAAAKAAAFHHPTSHEGD  156



>ref|XP_010417360.1| PREDICTED: ethylene-responsive transcription factor ERF042-like 
[Camelina sativa]
Length=219

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IKG SA LNFP LA  LPRP S
Sbjct  35   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGTSAILNFPELAEFLPRPIS  94

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  95   LSPQDIQ  101



>ref|XP_002873522.1| hypothetical protein ARALYDRAFT_487996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49781.1| hypothetical protein ARALYDRAFT_487996 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP LA   PRP S
Sbjct  60   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGTSAILNFPELADSFPRPVS  119

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  120  LSPRDIQ  126



>ref|XP_009125819.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Brassica rapa]
Length=234

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP L    PRP S
Sbjct  71   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELVESFPRPVS  130

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  131  LSPRDIQ  137



>ref|XP_009767580.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana sylvestris]
Length=212

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+P PEMAARAHDVAAL+IKG+SA LNFP LA  LPRP +
Sbjct  32   WGKWVSEIREPRKKSRIWLGTFPNPEMAARAHDVAALSIKGNSAILNFPELAASLPRPVT  91

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  92   LSPRDIQ  98



>ref|XP_010254012.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Nelumbo nucifera]
Length=242

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP L   LPRPAS
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELVGSLPRPAS  124

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  125  LSPRDVQ  131



>gb|AAW28084.1| transcription factor DREBIII-1 [Brassica napus]
 emb|CDY71448.1| BnaAnng37500D [Brassica napus]
Length=204

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+ T EMAARAHDVAALAIKG SA LNFP LA+ LPRPAS
Sbjct  65   WGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNFPELAYQLPRPAS  124

Query  181  TSPKDIQ  201
              PKDIQ
Sbjct  125  ADPKDIQ  131



>ref|XP_009398119.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=237

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 96/157 (61%), Gaps = 7/157 (4%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREPKKKSRIWLGT+PT EMAARAHDVAAL IKG SA LNFP LA  LPRPA+
Sbjct  78   WGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAALTIKGPSAHLNFPELASKLPRPAT  137

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLL-----TTNVVDDDIVFDLP  345
             +PKD+QAAAA AAA T      G  G+   A    +   +      T+   DD      
Sbjct  138  AAPKDVQAAAALAAAATLGGHSPGLCGSPESAPSQNEPSPIPHSPAPTSPRSDDDGALFD  197

Query  346  DLSLVSGMDDEYGQISPSPLAGNNAG--FQLDEPFLW  450
               L+  + + +G  S    +   AG  F+++EPFLW
Sbjct  198  LPDLLLDLREGFGHSSSWNASSAEAGIEFRVEEPFLW  234



>ref|XP_011012511.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Populus euphratica]
Length=237

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIR+P+KKSRIWLGT+PTPEMAARAHDVAAL IKG SA LNFP LA  LPRP S
Sbjct  66   WGKWVSEIRQPRKKSRIWLGTFPTPEMAARAHDVAALCIKGDSAILNFPELADSLPRPVS  125

Query  181  TSPKDIQ  201
              P+DIQ
Sbjct  126  VMPRDIQ  132



>ref|XP_002283864.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Vitis vinifera]
Length=241

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG+SA LNFP LA  LPRP S
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPQLAASLPRPVS  124

Query  181  TSPKDIQ  201
             +P+D+Q
Sbjct  125  LAPRDVQ  131



>emb|CBI23469.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL IKGHSA LNFP LA  LPRPA+
Sbjct  83   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPAT  142

Query  181  TSPKDIQaaaaraaaTTFPSTDAGE  255
             SPKDI+AAAA+AAA   P++  G+
Sbjct  143  ASPKDIRAAAAKAAAFHHPTSHEGD  167



>emb|CDX85705.1| BnaA02g01080D [Brassica napus]
Length=234

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP L    PRP S
Sbjct  71   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELVESFPRPVS  130

Query  181  TSPKDIQ  201
             SP+DIQ
Sbjct  131  LSPRDIQ  137



>ref|XP_010062516.1| PREDICTED: ethylene-responsive transcription factor ERF036 [Eucalyptus 
grandis]
 gb|KCW69660.1| hypothetical protein EUGRSUZ_F03062 [Eucalyptus grandis]
Length=276

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IKG SA LNFPHLA  LPRPAS
Sbjct  85   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGKSAVLNFPHLAKLLPRPAS  144

Query  181  TSPKDIQ  201
             +P+DIQ
Sbjct  145  LAPRDIQ  151



>ref|XP_009776195.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana sylvestris]
Length=199

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP KKSRIWLGTY TPEMAARAHDVAAL+IK +S+ LNFPHL + LPRP S
Sbjct  27   WGKWVSEIREPCKKSRIWLGTYSTPEMAARAHDVAALSIKKNSSILNFPHLVNSLPRPIS  86

Query  181  TSPKDIQaaaaraaaTTFPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDL  351
             SP+D+QAAAA+AA+   P   +        ++D T + + + + V+   + +LP L
Sbjct  87   LSPRDVQAAAAKAASMEEPIISSISSSNSSSSSDLTLETITSASDVELGEIIELPSL  143



>ref|XP_003529759.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Glycine max]
Length=207

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 83/125 (66%), Gaps = 3/125 (2%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+ TPEMAARAHDVAAL IKG SA LNFP +A  LPRP +
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGQSAILNFPEIADLLPRPVT  102

Query  181  TSPKDIQaaaaraaaTT-FPSTDAGEDGAQPRAADNTQQHLLTTNVVDDDIVFDLPDLSL  357
             SP+DIQ AA  AA+   F       D   P +++ ++  ++    ++D  V   P+  L
Sbjct  103  CSPRDIQTAATAAASMVKFDPVTQSSDSETPESSELSE--IVELPNIEDSSVDSTPEFVL  160

Query  358  VSGMD  372
            V  +D
Sbjct  161  VDVVD  165



>gb|KCW79144.1| hypothetical protein EUGRSUZ_C00590 [Eucalyptus grandis]
Length=166

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    WGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAALAIKGHSASLNFPHLAHHLPRPAS  180
            WGKWVSEIREP+KKSRIWLGT+PTPEMAARAHDVAAL+IKG SA LNFP L   LPRP S
Sbjct  4    WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELIGLLPRPIS  63

Query  181  TSPKDIQ  201
             SP+D+Q
Sbjct  64   LSPRDVQ  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 910113435382