BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86340_g1_i1 len=1392 path=[1:0-1391]

Length=1392
                                                                      Score     E

ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              438   2e-148   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              437   4e-148   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              431   8e-146   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              430   3e-145   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              429   9e-145   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              428   1e-144   
ref|XP_007033589.1|  Peroxidase superfamily protein                     428   1e-144   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              426   9e-144   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   424   5e-143   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              423   1e-142   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              423   2e-142   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          422   3e-142   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              422   3e-142   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              421   8e-142   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              421   9e-142   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              421   1e-141   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            420   2e-141   Vitis vinifera
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              419   5e-141   
gb|ACJ11762.1|  class III peroxidase                                    419   1e-140   Gossypium hirsutum [American cotton]
dbj|BAM28608.1|  putative peroxidase                                    418   1e-140   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  418   1e-140   Ricinus communis
gb|ACZ51443.1|  peroxidase protein                                      418   2e-140   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              418   2e-140   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             418   2e-140   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              417   4e-140   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              417   4e-140   
dbj|BAM28609.1|  putative peroxidase                                    417   5e-140   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              416   1e-139   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       415   4e-139   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              414   5e-139   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              415   5e-139   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        414   7e-139   Vitis vinifera
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         414   8e-139   
ref|XP_010093550.1|  Cationic peroxidase 1                              413   1e-138   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              412   1e-138   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              412   7e-138   
emb|CBI19219.3|  unnamed protein product                                416   8e-138   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             411   9e-138   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            410   1e-137   
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           410   1e-137   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              410   2e-137   
emb|CAH10839.1|  peroxidase                                             410   2e-137   Picea abies
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              409   4e-137   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              409   4e-137   
gb|KHN29529.1|  Cationic peroxidase 1                                   409   7e-137   
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       408   9e-137   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       408   1e-136   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    408   1e-136   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            408   1e-136   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              409   2e-136   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        407   2e-136   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       408   2e-136   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              409   2e-136   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              407   2e-136   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        407   3e-136   Vitis vinifera
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      407   4e-136   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              407   4e-136   
gb|ACU17608.1|  unknown                                                 407   5e-136   Glycine max [soybeans]
dbj|BAM28607.1|  putative peroxidase                                    404   3e-135   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             404   5e-135   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              404   5e-135   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              404   6e-135   
ref|NP_001065566.1|  Os11g0112200                                       404   6e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       404   6e-135   
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       404   7e-135   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    404   7e-135   Arachis hypogaea [goober]
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     403   1e-134   
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like              403   2e-134   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              402   2e-134   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              402   2e-134   Vitis vinifera
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              402   2e-134   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   402   2e-134   
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           402   2e-134   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     402   3e-134   
gb|KHN40655.1|  Cationic peroxidase 1                                   402   4e-134   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          401   6e-134   Sorghum bicolor [broomcorn]
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              401   6e-134   
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like              402   6e-134   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    401   7e-134   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  400   8e-134   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       401   9e-134   
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            400   9e-134   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    400   1e-133   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              401   2e-133   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      400   3e-133   
gb|AAB02554.1|  cationic peroxidase                                     399   3e-133   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             400   3e-133   
gb|AAP76387.1|  class III peroxidase                                    400   3e-133   Gossypium hirsutum [American cotton]
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       399   3e-133   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      399   4e-133   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           399   4e-133   
ref|NP_196153.1|  peroxidase 52                                         399   5e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              399   5e-133   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    399   5e-133   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         399   5e-133   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      399   6e-133   
gb|KHG18057.1|  Peroxidase 52 -like protein                             399   6e-133   
dbj|BAA77389.1|  peroxidase 3                                           398   7e-133   Scutellaria baicalensis [Baikal skullcap]
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      398   9e-133   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             398   9e-133   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              398   1e-132   
gb|AFR44628.1|  class III secretory peroxidase                          398   1e-132   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       397   2e-132   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                397   2e-132   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       398   2e-132   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             397   3e-132   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       397   3e-132   
ref|XP_007048724.1|  Peroxidase superfamily protein                     397   3e-132   
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   397   3e-132   
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       397   3e-132   
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              396   4e-132   
emb|CDY14118.1|  BnaC02g02350D                                          397   4e-132   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      397   5e-132   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              396   5e-132   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              396   6e-132   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              396   6e-132   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       396   7e-132   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       396   7e-132   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       395   1e-131   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      395   1e-131   
gb|ABK21858.1|  unknown                                                 395   2e-131   Picea sitchensis
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      395   2e-131   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           395   2e-131   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             394   2e-131   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       395   2e-131   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      395   2e-131   
emb|CDY04948.1|  BnaAnng01300D                                          395   2e-131   
gb|ABK23423.1|  unknown                                                 394   3e-131   Picea sitchensis
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           394   3e-131   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              394   3e-131   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      394   4e-131   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              394   4e-131   
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      394   4e-131   
gb|ACT35473.1|  peroxidase 52                                           394   4e-131   Brassica rapa
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              394   4e-131   
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           394   6e-131   
emb|CDX70158.1|  BnaA10g25070D                                          394   6e-131   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       393   1e-130   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              392   1e-130   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              393   1e-130   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              393   1e-130   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              392   2e-130   
ref|XP_003601028.1|  Peroxidase                                         392   2e-130   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      392   2e-130   
gb|AFK46186.1|  unknown                                                 392   2e-130   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           392   2e-130   
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      392   2e-130   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    391   3e-130   Brassica rapa subsp. rapa
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      391   5e-130   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       392   5e-130   
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      391   5e-130   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      391   6e-130   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              391   6e-130   
dbj|BAM05634.1|  peroxidase 2                                           391   7e-130   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             391   7e-130   
gb|ABR18139.1|  unknown                                                 391   7e-130   Picea sitchensis
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       391   7e-130   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       390   8e-130   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              390   9e-130   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       390   1e-129   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             390   1e-129   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             390   1e-129   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              390   1e-129   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       390   1e-129   
dbj|BAA82306.1|  peroxidase                                             390   1e-129   Nicotiana tabacum [American tobacco]
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       390   2e-129   
gb|ACM47317.1|  peroxidase                                              390   2e-129   Capsicum annuum
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            390   2e-129   Vitis vinifera
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           390   2e-129   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              389   2e-129   
gb|KHN44724.1|  Peroxidase 4                                            390   2e-129   
gb|AHL39176.1|  class III peroxidase                                    389   2e-129   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              389   2e-129   
ref|XP_002319968.2|  peroxidase family protein                          390   2e-129   Populus trichocarpa [western balsam poplar]
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             389   3e-129   
gb|KDP22793.1|  hypothetical protein JCGZ_00380                         388   3e-129   
ref|XP_007208188.1|  hypothetical protein PRUPE_ppa020902mg             389   3e-129   
emb|CDX98835.1|  BnaC09g50000D                                          389   4e-129   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       389   4e-129   
dbj|BAM05635.1|  peroxidase 2                                           389   4e-129   
gb|ACI03401.1|  peroxidase 1                                            389   4e-129   Litchi chinensis [litchi]
gb|ACU23245.1|  unknown                                                 389   4e-129   Glycine max [soybeans]
gb|KHN46100.1|  Cationic peroxidase 1                                   388   5e-129   
emb|CAL25300.1|  properoxidase                                          388   5e-129   Picea abies
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              389   5e-129   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        388   6e-129   Gossypium hirsutum [American cotton]
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           389   6e-129   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              388   7e-129   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       389   7e-129   
gb|AII99880.1|  peroxidase                                              387   1e-128   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             388   1e-128   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       387   1e-128   
ref|XP_007011229.1|  Peroxidase superfamily protein                     387   1e-128   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       387   1e-128   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            387   2e-128   
emb|CAH10840.1|  peroxidase                                             387   2e-128   Picea abies
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         387   2e-128   
ref|XP_010264469.1|  PREDICTED: peroxidase 2-like                       387   3e-128   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            387   4e-128   
ref|XP_003616748.1|  Peroxidase                                         387   4e-128   
gb|AGF25269.1|  peroxidase 2                                            386   4e-128   
gb|KHG17773.1|  Peroxidase 52 -like protein                             387   4e-128   
ref|NP_001106040.1|  peroxidase 70 precursor                            386   4e-128   Zea mays [maize]
ref|XP_003602462.1|  Peroxidase                                         386   4e-128   
ref|XP_010915493.1|  PREDICTED: peroxidase P7-like                      386   6e-128   
gb|KHN44723.1|  Peroxidase 4                                            385   6e-128   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          386   6e-128   
ref|XP_003623567.1|  Peroxidase                                         385   9e-128   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       385   1e-127   
dbj|BAM05637.1|  peroxidase 2                                           385   1e-127   
ref|XP_003545648.1|  PREDICTED: peroxidase 4                            385   1e-127   
emb|CAA62597.1|  korean-radish isoperoxidase                            384   2e-127   Raphanus sativus
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              385   2e-127   
gb|KHG00581.1|  hypothetical protein F383_17561                         396   2e-127   
gb|KEH29224.1|  class III peroxidase                                    385   2e-127   
gb|KHG09190.1|  Peroxidase 4                                            384   2e-127   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       384   2e-127   
ref|XP_010921099.1|  PREDICTED: peroxidase P7-like                      384   3e-127   
emb|CDP13933.1|  unnamed protein product                                384   3e-127   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                384   3e-127   
ref|XP_002319407.1|  peroxidase family protein                          384   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              384   3e-127   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       384   3e-127   
gb|EPS58869.1|  peroxidase                                              383   4e-127   
gb|ABK25962.1|  unknown                                                 384   5e-127   Picea sitchensis
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          383   6e-127   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                      383   6e-127   
ref|XP_010066274.1|  PREDICTED: cationic peroxidase 1-like              383   8e-127   
gb|ADN96693.1|  peroxidase 6                                            383   1e-126   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      383   1e-126   
ref|NP_001241243.1|  uncharacterized protein LOC100816056 precursor     382   2e-126   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             382   2e-126   
ref|XP_004249055.1|  PREDICTED: cationic peroxidase 1                   382   2e-126   
gb|AAP42508.1|  anionic peroxidase swpb3                                382   2e-126   Ipomoea batatas [batate]
emb|CBI18066.3|  unnamed protein product                                380   2e-126   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                382   3e-126   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          381   3e-126   
emb|CAD67479.1|  peroxidase                                             381   3e-126   Asparagus officinalis
ref|XP_006842568.1|  hypothetical protein AMTR_s00077p00148760          380   4e-126   
gb|KHN46627.1|  Peroxidase 4                                            380   6e-126   
gb|AFK49124.1|  unknown                                                 380   7e-126   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       381   8e-126   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      380   8e-126   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      380   9e-126   
ref|XP_010264471.1|  PREDICTED: cationic peroxidase 1-like              380   1e-125   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                380   1e-125   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                379   2e-125   
ref|XP_003615990.1|  Peroxidase                                         380   2e-125   
gb|AFK43134.1|  unknown                                                 379   2e-125   
ref|XP_008450825.1|  PREDICTED: peroxidase P7-like                      379   3e-125   
ref|XP_006365356.1|  PREDICTED: cationic peroxidase 1-like              379   5e-125   
gb|AAL93151.1|AF485265_1  class III peroxidase                          379   5e-125   Gossypium hirsutum [American cotton]
ref|XP_006365357.1|  PREDICTED: cationic peroxidase 1-like              378   5e-125   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      379   5e-125   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      379   5e-125   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    378   5e-125   Ricinus communis
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    378   6e-125   
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      378   8e-125   
ref|XP_010260327.1|  PREDICTED: peroxidase P7-like                      378   9e-125   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              378   9e-125   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       378   9e-125   
ref|NP_001242396.1|  uncharacterized protein LOC100812163 precursor     377   1e-124   
gb|AFK41406.1|  unknown                                                 377   1e-124   
ref|XP_003517000.1|  PREDICTED: peroxidase 52-like isoform 1            377   1e-124   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       377   2e-124   
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      377   2e-124   
ref|XP_006365360.1|  PREDICTED: peroxidase 70-like                      377   2e-124   
ref|XP_002437128.1|  hypothetical protein SORBIDRAFT_10g021610          376   3e-124   Sorghum bicolor [broomcorn]
ref|XP_003623564.1|  Peroxidase                                         376   3e-124   
ref|XP_003522118.1|  PREDICTED: cationic peroxidase 1-like              376   4e-124   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              376   5e-124   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840          376   5e-124   Sorghum bicolor [broomcorn]
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         376   5e-124   
gb|KHG25850.1|  Peroxidase 4                                            376   6e-124   
emb|CDX80957.1|  BnaC03g02110D                                          376   6e-124   
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      375   6e-124   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      375   7e-124   
ref|XP_007033538.1|  Peroxidase superfamily protein                     375   7e-124   
ref|XP_002323054.1|  hypothetical protein POPTR_0016s14030g             375   7e-124   Populus trichocarpa [western balsam poplar]
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      375   7e-124   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                375   8e-124   
gb|AFK33633.1|  unknown                                                 375   8e-124   
ref|XP_003602463.1|  Peroxidase                                         375   1e-123   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       375   1e-123   
gb|AAR31108.1|  peroxidase precursor                                    375   1e-123   
ref|XP_007134678.1|  hypothetical protein PHAVU_010G066800g             375   1e-123   
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       375   1e-123   
ref|XP_007134679.1|  hypothetical protein PHAVU_010G066900g             374   2e-123   
gb|AAX44001.2|  putative secretory peroxidase                           374   2e-123   
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          374   2e-123   
gb|AAB48184.1|  peroxidase precursor                                    374   3e-123   
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       383   3e-123   
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       374   3e-123   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      374   3e-123   
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      374   4e-123   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                374   4e-123   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             374   4e-123   
ref|XP_011003587.1|  PREDICTED: cationic peroxidase 1-like              373   5e-123   
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      373   5e-123   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       374   5e-123   
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       374   6e-123   
ref|XP_007146855.1|  hypothetical protein PHAVU_006G075800g             373   6e-123   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           373   7e-123   
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                       373   7e-123   
emb|CAH10841.1|  peroxidase                                             373   7e-123   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                373   8e-123   
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             373   9e-123   
ref|XP_007206549.1|  hypothetical protein PRUPE_ppa018900mg             372   9e-123   
ref|XP_007134677.1|  hypothetical protein PHAVU_010G066700g             372   1e-122   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      377   1e-122   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        372   1e-122   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    372   1e-122   
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      372   1e-122   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       372   2e-122   
emb|CBI19220.3|  unnamed protein product                                374   2e-122   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      372   2e-122   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       372   2e-122   
ref|XP_002448660.1|  hypothetical protein SORBIDRAFT_06g030940          372   2e-122   
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      372   2e-122   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       371   2e-122   
gb|AAX53172.1|  peroxidase                                              371   2e-122   
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                       372   3e-122   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       371   3e-122   
gb|KHN48387.1|  Peroxidase 52                                           369   3e-122   
gb|KHN46282.1|  Peroxidase 4                                            371   4e-122   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       371   4e-122   
gb|EPS58134.1|  anionic peroxidase swpb3                                371   4e-122   
gb|AAR31106.1|  peroxidase precursor                                    371   4e-122   
gb|EPS63041.1|  hypothetical protein M569_11749                         370   6e-122   
gb|AHL39144.1|  class III peroxidase                                    370   7e-122   
gb|ABV24960.2|  putative secretory peroxidase                           370   8e-122   
ref|XP_002268412.1|  PREDICTED: cationic peroxidase 1                   370   1e-121   
gb|KEH34417.1|  cationic peroxidase                                     370   1e-121   
ref|XP_004307711.1|  PREDICTED: peroxidase 4-like                       370   1e-121   
emb|CDP04065.1|  unnamed protein product                                370   1e-121   
ref|XP_008235963.1|  PREDICTED: peroxidase P7-like                      370   1e-121   
emb|CAH10842.1|  peroxidase                                             370   1e-121   
ref|XP_007033587.1|  Peroxidase superfamily protein                     369   2e-121   
ref|XP_008455297.1|  PREDICTED: peroxidase P7-like                      369   2e-121   
ref|XP_009610471.1|  PREDICTED: cationic peroxidase 1-like              369   2e-121   
ref|XP_003517003.1|  PREDICTED: cationic peroxidase 1                   369   2e-121   
gb|KEH29223.1|  class III peroxidase                                    370   2e-121   
ref|XP_010261059.1|  PREDICTED: cationic peroxidase 1-like isofor...    369   2e-121   
gb|ACD70388.1|  class III peroxidase                                    369   2e-121   
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       369   2e-121   
ref|XP_011003590.1|  PREDICTED: peroxidase 2-like                       369   2e-121   
emb|CAD67478.1|  peroxidase                                             368   3e-121   
ref|XP_006576455.1|  PREDICTED: cationic peroxidase 1-like              369   3e-121   
ref|XP_003522116.1|  PREDICTED: cationic peroxidase 1-like              369   3e-121   
ref|XP_008229652.1|  PREDICTED: cationic peroxidase 1-like              369   3e-121   
ref|XP_004965567.1|  PREDICTED: peroxidase 4-like                       369   3e-121   
ref|XP_004149367.1|  PREDICTED: peroxidase 4-like                       369   4e-121   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    370   4e-121   
ref|XP_004149369.1|  PREDICTED: cationic peroxidase 1-like              369   4e-121   
gb|EPS67864.1|  hypothetical protein M569_06908                         368   4e-121   
ref|XP_011019031.1|  PREDICTED: peroxidase 2-like                       369   4e-121   
ref|XP_002320417.1|  peroxidase family protein                          368   5e-121   
ref|XP_004984445.1|  PREDICTED: peroxidase 52-like                      369   5e-121   
gb|KHN33222.1|  Cationic peroxidase 1                                   368   5e-121   
ref|XP_004514549.1|  PREDICTED: cationic peroxidase 1-like              368   5e-121   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       368   5e-121   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           368   6e-121   
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              368   6e-121   
ref|XP_007207602.1|  hypothetical protein PRUPE_ppa019253mg             369   6e-121   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg             368   6e-121   
ref|XP_010915491.1|  PREDICTED: peroxidase P7-like                      368   6e-121   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            368   8e-121   
ref|XP_004497330.1|  PREDICTED: cationic peroxidase 1-like              368   8e-121   
ref|XP_007146854.1|  hypothetical protein PHAVU_006G075700g             368   8e-121   
ref|XP_009597807.1|  PREDICTED: peroxidase 2-like                       367   8e-121   
emb|CAA59484.1|  pox1                                                   367   9e-121   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      367   9e-121   
ref|XP_003551178.1|  PREDICTED: cationic peroxidase 1-like              367   1e-120   
ref|XP_007017044.1|  Peroxidase 68                                      377   1e-120   
gb|AAQ55292.1|  class III peroxidase GvPx2b                             365   1e-120   
gb|ACF08086.1|  class III peroxidase                                    367   1e-120   
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                      367   1e-120   
ref|XP_004249044.1|  PREDICTED: peroxidase 2-like                       367   1e-120   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      367   1e-120   
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     367   1e-120   
ref|XP_003522112.1|  PREDICTED: cationic peroxidase 1-like              367   1e-120   
ref|XP_002323056.1|  peroxidase family protein                          367   2e-120   
ref|XP_002308244.1|  peroxidase family protein                          367   2e-120   
gb|ACF08087.1|  class III peroxidase                                    367   2e-120   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    367   2e-120   
ref|XP_009597808.1|  PREDICTED: peroxidase 2-like                       367   2e-120   
emb|CAD67477.1|  peroxidase                                             367   2e-120   
ref|XP_010256953.1|  PREDICTED: cationic peroxidase 1-like              367   2e-120   
ref|NP_001054096.1|  Os04g0651000                                       366   2e-120   
ref|XP_008790007.1|  PREDICTED: peroxidase P7-like                      366   3e-120   
gb|KDO49649.1|  hypothetical protein CISIN_1g021171mg                   366   3e-120   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             366   3e-120   
ref|NP_001057822.1|  Os06g0547400                                       366   3e-120   
ref|NP_001241115.1|  uncharacterized protein LOC100811170 precursor     367   3e-120   
gb|EPS73958.1|  peroxidase 3                                            366   3e-120   
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       366   3e-120   
gb|KHN33217.1|  Cationic peroxidase 1                                   366   4e-120   
ref|XP_003522108.1|  PREDICTED: cationic peroxidase 1-like              366   4e-120   
ref|XP_009410539.1|  PREDICTED: cationic peroxidase 1-like              366   4e-120   
gb|ACU24215.1|  unknown                                                 366   4e-120   
ref|XP_009354363.1|  PREDICTED: peroxidase P7-like                      366   4e-120   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      366   4e-120   
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       366   4e-120   
ref|XP_004490698.1|  PREDICTED: cationic peroxidase 1-like              366   5e-120   
gb|ACU82387.2|  peroxidase 1                                            365   5e-120   
ref|XP_007206479.1|  hypothetical protein PRUPE_ppa018750mg             366   5e-120   
ref|XP_009795618.1|  PREDICTED: peroxidase 2-like                       365   5e-120   
ref|XP_007142067.1|  hypothetical protein PHAVU_008G249700g             366   5e-120   
ref|XP_008463818.1|  PREDICTED: cationic peroxidase 1-like              367   5e-120   
ref|XP_003602461.1|  Peroxidase                                         365   6e-120   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          365   7e-120   
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       365   7e-120   
ref|XP_007033588.1|  Peroxidase superfamily protein                     366   7e-120   
ref|XP_008463816.1|  PREDICTED: peroxidase P7-like                      365   8e-120   
gb|ACN33662.1|  unknown                                                 365   8e-120   
ref|XP_007142068.1|  hypothetical protein PHAVU_008G249800g             365   8e-120   
ref|XP_004136832.1|  PREDICTED: peroxidase 4-like                       365   1e-119   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      365   1e-119   
ref|XP_010087166.1|  Peroxidase 4                                       365   1e-119   
emb|CAN81400.1|  hypothetical protein VITISV_038539                     365   1e-119   
ref|XP_006481156.1|  PREDICTED: cationic peroxidase 1-like              365   1e-119   
ref|XP_002438530.1|  hypothetical protein SORBIDRAFT_10g021630          365   1e-119   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       365   1e-119   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          364   2e-119   
ref|XP_008228933.1|  PREDICTED: peroxidase P7-like                      364   2e-119   
gb|EMT13502.1|  Peroxidase 70                                           364   2e-119   
ref|XP_010695664.1|  PREDICTED: peroxidase P7-like                      364   2e-119   
dbj|BAC83101.1|  putative peroxidase precursor                          364   2e-119   
ref|XP_009775854.1|  PREDICTED: peroxidase 2-like                       364   2e-119   
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      364   2e-119   
ref|NP_001167809.1|  hypothetical protein precursor                     364   2e-119   
ref|XP_003522119.1|  PREDICTED: peroxidase 52-like                      364   3e-119   
gb|ABK59095.1|  peroxidase 1                                            364   3e-119   
ref|XP_004977056.1|  PREDICTED: peroxidase 4-like                       363   3e-119   
ref|XP_003615995.1|  Peroxidase                                         364   3e-119   
ref|XP_004135694.1|  PREDICTED: peroxidase 4-like                       363   3e-119   
ref|XP_007011212.1|  Peroxidase superfamily protein                     363   3e-119   
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                       363   3e-119   
ref|XP_002517727.1|  Cationic peroxidase 1 precursor, putative          361   4e-119   
gb|AFW86738.1|  peroxidase 52 isoform 1                                 363   4e-119   
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      363   4e-119   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          363   4e-119   
emb|CAA59487.1|  peroxidase                                             363   5e-119   
gb|EEC82680.1|  hypothetical protein OsI_27324                          363   5e-119   
gb|ACF08094.1|  class III peroxidase                                    363   5e-119   
ref|XP_008354739.1|  PREDICTED: cationic peroxidase 1-like              363   5e-119   
ref|XP_006665078.1|  PREDICTED: peroxidase 2-like                       363   5e-119   
emb|CDP07980.1|  unnamed protein product                                363   6e-119   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             363   6e-119   
ref|XP_003592769.1|  Peroxidase                                         363   6e-119   
ref|NP_001151940.1|  peroxidase 52 precursor                            363   6e-119   
ref|XP_010264470.1|  PREDICTED: peroxidase P7-like                      363   7e-119   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor     363   8e-119   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       363   8e-119   
ref|XP_008381199.1|  PREDICTED: peroxidase P7-like                      364   9e-119   
ref|NP_001147216.1|  LOC100280824 precursor                             362   9e-119   
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      362   1e-118   
ref|XP_006367398.1|  PREDICTED: peroxidase 4-like                       362   1e-118   
gb|ABO77632.1|  peroxidase                                              362   1e-118   
ref|XP_007033582.1|  Peroxidase superfamily protein                     362   1e-118   
ref|XP_003540408.1|  PREDICTED: cationic peroxidase 1                   362   1e-118   
ref|XP_002319422.1|  peroxidase precursor family protein                362   1e-118   
gb|KHN27952.1|  Cationic peroxidase 1                                   362   1e-118   
ref|NP_001060626.1|  Os07g0676900                                       363   1e-118   
gb|ACF08095.1|  class III peroxidase                                    362   1e-118   
gb|ABR23054.1|  basic peroxidase swpb4                                  362   1e-118   
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   362   1e-118   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       363   2e-118   
dbj|BAK07852.1|  predicted protein                                      362   2e-118   
gb|AIE12239.1|  peroxide                                                362   2e-118   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      362   2e-118   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    362   2e-118   
ref|XP_004967085.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P...    362   2e-118   
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                      362   2e-118   
ref|XP_004514553.1|  PREDICTED: cationic peroxidase 1-like              362   2e-118   
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    362   2e-118   
gb|EAZ01280.1|  hypothetical protein OsI_23303                          362   2e-118   
gb|KHN40654.1|  Cationic peroxidase 1                                   359   3e-118   
dbj|BAJ91992.1|  predicted protein                                      361   3e-118   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                      361   3e-118   
emb|CBI15847.3|  unnamed protein product                                359   3e-118   
ref|XP_009625317.1|  PREDICTED: cationic peroxidase 1-like              361   3e-118   
ref|XP_009788801.1|  PREDICTED: cationic peroxidase 1-like              361   3e-118   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    361   3e-118   
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                      361   4e-118   
ref|XP_002437129.1|  hypothetical protein SORBIDRAFT_10g021620          360   4e-118   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          361   4e-118   
ref|XP_004249054.1|  PREDICTED: peroxidase 70-like                      360   5e-118   
ref|XP_007206418.1|  hypothetical protein PRUPE_ppa018701mg             361   5e-118   
ref|XP_010087168.1|  Cationic peroxidase 1                              360   5e-118   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       362   5e-118   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                360   5e-118   
gb|KHG00582.1|  hypothetical protein F383_17561                         370   5e-118   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                       360   6e-118   
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             360   6e-118   
emb|CBI22007.3|  unnamed protein product                                364   6e-118   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      360   6e-118   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    360   6e-118   
ref|XP_003557955.1|  PREDICTED: peroxidase P7-like                      360   7e-118   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                      360   7e-118   



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   438 bits (1126),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/294 (70%), Positives = 247/294 (84%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+L++NFYS +CPN LS+IK+ V SAI  E+RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  21    AELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTS  80

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N+ S+RG +VID IK ++ES C GVVSCADI+AVAARDS V LGGPSWNV
Sbjct  81    SFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNV  140

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA+N++PAPTLNL+ LISSFS  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  141   LLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARCTTF  200

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R R+YN+TNI+  F ++++A CPQ+GGDNNL+P+D +PTTFDN Y+++L  QKG+ HSDQ
Sbjct  201   RDRLYNETNINSSFGTSIKANCPQNGGDNNLSPLDTSPTTFDNAYYKNLQSQKGILHSDQ  260

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDSIV TY+ N   F  DFA AM+KM NL PLTGT GQIRKNC K N
Sbjct  261   QLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKNN  314



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   437 bits (1124),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/294 (69%), Positives = 247/294 (84%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+L++NFYS +CPN LS+IK+ V SAI  E+RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  21    AELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTS  80

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N+ S+RG +VID IK ++ES C GVVSCADI+AVAARDS V LGGPSWNV
Sbjct  81    SFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNV  140

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA+N++PAPTLNL+ LISSFS  GF++RE+VALSG HTIG+ARCTTF
Sbjct  141   LLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCTTF  200

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R R+YN+TNI+  F + ++A CPQ+GGDNNL+P+D +PT+FDN Y+++L  QKG+ HSDQ
Sbjct  201   RDRLYNETNINSSFGTTIKANCPQNGGDNNLSPLDTSPTSFDNVYYKNLQSQKGILHSDQ  260

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDSIV TY+ N   F  DFA AM+KM NL PLTGT GQIRKNC K+N
Sbjct  261   QLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKIN  314



>ref|XP_009803848.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   431 bits (1109),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 241/292 (83%), Gaps = 0/292 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LSANFYS SCPN LS+IK+ V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT  F
Sbjct  23    LSANFYSSSCPNVLSVIKTAVDSAVTKEARMGASLLRLHFHDCFVNGCDASVLLDDTSNF  82

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+T+  N+ S+RG +VID IK K+E+ C GVVSCADI+AVAARDS V LGGPSW VLL
Sbjct  83    TGEKTANPNSGSLRGFDVIDTIKTKVEASCAGVVSCADILAVAARDSVVKLGGPSWTVLL  142

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTAS SAA+NN+PAPTLNL+ LISSFS  G +ARE+VALSGGHTIG+ARCTTFR 
Sbjct  143   GRRDSTTASLSAANNNIPAPTLNLSGLISSFSTKGLTAREMVALSGGHTIGQARCTTFRN  202

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQAL  502
             R+YN+ NI+  FA++++A CPQSGG+NNL+P+D +PT+FDN YF++L  QKGL HSDQ L
Sbjct  203   RLYNEANINASFATSVKANCPQSGGNNNLSPLDTSPTSFDNVYFKNLQIQKGLLHSDQQL  262

Query  501   YNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             ++GGST SIV TY+ N   F  DF +AM+KM NL PLTGT GQIRKNC K N
Sbjct  263   FSGGSTHSIVNTYSSNSATFFTDFKNAMVKMGNLSPLTGTSGQIRKNCRKTN  314



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   430 bits (1106),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFY+K+CPNALSIIKS V SA+++E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  31    AQLTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASILLDDTS  90

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG  V+D IK++LE+ CPGVVSCADI+AVAARDS V L GPSW V
Sbjct  91    NFTGEKTAGPNANSVRGYEVVDTIKSQLEASCPGVVSCADILAVAARDSVVALRGPSWMV  150

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++N+PAPTLNL+ LIS+F+  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  151   RLGRRDSTTASLSAANSNIPAPTLNLSGLISAFTNKGFNAREMVALSGSHTIGQARCTTF  210

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+ NID  F ++LQA CP SGGDN L+P+D  TPTTFDN Y+ +L+ +KGL HSD
Sbjct  211   RTRIYNEANIDASFKTSLQANCPSSGGDNTLSPLDTQTPTTFDNAYYTNLVNKKGLLHSD  270

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTD++V TY+     F  DFA+AM+KM NL PLTGT GQIR NC K N
Sbjct  271   QQLFNGGSTDAVVNTYSTRSTTFFTDFANAMVKMGNLSPLTGTSGQIRTNCRKTN  325



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   429 bits (1102),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYSKSCP+AL  IKSGV SA+ +E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  25    AQLSSTFYSKSCPSALRTIKSGVSSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTT  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+ ANNNSIRG  VID IK+ LES CPGVVSCADI+A+AARDS V LGGPSW V
Sbjct  85    NFTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVALGGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS + A++++PAPTL+L+ LI+SFS  GF+A+E+VALSG HTIG+ARCT+F
Sbjct  145   LLGRRDSTTASLTDANSDIPAPTLSLSDLITSFSNKGFTAKEMVALSGSHTIGQARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+ +I+  FA++L A CP SGGDNNL+P+D T PT FDN YF++L  QKGL HSD
Sbjct  205   RTRLYNENDINATFATSLNANCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD+ V TY+ N   F  DFA+AM+ M NL PLTG+ GQIRKNC KVN
Sbjct  265   QQLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRKNCRKVN  319



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/293 (70%), Positives = 241/293 (82%), Gaps = 1/293 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LSANFYS SCPN LS+IK+ V SA+ +E RMGASLLRLHFHDCFVNGCD S+LLDDT  F
Sbjct  24    LSANFYSSSCPNVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTSNF  83

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+T+  N+ SIRG +VID IK ++ES C G+VSCADI+AVAARDS V LGGPSW VLL
Sbjct  84    TGEKTAGPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPSWTVLL  143

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTAS SAA++NLP PT +L+ LISSFS  G +ARE+VALSG HTIG+ARCTTFR 
Sbjct  144   GRRDSTTASLSAANSNLPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQARCTTFRT  203

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSDQA  505
             R+YN+ NI+  FA+ ++A CPQSGGDNNL+P+D T PT+FDN Y+++L  QKGL HSDQ 
Sbjct  204   RLYNEANINASFATTVKANCPQSGGDNNLSPLDITSPTSFDNAYYKNLQIQKGLLHSDQV  263

Query  504   LYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             L+NGGSTDSIV TY+ N   F+ DFA+AM+KM NL PLTGT GQIRKNC K N
Sbjct  264   LFNGGSTDSIVNTYSSNSATFSTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  316



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 244/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFY+ +CP AL+ IKS V SA+  E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  28    AQLSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDTA  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
               TGE+T+  NNNS+RG  VID IK++LES CP VVSCADIVAVAARDS V LGGPSW+V
Sbjct  88    NITGEKTAGPNNNSVRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSWSV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS +AA++N+PAPTL+L+ LIS+FS  GF+A+E+VALSG HTIG+ARCTTF
Sbjct  148   LLGRRDSTTASLNAANSNIPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCTTF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+T IDP FA++L+A CP +GGDNNL+P+D T PT+FDN Y+++L  QKGL HSD
Sbjct  208   RSRIYNETTIDPSFATSLRANCPSTGGDNNLSPLDTTSPTSFDNAYYKNLQSQKGLLHSD  267

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y+ N   F  DFA+AM+KM NL PLTGT GQIR NC KVN
Sbjct  268   QQLFSGGSTDSQVNAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_010041464.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   426 bits (1096),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 245/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS SCP+ALS IKSGV SA+++E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  25    AQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG NVID IK++LES CPG+VSCAD++ VAARDS V LGGPSW V
Sbjct  85    NFTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIVSCADLLTVAARDSVVALGGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+SAA++N+PA TL+L+ LI++FS  GF+A+E+VALSG HTIG+ARCTTF
Sbjct  145   PLGRRDSTTASQSAANSNIPAFTLSLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+ NI+  FA++L+A CP SGGDNNL+P+D T PT+FDN YF++L  QKGL HSD
Sbjct  205   RTRLYNENNINATFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQKGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD+ V  Y+ N   F  DFA+AM+KM NL PLTG+ GQIRK+CGKVN
Sbjct  265   QQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKSCGKVN  319



>ref|XP_003634480.1| PREDICTED: cationic peroxidase 1 [Vitis vinifera]
Length=318

 Score =   424 bits (1091),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 202/292 (69%), Positives = 235/292 (80%), Gaps = 0/292 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LS NFY++SCP AL  I++ V  A+  E RMGASLLRLHFHDCFV GCD SILLDDT TF
Sbjct  25    LSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCFVLGCDASILLDDTATF  84

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+T+  NNNS+RG  VID IK+++ES CPGVVSCADIVAVAARDS V LGGP+W V L
Sbjct  85    TGEKTAGPNNNSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTVRL  144

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTAS SAA  +LP P LNL+QLIS+FSK G + +E+V LSG HTIGKARCT+FR 
Sbjct  145   GRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTSFRN  204

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQAL  502
              IYNDT+IDP FA++ Q ICP+SGGD+NL+P+D T T FDN YFR L ++KGL HSDQ L
Sbjct  205   HIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTTTVFDNVYFRGLKEKKGLLHSDQEL  264

Query  501   YNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             YNGGSTDSIVETY+ N   F +D A+AM+KM N+ PLTGT GQIR NC KVN
Sbjct  265   YNGGSTDSIVETYSINTATFFRDVANAMVKMGNISPLTGTNGQIRTNCRKVN  316



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 240/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS SCP AL+ IKS V SA+ +E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+ AN NS+RG +V+D IK++LES CPGV SC+DI+AVAARDS V LGGPSW V
Sbjct  83    NFTGEKTAGANANSLRGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGPSWTV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA+ N+PAPTLNL+ L++SFS  GF+A+ELVALSG HTIG+ARCTTF
Sbjct  143   QLGRRDSTTASLSAANTNIPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RAR+YN+ NID  FA++L+A CP SGGD NL+P+D  TP  FDN YF++L+ QKGL HSD
Sbjct  203   RARLYNEANIDSSFATSLKANCPSSGGDANLSPLDVTTPNKFDNAYFKNLVSQKGLLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGST++ V  Y  NP  F+ DFA AM+KM NL PLTGT GQIR +C KVN
Sbjct  263   QQLFSGGSTNAQVNAYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQIRTDCKKVN  317



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 245/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LS+ FY  SCP+AL  IKSGV SA+ +E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  25    ARLSSTFYFTSCPSALHTIKSGVNSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTT  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+ AN+NSIRG  VID IK++LES CPGVVSCADI+AVAARDS V LGGPSW V
Sbjct  85    NFTGEKTAGANDNSIRGYEVIDTIKSQLESSCPGVVSCADILAVAARDSIVALGGPSWRV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA++++PAPTL+L+ LI++FS  GF+A+E+VALSG HTIG+ARCTTF
Sbjct  145   LLGRRDSTTASLSAANSDIPAPTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             + R+YN+++I+  FA++L+  CP SGGDNNL+P+D T PT FDN YF++L  QKGL HSD
Sbjct  205   QTRLYNESDINSTFATSLKENCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD+ V TY+ N   F  DFA+AM+KM NL PLTG+ GQIRKNC K+N
Sbjct  265   QQLFSGGSTDAQVNTYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKLN  319



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   422 bits (1086),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 244/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY+ SCPNALS I++ V SA+  E+RMGASLLRLHFHDCFVNGCDGS+LLDD  
Sbjct  21    AQLSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNA  80

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T++ NNNS+RG  V+DNIK++LES CPGVVSCADI+AVAARDS VVLGGP+W V
Sbjct  81    TFTGEKTARPNNNSVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPTWTV  140

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S A++++PAP+L+L+ LI+SFS  G S+ E+VALSG HTIG+ARCTTF
Sbjct  141   LLGRRDSTTASLSTANSDIPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTTF  200

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R  IYN+TNID  +A++L++ CP SGGDNNL+P+D T PT FDN Y+++L+ +KGL HSD
Sbjct  201   RTHIYNETNIDSTYATSLKSNCPFSGGDNNLSPLDVTSPTVFDNAYYKNLVNKKGLLHSD  260

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V  YT +   F  DFA AM+KM N+ PLTG+ GQ+R NC KVN
Sbjct  261   QELFNGGSTDSQVTGYTSSSSTFPTDFAKAMVKMGNISPLTGSSGQVRTNCRKVN  315



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   422 bits (1086),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS SCP+ALS IKS V SA+++E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  25    AQLSSTFYSTSCPSALSTIKSAVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG +VID IK++LES CPGVVSCAD++ VAARDS V LGGPSW V
Sbjct  85    NFTGEKNATPNANSLRGFDVIDTIKSQLESACPGVVSCADLLTVAARDSVVALGGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+SAA++N+PAPTLNL+ LI++FS  GF+ +E+VALSG HTIG+ARCT+F
Sbjct  145   PLGRRDSTTASQSAANSNIPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             RAR+YN+ NI+  FA++L+A CP SGGDNNL+P+D T PT+FDN YF++L  Q+GL HSD
Sbjct  205   RARLYNENNINTTFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQEGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD+ V  Y+ N   F  DFA+AM+KM NL PLTG+ GQIRKNC  VN
Sbjct  265   QQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRNVN  319



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score =   421 bits (1083),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL++NFY+ SCPN LSIIK+ V SAI  E+RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLTSNFYNSSCPNVLSIIKTAVNSAIAKESRMGASLLRLHFHDCFVNGCDASVLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N+ S+RG +VID IK ++ES C GVVSCADI+AVAARDS V LGGPSW V
Sbjct  83    SFTGEKTANPNSGSLRGFDVIDTIKTQIESSCAGVVSCADILAVAARDSVVKLGGPSWTV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S A++++PAPTLNL+ LISSFS  GF+ RE+VALSG HTIG+ARCTTF
Sbjct  143   LLGRRDSTTASLSNANSDIPAPTLNLSSLISSFSNKGFNTREMVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R++N+T+I+  FA+++++ CPQSG DNN++P+D T PTTFDN Y+++L  QKGL HSD
Sbjct  203   RDRLHNETDINASFATSIKSKCPQSGSDNNVSPLDTTSPTTFDNIYYKNLRIQKGLLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L +GGSTDSIV TY+ N   F  DFA AM+KM NL PLTGT GQIRKNC K N
Sbjct  263   QQLSSGGSTDSIVNTYSSNSATFLADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_010653359.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=326

 Score =   421 bits (1083),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ N+YS SCPNALSIIKS V +A+  E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  32    AQLTTNYYSSSCPNALSIIKSAVNTAVNNEARMGASLLRLHFHDCFVNGCDASILLDDTS  91

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VID IK+++ES CPGVVSCADI+AV ARDS V LGGPSW V
Sbjct  92    NFTGEKTAVPNANSVRGFDVIDTIKSQVESSCPGVVSCADILAVVARDSVVALGGPSWTV  151

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A++++PAPTLNL+ LISSFS  GFSA E+VALSG HTIG+ARCT F
Sbjct  152   RLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFSANEMVALSGSHTIGQARCTNF  211

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+TNID  F S+LQA CP SGGDNNL+P+D  +PTTFDN YF +L+  KGL HSD
Sbjct  212   RDRLYNETNIDASFQSSLQANCPSSGGDNNLSPLDTKSPTTFDNAYFTNLVNNKGLLHSD  271

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V TY+     F  DFA+A++KM NL PLTGT GQIR NC K N
Sbjct  272   QQLFNGGSTDSQVTTYSTKSTTFFTDFANAIVKMGNLSPLTGTSGQIRTNCRKTN  326



>ref|XP_006345521.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   421 bits (1082),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 244/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL++NFY+ SCPN LSIIK+ V SAI  E+RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLTSNFYNSSCPNVLSIIKTVVNSAIATESRMGASLLRLHFHDCFVNGCDASVLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N+ SIRG +VID IK ++ES C G+VSCADI+AVAARDS V LGG SW V
Sbjct  83    SFTGEKTANPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGRSWTV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S A++++PAPTLNL+ LISSFS  GF++RE+VALSG HTIG+ARCTTF
Sbjct  143   LLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFNSREMVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T+I+  FA++L++ CPQSG DNN++P+D T PTTFDN Y+++L  QKGL HSD
Sbjct  203   RDRLYNETDINATFATSLKSNCPQSGSDNNISPLDTTSPTTFDNIYYKNLRIQKGLLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L +GGSTDSIV TY+ N   F  DFA+AM+KM NL PLTGT GQIRKNC K N
Sbjct  263   QQLSSGGSTDSIVNTYSSNSATFFTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   420 bits (1080),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSK+CP     +KSGV SA+  E RMGASLLRL FHDCFVNGCD S+LLDDT 
Sbjct  25    AQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT+  N NSIRGLNVIDNIK+++ES CPGVVSCADI+A+AARDS V+LGGP W+V
Sbjct  85    SFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS S A+NN+P PT +L+ LIS F   G S R++VALSG HTIG+ARCT+F
Sbjct  145   KLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNID  FA   QA CP +   GDNNL P+D  TPTTFDN Y+++L+ QKGL H
Sbjct  205   RARIYNETNIDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKGLLH  264

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ LYNGGSTDS V+TY  NP  F  DF   M+KM ++ PLTG+ G+IRK+CGKVN
Sbjct  265   SDQVLYNGGSTDSTVKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGEIRKSCGKVN  321



>ref|XP_009371984.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=323

 Score =   419 bits (1078),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY KSCPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDTP
Sbjct  29    AQLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTP  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VI+ IK++LES CP VVSCADI+ VAARDS V LGGP++ V
Sbjct  89    NFTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++NLPAPTLNL  LI++FS  GF+A+ELVALSG HTIG+A+CT+F
Sbjct  149   PLGRRDSTTASLSAANSNLPAPTLNLAGLITAFSNKGFTAKELVALSGSHTIGQAKCTSF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             RAR+YN+TNI+  FA++L++ CP  GGDNNL+P+D T PT+FDN YFR+L+ QKGL HSD
Sbjct  209   RARLYNETNINNSFATSLKSSCPTRGGDNNLSPLDVTSPTSFDNAYFRNLVSQKGLLHSD  268

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y  NP  F  DFA+A+ KM NL PLTG+RGQIR +C KVN
Sbjct  269   QQLFSGGSTDSQVNAYVSNPATFRADFANAIKKMGNLSPLTGSRGQIRTDCRKVN  323



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score =   419 bits (1076),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS +CP ALS IKS V SA+  E RMGASL RLHFHDCFVNGCDGSILLDDT 
Sbjct  29    AQLSSTFYSTTCPRALSTIKSAVNSAVSNEARMGASLPRLHFHDCFVNGCDGSILLDDTA  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
               TGE+T+  N+NS RG  VID IK+++ES CPGVVSCADIVAVAARDS V LGGPSW V
Sbjct  89    NMTGEKTAVPNSNSARGFEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPSWIV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA++N+PAPTLNL+ LI++FS  GF+A+E+VALSG HTIG+ARCTTF
Sbjct  149   LLGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA++L+A CP +GGDN+L+P+D T  T+FDN YF++L  QKGL HSD
Sbjct  209   RTRIYNETNIDSTFATSLRANCPSNGGDNSLSPLDTTSSTSFDNAYFKNLQGQKGLLHSD  268

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y+ N   F  DFA+AM+KM NL PLTGT GQIR NC K N
Sbjct  269   QQLFSGGSTDSQVNAYSSNLGSFTTDFANAMVKMGNLSPLTGTSGQIRTNCRKAN  323



>dbj|BAM28608.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ +Y  SCP ALS I+SGV SAIQ E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  22    AQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VID IKA +ES CPGVVSCADI+AV ARDS V LGG SW V
Sbjct  82    NFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA+ N+PAPTLNL+ LISSFS  G +  E+VALSG HTIG ARCTTF
Sbjct  142   LLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTTF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TNID  +A++L+  CP SGG NN  P+D T P TFDN YF+DL+  KGL HSD
Sbjct  202   RSRIYNETNIDSSYATSLKKTCPTSGGGNNTAPLDTTSPYTFDNAYFKDLINLKGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYN GS DS V  Y+ +P  F+ DFA+A++KM NL PLTGT GQIR NC KVN
Sbjct  262   QQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQIRTNCRKVN  316



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   418 bits (1074),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCPN  S +K  V SAI  E RMGASL+RL FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT+  N NS+RG  VID+IK+ +E  CPGVVSCADI+A+AARDST +LGGPSWNV
Sbjct  84    SFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS SAA+N +PAPT NLNQLIS FS  G S R+LVALSG HTIG+ARCT F
Sbjct  144   KLGRRDARTASLSAANNGIPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARCTNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNID  FA   ++ CP +GGDNNL P+D  TPT+FDN YF++LL QKGL HSD
Sbjct  204   RTRIYNDTNIDSSFAQTRRSNCPSTGGDNNLAPLDLQTPTSFDNNYFKNLLVQKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GSTDSIV TY+     F  DF   M+KM ++ PLTG++G+IRKNCGKVN
Sbjct  264   QELFNNGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCGKVN  318



>gb|ACZ51443.1| peroxidase protein [Mikania micrantha]
Length=321

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 238/294 (81%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLSANFY+ SCPN  SII S V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT  
Sbjct  28    QLSANFYATSCPNFSSIISSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDDTTN  87

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  NNNS+RG +VID IK++LES CPGVVSCAD++A AARDS V LGGPSWN+ 
Sbjct  88    FTGEKTAGPNNNSLRGFDVIDTIKSQLESSCPGVVSCADLLATAARDSVVALGGPSWNLA  147

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
              GRRDS TAS SAA++N+PAPTLNL+ LI+SFS  GF+A E+VALSG HTIG+ARCT FR
Sbjct  148   FGRRDSITASLSAANSNIPAPTLNLSGLITSFSNLGFTANEMVALSGSHTIGQARCTVFR  207

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             ARIYN+ NI+  FA++L+A CP SGGDNNL+P+D  +PT+FDN YF +LL Q GL HSDQ
Sbjct  208   ARIYNENNINSSFATSLRANCPSSGGDNNLSPLDVVSPTSFDNTYFTNLLNQNGLLHSDQ  267

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTD+ V TY+ N   F+ DFA+ M+KMSNL PLTG+ GQ+R NC + N
Sbjct  268   ELFNGGSTDAQVRTYSSNAATFSTDFANGMVKMSNLNPLTGSSGQVRTNCRRTN  321



>ref|XP_006345522.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL++NFY+ SCPN LSIIK+ V SAI  E+RMGAS+LRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLTSNFYNSSCPNILSIIKTAVNSAIAKESRMGASMLRLHFHDCFVNGCDASVLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N+ S+RG +VID IK ++ES C GVVSCADI+AVAARDS V LGGPSW V
Sbjct  83    SFTGEKTANPNSGSLRGFDVIDTIKTQVESSCAGVVSCADILAVAARDSVVKLGGPSWTV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S A++++PAPTLNL+ LISSFS  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  143   LLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFNAREMVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPT-TFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T+I+  FA+++++ CPQSG DNN++P+D T   TFDN Y+++L  QKGL HSD
Sbjct  203   RDRLYNETDINDSFATSVKSKCPQSGSDNNISPLDTTSANTFDNIYYKNLRIQKGLLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L +GGSTDSIV TY+ N   F  DFA AM+KM NL PLTGT GQIRKNC K N
Sbjct  263   QQLSSGGSTDSIVNTYSSNSATFFADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_007140134.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
 gb|ESW12128.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
Length=322

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 235/294 (80%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QLS +FYS +C NALS IK+ V SA+  E RMGASLLRLHFHDCFV GCDGS+LL+DT 
Sbjct  29    SQLSTDFYSTTCSNALSTIKTAVDSAVSNEARMGASLLRLHFHDCFVQGCDGSVLLNDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT+  N NS+RG  VIDNIK++LES CPGVVSCADI+AVAARDS V LGG SW V
Sbjct  89    SFTGEQTAFPNVNSLRGFGVIDNIKSQLESLCPGVVSCADILAVAARDSVVALGGQSWTV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS ++A+++LP PT +L QL+ +FSK  F+  E+VALSGGHTIG+A C++F
Sbjct  149   QLGRRDSTTASFNSANSDLPGPTFSLQQLVDAFSKKDFTTEEMVALSGGHTIGQAACSSF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R RIYNDTNID  FA++LQA CP  GGD NL P+D +PTTFDN YF+DL  QKGL HSDQ
Sbjct  209   RTRIYNDTNIDSSFATSLQANCPSVGGDRNLAPLDTSPTTFDNAYFQDLQSQKGLLHSDQ  268

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V  Y  NP  F  DFA+AM+KMSNLGPLTG+ G+IR NC K N
Sbjct  269   ELFNGGSTDSQVNGYVSNPSSFQTDFANAMVKMSNLGPLTGSSGEIRTNCWKTN  322



>ref|XP_008388322.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=323

 Score =   417 bits (1072),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 241/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY KSCPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  29    AQLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VI+ IK++LES CP VVSCADI+ VAARDS V LGGP++ V
Sbjct  89    NFTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++N+PAPTLNL+ LI++FS  GF+A+ELVALSG HTIG+ RCT+F
Sbjct  149   PLGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKELVALSGSHTIGQVRCTSF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             RAR+YN+TNI   FA++L++ CP  GGDNNL+P+D T PT+FDN YFR+L+ QKGL HSD
Sbjct  209   RARLYNETNISDSFATSLKSSCPTRGGDNNLSPLDVTSPTSFDNAYFRNLVSQKGLLHSD  268

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V+ Y  NP  F  DFA+A+ KM NL PLTGT+GQIR +C KVN
Sbjct  269   QQLFSGGSTDSQVKAYVSNPATFRADFANAIKKMGNLSPLTGTKGQIRTDCRKVN  323



>ref|XP_008370240.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=324

 Score =   417 bits (1072),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 238/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY  SCPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  30    AQLSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+ AN NS+RG +VID IK++LES CP VVSCADI+ VAARDS V LGG ++ V
Sbjct  90    NFTGEKTAGANANSLRGFDVIDTIKSQLESLCPKVVSCADILTVAARDSIVALGGLTYTV  149

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++N+PAPTLNL+ LI++FS  GF+A+ELVALSG HTIG+ARCTTF
Sbjct  150   PLGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTF  209

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+ NI+  FA++L++ CP SGG+NNL+P+D T PT+FDN YF +L+ Q GL HSD
Sbjct  210   RTRLYNEANINASFATSLKSSCPTSGGBNNLSPLDVTSPTSFDNAYFSNLVSQXGLLHSD  269

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y  NP  F  DFA+AM+KM NL PLTGT GQIR NC KVN
Sbjct  270   QQLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKVN  324



>dbj|BAM28609.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ +Y  SCP ALS I+SGV SAIQ E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  22    AQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VID IKA +ES CPGVVSCADI+AV ARDS V LGG SW V
Sbjct  82    NFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA+ N+PAPTLNL+ LISSFS  G +  E+VALSG HTIG ARCTTF
Sbjct  142   LLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTTF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TNID  +A++L+  CP SGG NN  P+D T P TFDN YF+DL+  KGL HSD
Sbjct  202   RSRIYNETNIDSSYATSLKKTCPTSGGGNNTAPLDTTSPYTFDNAYFKDLINLKGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYN GS DS V  Y+ +P  F+ DFA+A++KM N  PLTGT GQIR NC KVN
Sbjct  262   QQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNFSPLTGTEGQIRTNCRKVN  316



>ref|XP_009373126.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=324

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 238/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY  SCPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  30    AQLSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+ AN NS+RG +VID IK++LES CP VVSCADI+ VAARDS V LGG ++ V
Sbjct  90    NFTGEKTAGANVNSLRGFDVIDTIKSQLESLCPKVVSCADILTVAARDSIVALGGLTYTV  149

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++N+PAPTLNL+ LI++FS  GF+A+ELVALSG HTIG+ARCTTF
Sbjct  150   PLGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTF  209

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+ NI+  FA++L++ CP SGG NNL+P+D T PT+FDN YF +L+ QKGL HSD
Sbjct  210   RTRLYNEANINASFATSLKSSCPTSGGANNLSPLDVTSPTSFDNAYFTNLVSQKGLLHSD  269

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y  NP  F  DFA+AM+KM NL PLTGT GQIR NC KVN
Sbjct  270   QQLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKVN  324



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   415 bits (1066),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSK+CPN  + +KS V SAI  E+RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  25    AQLSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+D+IK+K+E  CPGVVSCADI+A+AARDS V+LGG SWNV
Sbjct  85    SFTGEKNANPNRNSARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTSWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS+SAA+NN+P PT NLN LISSF   G S +++VALSGGHTIG+ARCT F
Sbjct  145   KLGRRDSKTASQSAANNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARCTNF  204

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++NI+  FA   Q  CP S   GDNNL P+D  TPT FDN YF++L+ QKGL H
Sbjct  205   RARIYNESNIESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKGLLH  264

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS V TY+ NP  F  DFA AM+KM ++ PLTG+ G+IRKNC +VN
Sbjct  265   SDQQLFNGGSTDSQVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY K+CPNALS IKS V+SA+  E RMGASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  22    AQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+T+  N  SIRG NVID IK+K+ES CPGVVSCADI+AVAARDS V LGGP+W V
Sbjct  82    SFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A+++LPAPT +L+ LISSFS  GFS++ELVALSG HTIG+A+C++F
Sbjct  142   QLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNID  FA +LQ  CP +GG + L P+D T P TFDN YF++L  +KGL HSD
Sbjct  202   RTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V +Y+ NP  F  DFA+AM+KM NL PLTG+ GQIR NC K N
Sbjct  262   QELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   415 bits (1067),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 238/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY+K+CPNALS IKS V+SA+  E RMGASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  48    AQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTS  107

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N  SIRG +VID IK+K+ES CPGVVSCADI+AVAARDS V LGG +W V
Sbjct  108   SFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTV  167

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A+++LP PT +L+ LISSFS  GFS++ELVALSG HTIG+A+C++F
Sbjct  168   QLGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSF  227

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNID  FA +LQ  CP +GGD+NL P+D T P TFDN YF++L  +KGL HSD
Sbjct  228   RTRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSD  287

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V +Y+ NP  F  DFA+AM+KM NL PLTG+ GQIR NC K N
Sbjct  288   QELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  342



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score =   414 bits (1063),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 235/294 (80%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFY+ SCP ALS I++ V +A+  E RMGASLLRLHFHDCFV GCD SILLDDT 
Sbjct  22    AQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N +S+RG  VID IK+++ES CPGVVSCADIVAVAARDS V LGGP+W +
Sbjct  82    SFTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTL  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+++LP P  +L+ LIS FS  GF+ +E+VALSG HTIGKARCT+F
Sbjct  142   QLGRRDSTTASLSTANSDLPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKARCTSF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R+RIYN+TNID  FA++ Q ICP +GGDNNL+ +D T T FDN YFR+L  +KGL HSDQ
Sbjct  202   RSRIYNETNIDAAFATSKQKICPSTGGDNNLSDLDETTTVFDNVYFRNLKAKKGLLHSDQ  261

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNGGSTDSIVETY+ N   F  D A+AM+KM NL PLTGT G+IR +C K+N
Sbjct  262   QLYNGGSTDSIVETYSTNSATFFTDVANAMIKMGNLSPLTGTNGEIRTDCKKIN  315



>gb|KDP21683.1| hypothetical protein JCGZ_03354 [Jatropha curcas]
Length=316

 Score =   414 bits (1063),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 193/294 (66%), Positives = 237/294 (81%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS ++YS++CP ALS++++GV  AI+ ETR+GASLLRLHFHDCFVNGCDGSILLDD  T
Sbjct  23    KLSPDYYSRTCPKALSVVEAGVKKAIKNETRIGASLLRLHFHDCFVNGCDGSILLDDNAT  82

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNS+RG NVID+IK+KLE  CPGVVSCADIVA+AARDS V LGGPSW V 
Sbjct  83    FIGEKTAAPNNNSVRGFNVIDDIKSKLEKACPGVVSCADIVALAARDSAVYLGGPSWKVG  142

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGR+DS TAS++ A+ ++P PT NL+ LI+SFS  G S R++VALSG HTIG ARCT++R
Sbjct  143   LGRKDSLTASRALANTSIPPPTSNLSALITSFSAQGLSLRDMVALSGSHTIGLARCTSYR  202

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
               IYND+NIDP FA +LQ ICP+SG DN L P+D  TPT FDN Y+++LL +KGL HSDQ
Sbjct  203   GHIYNDSNIDPSFAKSLQQICPRSGKDNVLAPLDRQTPTRFDNLYYKNLLNKKGLLHSDQ  262

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG S DS+V  Y   PF F KDFA AM+KMSN+ PLTG+ GQ+RKNC +VN
Sbjct  263   ELFNGRSADSLVRKYASKPFTFFKDFAQAMVKMSNIKPLTGSHGQVRKNCRRVN  316



>ref|XP_010093550.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54257.1| Cationic peroxidase 1 [Morus notabilis]
Length=322

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 239/295 (81%), Gaps = 3/295 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFYS SCPNALSI+KS V +A+  E RMGASLLRLHFHDCF  GCD SILLDDT 
Sbjct  30    AQLSSNFYSSSCPNALSIVKSAVKTAVSNEARMGASLLRLHFHDCF--GCDASILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ +  N NS+RG +V+D IK +LES C GVVSCADI+AVAARDS V+LGGPSW V
Sbjct  88    TFTGEKNAGPNANSVRGFDVVDTIKTQLESACAGVVSCADILAVAARDSVVLLGGPSWTV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS+SAA +N+PAPT NL+ LI++FS  GF+ +ELVALSGGHTIG+A+C++F
Sbjct  148   QLGRRDATTASQSAAGSNIPAPTTNLSGLITAFSNKGFTTKELVALSGGHTIGQAKCSSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             RAR+YN+ NI+  FA++ ++ CP SG DNNL+P+D T PTTFDN YF++++  KGL HSD
Sbjct  208   RARLYNENNIEASFATSTKSKCPNSGSDNNLSPLDVTSPTTFDNAYFKNVVSLKGLLHSD  267

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GSTDS V  Y+ NP  F  DFA+AM+KM NL PLTGT GQIR NC KVN
Sbjct  268   QQLFNNGSTDSQVRAYSTNPTSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_006468149.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=305

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+N Y  +CP ALS IKS V +A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  11    AQLSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  70

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++ AN NSIRG  VID++K+K+ES CPGVVSCADI+AVAARDS V  GGPSW V
Sbjct  71    SFTGEKSASANANSIRGFEVIDSVKSKVESLCPGVVSCADILAVAARDSVVAFGGPSWTV  130

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SA + N+P+P ++LN LIS+F+K G SA+E+VALSG HTIG+ARC  F
Sbjct  131   QLGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLLF  190

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA++L++ CP SGGD+NL+ +D T P  FDN YFRDL+  KG+FHSD
Sbjct  191   RQRIYNETNIDSEFATSLKSNCPSSGGDDNLSSLDATSPVLFDNGYFRDLVNNKGVFHSD  250

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V TY+ N   F  DFA+AM+KM NL PLTGT GQIR NC K+N
Sbjct  251   QQLFNGGSTDSQVTTYSTNIGTFYADFANAMVKMGNLSPLTGTDGQIRTNCRKIN  305



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   412 bits (1058),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ +Y  SCP A S IKSGV +A+  E RMGASLLRLHFHDCFVNGCDGSILLDDT 
Sbjct  31    AQLSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTS  90

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+ AN NS+RG +VID IK+K+ES CPGVVSCADI+AVAARDS V LGGPSW V
Sbjct  91    SFTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGPSWTV  150

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS SAA++++PAPTL+L+ L S+FSK G +A+E+VALSG HTIG+ARCT+F
Sbjct  151   QLGRRDATTASLSAANSDIPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQARCTSF  210

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TNI+   A++L++ CP +GGD+NL+P+D T PT FDN YF++L+  KGL HSD
Sbjct  211   RSRIYNETNINSSLATSLKSNCPSTGGDSNLSPLDATSPTAFDNAYFKNLVNNKGLLHSD  270

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYNGGSTDS V +Y+ N   F+ DFA AM+KM N+ PLTG+ G+IR NC K N
Sbjct  271   QQLYNGGSTDSQVSSYSSNSATFSSDFASAMVKMGNISPLTGSNGEIRTNCRKTN  325



>emb|CBI19219.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   416 bits (1069),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 199/291 (68%), Positives = 233/291 (80%), Gaps = 2/291 (1%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LS NFY++SCP AL  I++ V  A+  E RMGASLLRLHFHDCF  GCD SILLDDT TF
Sbjct  25    LSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCF--GCDASILLDDTATF  82

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+T+  NNNS+RG  VID IK+++ES CPGVVSCADIVAVAARDS V LGGP+W V L
Sbjct  83    TGEKTAGPNNNSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTVRL  142

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTAS SAA  +LP P LNL+QLIS+FSK G + +E+V LSG HTIGKARCT+FR 
Sbjct  143   GRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTSFRN  202

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQAL  502
              IYNDT+IDP FA++ Q ICP+SGGD+NL+P+D T T FDN YFR L ++KGL HSDQ L
Sbjct  203   HIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTTTVFDNVYFRGLKEKKGLLHSDQEL  262

Query  501   YNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKV  349
             YNGGSTDSIVETY+ N   F +D A+AM+KM N+ PLTGT GQIR NC K+
Sbjct  263   YNGGSTDSIVETYSINTATFFRDVANAMVKMGNISPLTGTNGQIRTNCRKI  313



>ref|XP_007205557.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
 gb|EMJ06756.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
Length=324

 Score =   411 bits (1057),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS SCPNALS IKS V SA+ +E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  30    AQLSPTFYSTSCPNALSTIKSAVASAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             + TGE+T+  N NS+RG +VID IK +LES CP VVSCADI+ VAARDS V LGGP++ V
Sbjct  90    SLTGEKTAGPNANSLRGFDVIDTIKTQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  149

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS SAA++N+P P LNL  LIS+FS  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  150   PLGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTF  209

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+ NI+  FA+++++ CP SGGDN L+P+D T PT+FDN Y+R+L+ QKGL HSD
Sbjct  210   RNRLYNEANINASFATSVKSQCPSSGGDNTLSPLDVTSPTSFDNAYYRNLVSQKGLLHSD  269

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LY+GGST++IV+ Y  N   F  DFA+AM KM NL PLTGT GQIR NC K+N
Sbjct  270   QQLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRTNCRKIN  324



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY  SCPN  S +KS V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+A+AARDS  +LGGP+WNV
Sbjct  84    SFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+SAA+N +PAPT NLNQLIS FS  G S ++LVALSGGHTIG+ARCT F
Sbjct  144   KLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA   Q  CP++   GDNNL P+D  TPT+FDN YF++L+++KGL H
Sbjct  204   RARIYNETNIETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DFA AM+KM ++ PLTG+ G+IRKNC ++N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>ref|XP_008374511.1| PREDICTED: peroxidase P7-like isoform X1 [Malus domestica]
Length=318

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 237/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+  LP+PT N++ LISSFS  G S R+LVALSG HTIG ARCTTFR
Sbjct  144   LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD++V+ YT N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNISPLTGSQGEIRTNCRKVN  318



>ref|XP_008245160.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=324

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS SCPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  30    AQLSPTFYSTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             + TGE+T+  N NS+RG  VID IK +LES CP VVSCADI+ VAARDS V LGGP++ V
Sbjct  90    SLTGEKTAGPNANSLRGFEVIDTIKTQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  149

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS SAA++N+P P LNL  LIS+FS  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  150   PLGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTF  209

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+ NI+  FA++++  CP SGGDN L+P+D T PT+FDN YFR+L+ QKGL HSD
Sbjct  210   RNRLYNEANINASFATSVKTQCPSSGGDNTLSPLDVTSPTSFDNAYFRNLVSQKGLLHSD  269

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LY+GGST++IV+ Y  N   F  DFA+AM KM NL PLTGT GQIR NC KVN
Sbjct  270   QQLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRTNCRKVN  324



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 237/294 (81%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QL++ FY+K CP ALSI+K+ V  A+  E RMGASLLRLHFHDCFVNGCDGSILLDD  T
Sbjct  24    QLTSTFYNKLCPTALSIVKAAVNKAVNNEKRMGASLLRLHFHDCFVNGCDGSILLDDNST  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  N NS+RG +VID IK ++E+ C GVVSCADI+A+ ARDS V LGGP+W VL
Sbjct  84    FTGEKTALPNANSVRGFDVIDTIKTQVEAACSGVVSCADILAIVARDSVVQLGGPTWTVL  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS SAA+NN+P+P  NL+ LISSF+ HG S ++LVALSGGHTIG+ARCTTFR
Sbjct  144   LGRRDSTTASLSAANNNIPSPASNLSALISSFTAHGLSTKDLVALSGGHTIGQARCTTFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             ARIYN++NID  FA+++++ CP +GGDN L+P+D  TPTTFDN Y+ DL  +KGL HSDQ
Sbjct  204   ARIYNESNIDTSFATSVKSSCPSAGGDNTLSPLDLATPTTFDNKYYTDLGNRKGLLHSDQ  263

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L++GGST+S V TY+ N   F  DFA AM+KM N+ PLTGT GQIRKNC K N
Sbjct  264   QLFSGGSTNSQVTTYSANQNTFFTDFAAAMVKMGNISPLTGTSGQIRKNCRKAN  317



>ref|XP_010263840.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=318

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 234/294 (80%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS+ FY  SCP ALSIIKS V SA+ +E RMGASLLRLHFHDCFVNGCD SILLDDT T
Sbjct  25    QLSSTFYDTSCPRALSIIKSAVDSAVSSERRMGASLLRLHFHDCFVNGCDASILLDDTST  84

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  N NS+RG +VID IK++LES CPGVVSCADI+AVAARDS V LGG SW V 
Sbjct  85    FTGEKTALPNANSVRGFDVIDTIKSQLESACPGVVSCADILAVAARDSVVALGGTSWTVQ  144

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS + A+N+LPAP L+L+ LIS+F+  GF+A ELV LSG HTIG+ARCTTFR
Sbjct  145   LGRRDSTTASLNDANNDLPAPFLDLSALISAFANKGFTANELVVLSGAHTIGQARCTTFR  204

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RI+N+TNID  FA+++++ CP SGGDNNL  +D  T TTFDN +F +LL  KGL HSDQ
Sbjct  205   DRIHNETNIDSQFATSMKSNCPSSGGDNNLANLDTTTATTFDNVFFTNLLSNKGLLHSDQ  264

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V TY+ N   F  DF +AM+KM NL PLTGT GQ+R NC +VN
Sbjct  265   QLFNGGSTDSQVRTYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQLRTNCRRVN  318



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSANFY KSCPNALS I++ V SAI  E RMGASLLRLHFHDCFV GCDGS+LLDDTP
Sbjct  23    AQLSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDTP  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  NNNS+RG +VIDNIKA++E  CP VVSCADI+AVAARDS V LGGP+W V
Sbjct  83    TFTGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWVV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS  AA+N++PAPTL+L  L  SFS  G SA +++ALSG HTIG+ARC  F
Sbjct  143   QLGRRDSTTASLDAANNDIPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCVNF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R RIY++TNID   A++L++ CP + GDNN++P+D  TP  FDN Y+++LLK+KG+ HSD
Sbjct  203   RNRIYSETNIDSSLATSLKSNCPNTTGDNNISPLDASTPYVFDNFYYKNLLKKKGVLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS DS   TY+ N   F  DF+ AM+KMSN+ PLTG+ GQIRKNC KVN
Sbjct  263   QQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMSNITPLTGSSGQIRKNCRKVN  317



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   409 bits (1050),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 237/295 (80%), Gaps = 3/295 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY+K+CPNALS IKS V+SA+  E RMGASLLRLHFHDCF  GCD S+LLDDT 
Sbjct  22    AQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLLDDTS  79

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N  SIRG +VID IK+K+ES CPGVVSCADI+AVAARDS V LGG +W V
Sbjct  80    SFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTV  139

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A+++LP PT +L+ LISSFS  GFS++ELVALSG HTIG+A+C++F
Sbjct  140   QLGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSF  199

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNID  FA +LQ  CP +GGD+NL P+D T P TFDN YF++L  +KGL HSD
Sbjct  200   RTRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSD  259

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V +Y+ NP  F  DFA+AM+KM NL PLTG+ GQIR NC K N
Sbjct  260   QELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  314



>ref|XP_008364165.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   408 bits (1049),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 234/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+   P PT N++ LISSFS  G S R+LVALSG HTIG ARCT FR
Sbjct  144   LGRRDSTTASRSAANTXJPXPTSNISALISSFSAQGLSJRDLVALSGSHTIGLARCTXFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD++V+ YT N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIRTNCRKVN  318



>ref|XP_008343635.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 235/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+  LP PT N++ LISSFS  G S R+LVALSG HTIG ARCTTFR
Sbjct  144   LGRRDSTTASRSAANTXLPXPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD++V+ Y  N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIRTNCRKVN  318



>ref|XP_010263838.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010263839.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Nelumbo nucifera]
Length=318

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 234/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFY+ SCP+ALSIIKS V SA+  E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  24    AQLSSNFYATSCPSALSIIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS RG +VID IK++LES CPGVVSCADI+AVA+RDS V LGG SW V
Sbjct  84    SFTGEKTAAPNANSARGFDVIDTIKSQLESACPGVVSCADILAVASRDSVVALGGTSWTV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS   A+NNLP+P L+L+ LIS+F+  GF+A+ELV LSGGH+IG+ARC+ F
Sbjct  144   QLGRRDSTTASLDDANNNLPSPFLDLSDLISAFANKGFTAKELVVLSGGHSIGQARCSLF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TN+D  FA ++++ CP +GGDN L  +D T +T FDN YF +LL  KGL HSD
Sbjct  204   RSRIYNETNVDSSFAKSIKSNCPSAGGDNTLANLDTTTSTVFDNAYFTNLLNNKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTD+ V  Y+ N   F  DF +AM+KM NL PLTGT GQIR NC KVN
Sbjct  264   QQLFNGGSTDAQVRAYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQIRTNCRKVN  318



>ref|XP_008374539.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=318

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 235/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRXGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+  LP+PT N++ LISSFS  G S R+LVALSG HTIG ARCTTFR
Sbjct  144   LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNXYYKNLLKEKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD++V+ Y  N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIRTNCRKVN  318



>ref|XP_010683551.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 235/296 (79%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYS SCPNALS I+S V SA+  E+RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSPNFYSSSCPNALSTIQSAVQSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDTA  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG  VID IK+++E+ C GVVSCADI+AVAARDS V LGGPSW V
Sbjct  86    NFTGEKTAIPNLNSVRGFEVIDTIKSQVENVCAGVVSCADILAVAARDSVVALGGPSWTV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTA+ SAA+  LPAPTLN+ QLI+ FS  GF+ ++LVALSG HTIG+ARCTTF
Sbjct  146   LLGRRDSTTANISAANAILPAPTLNITQLITLFSGLGFTNQDLVALSGAHTIGQARCTTF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R+RIYN+TNI+  FA++LQA CP SGGDNN +P+D TPTTFDN YF DLL  +G+ HSDQ
Sbjct  206   RSRIYNETNINSTFATSLQANCPSSGGDNNTSPLDKTPTTFDNTYFNDLLTLQGVLHSDQ  265

Query  507   ALYNG--GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+ G  G+TDS V +Y  N   F  DFA AMLKM N+  LTGT G+IR NC + N
Sbjct  266   ELFTGNNGTTDSQVSSYGSNSTTFFADFASAMLKMGNMSVLTGTSGEIRTNCRRPN  321



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 233/294 (79%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFY+ SCP ALS I++ V +A+  E RMGASLLRLHFHDCFV GCD SILLDDT 
Sbjct  22    AQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  NNNS+RG +VID IK+++ES CPGVVSCADIVAVAARDS V LGGP+W V
Sbjct  82    NFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+++LPAPT +L+ LIS FS  GF+ +E+V LSG HTIGKA+C+ F
Sbjct  142   QLGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R RIYN+TNID  FA++ QAICP SGGD NL+ +D T T FDN YF +L+++KGL HSDQ
Sbjct  202   RDRIYNETNIDATFATSKQAICPSSGGDENLSDLDETTTVFDNVYFTNLIEKKGLLHSDQ  261

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNG STDS+VETY+ +   F  D A AM+KM NL PLTGT G+IR NC  +N
Sbjct  262   QLYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRTNCRAIN  315



>ref|XP_008374568.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 235/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    KLTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LISSFS  G S R+LVALSG HTIG ARCT+FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSIRDLVALSGSHTIGLARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG DNNL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDNNLASLDLQTPTHFDNKYYKNLLKEKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD +V+ Y  N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTTSTDKLVQIYANNTLTFFKHFAVAMVKMGNIDPLTGSQGEIRTNCRKVN  318



>ref|XP_010685963.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSAN+Y+K+CP ALS I++ V  A+ AE RMGASLLRLHFHDCFVNGCD SILL+DT 
Sbjct  71    AQLSANYYAKTCPKALSTIQNAVRKAVSAERRMGASLLRLHFHDCFVNGCDASILLNDTS  130

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGEQT+ AN  S+RG  V+D+IK+++ES CPGVVSCADI+AVAARDS V LGGP+W V
Sbjct  131   TFTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARDSVVSLGGPTWQV  190

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A++++P+PT++L+ L+SSFS  G +A+E+VAL+G HTIG+ARC  F
Sbjct  191   QLGRRDSTTASLSTANSDIPSPTMDLSGLLSSFSDKGLTAKEMVALAGAHTIGQARCVVF  250

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN++NID  F ++++  CP SGGDNNLTP+D  TP  FDN YF+DL+  KGL HSD
Sbjct  251   RNRVYNESNIDASFVTSVKTNCPSSGGDNNLTPLDSTTPVAFDNGYFKDLVNNKGLMHSD  310

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GSTDS V +Y+ +   F KDFA AM+KM NL PLTGT GQIR NC K N
Sbjct  311   QQLFNNGSTDSQVTSYSKDSKSFQKDFASAMVKMGNLSPLTGTNGQIRTNCWKTN  365



>ref|XP_010261061.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=317

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ SCP ALSII+S V  A+  E RMGASLLRLHFHDCFVNGCD SILLDD  
Sbjct  23    AQLSPNFYASSCPRALSIIRSAVSIAVARERRMGASLLRLHFHDCFVNGCDASILLDDNS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  N NS+RG +V+D IK++LES CPGVVSCADI+AVAARDS V LGG SW V
Sbjct  83    TFTGEKTAAPNANSVRGFDVVDTIKSQLESACPGVVSCADILAVAARDSVVALGGSSWTV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS +AA+NNLP+P  +L+ L+S+FS  GF+A+ELVALSG HTIG+ARCT F
Sbjct  143   QLGRRDSTTASLNAANNNLPSPFSDLSALLSAFSNKGFTAKELVALSGSHTIGQARCTIF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TNI+  +A++L+A CP SGGDNNL  +D  T T FDN YF +LL  +GL HSD
Sbjct  203   RSRIYNETNINSAYATSLKANCPSSGGDNNLAGLDASTSTVFDNAYFTNLLNNRGLLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD+ V  Y+ N   F  DF +AM+KM NL PLTGT GQIR NC KVN
Sbjct  263   QQLFSGGSTDAQVRAYSSNSATFLSDFGNAMIKMGNLSPLTGTSGQIRNNCRKVN  317



>ref|XP_002284007.1| PREDICTED: cationic peroxidase 1 isoform X2 [Vitis vinifera]
Length=316

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/294 (66%), Positives = 235/294 (80%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+++YS SCP+ALS I++ V +A+  E+RMGASLLRLHFHDCFV GCD SILLDDT 
Sbjct  22    AQLSSDYYSSSCPSALSTIQTAVNNAVADESRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  NNNS+RG +VID IK+++ES CPGVVSCADIVAVAARDS V LGGP+W V
Sbjct  82    NFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+++LPAPT +L+ LIS FS  GF+ +E+V LSG HTIGKA+C+ F
Sbjct  142   QLGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R RIYN+TNID  FA++ QAICP SGGD NL+ +D T T FDN YF +L+++KGL HSDQ
Sbjct  202   RDRIYNETNIDATFATSKQAICPSSGGDENLSDLDETTTVFDNVYFTNLIEKKGLLHSDQ  261

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNG STDS+VETY+ +   F  D A AM+KM NL PLTGT G+IR NC  +N
Sbjct  262   QLYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRTNCRAIN  315



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   407 bits (1045),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYS SCP   S +KS V SAIQ E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  23    AQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+DNIK+ +E+ CPGVVSCADI+A+AARDS V LGGPSWNV
Sbjct  83    SFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPSWNV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+NN+P PT NLNQLIS+FS  G S R+LVALSG HTIG+ARCT+F
Sbjct  143   KLGRRDARTASQAAANNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTSF  202

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TN+D   A   ++ CP++   GDNNL P+D  TPT+FDN YF++L++ KGL H
Sbjct  203   RPRIYNETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +   F+ DFA AM+KM ++ PLTG+ G+IRKNC K N
Sbjct  263   SDQQLFNGGSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRKNCRKTN  319



>ref|XP_011095107.1| PREDICTED: cationic peroxidase 1-like [Sesamum indicum]
Length=321

 Score =   407 bits (1045),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFYS +CPN LSIIK+ V SA++ + RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  27    AQLSSNFYSSTCPNLLSIIKTAVDSAVRGDARMGASLLRLHFHDCFVNGCDASVLLDDTA  86

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VID IK ++ES CPG+VSCADI++VAARD  V L GPSW V
Sbjct  87    NFTGEKTAAPNVNSLRGFDVIDTIKTQVESSCPGIVSCADILSVAARDGVVALNGPSWAV  146

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++ +P P LNLN LI+SFS  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  147   ALGRRDSTTASLSAANSQIPGPNLNLNALITSFSNKGFTAREMVALSGSHTIGQARCTTF  206

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+ NI+  FA++++A CPQSGG+NNL+P+D  +P  F+N YFR+LL  +GL HSD
Sbjct  207   RNRIYNEANINASFAASVRANCPQSGGNNNLSPLDVVSPNVFNNDYFRNLLSLRGLLHSD  266

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++ GSTD+ V  Y+ N   F  DFA AM+KMSNL PLTGT GQIR+NC + N
Sbjct  267   QQLFSNGSTDAQVRAYSTNSAAFFNDFASAMVKMSNLSPLTGTNGQIRRNCRRTN  321



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   407 bits (1045),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 233/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY  SCPN  S +KS V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSTNFYYHSCPNLFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+A+AARDS  +LGGP+WNV
Sbjct  84    SFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+SAA+N +PAPT NLNQLIS FS  G S ++LVALSGGHTIG+ARCT F
Sbjct  144   KLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI   FA   Q  CP++   GDNNL P+D  TPT+FDN YF++L+++KG  H
Sbjct  204   RARIYNETNIGTAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGFLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F  DFA AM+KM ++ PLTG+ G++RKNC ++N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGEVRKNCRRIN  320



>dbj|BAM28607.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 229/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ +Y  SCP ALS I+SGV SAIQ E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  22    AQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VID IKA +ES CPGVVSCADI+AV ARDS V LGG SW V
Sbjct  82    NFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA+ N+PAPTLNL+ LISSFS  G +  E+VALSG HTIG ARC TF
Sbjct  142   LLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCVTF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TNI   +A++L+  CP + G NN  P+D  TP  FDN YF+DL+  +GL HSD
Sbjct  202   RSRIYNETNIKSSYAASLKKNCPTNDGGNNTAPLDITTPFIFDNAYFKDLINLEGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYN GS DS V  Y+ +P  F+ DFA+A++KM NL PLTGT GQIR NC KVN
Sbjct  262   QQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQIRTNCRKVN  316



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S V SA+ +E RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS VVLGGP+WNV
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ Q+GL H
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F  DFA AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_010256954.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=323

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ +YS SCP ALS IKS V SA+  E RMGASLLRLHFHDCFVNGCDGSILLDDT 
Sbjct  29    AQLSSTYYSTSCPEALSTIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDTT  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS+RG +VID IK+++ES C GVVSCADI+AVAARDS V LGGP+W V
Sbjct  89    SFTGEKTATPNANSLRGFDVIDTIKSQVESVCAGVVSCADILAVAARDSVVALGGPTWTV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS SAA++++PAPTL+L+ LIS+FS  GF+A+E+VALSG HTIG+ARCT+F
Sbjct  149   QLGRRDATTASLSAANSDIPAPTLDLSGLISAFSNKGFTAKEMVALSGAHTIGQARCTSF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNI+  FA++L++ CP +GGDNNL+P+D T  TTFDN YF +L+  KGL HSD
Sbjct  209   RDRIYNETNINSSFATSLKSKCPSAGGDNNLSPLDATSATTFDNAYFTNLVNNKGLLHSD  268

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYN GSTDS V +Y+ N   F  DFA AM+KM NL PLTG+ G++R NC K N
Sbjct  269   QQLYNSGSTDSQVSSYSSNSATFFSDFASAMVKMGNLSPLTGSSGEVRTNCRKTN  323



>ref|XP_003552299.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=322

 Score =   404 bits (1038),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 232/294 (79%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QLS++FYS +CPNALS IKS V SA+  E RMGASLLRLHFHDCFV GCD S+LL+DT 
Sbjct  29    SQLSSDFYSTTCPNALSTIKSVVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTT  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT++ N NSIRG  VIDNIK+++ES CPGVVSCADI+AVAARDS V LGGPSW V
Sbjct  89    SFTGEQTARGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILAVAARDSVVALGGPSWTV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A+++LP   L+L QL  +F   G +  E+VALSGGHTIG+A+C+TF
Sbjct  149   QLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAQCSTF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R RIYN+TNID  FA++LQA CP  GGD+NL P+D +  TFDN YF+DL  QKGL H+DQ
Sbjct  209   RTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSSQNTFDNAYFKDLQSQKGLLHTDQ  268

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V  Y  +P  F  DFA+AM+KM N+ PLTG+ G+IR NC K N
Sbjct  269   VLFNGGSTDSQVNGYASDPSSFNTDFANAMIKMGNISPLTGSSGEIRTNCWKTN  322



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   404 bits (1037),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 234/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSANFY KSCPNALS I++ V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDTP
Sbjct  23    AQLSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  NNNS+RG +VIDNIKA++E  CP VVSCADI+AVAARDS   LGGP+W V
Sbjct  83    TFTGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWVV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS   A+N++PAPTL+L  L  SFS  G SA +++ALSG HTIG+ARC  F
Sbjct  143   QLGRRDSTTASLDTANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R RIY++TNID   A++L++ CP + GDNN++P+D  TP TFDN Y+++LL +KG+ HSD
Sbjct  203   RNRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYTFDNFYYKNLLNKKGVLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS DS   TY+ N   F  DF+ A++KM N+ PLTG+ GQIRKNC KVN
Sbjct  263   QQLFNGGSADSQTTTYSSNMATFFTDFSAAIVKMGNIDPLTGSSGQIRKNCRKVN  317



>ref|XP_008369323.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=335

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 233/294 (79%), Gaps = 2/294 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++  VI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT  
Sbjct  43    KLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASVLLDDTSN  102

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDS VV GGPSW V 
Sbjct  103   FVGEKTAVPNNNSIRGFEVVDGIKAKLEKACPGVVSCADLLALAARDS-VVYGGPSWKVR  161

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LISSFS  G S R+LVALSG HTIG ARCT+FR
Sbjct  162   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTSFR  221

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYN++ I+  FA +LQ  CP+SG DNNL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  222   SRIYNESTINAAFAKSLQGSCPRSGSDNNLASLDLQTPTHFDNLYYKNLLKEKGLLHSDQ  281

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNG STD +V+ Y  N F+F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  282   ELYNGTSTDKLVKKYANNTFVFFKHFAKAMVKMGNIDPLTGSQGEIRTNCRKVN  335



>ref|XP_008374993.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 230/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR GASLLRLHFHDCFVNG D S+LLDDT +
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRXGASLLRLHFHDCFVNGXDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+   P PT N++ LISSFS  G S R+LVALSG HTIG ARCT FR
Sbjct  144   LGRRDSTTASRSAANTXJPXPTSNISALISSFSAQGLSJRDLVALSGSHTIGLARCTXFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDBNLASLDLQTPTHFDNXYYKNLLKEKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD +V+ Y  N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTTSTDXLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIRTNCRKVN  318



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 228/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFY+  CPNALS IKS V SA+  E RMGASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  22    AQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NSIRG  VID IK+++ES CPGVVSCADI+AVAARDS V LGG SWNV
Sbjct  82    NFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S+A+++LPAP  NL+ LIS+FS  GF+ +ELV LSG HTIG+A+CT F
Sbjct  142   LLGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN++NIDP +A +LQA CP  GGD NL+P D  TP  FDN Y+ +L  +KGL HSD
Sbjct  202   RTRIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NG STDS V  Y+ N   F  DF +AM+KM NL PLTGT GQIR NC K N
Sbjct  262   QQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  316



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 233/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY  SCPN  S +KS V SAI  ETRMGASLLR  FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+A+AARDS  +LGGPSWNV
Sbjct  84    SFTGEKNANPNRNSARGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGPSWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS+SAA+N +P PT NLNQLIS FS  G S ++LVALSGGHTIG+ARCT F
Sbjct  144   KVGRRDARTASQSAANNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++NID  FA A Q  CP++   GDNNL  +D  TPT FDN YF++L+++KGL H
Sbjct  204   RARIYNESNIDTAFARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKNLVQKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DFA AM+KM ++ PLTG+ G+IRKNC ++N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>ref|XP_010066439.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=322

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 241/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LS+ FYS SCP+AL  IKSGV SA+ +E  M  SLLRLHFHDCFVNGCD SILLDDT 
Sbjct  28    ARLSSTFYSTSCPSALHTIKSGVSSAVSSEASMDGSLLRLHFHDCFVNGCDASILLDDTM  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+ AN+NSI G  VID IK++LES CPGVVSCADI+AVAARDS V LGGPSW V
Sbjct  88    NFTGEKTADANDNSIHGYEVIDKIKSQLESSCPGVVSCADILAVAARDSVVALGGPSWTV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS SAA+++LPA TL+L+ LI++FS  GF+A+E+VALSG HTIG+ARCTTF
Sbjct  148   LLGRRDSTTASLSAANSDLPASTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+++I+ ++A++L+A C  SGGDNNL+P+D  +PT FDN YF++L  QKGL HSD
Sbjct  208   RTRLYNESDINSMYATSLKANCQSSGGDNNLSPLDTMSPTYFDNAYFKNLQTQKGLLHSD  267

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD+ V  Y+ N   F  DFA+AM+KM NL PLTG+ GQIRKNC KVN
Sbjct  268   QQLFSGGSTDAQVNMYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKVN  322



>ref|XP_010685954.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS N+YSK+CP AL  IK+ V  A+ AE RMGASLLRLHFHDCFVNGCD S+LL+D+ 
Sbjct  24    AQLSTNYYSKTCPRALFTIKTAVHKAVAAEHRMGASLLRLHFHDCFVNGCDASVLLNDSS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGEQT+  N  S+RG  VID+IK+++ES CPGVVSCADI+AVAARDS  +LGGP+W V
Sbjct  84    TFTGEQTAGGNAGSLRGFTVIDDIKSQVESVCPGVVSCADILAVAARDSVALLGGPTWPV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A++++P+PT++L+ L+SSFS  G +A+E+VAL+G HTIG+ARC  F
Sbjct  144   QLGRRDSTTASLSIANSDIPSPTMDLSGLLSSFSNKGLTAKEMVALAGAHTIGQARCVVF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN++NID  + S+++  CP +GGDNNLTP+D  TP  FDN YF+DL+  KGL HSD
Sbjct  204   RNRVYNESNIDASYVSSVKPNCPNNGGDNNLTPLDSNTPVIFDNGYFKDLVSNKGLMHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS V +Y+ NP  F  DFA AM+KM NL PLTGT+GQIR NC K N
Sbjct  264   QQLFNGGSTDSQVTSYSKNPTSFHADFAQAMVKMGNLSPLTGTKGQIRTNCWKTN  318



>ref|XP_002283995.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=316

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 230/294 (78%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ SCP ALS I++ V +A+  E RMGASLLRLHFHDCFV GCD SILLDDT 
Sbjct  22    AQLSPNFYASSCPRALSTIRTAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  NNNS+RG +VID IK+++ES CPGVVSCADIVAVAARDS V LGGP+W V
Sbjct  82    NFTGEKTAGPNNNSLRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRDSTTAS S A+ +LPAPT +L+ L S FS  GF+ +E+VALSG HTIGKA+C  F
Sbjct  142   QMGRRDSTTASLSTANADLPAPTSDLDVLTSLFSNKGFTTQEMVALSGTHTIGKAQCIKF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R RIYN+TN+D  FA + Q ICP +GGD NL+ +D T T FD  YF+DL+++KGL HSDQ
Sbjct  202   RYRIYNETNVDAAFAKSKQKICPWTGGDENLSDLDETTTVFDTVYFKDLIEKKGLLHSDQ  261

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNG STDS+VETY+ +   F  D A+AM+KM NL PLTGT G+IR NC K+N
Sbjct  262   QLYNGNSTDSMVETYSTDSTTFFTDVANAMVKMGNLSPLTGTDGEIRTNCRKIN  315



>ref|XP_010921098.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=319

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY  SCPNALS I+S V +A+  E RMGASLLRLHFHDCFV GCDGS+LLDDT 
Sbjct  25    AQLSSTFYDTSCPNALSTIQSAVKAAVAKEARMGASLLRLHFHDCFVQGCDGSVLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+K N NSIRG +VID IK+++E+ C   VSCADI+AVAARDS V LGGPSW V
Sbjct  85    TFTGEKTAKPNINSIRGFDVIDTIKSQVEAVCNQTVSCADILAVAARDSVVALGGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S A++++P PT +L+ LIS+FSK G S  ++VALSG HTIG+ARCT+F
Sbjct  145   LLGRRDSTTASLSLANSDIPPPTSDLSALISAFSKKGLSTSDMVALSGSHTIGQARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RARIYN+TNID  +A++LQ+ CP SGGDNNL+P+D  TPTTFDN Y+R+L+ +KGL HSD
Sbjct  205   RARIYNETNIDSSYATSLQSNCPVSGGDNNLSPLDVSTPTTFDNFYYRNLVNKKGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYNGGSTDS V +Y  N   F  DFA AM+KM N+ PLTG+ G+IR NC K N
Sbjct  265   QQLYNGGSTDSQVSSYNTNSATFFSDFAAAMVKMGNISPLTGSSGEIRINCRKTN  319



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 240/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A LS+++Y KSCP A+  IK+ V +A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  20    ADLSSDYYEKSCPKAMYTIKNAVANAVTNERRMGASLLRLHFHDCFVNGCDASVLLDDTT  79

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+++K N+NSIRG +VID IK+++E  CPG+VSCADI+AVAARDS V+LGGPSW V
Sbjct  80    DFTGEKSAKPNSNSIRGFDVIDKIKSQIEKLCPGIVSCADIIAVAARDSVVLLGGPSWTV  139

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS   A++++P+P+L+LN LI++F+  GF+A+E+VALSGGHTIGKA+CTTF
Sbjct  140   ELGRRDSTTASLDTANSDIPSPSLDLNDLITNFANKGFTAKEMVALSGGHTIGKAQCTTF  199

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             RAR+YN+TNID   A++L++ CP +GGD+ L+ +D  TP  FDN ++++L+  KG+ HSD
Sbjct  200   RARVYNETNIDSSLATSLKSNCPSTGGDDTLSSLDATTPVLFDNHFYKNLVNNKGILHSD  259

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LY+GGSTDS V++Y+ NP  F  DFA AM+K+ NL PLTGT GQIR NC K+N
Sbjct  260   QQLYSGGSTDSQVKSYSTNPIAFDADFAKAMVKLGNLSPLTGTNGQIRTNCRKIN  314



>ref|XP_008374518.1| PREDICTED: peroxidase P7-like isoform X2 [Malus domestica]
Length=317

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 236/295 (80%), Gaps = 3/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHF DCFVNGCD S+LLDDT +
Sbjct  24    KLTQNFYKSKCPKALSIVQ-GVIAAIKNETRVGASLLRLHFQDCFVNGCDASVLLDDTSS  82

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  83    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  142

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+  LP+PT N++ LISSFS  G S R+LVALSG HTIG ARCTTFR
Sbjct  143   LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  202

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  203   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHSDQ  262

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD++V+ YT N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  263   ELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNISPLTGSQGEIRTNCRKVN  317



>ref|NP_001242089.1| uncharacterized protein LOC100815671 precursor [Glycine max]
 gb|ACU22965.1| unknown [Glycine max]
Length=322

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 229/294 (78%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QLS++FYS +CPNALS IKS V SA+  E RMGASLLRLHFHDCFV GCD S+LL+DT 
Sbjct  29    SQLSSDFYSTTCPNALSTIKSAVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT+  N NSIRG  VIDNIK+++ES CPGVVSCADI+ VAARDS V LGGPSW V
Sbjct  89    SFTGEQTAAGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILTVAARDSVVALGGPSWTV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A+++LP   L+L QL  +F   G +  E+VALSGGHTIG+A+C+TF
Sbjct  149   QLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAKCSTF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R RIYN+TNID  FA++LQA CP  GGD+NL P+D    TFDN YF+DL  QKGL H+DQ
Sbjct  209   RTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSNQNTFDNAYFKDLQSQKGLLHTDQ  268

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V  Y  +P  F  DFA+AM+KM N+ PLTG+ G+IR NC K N
Sbjct  269   VLFNGGSTDSQVNGYASDPSSFNTDFANAMVKMGNISPLTGSSGEIRTNCWKTN  322



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 237/313 (76%), Gaps = 19/313 (6%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFV-------------  1087
             AQLS+ FY K+CPNALS IKS V+SA+  E RMGASLLRLHFHDCFV             
Sbjct  22    AQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQASQLSLCPFFHY  81

Query  1086  -----NGCDGSILLDDTPTFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIV  922
                  +GCD S+LLDDT +F GE+T+  N  SIRG NVID IK+K+ES CPGVVSCADI+
Sbjct  82    DLFSLSGCDASVLLDDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADIL  141

Query  921   AVAARDSTVVLGGPSWNVLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARE  742
             AVAARDS V LGGP+W V LGRRDSTTAS S+A+++LPAPT +L+ LISSFS  GFS++E
Sbjct  142   AVAARDSVVALGGPTWTVQLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKE  201

Query  741   LVALSGGHTIGKARCTTFRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTF  565
             LVALSG HTIG+A+C++FR RIYNDTNID  FA +LQ  CP +GG + L P+D T P TF
Sbjct  202   LVALSGSHTIGQAQCSSFRTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTF  261

Query  564   DNCYFRDLLKQKGLFHSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTG  385
             DN YF++L  +KGL HSDQ L+NGGSTDS V +Y+ NP  F  DFA+AM+KM NL PLTG
Sbjct  262   DNAYFKNLQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTG  321

Query  384   TRGQIRKNCGKVN  346
             + GQIR NC K N
Sbjct  322   SSGQIRTNCRKTN  334



>ref|XP_002450134.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
 gb|EES09122.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
Length=317

 Score =   401 bits (1031),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QL+ANFY KSCPNAL  I++ V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDTP
Sbjct  23    SQLNANFYDKSCPNALYTIQTAVRSAVARENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  NNNS+RG +VID+IKA+LE  CP VVSCADIVAVAARDS V LGGP+W V
Sbjct  83    TFTGEKTAVPNNNSLRGFDVIDSIKAQLERICPQVVSCADIVAVAARDSVVALGGPTWAV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS  AA+N++PAPTL+L  L  SFS  G SA +++ALSGGHTIG+ARC  F
Sbjct  143   NLGRRDSLTASLDAANNDIPAPTLDLTDLTKSFSNKGLSASDMIALSGGHTIGQARCVNF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R RIY++ NID   A++L+  CP   GDNN++P+D  TP  FDN Y+++LL +KG+ HSD
Sbjct  203   RDRIYSEANIDTSLATSLKTNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS DS   TY+ N   F  DF+ AMLKMSN+ PLTG+ GQIRKNC +VN
Sbjct  263   QQLFNGGSADSQTTTYSSNMAKFFTDFSTAMLKMSNISPLTGSSGQIRKNCRRVN  317



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   401 bits (1031),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S V SA+ +E RMGAS++RL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIKA +E  CPGVVSCADI+A+AARDS VVLGGP+W V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ Q+GL H
Sbjct  208   RTRIYNETNINAAFATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DFA AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQELFNGGSTDSIVRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_010683553.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=329

 Score =   402 bits (1032),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 241/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFYS SCPNALS I+S V +A++ E+RMGASLLRLHFHDCFVNGCDGSILLDDT 
Sbjct  33    AQLSSNFYSSSCPNALSTIQSAVQAAVKNESRMGASLLRLHFHDCFVNGCDGSILLDDTA  92

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG +VID IK+++E+ C GVVSCADI+AVAARDS V LGG SW V
Sbjct  93    NFTGEKNAAPNANSVRGFDVIDTIKSQVENVCSGVVSCADILAVAARDSVVALGGQSWTV  152

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRD+TTAS+SAA +N+PAPTLNL QLI+ FS  GF+ +ELVALSG HTIG+ARCT+F
Sbjct  153   LLGRRDATTASQSAATSNIPAPTLNLTQLITFFSNKGFTTQELVALSGAHTIGQARCTSF  212

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+T+I+  FA++LQA CP +GGDNNL+P+D T PTTFDN YF +LL  +GL HSD
Sbjct  213   RSRIYNETSINSTFATSLQANCPSNGGDNNLSPLDKTSPTTFDNAYFTNLLSLEGLLHSD  272

Query  510   QALYNG--GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LY+G  G+TDS V +Y+ +   F  DFA+AM+KM N+  LTGT G+IR NC   N
Sbjct  273   QQLYSGNSGTTDSQVSSYSSSSSTFFTDFANAMVKMGNMSVLTGTNGEIRTNCRNTN  329



>ref|XP_009371986.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=312

 Score =   401 bits (1030),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 232/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS+ FY  SCPNALS IKS V SA+  E RMGA LLR+ FHDCFVNGCD S+LLDDTP 
Sbjct  19    QLSSTFYETSCPNALSTIKSAVNSAVSKEARMGAFLLRIQFHDCFVNGCDASVLLDDTPN  78

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  N  S+RG +VID IK++LE  CP VV+CADI+AVAARDS V LGGP++ V 
Sbjct  79    FTGEKTADPNAKSLRGFDVIDTIKSQLERICPKVVTCADIIAVAARDSIVALGGPAYKVP  138

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS SAA++N+PAPTLNL  LI++FS  GF+A++LVALSG HTIG ARCT FR
Sbjct  139   LGRRDSTTASLSAANSNIPAPTLNLTGLITAFSNKGFTAKDLVALSGSHTIGLARCTNFR  198

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSDQ  508
             AR+YN+TNI+  FA++L+  CP SGGDNNL P+D T PTTF+N YFR+L+ Q+GL HSDQ
Sbjct  199   ARLYNETNINASFATSLKPSCPTSGGDNNLYPLDVTSPTTFNNAYFRNLVNQRGLLHSDQ  258

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L++GGSTD+ V  Y  N   F  DFA+AM KM NL PLTGT GQIR +C KVN
Sbjct  259   QLFSGGSTDAQVNAYVSNTAAFRADFANAMKKMGNLSPLTGTNGQIRTDCRKVN  312



>pdb|1SCH|A Chain A, Peanut Peroxidase
 pdb|1SCH|B Chain B, Peanut Peroxidase
Length=294

 Score =   400 bits (1027),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 226/293 (77%), Gaps = 1/293 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LS+NFY+  CPNALS IKS V SA+  E RMGASLLRLHFHDCFV GCD S+LLDDT  F
Sbjct  2     LSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNF  61

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+T+  N NSIRG  VID IK+++ES CPGVVSCADI+AVAARDS V LGG SWNVLL
Sbjct  62    TGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLL  121

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTAS S+A+++LPAP  NL+ LIS+FS  GF+ +ELV LSG HTIG+A+CT FR 
Sbjct  122   GRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRT  181

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQA  505
             RIYN++NIDP +A +LQA CP  GGD NL+P D  TP  FDN Y+ +L  +KGL HSDQ 
Sbjct  182   RIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSDQQ  241

Query  504   LYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             L+NG STDS V  Y+ N   F  DF +AM+KM NL PLTGT GQIR NC K N
Sbjct  242   LFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  294



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   401 bits (1030),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSK+CPN  S ++  + SAI +E RMGAS+LRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS RG +VID IKA +E  CPGVVSCADI+A++ARDS V+LGGP+WNV
Sbjct  84    SFTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPNWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS S A+NN+P PT +L+ LIS FS  G SA E+VALSG HTIG+ARCT+F
Sbjct  144   KLGRRDARTASLSGANNNIPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARCTSF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYNDTNID  FA   ++ CP +   GDNNL P+D  TPT+FDN YF++L+ QKGL H
Sbjct  204   RARIYNDTNIDGSFAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVNQKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+N GSTDS+V TY+ NP  F+ DF  AM+KM ++ PLTG++G+IRKNC K+N
Sbjct  264   SDQQLFNKGSTDSLVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGEIRKNCRKIN  320



>ref|XP_008374548.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=317

 Score =   400 bits (1029),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 235/295 (80%), Gaps = 3/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHF DCFVNGCD S+LLDDT +
Sbjct  24    KLTQNFYKSKCPKALSIVQ-GVIAAIKNETRVGASLLRLHFQDCFVNGCDASVLLDDTSS  82

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  83    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  142

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+  LP+PT N++ LISSFS  G S R+LVALSG HTIG ARCTTFR
Sbjct  143   LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  202

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ ID  FA +LQ ICP+SG D+NL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  203   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNXYYKNLLKEKGLLHSDQ  262

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STD++V+ Y  N   F K FA AM+KM N+ PLTG++G+IR NC KVN
Sbjct  263   ELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIRTNCRKVN  317



>ref|XP_009371985.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=325

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 232/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS+ FY  SCPNALS IKS V SA+  E RMGA LLR+ FHDCFVNGCD S+LLDDTP 
Sbjct  32    QLSSTFYETSCPNALSTIKSAVNSAVSKEARMGAFLLRIQFHDCFVNGCDASVLLDDTPN  91

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  N  S+RG +VID IK++LE  CP VV+CADI+AVAARDS V LGGP++ V 
Sbjct  92    FTGEKTADPNAKSLRGFDVIDTIKSQLERICPKVVTCADIIAVAARDSIVALGGPAYKVP  151

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS SAA++N+PAPTLNL  LI++FS  GF+A++LVALSG HTIG ARCT FR
Sbjct  152   LGRRDSTTASLSAANSNIPAPTLNLTGLITAFSNKGFTAKDLVALSGSHTIGLARCTNFR  211

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSDQ  508
             AR+YN+TNI+  FA++L+  CP SGGDNNL P+D T PTTF+N YFR+L+ Q+GL HSDQ
Sbjct  212   ARLYNETNINASFATSLKPSCPTSGGDNNLYPLDVTSPTTFNNAYFRNLVNQRGLLHSDQ  271

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L++GGSTD+ V  Y  N   F  DFA+AM KM NL PLTGT GQIR +C KVN
Sbjct  272   QLFSGGSTDAQVNAYVSNTAAFRADFANAMKKMGNLSPLTGTNGQIRTDCRKVN  325



>ref|XP_010685962.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSAN+Y+K+CP ALS I++ V  A+ AE+RMGASLLRLHFHDCFVNGCD S+LL+DT 
Sbjct  71    AQLSANYYAKTCPKALSTIRNAVRKAVSAESRMGASLLRLHFHDCFVNGCDASVLLNDTS  130

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGEQT+ AN  S+RG  V+D+IK+++ES CPGVVSCADI+AVAAR+S V L GP+W V
Sbjct  131   TFTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARESVVSLRGPTWQV  190

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A++++P+P+++L  L+SSFS  G +A+E+VAL+G HTIG+ARC  F
Sbjct  191   QLGRRDSTTASLSTANSDIPSPSMDLRGLLSSFSDKGLTAKEMVALAGAHTIGQARCVVF  250

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN++NID  F +++++ CP SGGDNNL+P+D  TP  FDN YF+DL+  KGL HSD
Sbjct  251   RNRVYNESNIDASFVTSVKSNCPSSGGDNNLSPLDSTTPVVFDNGYFKDLVNNKGLMHSD  310

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GSTDS V +Y+     F KDFA AM+KM NL PLTGT GQIR NC K N
Sbjct  311   QQLFNNGSTDSQVTSYSKGSSSFHKDFARAMVKMGNLSPLTGTNGQIRTNCWKTN  365



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +++ V SA+++E RMG S+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+P PT +L+QLISSFS  G S R++VALSG HTIG++RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ QKGL H
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 232/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
              QLS+NFY+  CPNALS IKS V SA+  E R+GASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  25    GQLSSNFYATKCPNALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  N NS RG +VID IK+++ES CPGVVSCADI+A+AARDS V LGGPSWNV
Sbjct  85    TFTGEKTAFPNVNSARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGPSWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS ++A+++LP P+ NL+ LIS+FSK GF+A+ELV LSG HTIG+ARCTTF
Sbjct  145   QLGRRDSTTASLNSANSDLPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQARCTTF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN++NIDP +A +LQ  CP  GGD+NL+P D  TP  FDN Y+ +L  +KGL H+D
Sbjct  205   RTRIYNESNIDPSYAKSLQGNCPSVGGDSNLSPFDVTTPNKFDNAYYINLKNKKGLLHAD  264

Query  510   QALYN-GGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GGSTDS V  Y+ N   F  DF +AM+KM NL PLTGT GQIR NC K N
Sbjct  265   QQLFNGGGSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  320



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +++ V SA+ ++ RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSSSCPNLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS V+LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  148   KLGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RAR+YN+TNI+  FA+  Q  CP++   GD NL P+D  +  +FDN YF++L+ Q+GL H
Sbjct  208   RARVYNETNINAAFATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+  P  F+ DFA AM+KM ++ PLTGT G+IRK CG+ N
Sbjct  268   SDQELFNGGSTDSIVRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGEIRKLCGRTN  324



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 233/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCPN LS +KS V SAI  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  34    AQLSTNFYSKSCPNLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  93

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+DNIK+ +E+ CPGVVSCADI+A+AARDS  +LGGP W V
Sbjct  94    SFTGEKNANPNRNSSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPKWAV  153

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ +AS+SAA+N +P PT NLN+L S F+  G S R+LVALSG HTIG+ARCT+F
Sbjct  154   KLGRRDARSASQSAANNGIPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQARCTSF  213

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++NID  FA   Q  CP++   GDNNL P+D  TPT+FDN YF++L+ Q+GL H
Sbjct  214   RARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLISQRGLLH  273

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y  +P  F  DF  AM+KM ++ PLTG+RG+IRKNC +VN
Sbjct  274   SDQQLFNGGSTDSIVRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGEIRKNCRRVN  330



>ref|XP_009369253.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=318

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 233/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++  VI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT T
Sbjct  24    KLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASVLLDDTST  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AAR+STV LGGP W V 
Sbjct  84    FVGEKTAVPNNNSIRGFEVVDRIKAKLEKACPGVVSCADLLALAARESTVYLGGPPWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LISSFS  G S R+LVAL+G HTIG+ARCT+FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSLRDLVALAGAHTIGRARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYN++ I+  FA +LQ  CP+SG DNNL  +D  TPT FDN Y+++LLK+KGL HSD 
Sbjct  204   SRIYNESTINAAFAKSLQRSCPRSGSDNNLASLDLQTPTHFDNLYYKNLLKEKGLLHSDN  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNG  ST+ +V+ Y  N F+F K FA AM+KM N+  LTGT+G+IR NC KVN
Sbjct  264   ELYNGTSSTEKLVKKYANNTFVFFKHFAKAMVKMGNIHLLTGTQGEIRTNCRKVN  318



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS SCP   S +KS V SAIQ ETR GASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG NV+D IK+ +E+ CPGVVSCADI+A+AARDS  +LGGPSW+V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLIS+F+  G S R+LVALSG HTIG+ARCTTF
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TN+D   A   Q+ CP++   GDNNL P+D  +PT+FDN YF++L+++KGL H
Sbjct  203   RPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y  +   F+ DFA AM+KM ++ PLTG+ G+IRKNC K N
Sbjct  263   SDQQLFNGGSTDSIVRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+  FYS SCPN LS +++ V SA+++E RMG S+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTTFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ QKGL H
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +++ V SA+ +E RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ Q+GL H
Sbjct  208   RARIYNETNINAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F  DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS++FY+ +CP+ LS IK+ +  A+  E RMGASLLRLHFHDCFV GCDGS+LLDDT 
Sbjct  23    AQLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCFVQGCDGSVLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++  N NS+RG +VID IK+++ES CP VVSCADI++VAARDS V LGGPSW V
Sbjct  83    SFTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS  +A+ NLP PT +L  LI++F K GF+ +E+VALSG HTIG+A C  F
Sbjct  143   QLGRRDSTTASLDSANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSGSHTIGQASCRFF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+ NIDP FA++LQA CP SGGDNNL+P+D  TP TFDN Y+ +L  Q GLFHSD
Sbjct  203   RSRIYNEDNIDPTFAASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGLFHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GSTDSIV+ Y+ +P  F  DFA+AMLKM NL PLTG+ GQIR  CG +N
Sbjct  263   QELFNQGSTDSIVDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRTTCGAIN  317



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +++ V SA+++E RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIKA +E  CPGVVSCAD++A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TNI+  FA+  Q  CP++   GD NL P+D  TP +FDN YF++LL QKGL H
Sbjct  208   RTRIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y  N   F  DF  AM+KM ++ PLTG+ G+IRK CG  N
Sbjct  268   SDQELFNGGSTDSIVRGYNNNARSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGSTN  324



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYSKSCPN  S IK  V SAI  E RMGASL+RL FHDCFVNGCDGS+LLDDT 
Sbjct  29    AQLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLDDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS RG  VID+IK+ +E  CPGVVSCADI+AVAARDSTV+LGGP+WNV
Sbjct  89    SFTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPTWNV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS SAA+N +P PT NLNQLIS F+  G S R+LVAL+G HTIG+ARCT+F
Sbjct  149   KLGRRDARTASLSAANNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNID  FA   ++ CP++   GDNNL P+D  TPT+FDN YF++LL QKGL H
Sbjct  209   RARIYNETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQKGLLH  268

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV TY+     F  DF   M+KM ++ PLTG++G+IRKNC ++N
Sbjct  269   SDQQLFNGGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCRRMN  325



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   399 bits (1024),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS SCP   S +KS V SAIQ ETRMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG NV+D IK  +E+ CPGVVSCADI+A+AARDS  +LGGPSW+V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKFAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLIS+F+  G S R+LVALSG HTIG+ARCTTF
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R R+YN+TN+D   A   Q+ CP++   GDNNL P+D  +PT+FDN YF++L+++KGL H
Sbjct  203   RPRVYNETNLDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+N GSTDSIV  Y+ +   F+ DFA AM+KM ++ PLTG++G+IRKNC K N
Sbjct  263   SDQQLFNRGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSKGEIRKNCRKPN  319



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   399 bits (1024),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP  LS +KS V SAI  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSTNFYSKSCPKLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+DNIK+ +E+ CPGVVSCADI+A+ ARDS  +LGGP W V
Sbjct  86    SFTGEKNAIPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGPKWAV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ +AS+SAA+N +PAPT NLNQL S F+  G S R+LVALSG HTIG+ARCT+F
Sbjct  146   KLGRRDARSASQSAANNGIPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQARCTSF  205

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++NID  FA   Q  CP++   GDNNL P+D  TPT+FDN YF++L+ ++GL H
Sbjct  206   RARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLVSRRGLLH  265

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y  +P  F  DF  AM+KM ++ PLTG+RG+IRKNC +VN
Sbjct  266   SDQQLFNGGSTDSIVRGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGEIRKNCRRVN  322



>dbj|BAA77389.1| peroxidase 3 [Scutellaria baicalensis]
Length=318

 Score =   398 bits (1023),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSANFY+ +CPN L+II++ V SA+ ++TRMGASLLRLHFHDCFVNGCD S+LLDD  
Sbjct  24    AQLSANFYNTTCPNLLTIIRNAVNSAVSSDTRMGASLLRLHFHDCFVNGCDASVLLDDRT  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +VIDNIK  +E  CP +VSC+DI++VAARD  V +GGPSW V
Sbjct  84    GFTGEKTAGPNANSLRGFDVIDNIKTLVEGSCPNIVSCSDILSVAARDGVVAVGGPSWAV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS +AA+  +P P LNLN LI+SFS  GF+ARE+VALSG HTIG+ARCTTF
Sbjct  144   ALGRRDSTTASLNAANTQIPGPGLNLNALITSFSNKGFTAREMVALSGSHTIGQARCTTF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNI+  FA+ L+A CP+SGGDNNL P+D  +P  F+N Y+R+L+  +GL HSD
Sbjct  204   RGRIYNDTNINGAFATGLRANCPRSGGDNNLAPLDNVSPARFNNDYYRNLIGLRGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N G+ D+ V  Y+ N   F  DFA+AM+KMSNL PLTGT GQIR+NC + N
Sbjct  264   QELFNNGTADAQVRAYSTNSAAFFNDFANAMVKMSNLSPLTGTNGQIRRNCRRTN  318



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS SCP   S +KS V SAIQ ETRMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG NV+D IK+ +E+ CPGVVSCADI+A+AAR+S  VLGGPSW+V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENACPGVVSCADILAIAARESVTVLGGPSWDV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQL+S+F+  G S R+LVALSG HTIG+ARCTTF
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLVSTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TN+D   A   Q+ CP++   GDNNL P+D  +PT FDN YF++L++ KGL H
Sbjct  203   RPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFKNLIQNKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +   F+ DFA AM+KM ++ PLTG+ G+IRKNC K N
Sbjct  263   SDQQLFNGGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 237/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY  SCP  LS +KS + SAI  ETR+GASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VID+IK+ +E  CPGVVSCADI+A+AARDS  +LGGP+W+V
Sbjct  84    SFTGEKNANPNRNSARGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGGPTWDV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+SAA++ +P PT NLNQLIS FS  G S +++VALSGGHTIG++RCT+F
Sbjct  144   KLGRRDARTASQSAANSAIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQSRCTSF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++NID  FA   Q+ CP++   GDNNL P+D  TPT+FDN YF++L+++KGL H
Sbjct  204   RARIYNESNIDTSFARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG++G++RKNC ++N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRKNCRRIN  320



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ANFY KSCPNAL  I++ V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDTP
Sbjct  23    AQLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  NNNSIRG +VID+IKA++E  CP VVSCADI+AVAARDS V LGGP+W V
Sbjct  83    TFTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWVV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS  AA+N++P PT +L+ L  SFS  G +A +++ALSGGHTIG+ARC  F
Sbjct  143   NLGRRDSTTASLDAANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVNF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R RIY++ NID   A++L++ CP   GDNN++P+D  TP  FDN Y+++LL +KG+ HSD
Sbjct  203   RNRIYSEANIDTSLATSLKSNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS DS   TY+ N   F  DF+ AM+KM N+ PLTG+ GQIRKNC KVN
Sbjct  263   QQLFNGGSADSQTTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQIRKNCRKVN  317



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 231/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS  FY+KSCPN LS +KS V  A+  E RMGASLLRLHFHDCFVNGCDGSILLDD+ T
Sbjct  23    QLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDSST  82

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
              TGE+T+  N NS RG +VIDNIK+++E+ C GVVSCADI+ +AARDS V LGGPSW V 
Sbjct  83    LTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGPSWAVP  142

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS S A+NN+P PT +L  L+S F   G S +++VAL+GGHTIG+ARCT+FR
Sbjct  143   LGRRDSRTASLSGANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQARCTSFR  202

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             A IYNDTNID  +A++L+A CP++G DNN++P+D  TPT+FDN YF++L  +KGL HSDQ
Sbjct  203   AHIYNDTNIDTTYANSLKAKCPRTGSDNNISPLDVVTPTSFDNNYFKNLRAKKGLLHSDQ  262

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V +Y  +P  F  DFA +M+KM N+ PLTGT G+IRKNC K N
Sbjct  263   ELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRKNCRKPN  316



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS N+YSK+CPN  S +K  + SAI +E RMGAS+LRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLSTNYYSKTCPNLFSAVKPVIESAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+ AN NS+RG +VID IK  +E  CPGVVSCADI+AVAARDS V+LGGP+W+V
Sbjct  84    SFTGEKTANANRNSVRGFDVIDKIKTAVEEACPGVVSCADILAVAARDSVVILGGPNWDV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS SAA+NN+P PT +L+ LIS FS  G S  E+VAL+G HTIG+ARCT+F
Sbjct  144   KLGRRDARTASLSAANNNIPPPTSSLSNLISKFSAQGLSTDEMVALAGAHTIGQARCTSF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA IYNDT+I+  FA   QA CP +   GDNNL P+D  TPT FDN Y+++L+ Q+GL H
Sbjct  204   RAHIYNDTDINSSFAKTRQANCPSTSGNGDNNLAPLDLQTPTVFDNNYYKNLVSQEGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ LYN GSTDS+V TY+ NP  F+ DF  A++KM ++ PLTG++G+IRKNC K+N
Sbjct  264   SDQELYNKGSTDSLVSTYSTNPSKFSSDFVAAIIKMGDISPLTGSQGEIRKNCRKIN  320



>tpe|CAH69378.1| TPA: class III peroxidase 136 precursor [Oryza sativa Japonica 
Group]
Length=317

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 230/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSANFY KSCPNAL  I+  V SAI  E RMGASLLRLHFHDCFVNGCDGS+LLDDTP
Sbjct  23    AQLSANFYDKSCPNALPTIRIAVRSAIARENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  NNNS+RG +VIDNIKA +E  CP VVSCADI+AVAAR+S V LGGP+W V
Sbjct  83    TFTGEKTAAPNNNSLRGFDVIDNIKAHIEGICPQVVSCADILAVAARESVVALGGPTWVV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS   A+N++PAPT +L  L  SFS  G SA +++ALSG HTIG+ARC  F
Sbjct  143   QLGRRDSTTASLDTANNDIPAPTFDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R RIY++TNID   A++L++ CP + GDNN++P+D  TP  FDN Y+++LL +KG+ HSD
Sbjct  203   RNRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYAFDNFYYKNLLNKKGVLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS DS   TY+ N   F  DF+ AM+KM N+ P+TG+ GQIRKNC KVN
Sbjct  263   QQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMGNINPITGSSGQIRKNCRKVN  317



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 230/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSK+CPN  + +KS V +AI  E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  35    AQLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  94

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ +  N NS RG +V+DNIK+ +E  CPGVVSCAD++A+ ARDSTV+LGGPSWNV
Sbjct  95    TFTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSWNV  154

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA+N++P PT NLN LIS F   G S R++VALSG HTIG+ARCT F
Sbjct  155   KVGRRDARTASQAAANNSIPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARCTNF  214

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TN+D   A   Q+ CP++   GDNNL P+D  TPT FDN Y+++LL+ KGL H
Sbjct  215   RTRIYNETNLDSSLAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGLLH  274

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS+V TY  NP  F  DF   M+KM ++ PLTG+ G+IRKNC K+N
Sbjct  275   SDQQLFNGGSTDSLVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRKNCRKIN  331



>ref|XP_007142069.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
 gb|ESW14063.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
Length=318

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QL++  Y  +CP ALSII+S VISA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  24    SQLTSICYQSTCPQALSIIRSSVISAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++ AN NS+RG  VID+IK K+E+ CPGVVSCADIVAVAARDS V LGGPSWNV
Sbjct  84    SFTGEKSAGANVNSLRGFEVIDDIKTKVEAVCPGVVSCADIVAVAARDSVVALGGPSWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTASK AA  ++P+P ++L+ LIS+F+  GF+++E+VALSG HT G ARC  F
Sbjct  144   GLGRRDSTTASKDAATKDIPSPLMDLSALISAFANKGFNSKEMVALSGAHTTGLARCQLF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R R+YN+T+I+  FA++L++ CP +GGD NL+P+D T +  FDN YF++L+ QKGL HSD
Sbjct  204   RGRVYNETSIESNFATSLKSNCPSTGGDTNLSPLDVTTSVQFDNAYFKNLINQKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY+ +P  F  DFA AM+KM NL PLTG  GQIR +C KVN
Sbjct  264   QQLFSGGSTDSQVTTYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTDCRKVN  318



>ref|XP_009363835.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=318

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 233/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++  VI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    KLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D IKAKLE  CPGVVSCAD++A+AAR+STV LGGP W V 
Sbjct  84    FVGEKTAVPNNNSIRGFEVVDRIKAKLEKACPGVVSCADLLALAARESTVYLGGPPWEVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LISSFS  G S R+LVAL+G HTIG+ARCT+FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSLRDLVALAGAHTIGRARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYN++ I+  FA +LQ  CP+SG DNNL  +D  TPT FDN Y+++LLK+KGL HSD 
Sbjct  204   SRIYNESTINAAFAKSLQRSCPRSGSDNNLASLDLQTPTHFDNLYYKNLLKEKGLLHSDN  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNG  ST+ +V+ Y  N F+F K FA AM+KM N+  LTG++G+IR NC KVN
Sbjct  264   ELYNGTSSTEKLVKKYANNTFVFFKHFAKAMVKMGNIHLLTGSQGEIRTNCRKVN  318



>ref|XP_007048724.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX92881.1| Peroxidase superfamily protein [Theobroma cacao]
Length=320

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 228/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FY+ SCPN  +I+++ +  A+  ETR+GAS+LRL FHDCFVNGCD SILLDDT 
Sbjct  26    AQLSPKFYANSCPNLQTIVRNAMTQAVNRETRIGASILRLFFHDCFVNGCDASILLDDTA  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ +  N NS RG  VID IK  +E+ C   VSCADI+A+AARD  V+L GPSW V
Sbjct  86    TFTGEKNAAPNRNSARGFEVIDTIKTSVEAACSATVSCADILALAARDGVVLLKGPSWQV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+SAA+N LP+P  NL+ L SSF+  G SAR+L ALSGGHTIG ARCTTF
Sbjct  146   PLGRRDARTASQSAANNQLPSPFSNLSALTSSFAAKGLSARDLTALSGGHTIGLARCTTF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNIDP FA+  +A CP SGGDNNL P+D  TPT FDN YFR+L+ Q+GL HSD
Sbjct  206   RGRIYNDTNIDPNFAANRRANCPASGGDNNLAPLDIQTPTRFDNYYFRNLVAQRGLLHSD  265

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS D++V TY+ NP +F+ DFA AM++M N+ PLTGTRG+IR+NC  VN
Sbjct  266   QELFNGGSQDALVRTYSTNPEVFSSDFAAAMVRMGNISPLTGTRGEIRRNCRVVN  320



>gb|KDO60611.1| hypothetical protein CISIN_1g020951mg [Citrus sinensis]
Length=319

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 230/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QLS N+Y  +CP ALSI+++G+I+AI+ ETR+GASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  25    SQLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVLLDDTA  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              F GE+T+  NNNS RG NV+D IKA LE  CP VVSCADI+A+AARDS VV GGPSW V
Sbjct  85    NFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGGPSWKV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS++AA+ ++P PT NL+ LISSFS  G S + +VAL+GGHT+GKARCT+F
Sbjct  145   RLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R  IYND+NID  FA +LQ  CP+ G DN L  +D  TPT FDN Y+++LL +KGL HSD
Sbjct  205   RGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NG S D +V+ Y  +  +F KDFA  M+KM N+ PLTG+ GQIR NC K+N
Sbjct  265   QELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN  319



>ref|XP_006466288.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 230/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QLS N+Y  +CP ALSI+++G+I+AI+ ETR+GASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  25    SQLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVLLDDTA  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              F GE+T+  NNNS RG NV+D IKA LE  CP VVSCADI+A+AARDS VV GGPSW V
Sbjct  85    NFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGGPSWKV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS++AA+ ++P PT NL+ LISSFS  G S + +VAL+GGHT+GKARCT+F
Sbjct  145   RLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R  IYND+NID  FA +LQ  CP+ G DN L  +D  TPT FDN Y+++LL +KGL HSD
Sbjct  205   RGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGLLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NG S D +V+ Y  +  +F KDFA  M+KM N+ PLTG+ GQIR NC K+N
Sbjct  265   QQLFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN  319



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   396 bits (1018),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS++FY  +CP ALSII S V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  24    AQLSSDFYGTTCPKALSIINSAVCSAVSKEQRMGASLLRLHFHDCFVNGCDASVLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++ AN NS+RG  VID+IK +LE+ CPG+VSCADIVAVAARDS   LGGPSW+V
Sbjct  84    SFTGEKSAGANVNSLRGFEVIDDIKTQLETACPGIVSCADIVAVAARDSVKALGGPSWSV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTASK AA N++P+P ++L+ LIS+FS  GF+  E+V LSG HT G+ARC  F
Sbjct  144   GLGRRDSTTASKDAATNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQLF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R RIYN+T ID  FA+++++ CP +GGD+NLT +D T    FDN YF++L+ +KGL HSD
Sbjct  204   RGRIYNETTIDSNFATSVKSNCPSTGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY+ +P  F  DFA AM+KM NL PLTG  GQIR NC KVN
Sbjct  264   QQLFSGGSTDSQVTTYSTSPSTFNADFASAMVKMGNLSPLTGNNGQIRTNCHKVN  318



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +KSGV SA+ ++ RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAP ++L+QLISSFS  G S R++VALSG HTIG++RC  F
Sbjct  148   KVGRRDAKTASQAAANSNIPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RAR+YN+TNI+  FA+  Q  CP++   GD NL P+D  + T+FDN YF++L+ Q+GL H
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +P  F  DFA AM+KM ++ PLTG+ G+IRK CGK N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 232/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     IKS V SAI  ETRMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  25    AQLSTNFYSKSCPKLYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS+RG  VIDNIK+ +E  CPG+VSCADI+AV ARDS V+LGGP+WNV
Sbjct  85    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGPNWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+ AA++++PAPT NLN+LISSFS  G S +++VALSG HTIG+ARCTTF
Sbjct  145   KLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTF  204

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T NID  FA   Q  CP++   GDNNL P+D  TP+ FDN YF++L+ +KGL 
Sbjct  205   RARIYNETNNIDSTFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLL  264

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV +Y  NP  F  DF  AM+KM ++ PLTG+ G+IRKNC + N
Sbjct  265   HSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNCRRRN  322



>ref|XP_009775239.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=320

 Score =   396 bits (1018),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 238/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LSA++Y KSCP A+  IK+ V +A+  E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  26    ARLSADYYEKSCPKAIYTIKNAVTNAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+K N+NS+RG ++ID IK+++E  CPG+VSCADI+A+AARDS  +LGG +WNV
Sbjct  86    DFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVEILGGSTWNV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
             LLGRRDSTTAS S+A++++P+P ++L+ LI+ F   GF+A+E+VAL+G HTIG+A+CTTF
Sbjct  146   LLGRRDSTTASLSSANSDIPSPLMDLSDLITKFDNKGFTAKEMVALAGAHTIGQAQCTTF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T ID   A++L++ CP +GGD++L+ +D  TP  FDN YF++L+K KG+ HSD
Sbjct  206   RERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFKNLVKNKGILHSD  265

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY+  P  FA DFA A++KM NL PLTGT GQIR NC K+N
Sbjct  266   QQLFSGGSTDSQVTTYSTRPITFAADFAKAIVKMGNLSPLTGTNGQIRTNCRKIN  320



>ref|XP_010035984.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 231/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLS-ANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDT  1051
             AQLS  N+Y+  CP AL  IKS V SA+  E RMGASLLRLHFHDCFVNGCD SILLDDT
Sbjct  25    AQLSNQNYYATRCPKALDTIKSAVKSAVAKEARMGASLLRLHFHDCFVNGCDASILLDDT  84

Query  1050  PTFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWN  871
               FTGE+T+  N NS RG NVID IK+K+E  CPGVVSCADI+AV ARDS V LGG SW 
Sbjct  85    ANFTGEKTAFPNVNSARGFNVIDTIKSKVEKLCPGVVSCADILAVVARDSVVELGGRSWQ  144

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V LGRRDSTTAS +AA+ NLPAPTLNL+ LI+SFS  GF+A+E+VALSG HTIG+ARC T
Sbjct  145   VQLGRRDSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVT  204

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHS  514
             FR R+YN+ +I   FA++L+A CP SGGDN L+P+D T PT+FD+ YF +L+ QKGL HS
Sbjct  205   FRNRLYNENDISSSFATSLKAQCPSSGGDNKLSPLDITSPTSFDSAYFSNLVSQKGLLHS  264

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L++GGST++ V TY+ N  +F  DFA AM+KM  L PLTG+ GQIR NC +VN
Sbjct  265   DQQLFSGGSTNAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRTNCKRVN  320



>ref|XP_011021015.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=316

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ +CP ALS I++ V+ A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  22    AQLSTNFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS+RG +VID IK++LES CPGVVSCADI+AVAARDS V L GPSW V
Sbjct  82    SFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA+++LP+P ++L+ LI+SFS  GF+A+E+VALSG HTIG+ARC  F
Sbjct  142   QLGRRDSTTASLSAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLMF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T++D   A++L++ CP +G D++L+ +D  TP TFDN YF++L+  KGL HSD
Sbjct  202   RNRVYNETSLDSTLATSLKSNCPDTGSDDSLSSLDATTPVTFDNSYFKNLVNNKGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GG+TDS V+TY+ N   F  DFA AM+KM ++ PLTG+ GQIR NC KVN
Sbjct  262   QQLFSGGTTDSQVKTYSINYATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 231/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCPN  + +KS V SAI  E RMGASLLRL FHDCFVNGCDGSIL+DDT 
Sbjct  24    AQLSTNFYSKSCPNVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSILVDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG NV+D+IK+K+E  CPGVVSCADI+A+AARDS V+LGGPSW V
Sbjct  84    NFTGEKNAAPNRNSVRGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGPSWKV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+ ++P PT +L+ LISSF   G S +++VALSG HTIG+ARCT+F
Sbjct  144   KLGRRDARTASQAAANTSIPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQARCTSF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN++NID  FA A Q  CP +   GDNNL P+D  TPT FDN YF++L+  KGL H
Sbjct  204   RTRIYNESNIDGSFAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKNLINNKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS+V +Y+  P  F  DF+ AM+KM ++ PLTG+ G+IR NC +VN
Sbjct  264   SDQQLFNGGSTDSLVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRNNCRRVN  320



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 231/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCPN LS  KS V SA+  E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  26    AQLSTNFYSKSCPNVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+T+  N NS+RG NVID IK+K+ES CPGVVSCADIVA+AARDS V+LGGPSW V
Sbjct  86    SFQGEKTAGPNQNSVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEV  145

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRD+ TAS S A++  +P PT  L+ LIS F   G S R++VALSG HTIG+ARC +
Sbjct  146   KLGRRDARTASLSRANSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQARCIS  205

Query  690   FRARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FR RIYND+NID  F+   Q  CP++   GDNNL+P+D  +PT FDN YF++LL  KGL 
Sbjct  206   FRPRIYNDSNIDSSFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLSNKGLL  265

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGG+TDS+V+TY+ NP  F  DFA AM+KM ++ PLTG++G+IRK C K+N
Sbjct  266   HSDQELFNGGTTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKIN  323



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 230/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ +C N L  +KS V SAI  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLSTNFYANTCKNLLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ + AN NS RG  VIDNIK+ +E  CPGVVSCADI+A+ ARDS V+LGGPSW V
Sbjct  84    SFTGEKNANANRNSARGFQVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPSWRV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS SAA++ +PAPT NLNQL S F+  G S ++LVAL+GGHTIG+ARCT+F
Sbjct  144   KLGRRDARTASLSAANSGIPAPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA IYN+TNID  FA   Q  CP++   GDNNL P+D  TPT FDN YF++L+ +KGL H
Sbjct  204   RAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTCFDNNYFKNLVNRKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS V TY+ NP  F+ DF   M+KM ++ PLTG+RG+IRKNC +VN
Sbjct  264   SDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRVN  320



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 233/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYSKSCP     +KS V SAI+ ETRMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  25    AQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS+RG  VIDNIK+ +E  CPGVVSCADI+AV ARDS V+LGGP+WNV
Sbjct  85    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGGPNWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+ AA++++PAPT NLN+LISSFS  G S +++VALSG HTIG+ARCTTF
Sbjct  145   KLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIGQARCTTF  204

Query  687   RARIYNDTN-IDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+TN ID  FA   Q  CP++   GDNNL P+D  TP+ FDN YF++L+ +KGL 
Sbjct  205   RARIYNETNSIDSSFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLL  264

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV +Y  NP  F  DF  AM+KM ++ PLTG+ G+IRKNC + N
Sbjct  265   HSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNCRRRN  322



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 230/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QL   FY  SCP+A SI+ S V  A+  E RMGASLLRLHFHDCFVNGCDGSILLDDT T
Sbjct  33    QLCPRFYDISCPSAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTST  92

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  N NS+RG  VID IK ++E+ CPGVVSCADIVA+AARD+ V LGGP+W VL
Sbjct  93    FQGEKTAVPNKNSVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVL  152

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS SAA++NLP P  NL+ LISSF  HG S R+LVALSG HTIG+ARCT FR
Sbjct  153   LGRRDSTTASLSAANSNLPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNFR  212

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RI++++NID  FA A QA CP +GGD+NL P+D  TPTTFDN Y+++L +++GL HSDQ
Sbjct  213   NRIHSESNIDLSFARARQANCPSTGGDDNLAPLDLLTPTTFDNNYYKNLERRRGLLHSDQ  272

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTD++V  YT  P  F+ DFA AM+KM ++ PLTG  G+IRKNC K+N
Sbjct  273   QLFNGGSTDNLVSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRKNCRKIN  326



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 234/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYSKSCP     +KS V SAI+ ETRMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+AV ARDS V+LGGP+WNV
Sbjct  84    SFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+ ++P PT NLN+LISSFS  G S +++VALSG HTIG+ARCTTF
Sbjct  144   KLGRRDARTASQAAANRSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTF  203

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T N+D  FA   Q+ CP+S   GDN+L P+D  TP  FDN YF++L+ +KGL 
Sbjct  204   RARIYNETNNLDASFARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKNLVNKKGLL  263

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV +Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRKNCG++N
Sbjct  264   HSDQQLFNGGSADSIVTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCGRIN  321



>ref|XP_007011215.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20025.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=317

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 228/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS N+YS +CP  LSI+K  V  AI+ E RMGASLLRLHFHDCFVNGCDGS+LLDDT T
Sbjct  24    KLSPNYYSSTCPEVLSIVKERVRVAIKKEARMGASLLRLHFHDCFVNGCDGSLLLDDTAT  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNS+RG  V+D+IKAK+E  CPGVVSCADI+A+AARDST +LGGPSW V 
Sbjct  84    FIGEKTAAPNNNSVRGFYVVDDIKAKVEKACPGVVSCADILAIAARDSTAMLGGPSWEVK  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS++AA+N++PAPT N++ L+ SF+  G S  +LVALSG HTIG ARCT+FR
Sbjct  144   LGRRDSTTASRAAANNSIPAPTFNISGLLLSFAAQGLSLEDLVALSGSHTIGLARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
               IYND+NID  FA +LQ  CP+SG DN   P+D  TPT+FDN Y+ +LLK KGL HSDQ
Sbjct  204   THIYNDSNIDASFAKSLQRKCPKSGKDNVHQPLDFQTPTSFDNLYYHNLLKMKGLLHSDQ  263

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG S D +VE Y  +   F K FA +M+KM ++ PLTG+ G+IR NC KVN
Sbjct  264   ELFNGASADCLVEEYAADTSAFFKAFAKSMIKMGDIKPLTGSSGEIRTNCRKVN  317



>ref|XP_007206416.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
 gb|EMJ07615.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
Length=303

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 234/296 (79%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+++Y+ +CP ALS+++S VI+A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  8     AQLSSDYYATTCPRALSVVRSSVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  67

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N  S+RG  VID IK++LES CPGVVSCADI+AVAARDS ++ GGPSW V
Sbjct  68    NFTGEKTALPNVRSLRGFEVIDTIKSQLESLCPGVVSCADILAVAARDSVLLFGGPSWTV  127

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+  LP+P+L+L  LISSFS  GFSA+E+VALSG HT+G+ARC  F
Sbjct  128   QLGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAKEMVALSGSHTMGQARCQMF  187

Query  687   RARIYNDTNIDPLFASALQAICPQSGG-DNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHS  514
             R RIYN+TNI+  FA+ L++ C QS G D+NL+P+D T P  FDN YF++L+  KGL HS
Sbjct  188   RDRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNAYFKNLVDSKGLLHS  247

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L++GGSTDS+V TY+ +   F  DFA+AMLKM NL PLTGT GQIR NC K N
Sbjct  248   DQQLFSGGSTDSLVTTYSNSSGTFYTDFANAMLKMGNLSPLTGTSGQIRTNCRKTN  303



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 230/295 (78%), Gaps = 3/295 (1%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             L  NFY  SCP     +K  V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT +F
Sbjct  30    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  89

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+ +  N NS RG  VID IK+ +E  CPGVVSCADI+A+AARDS  +LGGP+W+V L
Sbjct  90    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILGGPTWDVKL  149

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDS TAS+SAA+N++P PT NLNQLIS F+  G S ++LVALSGGHTIG+ARCTTFRA
Sbjct  150   GRRDSRTASQSAANNDIPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRA  209

Query  681   RIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RIYN+TNID  FA   Q+ CP++   GDNNL P+D  TP  FDN YF++L+++KGL HSD
Sbjct  210   RIYNETNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNHYFKNLIQKKGLIHSD  269

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDSIV TY+ NP  F  DF+ AM++M ++ PLTG+RG+IR+NC +VN
Sbjct  270   QQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  324



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 233/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYSKSCPN L+ + S V SAI  E+RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  26    AQLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N+ S+RG  VID IK+ +E  CPGVVSCADI+ + ARDS V+LGGP+WNV
Sbjct  86    SFTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPTWNV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+NN+P P  +L+QL+SSFS  G S  ++VAL+GGHTIG+ARCT+F
Sbjct  146   KLGRRDARTASRTAANNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSF  205

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN++NID  FA   QA CP+S   G NNL P+D  TP +FDN Y+++L+ QKGL H
Sbjct  206   RTRIYNESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKGLLH  265

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L++GGST+S+V+TY  NP  F  DF  AM+KM ++ PLTG+ G++RKNC K N
Sbjct  266   SDQQLFSGGSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRKNCRKTN  322



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +KSGV SA+ ++ RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG  VID IK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAP+++L+QLISSFS  G S R++VALSG HTIG++RC  F
Sbjct  148   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RAR+YN+TNI+  FA+  Q  CP++   GD NL P+D  + T+FDN YF++L+ Q+GL H
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +P  F  DFA AM+KM ++ PLTG+ G+IRK CGK N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>gb|ABK23423.1| unknown [Picea sitchensis]
Length=318

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 233/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QL++ FYS+SCP ALSI+++ V  A+  E RMGASLLRLHFHDCFVNGCDGSILLDD  T
Sbjct  25    QLTSTFYSESCPRALSIVQAAVEQAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDNST  84

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  NNNS+RG +VID IK ++E+ C GVVSCADIVA+AARDS V LGGP+W VL
Sbjct  85    FTGEKTATPNNNSVRGYDVIDTIKTQVEAACSGVVSCADIVAIAARDSVVALGGPTWTVL  144

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS +AA++++P+P  NL+ LISSF  H  S ++LVALSG HTIG+ARCT+FR
Sbjct  145   LGRRDSTTASFNAANSSIPSPASNLSTLISSFRSHNLSPKDLVALSGAHTIGQARCTSFR  204

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             ARIYN++NID   A+A++  CP++GGDN L+P+D  TP TFD  Y+ +L  +KGL HSDQ
Sbjct  205   ARIYNESNIDTSLATAVKPKCPRTGGDNTLSPLDLATPITFDKHYYCNLRSKKGLLHSDQ  264

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V TY+ N   F  DFA AM+ M N+ PLTGT GQIR+NC K N
Sbjct  265   QLFNGGSTDSQVTTYSTNQNNFFTDFAAAMVNMGNIKPLTGTSGQIRRNCRKSN  318



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +KSGV SA+ ++ RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG  VID IK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAP+++L+QLISSFS  G S R++VALSG HTIG++RC  F
Sbjct  148   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RAR+YN+TNI+  FA+  Q  CP++   GD NL P+D  + T+FDN YF++L+ Q+GL H
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +P  F  DFA AM+KM ++ PLTG+ G+IRK CGK N
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 231/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS  FY  SCP AL  I++ V +A+  E RMGASLLRLHFHDCFVNGCDGSILLDDTPT
Sbjct  23    QLSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPT  82

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  NNNS+RG +VID IK+++E+ C  VVSCADI+AVAARDS V LGGPSW V 
Sbjct  83    FTGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQ  142

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRD+TTAS S A++++P+PT +L+ LIS+FSK G S  ++VALSG HTIG+ARCT FR
Sbjct  143   LGRRDATTASFSGANSDIPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVFR  202

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSDQ  508
              R+YN+TNID   A++L++ CP SGGD+NL+P+D  TPT  DN Y++DL+ +KGL HSDQ
Sbjct  203   TRLYNETNIDASLATSLKSNCPSSGGDDNLSPLDAITPTIVDNFYYKDLVNKKGLLHSDQ  262

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              LYNGGSTDS V TY  N   F  DFA AM+ M N+ PLTGT G+IR NC K+N
Sbjct  263   QLYNGGSTDSQVTTYANNFAKFYSDFAAAMVNMGNISPLTGTSGEIRTNCRKIN  316



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 231/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
              QLS  FYS SCPN LS +KS V SA+ +E RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  26    GQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +VIDNIK  +E  CPGVVSCADI+A+AARDS V+LGGPSWNV
Sbjct  86    SFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+S A+N++P PT +L+QL S FS  G S+ +LVALSGGHTIG+ARCTTF
Sbjct  146   KLGRRDSTTASQSQANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTF  205

Query  687   RARIY-NDTNIDPLFASALQAICPQSG--GDNNLTPMDPTPTTFDNCYFRDLLKQKGLFH  517
             R+RIY N +NI+  FA   Q+ CP +   GDNNL P+D TPT+FDN Y+++L++ KGL  
Sbjct  206   RSRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDFTPTSFDNNYYKNLVQNKGLLQ  265

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS+V+ Y   P  F  DFA AM+KM ++ PLTG+ GQIRKNC  VN
Sbjct  266   SDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMVN  322



>ref|XP_009622973.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=320

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+++Y KSCP A+  IK  V +A+  E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSSDYYEKSCPKAIYTIKDAVTNAVAKEHRMGASLLRLHFHDCFVNGCDGSVLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+K N+NS+RG ++ID IK+++E  CPG+VSCADI+A+AARDS  +LGGPSW V
Sbjct  86    DFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVAILGGPSWTV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A++++P+P ++L  LI++F+  GF+A+E+VAL+G HTIG+A+CTTF
Sbjct  146   QLGRRDSTTASLSSANSDIPSPLMDLTDLITNFANKGFTAKEMVALAGAHTIGQAQCTTF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T ID   A++L++ CP +GGD++L+ +D  TP  FDN YF +L K KG+ HSD
Sbjct  206   RERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFNNLKKNKGILHSD  265

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY   P  FA DFA A++KM NL PLTGT GQIR NC K+N
Sbjct  266   QQLFSGGSTDSQVTTYGTRPITFAADFAKAIVKMGNLSPLTGTNGQIRTNCRKIN  320



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYS SCP   S ++S V SAI+ E R+GASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  23    AQLSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+DNIK+ +E+ CPGVVSCADI+A+AARDS  +LGGPSWNV
Sbjct  83    SFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGPSWNV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+NN+P PT NLNQLIS F+  G S R+LVALSG HTIG++RC  F
Sbjct  143   KLGRRDARTASQAAANNNIPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQF  202

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TN+D  FA   ++ CP++   GDNNL P+D  TPT FDN YF++L+++KGL H
Sbjct  203   RPRIYNETNLDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNLIQKKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV TY+ +   F+ DF  A++KM ++ PLTG+ G+IRKNC K N
Sbjct  263   SDQQLFNGGSTDSIVRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGEIRKNCRKPN  319



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S V SA+ ++ R GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  10    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  69

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK  +E+ CPGVVSCADI+A+AARDS V+LGGP+WNV
Sbjct  70    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  129

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA+NN+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  130   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  189

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R R+YN+TNI+  FA+  Q  CP++   GD NL P+D  +  TFDN YF++L+ Q+GL H
Sbjct  190   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  249

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  250   SDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  306



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 232/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FY  SCP ALS I+S V +A+  E RMGASLLRLHFHDCFV GCDGS+LLDDT 
Sbjct  25    AQLSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  NNNSIRG +VID IK+++E+ C   VSCADI+AVAARDS V LGGPSW V
Sbjct  85    TFTGEKTAGPNNNSIRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAP-TLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDSTTAS S A++++P+P T +L+ LIS+FSK G +  ++VALSG HTIG+ARCT+
Sbjct  145   QLGRRDSTTASLSLANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARCTS  204

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHS  514
             FR RIYN+TNID  FA++LQ+ CP SGGD+NL P+D  TPT FDN Y+R+LL +KGL HS
Sbjct  205   FRNRIYNETNIDSSFATSLQSNCPVSGGDSNLAPLDVSTPTIFDNFYYRNLLNKKGLLHS  264

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGSTDS V +Y+ N   F  DFA AM+ M N+ PLTGT G+IR +C K N
Sbjct  265   DQQLFNGGSTDSQVSSYSTNSAKFFSDFASAMVNMGNISPLTGTSGEIRISCRKTN  320



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   394 bits (1011),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 230/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S + SA+  E R GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSSSCPNLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS RG +VIDNIK  +E  CPGVVSCADI+AVAARD  V+LGGP+WNV
Sbjct  88    NFTGEKNANPNRNSARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+S A++N+PAPT +L+QLISSF   G S R++VALSGGHTIG+ARCT+F
Sbjct  148   KLGRRDARTASQSGANSNIPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCTSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TNI+  FA+  Q  CP++   GD NL P+D  TP  F+N YF++L+ Q+GL H
Sbjct  208   RTRIYNETNINSAFATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV TY+ NP  F  DF  AM+KM ++ PLTG  G+IR+NC ++N
Sbjct  268   SDQELFNGGSTDSIVRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGEIRRNCRRLN  324



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   394 bits (1011),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S V SA+ ++ R GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK  +E+ CPGVVSCADI+A+AARDS V+LGGP+WNV
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA+NN+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  149   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFH  517
             R R+YN+TNI+  FA+  Q  CP++   GD NL P+D  +  TFDN YF++L+ Q+GL H
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  268

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  269   SDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 229/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCPN LS +KS V SA+  E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  26    AQLSTNFYSKSCPNVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+T+  NN S+RG NVID IK+K+ES CPGVVSCADIVA+AARDS V+LGGPSW V
Sbjct  86    SFQGEKTAGPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEV  145

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRD+ TAS S A++  LP PT  L+ L S F   G S R++VALSG HTIG+ARC +
Sbjct  146   KLGRRDARTASFSLANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQARCIS  205

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FR+RIYND+NID  F+   Q  CP +   GD NL P+D  +PT FDN YF++LL  KGL 
Sbjct  206   FRSRIYNDSNIDSSFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLSNKGLL  265

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGSTDS+V+TY+ NP  F  DFA AM+KM ++ PLTG++G+IRK C KVN
Sbjct  266   HSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKVN  323



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QL++N Y  +CP ALSII++ VI A+  + RMGASLLRLHFHDCFVNGCD S+LLD+T 
Sbjct  7     SQLTSNCYESTCPQALSIIRTVVIGAVAKDHRMGASLLRLHFHDCFVNGCDASVLLDNTS  66

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+++ AN NS+RG  VID+IK K+E+ CPGVVSCADI+A+AARDS V LGGPSWNV
Sbjct  67    TFTGEKSAGANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVALGGPSWNV  126

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTASK +A  ++P+P ++L+ LISSFSK GF+ +E+VALSG HT G+ARC  F
Sbjct  127   GLGRRDSTTASKDSATTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQARCQLF  186

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R R+YN+++I+  FA++L++ CP +GGD+NL+P+D T +  FD  YF++L+ +KGL HSD
Sbjct  187   RGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTSVLFDTAYFKNLINKKGLLHSD  246

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y+ +P  F  DFA AM+KM NL PLTG  GQIR NC KVN
Sbjct  247   QQLFSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCRKVN  301



>ref|XP_010035985.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 231/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLS-ANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDT  1051
             AQLS  N+Y K CP AL  I S V SA+  E+RMGASLLRLHFHDCFVNGCDGSILLDDT
Sbjct  25    AQLSNQNYYEKGCPKALQTIGSAVKSAVANESRMGASLLRLHFHDCFVNGCDGSILLDDT  84

Query  1050  PTFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWN  871
               FTGE+T+  N NS+RG +V+D IK+++E  CPGVVSCADI+A+ ARDS V LGG SW 
Sbjct  85    ANFTGEKTAFPNLNSLRGFDVVDTIKSEVEKLCPGVVSCADILAIVARDSVVELGGQSWQ  144

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V LGRRDSTTAS + A+ +LPAPTLNL+ LI+SFS  GF+A E+V LSG HTIG++RC T
Sbjct  145   VQLGRRDSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTLSGSHTIGQSRCVT  204

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHS  514
             FRAR+YN++NID  FA+ L+A CP SGGDNNL+P+D T PT+FDN YF +L+ QKGL HS
Sbjct  205   FRARLYNESNIDSSFATTLKANCPSSGGDNNLSPLDVTSPTSFDNAYFTNLVCQKGLLHS  264

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L++GGST++ V  Y+ N   F  DFA AM+KM  L PLTG+ GQIR NC +VN
Sbjct  265   DQQLFSGGSTNAQVTAYSKNFGSFQNDFAKAMVKMGGLSPLTGSTGQIRTNCRRVN  320



>ref|XP_010683552.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS SCPN LS I+S V SAI  E+RMGASLLRLHFHDCFVNGCDGSILLDD  
Sbjct  31    AQLSSTFYSSSCPNVLSTIQSAVQSAIDTESRMGASLLRLHFHDCFVNGCDGSILLDDNA  90

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  N NS+RG +VID IK+++E+ CPGVVSCADI+AVAARDS V LGG SW V
Sbjct  91    TFTGEKTALPNVNSVRGYDVIDTIKSQVENVCPGVVSCADILAVAARDSVVALGGQSWTV  150

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A++N+PAPTL+L+QL+ SF+  GF+ +ELV LSG HTIG+ARCTTF
Sbjct  151   QLGRRDSTTASLSTANSNIPAPTLDLSQLLDSFNNQGFTPQELVVLSGAHTIGQARCTTF  210

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R+RIYN+TNI+  FA++LQA CP +GGDNNL+P+D T PTTFDN YF  L   +GL HSD
Sbjct  211   RSRIYNETNINSTFATSLQANCPSNGGDNNLSPLDQTSPTTFDNAYFTHLTSLQGLLHSD  270

Query  510   QALY--NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+  NGGSTDS V +Y+ +   F  DFADAM+KM NL  +TGT G++R NC   N
Sbjct  271   QQLFSGNGGSTDSHVTSYSSSSSTFLSDFADAMVKMGNLNVVTGTNGEVRTNCRVTN  327



>ref|XP_008229747.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=319

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 232/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+++Y+ +CP ALS++KS VI+A+  E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  24    AQLSSDYYATTCPRALSVVKSAVINAVVKEHRMGASLLRLHFHDCFVNGCDASILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N  S+RG  VID IK++LES CPGVVSCADI+A+AARDS +  GGPSW V
Sbjct  84    NFTGEKTALPNVGSLRGFEVIDTIKSQLESICPGVVSCADILAIAARDSVLSFGGPSWTV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+  LP+P+L+L  LISSFS  GFSA ELVALSG HT+G+ARC  F
Sbjct  144   QLGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAEELVALSGSHTMGQARCRMF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGG-DNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHS  514
             R RIYN+TNI+  FA+ L++ C QS G D+NL+P+D T P  FDN YF++L+  KGL HS
Sbjct  204   RNRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNTYFKNLVDSKGLLHS  263

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L++GGSTDS+V TY+ +   F  DFA+AM+KM NL PLTGT GQIR NC K N
Sbjct  264   DQQLFSGGSTDSLVTTYSTSSGTFYTDFANAMVKMGNLSPLTGTSGQIRTNCRKTN  319



>ref|XP_003601028.1| Peroxidase [Medicago truncatula]
 gb|AES71279.1| peroxidase family protein [Medicago truncatula]
Length=318

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 228/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS +FY  SCP  LSI+  GVI+AI+ ETR+GASLLRLHFHDCFVNGCD SILLDDT +
Sbjct  25    KLSKDFYCSSCPELLSIVNQGVINAIKKETRIGASLLRLHFHDCFVNGCDASILLDDTSS  84

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+ ANNNS RG NVID+IKA +E  CPGVVSCADI+ +AARDS V LGGPSWNV 
Sbjct  85    FIGEKTAAANNNSARGFNVIDDIKANVEKACPGVVSCADILTLAARDSVVHLGGPSWNVG  144

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS+S A+N++PAP LNL+ L ++F+  G SA++LVALSG HTIG ARC  FR
Sbjct  145   LGRRDSITASRSDANNSIPAPFLNLSALKTNFANQGLSAKDLVALSGAHTIGLARCVQFR  204

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             A IYND+N+D LF  +LQ  CP+SG DN L P+D  TPT FDN YF++LL +K L HSDQ
Sbjct  205   AHIYNDSNVDSLFRKSLQNKCPRSGNDNVLEPLDHQTPTHFDNLYFKNLLAKKALLHSDQ  264

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG STD++V  Y  +   F K FA  M+KMS++ PLTG+ GQIR NC K+N
Sbjct  265   ELFNGSSTDNLVRKYATDNAKFFKAFAKGMVKMSSIKPLTGSNGQIRTNCRKIN  318



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
              QL+ NFY+ SCP  +  ++S + SA++ E R+GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  23    GQLTTNFYASSCPKLIPTVRSVMQSAVKREARIGASILRLFFHDCFVNGCDGSILLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS+RG +VIDNIK   E  CPG+VSCADI+A+AARD  V+LGGPSW V
Sbjct  83    SFTGEKNAGPNRNSVRGFDVIDNIKTAAEKACPGIVSCADILAIAARDGVVLLGGPSWEV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS+SAA+ ++PAPT NL++L+SSFS  G SAR++VALSGGHTIG+ARCTTF
Sbjct  143   KLGRRDSRTASQSAANRDIPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQARCTTF  202

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+ NI+  FA+  Q  CP++   GD NL P+D  TPT FDN YF++L+ QKGL H
Sbjct  203   RARIYNEKNINSAFAATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFKNLMVQKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV TY   P  F+ DF  AM++M ++ PLTG +G+IR+NC +VN
Sbjct  263   SDQELFNGGSTDSIVRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGEIRRNCRRVN  319



>gb|AFK46186.1| unknown [Lotus japonicus]
Length=316

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 230/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FY+K+CP  L+ IK+ V  A+  E RMGASLLRLHFHDCFV GCD SILLDDT 
Sbjct  22    AQLSSTFYAKTCPLVLATIKTQVNLAVAKEARMGASLLRLHFHDCFVQGCDASILLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS+RG +VID IK+K+ES CPGVVSCADIVAVAARDS V LGG SW V
Sbjct  82    SFTGEKTAGPNANSVRGYDVIDTIKSKVESLCPGVVSCADIVAVAARDSVVALGGFSWAV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A++ LP P+ NL+ L ++FS  GF+ RE+VALSG HTIG+ARC  F
Sbjct  142   PLGRRDSTTASLSSANSELPGPSSNLDGLNTAFSNKGFTTREMVALSGSHTIGQARCLFF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA  LQ  CP +GGD+NL+P+D T PTTFD+ Y+R+L  +KGLFHSD
Sbjct  202   RTRIYNETNIDSTFAKNLQGNCPFNGGDSNLSPLDTTSPTTFDDGYYRNLQSKKGLFHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q  +NGGSTDS V +Y  NP  F  DFA+AM+KM NL PLTG+ GQIR NC K N
Sbjct  262   QVPFNGGSTDSQVNSYVTNPASFKTDFANAMVKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYSKSCP+  S +K  V SAI  E R+GAS+LRL FHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSTDFYSKSCPHLFSTVKPVVQSAINKEARIGASILRLFFHDCFVNGCDGSLLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCAD++A+AARDSTV+LGGP WNV
Sbjct  86    SFTGEKNAAPNRNSARGFEVIDNIKSAVEKACPGVVSCADVLAIAARDSTVILGGPQWNV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLIS F+  G S R++VALSG HTIG+ARCT F
Sbjct  146   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNF  205

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+T ID   A   ++ CP++   GDNNL P+D  TPT F+N Y+++L+ ++GL H
Sbjct  206   RARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLVNRRGLLH  265

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV TY++N   F  DF   M+KM ++ PLTG+RG+IRKNC ++N
Sbjct  266   SDQQLFNGGSTDSIVRTYSYNENTFRSDFVAGMIKMGDIRPLTGSRGEIRKNCRRIN  322



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 233/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S V SA+ ++ R GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK  +E+ CPGVVSCADI+A+AARDS V+LGGP+WNV
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA+NN+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  149   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFH  517
             R R+YN+TNI+  FA+  Q  CP++   GD NL P+D  +  TFDN YF++L+ Q+GL H
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  268

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGG TDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  269   SDQELFNGGXTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 235/296 (79%), Gaps = 3/296 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QL+ NFYS SCPN LS +KSGV SA+ ++ RMGAS+LRL FHDCFVNGCDGSILLDDT +
Sbjct  1     QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSS  60

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGEQ +  N NS RG  VI++IK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV 
Sbjct  61    FTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVK  120

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             +GRRD+ TAS++AA++N+PAP+++L+QLISSFS  G S R++VALSG HTIG++RC  FR
Sbjct  121   VGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFR  180

Query  684   ARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHS  514
             AR+YN+TNI+  FA+  Q  CP++   GD NL P+D  + T+FDN YF++L+ Q+GL HS
Sbjct  181   ARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHS  240

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGSTDSIV  Y+ +P  F  DFA AM+KM ++ PLTG+ G+IRK CGK N
Sbjct  241   DQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  296



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 231/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS SCPN LS +KS V SA+ +E RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  26    AQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLXFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++  N NS RG +VIDNIK  +E+ CPGVVSCADI+A+AARDS V LGGPSWNV
Sbjct  86    SFTGEKSANPNRNSARGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLGGPSWNV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+S A+N++P P  +L+QL S FS  G S  +LVALSGGHTIG+ARCTTF
Sbjct  146   KLGRRDSTTASQSQANNDIPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTIGQARCTTF  205

Query  687   RARIY-NDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             R+RIY N +NI+ LFA   Q+ CP +   GDNNL P+D  TP +FDN YF++L++ KGL 
Sbjct  206   RSRIYSNSSNIESLFARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFKNLVQNKGLL  265

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              SDQ L+NGGSTDS+V  Y   P  F  DFA AM+KM ++ PLTG+ GQIRKNC +VN
Sbjct  266   QSDQVLFNGGSTDSVVRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRRVN  323



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score =   392 bits (1006),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 229/295 (78%), Gaps = 3/295 (1%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             L  NFY  SCP     +K  V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT +F
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+ +  N NS RG  VID IK+ +E  CPGVVSCADI+A+AARDS  +L GP+W+V L
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDS TAS+SAA+N +P PT NLNQLIS F+  G S ++LVALSGGHTIG+ARCTTFRA
Sbjct  152   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  211

Query  681   RIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RIYN++NID  FA   Q+ CP++   GDNNL P+D  TPT FDN YF++L+++KGL HSD
Sbjct  212   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGLIHSD  271

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS+V TY+ NP  F  DF+ AM++M ++ PLTG+RG+IR+NC +VN
Sbjct  272   QELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +++ V SA+++E RMG S+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+P PT +L+QLISSFS  G S R++VALSG HTIG+ARCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCTSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ QKGL H
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +P  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQELFNGGSTDSIVRGYSNSPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 229/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYS SCPN LS +KS V SA+  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  27    AQLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  86

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N  S+RG +V+D IK  +E  CPGVVSCADI+A++ARDS V+LGGP+WNV
Sbjct  87    SFTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGPTWNV  146

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS+SAA+ N+PAPT +L+ LI SFS  G S  ++VALSG HTIG+ARCTTF
Sbjct  147   KLGRRDATTASQSAANTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTF  206

Query  687   RARIYNDTNIDPLFASALQAICP--QSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN++NID  FA   QA CP   + G NNL P+D  TP TFDN Y+ +L+ QKGL H
Sbjct  207   RTRIYNESNIDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGLLH  266

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L++GGST+++V+TY+ NP  F  DF  AM+ M ++ PLTG+ GQIRKNC K N
Sbjct  267   SDQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRKNCRKTN  323



>ref|XP_010066359.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   391 bits (1004),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 228/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS SCP+ALS IKS V SA++ E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  25    AQLSSTFYSTSCPSALSTIKSSVSSAVKNEARMGASLLRLHFHDCFVNGCDASILLDDTT  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG  VID IK++LES CP +VSCADI+AV ARDS V LGGPSW V
Sbjct  85    NFTGEKNAGPNANSMRGFEVIDTIKSELESKCPSIVSCADILAVVARDSIVALGGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+SAA+ ++P PTLNL+ LIS+FS  GF+A+E+VAL G HTIG+ARC TF
Sbjct  145   NLGRRDSTTASQSAANISIPPPTLNLSGLISTFSNKGFTAKEMVALLGSHTIGQARCLTF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R  +YN+ NID  FA++L+A CP SGGD+ L P D T PT+FDN +F++L   K   HSD
Sbjct  205   REHLYNENNIDATFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTHKVFLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD  V  Y+ N   F  DFA+AM+KM NL PL G+ GQIRKNC KVN
Sbjct  265   QQLFSGGSTDVHVNAYSSNLSTFRTDFANAMVKMGNLSPLIGSSGQIRKNCRKVN  319



>dbj|BAM05634.1| peroxidase 2 [Eucalyptus pilularis]
 dbj|BAM05636.1| peroxidase 2 [Eucalyptus pyrocarpa]
Length=333

 Score =   391 bits (1005),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 227/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS + Y  +CP ALSI+++GV  AI+ ETR+GASLLRLHFHDCFVNGCD SILLDDTP+
Sbjct  40    KLSPSHYQSTCPKALSIVQAGVAKAIKNETRIGASLLRLHFHDCFVNGCDASILLDDTPS  99

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNS+RG  VID IKA LE  C GVVSCADIVA+AARDS V LGGPSW V 
Sbjct  100   FEGEKTAAPNNNSVRGFEVIDRIKASLEKECHGVVSCADIVALAARDSVVYLGGPSWTVS  159

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS+S A+ ++P PT NL+ LI+SF+  G S + +VALSG HTIG ARCT FR
Sbjct  160   LGRRDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTIFR  219

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RIYND+NID  FA+ LQ ICP+ G D+ L  +D  TPT FDN Y+R+LL++KGL HSDQ
Sbjct  220   GRIYNDSNIDASFANKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYRNLLQKKGLLHSDQ  279

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG S DS+V+ Y  +   F +DFA AM+KMS + PLTG+ GQIRKNC KVN
Sbjct  280   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSKIKPLTGSSGQIRKNCRKVN  333



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 227/297 (76%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A L  NFYS SCP  L  +K  V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  24    ATLYTNFYSSSCPKLLDTVKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ ++ N NS RG +VID IK+ +E  CPGVVSCADI+A+AARDS  +LGGPSWNV
Sbjct  84    SFTGEKNARPNKNSARGFDVIDKIKSAVEEVCPGVVSCADILAIAARDSVHILGGPSWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS+SAA+N +P PT N+NQLIS F+  G S ++LVALSG HTIG+ARCTTF
Sbjct  144   KLGRRDSRTASQSAANNGIPPPTSNVNQLISRFNSLGLSPKDLVALSGAHTIGQARCTTF  203

Query  687   RARIYNDTNIDPLFASALQAICP--QSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNID  FA   Q+ CP     GDNNL P+D  TPT FDN YF++L+++KGL H
Sbjct  204   RARIYNETNIDSSFAHIRQSTCPPNSGSGDNNLAPLDLATPTFFDNHYFKNLIQKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NG STDS+V TY  NP  F  DF+ AM+KM ++ PLTG+ G+IR  C +VN
Sbjct  264   SDQQLFNGASTDSLVRTYNTNPGSFFADFSAAMIKMGDISPLTGSLGEIRNKCRRVN  320



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 225/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QL  +FY KSCPN LSI+ S V+ A+  E RMGASLLRLHFHDCFVNGCDGSILLDDT T
Sbjct  34    QLCPDFYDKSCPNVLSIVNSVVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTST  93

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  NNNS+RG +VID IK ++E+ C GVVSCADIVA+AARDS V LGGP+W V+
Sbjct  94    FTGEKTANPNNNSVRGFDVIDTIKTQVEATCSGVVSCADIVAIAARDSVVQLGGPTWTVM  153

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDST+ASKSAA+NN+P PT NL+ LIS F   G +  ++VALSG HTIG+ARCT FR
Sbjct  154   LGRRDSTSASKSAANNNIPPPTSNLSALISFFQAQGLTTEDMVALSGSHTIGQARCTNFR  213

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSDQ  508
              RIYN++NI  LFA   +A CP +GGDNNL P+D  TPT FDN Y+ +L  Q GL HSDQ
Sbjct  214   NRIYNESNIALLFAGLRKANCPVTGGDNNLAPLDLFTPTAFDNSYYNNLQFQNGLLHSDQ  273

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+ GGSTD+ V  Y  +P  F  DFA AM+KM N+ PLT   G+IRKNC K+N
Sbjct  274   QLFKGGSTDNRVSFYAVHPDAFFNDFAAAMVKMGNIKPLTVNNGEIRKNCRKIN  327



>ref|XP_011021038.1| PREDICTED: peroxidase 4-like [Populus euphratica]
Length=325

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 230/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LS NFYSKSCP    ++KS V SA+  E RMGASL+RL FHDCFV GCDGSILL+DT 
Sbjct  28    AKLSTNFYSKSCPKVFGVVKSVVQSAVSKERRMGASLVRLFFHDCFVKGCDGSILLEDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT++ NNNS+RG NV+  IK+++E  CPGVVSCADIVA+AARDSTV+LGGP WNV
Sbjct  88    SFTGEQTARPNNNSVRGFNVVAKIKSRVEKVCPGVVSCADIVAIAARDSTVILGGPFWNV  147

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  +P PT  L+ LI+ F   G S +++VALSG HTIG+ARCT+
Sbjct  148   KLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFKSKGLSVKDMVALSGSHTIGQARCTS  207

Query  690   FRARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRARIYN+TNID  FA+  Q  CP  G  GDN L P+D  TPT FDN Y+++L+ QKGL 
Sbjct  208   FRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTAFDNKYYKNLISQKGLL  267

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGSTDS+V TY+ NP  F  DF  AM+KM ++ PLTG++G+IRK C K N
Sbjct  268   HSDQVLFNGGSTDSLVRTYSRNPKTFRSDFVTAMIKMGDIDPLTGSQGEIRKICSKRN  325



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   390 bits (1003),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 226/297 (76%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS N+Y+ SCP   S +K  V SAI  E RMGASLLRL FHDCFV GCDGSILLDDT 
Sbjct  23    AQLSTNYYASSCPKVFSAVKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSILLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+T+  NNNS+RG +V+D+IKA +E  CPGVVSCADI+A+ ARDS V+LGGP+WNV
Sbjct  83    SFQGEKTATPNNNSVRGFDVVDSIKAAVEKVCPGVVSCADILAITARDSVVILGGPNWNV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+NN+P P  +L+ LIS FS  G S +++VALSGGHTIG+ARCT F
Sbjct  143   KLGRRDSTTASFSGANNNIPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQARCTNF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA +YNDT+ID  FA   Q  CP +   GDNNL P+D  TPT FDN Y+++L+ +KGL H
Sbjct  203   RAHVYNDTDIDSSFAKTRQMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYKNLINKKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS V TY+ NP  F  DF   M+ M ++ PLTGTRG+IRKNC +VN
Sbjct  263   SDQELFNGGSTDSQVTTYSNNPSTFNSDFVTGMINMGDINPLTGTRGEIRKNCRRVN  319



>ref|XP_003551179.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
 gb|KHN48392.1| Cationic peroxidase 1 [Glycine soja]
Length=320

 Score =   390 bits (1003),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LS++FY+ +CPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  26    AELSSDFYASTCPNALSTIKSAVKSAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++ AN NS+RG +VID+IK++LES CPG+VSCADIVAVAARDS V LGGPSW +
Sbjct  86    SFTGEKSAAANLNSLRGFDVIDDIKSQLESACPGIVSCADIVAVAARDSVVALGGPSWTI  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTASK AA +++P+P ++LN LIS+FS  GF+++E+V LSG HT G+A+C  F
Sbjct  146   GLGRRDSTTASKDAATSDIPSPLMDLNDLISAFSNKGFTSQEMVVLSGAHTTGQAKCQFF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA++ ++ CP + GD+NL+P+D T    FDN YF++L+ +KGL HSD
Sbjct  206   RGRIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSD  265

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY+ +   F  DFA AM+KM NL PLTG+ GQIR NC  VN
Sbjct  266   QQLFSGGSTDSQVTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRNVN  320



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 226/296 (76%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCPN LS +KS V SA+  E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  26    AQLSTNFYSKSCPNGLSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+T++ NN S+RG NVID IK+K+ES CPGVVSCADIVA+AARDS V+LGGPSW V
Sbjct  86    SFQGEKTARPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEV  145

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRD+ TAS S A++  LP PT  L+ LIS F   G S R++VALSG HTIG+ARCT+
Sbjct  146   KLGRRDARTASFSLANSGALPPPTSTLSNLISLFQAQGLSTRDMVALSGSHTIGQARCTS  205

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHS  514
             FR  IYND+NID  F    Q  CP   GDNN  P+D  +PT FDN YF++LL  KGL  S
Sbjct  206   FRPHIYNDSNIDSAFRKTRQGQCPFGSGDNNPAPLDLRSPTAFDNAYFKNLLSNKGLLRS  265

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGSTDS+V+TY+ NP  F  DFA AM+KM ++ PL G++G+IRK C KVN
Sbjct  266   DQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLKGSQGEIRKICSKVN  321



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 231/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYSKSCP+ LS +K  V SAI  E RMGAS+LRL FHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSIDFYSKSCPHLLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+A+AARDSTV+LGGP W+V
Sbjct  86    SFTGEKNAAPNKNSARGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGPEWDV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLIS F+  G S R++VALSG HTIG+ARCT F
Sbjct  146   KLGRRDARTASQAAANNSIPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNF  205

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+T ID   A   ++ CP++   GDNNL P+D  TPT F+N Y+++L+ ++GL H
Sbjct  206   RARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLINRRGLLH  265

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV TY+ N   F  DF   M+KM ++ PLTG+RG+IR NC ++N
Sbjct  266   SDQQLFNGGSTDSIVSTYSSNENTFRSDFVAGMIKMGDIRPLTGSRGEIRNNCRRIN  322



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 236/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFY+ SCPN LS +++ V SA+ +E RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  28    AQLTTNFYATSCPNLLSTVQAAVKSAVNSERRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS VVLGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+P PT +L+QLISSFS  G S R++VALSG HTIG++RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNI+  FA+  Q  CP++   GD NL P+D  T  +FDN YF++L+ Q+GL H
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQRGLLH  267

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  268   SDQVLFNGGSTDSIVRGYSSNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_004294750.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+++Y+  CP ALS +++ VI+A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  24    AQLSSDYYATRCPRALSTVRTAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTA  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG +V+D IK++LES CPGVVSCADI+A+AARDS V LGGPSW V
Sbjct  84    NFTGEKTALPNLNSLRGFDVVDTIKSQLESICPGVVSCADILAIAARDSVVSLGGPSWIV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA++ LP+P+L++N LIS+FS  GFSA+ELVALSG HT+G+A+C  F
Sbjct  144   QLGRRDSTTASLSAANSELPSPSLDVNDLISAFSNKGFSAKELVALSGSHTMGQAKCVLF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+T+I+  F+++L++ CP SG D+NL+P+D T P  FDN Y+++L+  KGL HSD
Sbjct  204   RDRIYNETSINSAFSTSLKSNCPNSGSDDNLSPLDVTSPVFFDNAYYKNLVNSKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY+     F  DFA+AM+KM NL  LTG+ GQIR NC K+N
Sbjct  264   QQLFSGGSTDSQVTTYSTTASAFFADFANAMVKMGNLNLLTGSNGQIRTNCRKIN  318



>ref|XP_010256951.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=318

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS+N YS +CP ALSI+ + VI+AI+ ETR+GASLLRLHFHDCFVNGCDGSILLDDT +
Sbjct  24    KLSSNHYSSTCPEALSIVNNAVIAAIKKETRIGASLLRLHFHDCFVNGCDGSILLDDTAS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  NNNS+RG +V+D+IK++LE  CPGVVSCADI+A+AARDS V LGGPSW V 
Sbjct  84    FTGEKTAVPNNNSVRGFDVVDDIKSRLEKKCPGVVSCADILALAARDSVVYLGGPSWTVE  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TA+ +AA++++PAPT NL+ L + F+  G S +++VALSG HTIG ARCTTFR
Sbjct  144   LGRRDSITANLTAANSDIPAPTSNLSVLETRFAAKGLSVKDMVALSGSHTIGLARCTTFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+NID   A +LQ  CP+SG DN L  +D  TPT FDN Y+++LLK KGL H+DQ
Sbjct  204   SRIYNDSNIDGTLAMSLQRKCPRSGNDNKLAGLDAQTPTYFDNYYYKNLLKGKGLLHTDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  STDS+V+ Y  NP  F KDFA AM+KM N+ PLTG+ G+IR NC ++N
Sbjct  264   ELFNGSSSTDSLVKKYVGNPSKFFKDFAKAMVKMGNISPLTGSEGEIRFNCRELN  318



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 231/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYSKSCP     +KS V SAI  ETRMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPGVVSCADI+AV ARDS V+LGGP+WNV
Sbjct  84    SFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS+SAA++ +P  T NLN+LISSFS  G S +++VALSG HTIG+ARCT+F
Sbjct  144   KLGRRDSRTASQSAANSGIPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  203

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T N+D  FA   Q+ CP+S   GDNNL P+D  TP  FDN YF++L+ +KGL 
Sbjct  204   RARIYNETNNLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLVDKKGLL  263

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV +Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRKNC ++N
Sbjct  264   HSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCRRLN  321



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 229/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ +C N L  +KS V SA+  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  23    AQLSTNFYANTCKNLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  VIDNIK+ +E  CPG VSCADI+A+ ARDS V+LGGPSW V
Sbjct  83    SFTGEKNAVPNRNSARGFEVIDNIKSAVEKACPGAVSCADILAITARDSVVLLGGPSWEV  142

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS+SAA++ +P PT NLNQL S F+  G S ++LVAL+GGHTIG+ARCT+F
Sbjct  143   KLGRRDSRTASQSAANSGIPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSF  202

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA IYN+TNID  FA   Q  CP++   GDNNL P+D  TPT+FDN YF++L+ +KGL H
Sbjct  203   RAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFKNLVNRKGLLH  262

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS V TY+ NP  F+ DF   M+KM ++ PLTG+RG+IRKNC ++N
Sbjct  263   SDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRIN  319



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/294 (65%), Positives = 230/294 (78%), Gaps = 4/294 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SAI  ETRMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  27    AQLSTNFYSKSCPKLFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  86

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS+RG  VIDNIK+ +E  CPGVVSCADI+A+ ARDS V+LGGP+WNV
Sbjct  87    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPNWNV  146

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+ AA++++P PT NLNQLISSFS  G S  ++VALSG HTIG+ARCT+F
Sbjct  147   KLGRRDARTASQGAANSSIPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQARCTSF  206

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T NID  FA+  Q  CP++   GDNNL P+D  TPT FDN YF++L+ ++GL 
Sbjct  207   RARIYNETNNIDSSFATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNLVSKRGLL  266

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNC  358
             HSDQ L+NGGS DSIV +Y+ NP  F+ DF  AM+KM +  PLTG+ G+IRKNC
Sbjct  267   HSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGEIRKNC  320



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 233/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS ++YS+SCP     +KS V SA+  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  25    AQLSTDYYSQSCPKLFPTVKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+ +  N NS+RG +V+D+IK+K+E+ CPGVVSCAD++A+AARDS V+LGGPSWNV
Sbjct  85    SFIGEKNAAPNANSVRGFDVVDDIKSKVETACPGVVSCADVLAIAARDSVVILGGPSWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLIS F   G S R+LVAL+G HTIG+ARCT+F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFQALGLSTRDLVALAGSHTIGQARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TNID  FA   Q+ CP++   GDNNL P+D  TPT F+N Y+++L+K+KGL H
Sbjct  205   RARIYNETNIDNSFAKTRQSNCPRASGSGDNNLAPLDLQTPTAFENNYYKNLIKKKGLLH  264

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ +   F   F   M+KM ++ PLTG+ G+IRKNC +VN
Sbjct  265   SDQQLFNGGSTDSIVRKYSNSRSNFNAHFVAGMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+  FYSKSCP     +KS V SAIQ ETRMGASLLRL FHDCFVNGCDGS+ LDDT 
Sbjct  22    AQLTTGFYSKSCPKLYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ ++ N NS RG  VID+IK+ +E  CPGVVSCADI+AV ARDS V+LGGP+W+V
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA++++P PT NLN+LISSFS  G S +++VALSG HTIG+ARCT+F
Sbjct  142   KLGRRDARTASQAAANSSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T N+D   A   Q  CP++   GDNNL P+D  TPT FDN YF +L+ +KGL 
Sbjct  202   RARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGLL  261

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV++Y+ NP IFA DF  AM+KM ++ PLTG++G+IRKNC ++N
Sbjct  262   HSDQQLFNGGSADSIVKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGEIRKNCRRIN  319



>ref|XP_010650833.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=307

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 228/293 (78%), Gaps = 1/293 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LS+ FYS  CP ALS I++ V +A+  E RMGASLLRLHFHDCFVNGCDGSILLDDT  F
Sbjct  15    LSSTFYSAKCPKALSTIRTAVNTAVANENRMGASLLRLHFHDCFVNGCDGSILLDDTANF  74

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+T+  N +S+RG  VID+IK+++ES CPGVV+CADI+AVAARDS V LGGP+W V L
Sbjct  75    TGEKTAGPNADSVRGFEVIDDIKSRVESVCPGVVTCADILAVAARDSVVALGGPTWTVQL  134

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTAS S A+ ++P+P L+L+ LIS+FS  GFSA+E+VALSG HTIG++RC  FR 
Sbjct  135   GRRDSTTASISDAETDIPSPALDLDDLISAFSDKGFSAKEMVALSGSHTIGQSRCLVFRD  194

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSDQA  505
             RIYND NID  FA +L++ CP + GD+NL+ +D T P  FDN YF++L+  KGL HSDQ 
Sbjct  195   RIYNDDNIDSSFAESLKSNCPDTDGDDNLSALDDTSPVIFDNGYFKNLVDNKGLLHSDQE  254

Query  504   LYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             L+N GSTDS V +Y  +   F KDF  AM+KM N+ PLTGT+GQIR NC K+N
Sbjct  255   LFNNGSTDSQVSSYASSATSFYKDFTAAMVKMGNISPLTGTKGQIRVNCRKIN  307



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 229/295 (78%), Gaps = 3/295 (1%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             L  NFY  SCP     +K  V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT +F
Sbjct  24    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  83

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+ +  N NS RG  VID IK+ +E  CPGVVSCADI+A+AARDS  +L GP+W+V L
Sbjct  84    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  143

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDS TAS+SAA+N +P PT NLNQLIS F+  G S ++LVALSGGHTIG+ARCTTFRA
Sbjct  144   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  203

Query  681   RIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RIYN++NID  FA   Q+ CP++   GDNNL P++  TPT FDN YF++L+++KGL HSD
Sbjct  204   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPINFATPTFFDNHYFKNLIQKKGLIHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS+V TY+ NP  F  DF+ AM++M ++ PLTG+RG+IR+NC +VN
Sbjct  264   QELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  318



>gb|AHL39176.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FY+ +CP ALS I++ V+ A+  E RMGASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  22    AQLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS+RG +VID IK++LES CPGVVSCADI+AVAARDS V L GPSW V
Sbjct  82    SFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS  AA+++LP+P ++L+ LI+SFS  GF+A+E+VALSG HTIG+ARC  F
Sbjct  142   QLGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T++D   A++L++ CP +G D++L+ +D  TP TFDN YF++L   KGL HSD
Sbjct  202   RNRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GG+TDS V+TY+ N   F  DFA AM+KM ++ PLTG+ GQIR NC KVN
Sbjct  262   QQLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_009358287.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=319

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/296 (63%), Positives = 230/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+N Y  +CP AL I+++ VI+A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  24    AQLSSNHYETTCPLALFIVRNAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTA  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  N NS+RG  VID IK++LES CPGVVSCADI+A+AARDS ++LGGPSW V
Sbjct  84    NFTGEKTALPNTNSLRGFEVIDTIKSELESACPGVVSCADILAIAARDSVLLLGGPSWTV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA+  LP+P+LNLN LIS FS  GF+ +ELVALSG HT+G+ARC  F
Sbjct  144   QLGRRDSTTASLSAANTELPSPSLNLNDLISFFSTKGFTTKELVALSGSHTMGQARCLLF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGG-DNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHS  514
             R RI+N+TNID  FA++L+  C  S G D+NL+ +D T P  FDN YF++L+  KGL HS
Sbjct  204   RERIHNETNIDSSFAASLKLNCTASSGTDDNLSSLDVTSPVIFDNAYFKNLVNSKGLLHS  263

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L++GGSTDS+V TY+     F  DFA AM+KM +L PLTGT GQ+R NC K+N
Sbjct  264   DQQLFSGGSTDSLVTTYSTTAGTFYTDFASAMVKMGSLSPLTGTTGQVRTNCRKIN  319



>ref|XP_002319968.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE95891.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39178.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 231/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA+  E RMGASL+RL FHDCFV GCDGSILL+DT 
Sbjct  28    AQLSTNFYSKSCPKVFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSILLEDTS  87

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT+  NNNS+RG NV+  IK+++E  CPG+VSCADIVA+AARDSTV+LGGP WNV
Sbjct  88    SFTGEQTAGPNNNSVRGFNVVAKIKSQVEKVCPGIVSCADIVAIAARDSTVILGGPFWNV  147

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  +P PT  L+ LI+ F+  G S +++VALSG HTIG+ARCT+
Sbjct  148   KLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFNSKGLSVKDMVALSGSHTIGQARCTS  207

Query  690   FRARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRARIYN+TNID  FA+  Q  CP  G  GDN L P+D  TPT+FDN Y+++L+ QKGL 
Sbjct  208   FRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTSFDNKYYKNLISQKGLL  267

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGSTDS+V TY+ NP  F+ DF  AM+KM ++ PLTG++G+IRK C K N
Sbjct  268   HSDQVLFNGGSTDSLVRTYSSNPKTFSSDFVTAMIKMGDIDPLTGSQGEIRKICSKRN  325



>ref|XP_007218699.1| hypothetical protein PRUPE_ppa008820mg [Prunus persica]
 gb|EMJ19898.1| hypothetical protein PRUPE_ppa008820mg [Prunus persica]
Length=318

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 231/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+  FYS  CP ALSI++  V++AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    KLTPKFYSSKCPKALSIVQEEVVAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D+IKAKLE  CPGVVSCAD++A+AARDS V LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDHIKAKLEKACPGVVSCADLLALAARDSVVYLGGPSWKVR  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LIS+F+    S R+LVALSG HTIG ARCT+FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNISSLISNFAAQNLSLRDLVALSGSHTIGLARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYN++ ID  FA++LQ  CP+SG D+NL  +D  TPT FDN Y+++LLK KGL HSDQ
Sbjct  204   SRIYNESTIDAAFANSLQGSCPRSGNDDNLANLDHQTPTHFDNLYYKNLLKVKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  S D +V+ Y  N F F + FA AM+ M N+ PLTG++G+IR NC KVN
Sbjct  264   ELFNGTSSADKLVKIYANNTFAFFEHFAKAMINMGNIEPLTGSQGEIRTNCRKVN  318



>gb|KDP22793.1| hypothetical protein JCGZ_00380 [Jatropha curcas]
Length=293

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 229/294 (78%), Gaps = 4/294 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYS +CP ALS I S V SAI  E RMGASLLRLHFHDCFVNGCDGS+LLD   
Sbjct  4     AQLSPTFYSTTCPAALSTINSAVTSAISKEARMGASLLRLHFHDCFVNGCDGSVLLDGA-  62

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
               +GE+T+ ANNNSIRG  VID+IK++LES C GVVSCADI+AVAARDS V LGGPSW V
Sbjct  63    --SGEKTAPANNNSIRGFEVIDSIKSQLESSCAGVVSCADILAVAARDSVVALGGPSWTV  120

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS SAA ++LP+P  +L+ LIS+FS  GF+ +E+VALSG HTIG+ARCT F
Sbjct  121   QLGRRDSTTASFSAASSSLPSPFSDLSVLISNFSSKGFTTKEMVALSGAHTIGQARCTVF  180

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
               RIYN+TNI+  FA++L+A CP +GG NNL P+D T  TFDN YF+DLL QKGL HSDQ
Sbjct  181   ATRIYNETNINTAFATSLKANCPSTGG-NNLAPLDSTTRTFDNAYFKDLLAQKGLLHSDQ  239

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V  Y+ NP  F  DFA AM+KM NL PLTGT GQIR NC K N
Sbjct  240   QLFNGGSTDSQVRAYSSNPTSFRSDFASAMVKMGNLSPLTGTSGQIRTNCRKAN  293



>ref|XP_007208188.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
 gb|EMJ09387.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
Length=326

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 235/297 (79%), Gaps = 4/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LSA+FY K+CPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  31    AELSASFYDKNCPNALSTIKSAVDSAVYKEARMGASLLRLHFHDCFVNGCDASLLLDDTA  90

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GE+TS AN NS+RG  VIDNIKA+LES CP +VSCADI+AVAARDS V LGGP++ V
Sbjct  91    TFKGEKTSVANANSLRGFEVIDNIKAELESLCPNMVSCADILAVAARDSIVALGGPTYTV  150

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDST A+ +A + +LP+P +N+ +LI++FSK GF+ +E+VALSG HTIG+ARC  F
Sbjct  151   ALGRRDSTAANVTATE-DLPSPFVNVTKLIAAFSKKGFTVKEMVALSGAHTIGQARCAFF  209

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R R+YNDT+I+  FA+A++A CP SG  GDNN++ +D  TPTTFD+ YF++++ QKGL H
Sbjct  210   RGRLYNDTDINASFAAAVRAKCPGSGGSGDNNMSELDVTTPTTFDSSYFKNVMSQKGLLH  269

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ LY+GG T + V+ Y  N   F +DFA+AM KM  L PLTG+ GQIR NC KVN
Sbjct  270   SDQQLYSGGFTKTAVDAYANNAASFMEDFAEAMNKMGRLSPLTGSIGQIRTNCRKVN  326



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS ++S V SA+ ++ R GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK  +E+ CPGVVSCADI+A+AARDS V+LGGP+WNV
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAPT +L+QLISSFS  G S R++VALSG HTIG++RCT F
Sbjct  149   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFH  517
             R R+YN+TNI+  FA+  Q  CP++   GD NL P+D      FDN YF++L+ Q+GL H
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFKNLVAQRGLLH  268

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF  AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  269   SDQELFNGGSTDSIVTGYSNNPASFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 234/299 (78%), Gaps = 5/299 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFYSKSCP   SI+KS V  AI+ E RMGAS+LRLHFHDCFVNGCDGS+LLDDT 
Sbjct  25    AQLSSNFYSKSCPRLFSIVKSTVQPAIRNEPRMGASILRLHFHDCFVNGCDGSVLLDDTA  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG NVIDNIK+ +E+ CPGVVSCADI+A+ ARDS  +LGGPSWNV
Sbjct  85    NFTGEKNAVPNKNSLRGFNVIDNIKSAVENVCPGVVSCADILAITARDSVAILGGPSWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLIS F+  G S +++VALSG HTIG+ARCT+F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTKDMVALSGSHTIGQARCTSF  204

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RAR+YN+T N+D   A   Q+ CP++   GDNNL P+D  +PT FDN Y+ +L+K +GL 
Sbjct  205   RARVYNETNNLDSSLAQTRQSNCPRTTGSGDNNLAPLDLQSPTAFDNNYYNNLIKNRGLL  264

Query  519   HSDQALY-NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+ NGGSTDSIV  Y+ +   F  DFA AM+KM N+ PLTG+ G+IRKNC K N
Sbjct  265   HSDQQLFLNGGSTDSIVRGYSSSQSTFTSDFAAAMIKMGNINPLTGSNGEIRKNCRKPN  323



>dbj|BAM05635.1| peroxidase 2 [Eucalyptus pilularis]
Length=333

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS + Y  +CP ALSI+++GV  AI+ ETR+GASLLRLHFHDCFVNGCD SILLDDTP+
Sbjct  40    KLSPSHYQSTCPKALSIVQAGVAKAIKNETRIGASLLRLHFHDCFVNGCDASILLDDTPS  99

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNS+RG  VID IKA LE  C GVVSCADIVA+AARDS V LGGPSW V 
Sbjct  100   FEGEKTAAPNNNSVRGFEVIDRIKASLEKECHGVVSCADIVALAARDSVVYLGGPSWTVS  159

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS+S A+ ++P PT NL+ LI+SF+  G S + +VALSG HTIG ARCT FR
Sbjct  160   LGRRDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTIFR  219

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RIYND+NID  FA+ LQ ICP+ G D+ L  +D   PT FDN Y+R+LL++KGL HSDQ
Sbjct  220   ERIYNDSNIDASFANKLQKICPKIGNDSVLQRLDIQMPTFFDNLYYRNLLQKKGLLHSDQ  279

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG S DS+V+ Y  +   F +DFA AM+KMS + PLTG+ GQIRKNC KVN
Sbjct  280   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSKIKPLTGSSGQIRKNCRKVN  333



>gb|ACI03401.1| peroxidase 1 [Litchi chinensis]
Length=318

 Score =   389 bits (998),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QL  NFY  +CP ALSI+  GV++AI+ ETR+GASLLRLHFHDCFVNGCDGS+LLDDT T
Sbjct  24    QLCPNFYESTCPQALSIVHKGVVAAIKNETRIGASLLRLHFHDCFVNGCDGSLLLDDTST  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NN S+RG NV+D IKAKLE  CPGVVSCAD++A+AARDS V LGGPSW V 
Sbjct  84    FVGEKTAVPNNISVRGFNVVDQIKAKLEKACPGVVSCADLLAIAARDSVVHLGGPSWKVR  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS++ A+ ++P PT NL+ LISSFS  G S ++LVALSG HTIG ARCT+FR
Sbjct  144   LGRRDSTTASRALANTSIPPPTSNLSALISSFSAQGLSLKDLVALSGSHTIGLARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
               +YNDTNID  FA +L+  CP+SG DN L  +D  TP  FD  Y+ +LLK+KGL HSDQ
Sbjct  204   GHVYNDTNIDSSFAQSLRRKCPRSGNDNVLANLDRQTPFCFDKLYYDNLLKKKGLLHSDQ  263

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+ GGS D  V+ Y  N   F KDFA AM+KM N+ PLTG  GQIR NC KVN
Sbjct  264   QLFKGGSADPFVKKYANNTSAFFKDFAGAMVKMGNIKPLTGRAGQIRINCRKVN  317



>gb|ACU23245.1| unknown [Glycine max]
Length=326

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 228/295 (77%), Gaps = 3/295 (1%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             L  NFY  SCP     +K  V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT +F
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGE+ +  N NS RG  VID IK+ +E  CPGVVSCADI+A+AARDS  +L GP+W+V L
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDS TAS+SAA+N +P PT NLNQLIS F+  G S ++LVALSGGHTIG+ARCTTFRA
Sbjct  152   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  211

Query  681   RIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RIYN++NID  FA   Q+ CP++   GDNNL P+D  TPT FDN YF++L+++KG  HSD
Sbjct  212   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGFIHSD  271

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS+V TY+ NP  F  DF+ AM++M ++ PLTG+RG+IR+NC +VN
Sbjct  272   QELFNGGSTDSLVGTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>gb|KHN46100.1| Cationic peroxidase 1 [Glycine soja]
Length=300

 Score =   388 bits (996),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 232/296 (78%), Gaps = 4/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             +QL++N Y  +CP ALSIIK+ VI A+  E RMGASLLRLHFHDCF  GCD S+LLDDT 
Sbjct  7     SQLTSNCYESTCPQALSIIKTAVIGAVAKEHRMGASLLRLHFHDCF--GCDASVLLDDTS  64

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+++ AN NS+RG  VID+IK K+E+ CPGVVSCADI+A+AARDS V LGGPSWNV
Sbjct  65    TFTGEKSAAANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVTLGGPSWNV  124

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTASK AA  ++P+P ++L+ LISSFS  GF+ +E+VALSG HT G+ARC  F
Sbjct  125   GLGRRDSTTASKDAATTDIPSPLMDLSALISSFSNKGFNTKEMVALSGAHTTGQARCQLF  184

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTP-TTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+++I+  FA++L++ CP +GGD+NL+P+D T    FDN YF++L+ +KGL HSD
Sbjct  185   RGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTNVVFDNAYFKNLINKKGLLHSD  244

Query  510   QALYN-GGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GGSTDS V  Y+ +P  F  DFA AM+KM NL PLTG  GQIR NC KVN
Sbjct  245   QQLFNSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCHKVN  300



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   388 bits (997),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 228/296 (77%), Gaps = 3/296 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS+ FY++SCP ALS++K+ V  A+  E RMGASLLRLHFHDCFVNGCDGS+LLDD+ T
Sbjct  15    QLSSTFYAQSCPTALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLDDSST  74

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
              TGE+T+  N NS RG +VID IK+ +E  C GVVSCADI+A++ARDS V LGGPSW V+
Sbjct  75    ITGEKTANPNANSARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPSWTVM  134

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTASK+ A+NN+P PT +L+ LIS F   G S +E+VALSGGHTIG+ARC  FR
Sbjct  135   LGRRDSTTASKNGANNNIPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQARCVNFR  194

Query  684   ARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHS  514
             A IYN+TNID  ++++LQ+ CP +   GD+NL+P+D  TPT FD  Y+ +L  +KGL HS
Sbjct  195   AHIYNETNIDSTYSTSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYYSNLKSKKGLLHS  254

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGSTDS V TY  N   F  DFA AM+KM N+ PLTGT GQIRKNC K N
Sbjct  255   DQELFNGGSTDSQVTTYASNQNSFFSDFAAAMVKMGNIKPLTGTSGQIRKNCRKPN  310



>ref|XP_003538325.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=320

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A LS++FY+ +CPNALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  26    ADLSSDFYASTCPNALSTIKSAVKSAVAKERRMGASLLRLHFHDCFVNGCDASVLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++ AN NS+RG +VID+IK++LES CPG+VSCADIVAVAARDS V LGGPSW +
Sbjct  86    SFTGEKSAAANLNSLRGFDVIDDIKSQLESSCPGIVSCADIVAVAARDSVVALGGPSWTI  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDST ASK AA +++P+P ++L+ LIS+FS  GF+++E+V LSG HT G+A+C  F
Sbjct  146   GLGRRDSTAASKEAATSDIPSPLMDLSDLISAFSNKGFTSKEMVVLSGAHTTGQAKCQFF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA++ ++ CP + GD+NL+P+D T    FDN YF++L+ +KGL HSD
Sbjct  206   RGRIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSD  265

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V TY+ +   F  DFA AM+KM NL PLTG+ GQIR NC KVN
Sbjct  266   QQLFSGGSTDSQVTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRKVN  320



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score =   388 bits (997),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 226/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ SCPN  +I+++ +  A+  ETR+GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  22    AQLSPNFYASSCPNLQTIVRNAMSRAVNRETRIGASILRLFFHDCFVNGCDGSILLDDTA  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ +  N NS RG  VID IK  +E+ C   VSCADI+A+AARD   +LGGP+W V
Sbjct  82    TFTGEKNAVPNRNSARGFEVIDTIKTNVEAACSATVSCADILALAARDGVALLGGPTWQV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+SAA+N +P+P  NL  L SSF+  G S R+L ALSGGHTIG ARCTTF
Sbjct  142   PLGRRDARTASQSAANNQIPSPFANLATLTSSFAAKGLSTRDLTALSGGHTIGLARCTTF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYNDTNID  FA+  +A CP SGGDNNL P+D  TPT FDN YFR+L+ ++GL HSD
Sbjct  202   RGRIYNDTNIDANFAATRRANCPASGGDNNLAPLDIQTPTRFDNDYFRNLVARRGLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGS D++V TY+ NP  F+ DFA AM+KM N+ PLTGT+G+IR+NC  VN
Sbjct  262   QELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNISPLTGTQGEIRRNCRVVN  316



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score =   389 bits (998),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYSKSCPN  + +KS V SA+Q E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  25    AQLSPDFYSKSCPNLFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSILLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+D IK+ +E  CPGVVSCAD++A+AARDS V+LGGP WNV
Sbjct  85    SFTGEKGAVPNRNSARGFDVVDQIKSAVEKACPGVVSCADVLAIAARDSVVILGGPDWNV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N +P PT NLN LIS F+  G S ++LVALSG HTIG+ARCT+F
Sbjct  145   KLGRRDAKTASRAAANNGIPPPTSNLNALISRFNALGLSTKDLVALSGSHTIGQARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++N+D   A   +  CP++   GDNNL P+D  TPT FDN YF++L+ ++GL H
Sbjct  205   RARIYNESNLDTSLAQTRKGNCPRASGVGDNNLAPLDLQTPTNFDNNYFKNLVSRRGLLH  264

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+ GG+TDSIV TY+ +P  F  DFA AMLKM ++ PLTG+ G++RKNC +VN
Sbjct  265   SDQQLFIGGATDSIVRTYSNDPNTFKSDFAAAMLKMGDIRPLTGSNGEVRKNCRRVN  321



>ref|XP_010035986.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 233/296 (79%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLS-ANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDT  1051
             AQLS  ++Y++ CP AL  I+S V SA+  ETRMGASLLRLHFHDCFVNGCD SILLDDT
Sbjct  25    AQLSNQDYYTQRCPRALETIQSAVRSAVANETRMGASLLRLHFHDCFVNGCDASILLDDT  84

Query  1050  PTFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWN  871
               FTGE+T+  N NS+RG +VID IK K+E  CPG+VSCADI+AVAARDS V+L GPSW 
Sbjct  85    VNFTGEKTAFPNVNSVRGFDVIDTIKLKVEKLCPGIVSCADILAVAARDSVVILDGPSWQ  144

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V LGRRDSTTAS + A+ +LPAPTLNL+ L++SFS  GF+A+E+V LSG HTIG+ARC T
Sbjct  145   VQLGRRDSTTASLNDANIDLPAPTLNLSGLVASFSNKGFTAKEMVTLSGSHTIGQARCVT  204

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHS  514
             FR R+YN++NI P FA +L++ CP SGG+NNL+P++ T PT FDN YF +L+ Q+GL HS
Sbjct  205   FRTRLYNESNISPSFAMSLKSNCPSSGGNNNLSPLNITSPTFFDNAYFGNLVSQEGLLHS  264

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L++GGST++ V  Y+ N   F  DFADAM+KM  L PLTG+ GQIR NC KVN
Sbjct  265   DQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN  320



>ref|XP_008233849.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=340

 Score =   389 bits (999),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 229/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+  FYS  CP ALSI++  V++AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  46    KLTPKFYSSKCPKALSIVQEEVVAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  105

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNSIRG  V+D+IKAKLE  CPGVVSCAD++A+AARDS V LGGPSW V 
Sbjct  106   FVGEKTAAPNNNSIRGFEVVDHIKAKLEKACPGVVSCADLLALAARDSVVYLGGPSWKVR  165

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LIS+F+    S R+LVALSG HTIG ARCT+FR
Sbjct  166   LGRRDSTTASRSAANTSIPPPTSNISSLISNFAAQNLSLRDLVALSGSHTIGLARCTSFR  225

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYN++ ID  FA +LQ  CP SG D+NL  +D  TPT FDN Y+++LLK KGL HSDQ
Sbjct  226   SRIYNESTIDAAFAKSLQGSCPLSGNDDNLANLDLQTPTHFDNLYYKNLLKVKGLLHSDQ  285

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  S D +V+ Y  N F F K FA AM+ M N+ PLTG++G+IR NC KVN
Sbjct  286   ELFNGTSSADKLVKIYANNTFAFFKHFAKAMINMGNIEPLTGSQGEIRTNCRKVN  340



>gb|AII99880.1| peroxidase [Cicer arietinum]
Length=306

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 232/298 (78%), Gaps = 6/298 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS++FY+ +CP+ LS IK+ +  A+  E RMGASLLRLHFHDCF  GCDGS+LLDDT 
Sbjct  11    AQLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCF--GCDGSVLLDDTS  68

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++  N NS+RG +VID IK+++ES CP VVSCADI++VAARDS V LGGPSW V
Sbjct  69    SFTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTV  128

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALS---GGHTIGKARC  697
              LGRRDSTTAS  +A+ NLP PT +L  LI++F K GF+ +E+VALS   G HTIG+A C
Sbjct  129   QLGRRDSTTASLDSANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSDVLGSHTIGQASC  188

Query  696   TTFRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
               FR+RIYN+ NIDP FA++LQA CP SGGDNNL+P+D  TP TFDN Y+ +L  Q GLF
Sbjct  189   RFFRSRIYNEDNIDPTFAASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGLF  248

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+N GSTDSIV+ Y+ +P  F  DFA+AMLKM NL PLTG+ GQIR  CG +N
Sbjct  249   HSDQELFNQGSTDSIVDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRTTCGAIN  306



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 231/299 (77%), Gaps = 5/299 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA+  E RMGASLLRLHFHDCFVNGCDGSILLDDT 
Sbjct  27    AQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLDDTS  86

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T++ NNNS+RG  V+DNIK+++E  CPGVVSCADI+A+AARDS  +LGGPSWNV
Sbjct  87    SFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGPSWNV  146

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS +AA++  +P PT  L+QL + F   G + R+LVALSG HTIG+ARCT+
Sbjct  147   KLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQARCTS  206

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRARIYN+TNID  FA A Q+ CP +   GDNNL P+D  TP TFD  YF++L+ QKGL 
Sbjct  207   FRARIYNETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKNLINQKGLL  266

Query  519   HSDQALY-NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ LY NGGSTDS+V+TY+ +   F  DFA AM+KM +  PLTG+ G+IR NC + N
Sbjct  267   HSDQILYNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEIRLNCRRPN  325



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 225/297 (76%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY+ SCP   S +K  V +AI  E RMGASLLRL FHDCFV GCDGSILLDDTP
Sbjct  24    AQLSTNFYASSCPQVFSAVKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSILLDDTP  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GE+T+  NNNS+RG +V+DNIKA +E  CPGVVSCADI+A+ +RDS V+LGGP+W+V
Sbjct  84    TFMGEKTAVPNNNSVRGFDVVDNIKAAVEKVCPGVVSCADILAITSRDSVVILGGPNWDV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+NN+P P  +L+ LIS F+  G S +++VALSGGHTIG+ARC  F
Sbjct  144   KLGRRDSTTASFSGANNNIPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQARCLNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA IYNDT+ID  FA   Q  CP +   GDNNL P+D  TPT FDN Y+++L+ +KGL H
Sbjct  204   RAHIYNDTDIDSSFAKTRQMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYKNLINKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDS V TY+ NP  F  DF   M+ M ++ PLTG+ GQIRKNC KVN
Sbjct  264   SDQELFNGGSTDSQVMTYSNNPSTFNSDFVTGMINMGDITPLTGSSGQIRKNCRKVN  320



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 230/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS N+YSK+CP     +KS V SAI  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  25    AQLSTNYYSKTCPKLFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG +V+DNIK+ +E  CPGVVSCADI+ +AARDS  +LGGP+W+V
Sbjct  85    SFTGEKNAAPNRNSARGFDVVDNIKSAVEDVCPGVVSCADILTIAARDSVAILGGPNWDV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLN+LIS F+  G S R++VALSG HTIG ARCT+F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCTSF  204

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN++NID  FA   Q  CP++   GDNNL P+D  TPT FDN YF++L+ ++GL H
Sbjct  205   RPRIYNESNIDSSFAQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFKNLINRRGLLH  264

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+ NP  F+ DF   M+KM ++ PLTG+RG+IRKNC +VN
Sbjct  265   SDQQLFNGGSTDSIVRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGEIRKNCRRVN  321



>ref|XP_008244444.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 227/296 (77%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA++ E R+GASLLRLHFHDCFV GCDGS+LLDDT 
Sbjct  27    AQLSTNFYSKSCPKVFHAVKSVVRSAVKKEKRIGASLLRLHFHDCFVKGCDGSVLLDDTS  86

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  NNNS+RG  V+D IK+K+E  CPGVVSCADI+A+AARDS  +LGGPSW V
Sbjct  87    SFTGEKTAAPNNNSLRGFKVVDKIKSKVEKRCPGVVSCADILAIAARDSVKILGGPSWKV  146

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS +AA+ +LPAPT  L+QL + F   G + R+LVALSG HTIGKA+CT+F
Sbjct  147   KLGRRDSKTASLAAANRSLPAPTSTLSQLKTGFRAVGLNERDLVALSGAHTIGKAKCTSF  206

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA A Q  CP++ GDNNL P+D  TP TFD  YF++L+ QKGL HSD
Sbjct  207   RVRIYNETNIDASFAKARQRKCPRTAGDNNLAPLDVQTPHTFDTAYFKNLINQKGLLHSD  266

Query  510   QALY-NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LY NGGST+S+V+ Y+ +   F  DFA AM+KM +  PLTG+ G+IR NC + N
Sbjct  267   QILYNNGGSTNSLVKKYSGSAHTFNSDFAKAMIKMGDNKPLTGSNGEIRLNCRRPN  322



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 229/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  30    AQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  NNNS+RG  V+D IK+++E  CPGVVSCADI+A+A+RDS  +LGGPSW V
Sbjct  90    SFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  149

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  +P PT  LN+L++ F   G S R+LVALSG HTIG+ARCTT
Sbjct  150   KLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTT  209

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRAR+YN+TNID  FA   Q  CP++   GDNNL P+D  TP TFD  YF++L+ +KGL 
Sbjct  210   FRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGLL  269

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGG+TDS+V++Y+ N   F  DFA AM+KM +  PLTG++G+IR NC K N
Sbjct  270   HSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 227/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS+ FY+KSCP   SI+K+ V  A+  E RMGASL+RLHFHDCFVNGCDGSILLDD  T
Sbjct  27    QLSSTFYAKSCPRVQSIVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNAT  86

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+T+  N NS RG +VID IK ++E+ C GVVSCADI+ +AARDS V L GP+W V+
Sbjct  87    FTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQGPTWTVM  146

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS SAA+NN+P+P  +L+ LI+SF  HG S ++LVALSG HTIG++RC  FR
Sbjct  147   LGRRDSPTASLSAANNNIPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIGQSRCAFFR  206

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RIYN++NI+  FA++++  CP +GGDN L+P+D  TPTTFDN Y+ +L  QKGL HSDQ
Sbjct  207   TRIYNESNINAAFATSVKPNCPSAGGDNTLSPLDVVTPTTFDNKYYSNLKVQKGLLHSDQ  266

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGSTDS V TY+ N   F  DFA AM+KM N+ PLTGT GQIRKNC K N
Sbjct  267   QLFNGGSTDSQVTTYSTNQNSFFTDFAAAMVKMGNISPLTGTSGQIRKNCRKAN  320



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 225/298 (76%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYSKSCP     +K  V  AI  E RMGASL+RL FHDCFV GCDGSILL+DT 
Sbjct  31    AQLSTGFYSKSCPKLFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSILLEDTA  90

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQT+  NNNS+RG NVI+NIKAK+E  CPGVVSCADI+A+AARDSTV LGGP+W V
Sbjct  91    SFTGEQTAGPNNNSVRGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGPNWAV  150

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  +P PT  L+ LI+ F   G SAR++VALSG HTIG+ARC  
Sbjct  151   KLGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQARCVI  210

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FR RIYN+TNID  FAS  Q  CP++   GDNNL P+D  TP  FDN YF++LL QKGL 
Sbjct  211   FRNRIYNETNIDSSFASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKNLLNQKGLL  270

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGSTDS+V TY+ NP  F  DF  AM+KM ++ PLTG+ G+IRK C +VN
Sbjct  271   HSDQVLFNGGSTDSLVRTYSNNPKTFNSDFVSAMIKMGDIDPLTGSSGEIRKKCNRVN  328



>ref|XP_010264469.1| PREDICTED: peroxidase 2-like [Nelumbo nucifera]
Length=320

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 225/295 (76%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A LS  FY+K CP AL  IK  V  A++ ETRMGASLLRLHFHDCFVNGCD SILLD T 
Sbjct  24    ANLSPTFYNKVCPQALPTIKKIVEEAVKKETRMGASLLRLHFHDCFVNGCDASILLDRTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPG-VVSCADIVAVAARDSTVVLGGPSWN  871
             +F  E+T+  NNNS+RG NV+D IK+ ++  C G VVSCADI+AVAARDS V LGGP+W 
Sbjct  84    SFLSEKTAPPNNNSVRGFNVVDKIKSAVDKACGGPVVSCADILAVAARDSVVALGGPTWK  143

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             VLLGRRDSTTA+++ A  NLP+P  NL+ LIS+F   G + ++LVALSGGHTIG ARC  
Sbjct  144   VLLGRRDSTTANRTLATVNLPSPFSNLSTLISNFKNQGLNRKDLVALSGGHTIGLARCII  203

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSD  511
             FR+RIYNDTNI P +A A QAICP SGGDNN  P+D T + FD  YF +L+K+KGL HSD
Sbjct  204   FRSRIYNDTNIHPSYARARQAICPVSGGDNNFAPLDHTRSLFDTVYFTNLVKRKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTDS+V+TY+ N   F+  FA +M+KM N+ PLTG +GQIR NC KVN
Sbjct  264   QELFNGGSTDSLVKTYSTNFKAFSAAFAKSMIKMGNIKPLTGKKGQIRVNCRKVN  318



>ref|XP_008384730.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=323

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 229/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  NNNS+RG  V+D IK+++E  CPGVVSCADI+A+A+RDS  +LGGPSW V
Sbjct  86    SFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  145

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  +P PT  LN+L++ F   G S R+LVALSG HTIG+ARCTT
Sbjct  146   KLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTT  205

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRAR+YN+TNID  FA   Q  CP++   GDNNL P+D  TP TFD  YF++L+ +KGL 
Sbjct  206   FRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGLL  265

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGG+TDS+V++Y+ N   F  DFA AM+KM +  PLTG++G+IR NC K N
Sbjct  266   HSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  323



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 225/297 (76%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A LS ++Y  SCP     +K  V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  29    ANLSKDYYYSSCPKLFETVKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  88

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS RG  VID IK+ +E  CPG VSCADI+ + ARDS  +LGGP+W+V
Sbjct  89    SFTGEKTANPNKNSARGFEVIDKIKSAVEKVCPGAVSCADILTITARDSVEILGGPTWDV  148

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TASKSAA+N++PAPT +LNQLIS F+  G S ++LVALSGGHTIG+ARCTTF
Sbjct  149   KLGRRDARTASKSAANNDIPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTF  208

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA IYND+NID  FA   Q+ CP++   GDNNL P+D  TPT+FDN YF++L+  KGL H
Sbjct  209   RAHIYNDSNIDTSFARTRQSGCPKTSGSGDNNLAPLDLATPTSFDNHYFKNLVDSKGLLH  268

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGSTDSIV  Y+  P  F+ DF  AM+KM ++ PLTG+ G+IRK C  VN
Sbjct  269   SDQQLFNGGSTDSIVHEYSLYPSSFSSDFVTAMIKMGDISPLTGSNGEIRKQCRSVN  325



>gb|AGF25269.1| peroxidase 2 [Pyrus communis]
Length=318

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +L+ NFY   CP ALSI++ GVI+AI+ ETR+GASLLRLHFHDCFVNGCD S+LLDDT +
Sbjct  24    KLTQNFYKSKCPKALSIVQEGVIAAIKKETRVGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  N NSIRG  V+D IKAKLE  CPGVVSCAD++A+AARDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNKNSIRGFEVVDRIKAKLEKACPGVVSCADLLALAARDSTVHLGGPSWKVG  143

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS+SAA+ ++P PT N++ LISSFS HG S R+LVALSG HTIG ARCT+FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNVSALISSFSAHGLSLRDLVALSGSHTIGLARCTSFR  203

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             +RIYND+ I+  FAS+L  ICP+SG +NNL  +D  TPT FDN Y+++LLK+KGL HSDQ
Sbjct  204   SRIYNDSAINATFASSLHRICPRSGNNNNLARLDLQTPTHFDNLYYKNLLKKKGLLHSDQ  263

Query  507   ALYNG-GSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG  ST ++V+ Y  N F F KDFA AM+KM N+ PLTG +G+IR NC KVN
Sbjct  264   ELFNGTTSTGALVKIYASNTFTFFKDFAVAMVKMGNIDPLTGRQGEIRTNCRKVN  318



>gb|KHG17773.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=325

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 233/299 (78%), Gaps = 5/299 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDD-T  1051
             A+LS NFYSKSCPN L  +K  V SAI  E RMGASLLRL FHDCFVNGCDGSILLDD  
Sbjct  27    AKLSTNFYSKSCPNLLPTVKFIVHSAIMKEARMGASLLRLFFHDCFVNGCDGSILLDDDI  86

Query  1050  PTFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWN  871
              +F GE+ +  N NS RG NV+D+IK+ +E  CPG+VSCADI+A++ARDS  +LGGP W+
Sbjct  87    SSFIGEKNAAPNRNSARGFNVVDDIKSAVEIVCPGLVSCADILAISARDSVTILGGPYWD  146

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V LGRRD+ TAS++AA+NN+P+P+ NLNQLIS F+ HG + R+LVALSGGHTIG+ARCTT
Sbjct  147   VKLGRRDARTASQAAANNNIPSPSSNLNQLISGFNAHGLAPRDLVALSGGHTIGQARCTT  206

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRAR+YN++NIDP FA   Q  CP+    GDNNL P+D  TPT FDN YF++L+ ++GLF
Sbjct  207   FRARVYNESNIDPSFARTRQRNCPRETGSGDNNLAPLDIHTPTYFDNSYFKNLIDRRGLF  266

Query  519   HSDQALYNGGS-TDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+ GG  TDSIV  Y+ NP  F  DFA AM+KM ++ PLTG+ G+IRKNC +VN
Sbjct  267   HSDQQLFTGGGFTDSIVRGYSNNPRSFRSDFAAAMIKMGDISPLTGSMGEIRKNCRRVN  325



>ref|NP_001106040.1| peroxidase 70 precursor [Zea mays]
 sp|A5H452.1|PER70_MAIZE RecName: Full=Peroxidase 70; AltName: Full=Plasma membrane-bound 
peroxidase 2b; Short=pmPOX2b; Flags: Precursor [Zea mays]
 gb|ABN48843.1| plasma membrane-bound peroxidase 2b [Zea mays]
Length=321

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 226/291 (78%), Gaps = 3/291 (1%)
 Frame = -1

Query  1209  FYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTFTGEQ  1030
             FYS+SCP AL+ IK+ V +A+  E RMGASLLRLHFHDCFV GCDGS+LL+DT TFTGEQ
Sbjct  31    FYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQ  90

Query  1029  TSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLLGRRD  850
             T+  N  SIRG  V+DNIKA++E+ CPGVVSCADI+AVAARDS V LGGPSW VLLGRRD
Sbjct  91    TANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRD  150

Query  849   STTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRARIYN  670
             STTAS + A+++LPAP+L+L  L ++F+K   S  +LVALSG HTIG A+C  FRA IYN
Sbjct  151   STTASLALANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQCKNFRAHIYN  210

Query  669   DTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQALY  499
             DTN++  FA+  +A CP +   GD NL P+D  TPT FDN Y+ +LL Q+GL HSDQ L+
Sbjct  211   DTNVNAAFATLRRANCPAAAGNGDGNLAPLDTATPTAFDNAYYTNLLAQRGLLHSDQQLF  270

Query  498   NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             NGG+TD +V TY   P  F++DFA AM++M N+ PLTGT+GQIR+ C +VN
Sbjct  271   NGGATDGLVRTYASTPRRFSRDFAAAMIRMGNISPLTGTQGQIRRACSRVN  321



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 228/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSK+CP   SI++  V SAI  E R+GAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  26    AQLSTNFYSKTCPKLSSIVQRQVQSAISKEARIGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG +VIDNIK  +E+ CPGVVSCADI+A+AA DS  +LGGP+WNV
Sbjct  86    NFTGEKNALPNKNSVRGFDVIDNIKTAVENVCPGVVSCADILAIAATDSVAILGGPTWNV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+TTAS+S A+  +P PT NLN L S F   G S ++LVALSG HTIG+ARCTTF
Sbjct  146   KLGRRDATTASQSDANTAIPRPTSNLNILTSMFKNVGLSTKDLVALSGAHTIGQARCTTF  205

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TNID  FAS  Q+ CP++   GDNNL P+D  TPT+FDNCY+R+L++ KGL H
Sbjct  206   RVRIYNETNIDTSFASTRQSNCPKTSGSGDNNLAPLDLHTPTSFDNCYYRNLVQNKGLLH  265

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGST+SIV  Y  N   F  DFA AM+KM ++ PLTG+ G+IRKNC K N
Sbjct  266   SDQQLFNGGSTNSIVSGYFNNQNSFFSDFATAMIKMGDIKPLTGSNGEIRKNCRKPN  322



>ref|XP_010915493.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 227/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS  FY+KSCPN  SI++SG+  A+ AE RMGAS+LRL FHDCFVNGCDGSILL DT T
Sbjct  23    QLSPTFYAKSCPNVQSIVRSGMAQAVSAEPRMGASILRLFFHDCFVNGCDGSILLADTAT  82

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGEQ +  N NS+RG  VID IKA++E+ C   VSCADI+A+AARD   +LGGP+W V 
Sbjct  83    FTGEQNAGPNKNSVRGFGVIDTIKARVEAACKATVSCADILALAARDGVNLLGGPTWTVQ  142

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRD+TTAS+SAA+NNLP+P  +L+ LIS F+  G SA+E+ ALSG HTIG+A+C  FR
Sbjct  143   LGRRDATTASQSAANNNLPSPASSLSILISKFAAQGLSAQEMTALSGSHTIGQAQCKNFR  202

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             A IYNDT+I+P FA+  +  CP SGGD NL P+D  TP  FDN Y+++L+ QKGL HSDQ
Sbjct  203   AHIYNDTDINPSFAALRKRNCPASGGDTNLAPLDVQTPNGFDNAYYQNLVAQKGLLHSDQ  262

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L++GGS D++V  Y+ N  +F++DF  AM+KM ++ PLTGT G+IR NCGKVN
Sbjct  263   ELFDGGSQDALVRQYSTNAALFSRDFVQAMVKMGSISPLTGTSGEIRLNCGKVN  316



>gb|KHN44723.1| Peroxidase 4 [Glycine soja]
Length=314

 Score =   385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 223/295 (76%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+L A+FYS +CPN L I+K GV  AIQ E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  20    AELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILLDDTS  79

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              F GEQT+ ANN S RG NVI++IKA +E  CP VVSCADI+A++ARDS V LGGPSW V
Sbjct  80    NFIGEQTAAANNQSARGFNVINDIKASVEKECPRVVSCADILALSARDSVVYLGGPSWEV  139

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+S A+N++P P L+L  LI++F+  G S  +LVALSG HTIG A C  F
Sbjct  140   GLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAECKNF  199

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RA IYND+N+DP +   LQ+ CP+SG D  L P+D  TP  FDN YF++L+ +K L HSD
Sbjct  200   RAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKALLHSD  259

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NG STD++V  Y  N   F +DFA  MLKMSN+ PLTG++GQIR NCGKVN
Sbjct  260   QELFNGSSTDNLVRKYATNAAAFFEDFAKGMLKMSNIKPLTGSQGQIRINCGKVN  314



>ref|XP_006843744.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
 gb|ERN05419.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
Length=318

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 230/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ ++Y+ SCP AL  I+S V SAI  + R+GA LLRL FHDCFVNGCDGS+LLDDT 
Sbjct  22    AQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GE+ +  N NS RG N++DNIK+ +E  CPGVVSCAD +AVAARDS V+LGGP W V
Sbjct  82    TFIGEKNAAPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPDWQV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLI+SF+  G S +++VALSGGHTIG ARC   
Sbjct  142   KLGRRDARTASQAAANNSIPPPTFNLNQLINSFANQGLSQKDMVALSGGHTIGVARCINI  201

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TNIDP FA   Q+ CP++   GDNN+ P+D  TPT FDN YF++L+ +KGL H
Sbjct  202   RNRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLDLQTPTAFDNKYFKNLINKKGLLH  261

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGS+DS+V +Y+ N  +F KDF  AM+KM ++ PLTG+ G+IRKNC K+N
Sbjct  262   SDQQLFNGGSSDSLVRSYSSNSDLFDKDFVAAMIKMGDIKPLTGSNGEIRKNCRKIN  318



>ref|XP_003623567.1| Peroxidase [Medicago truncatula]
 gb|AES79785.1| class III peroxidase [Medicago truncatula]
Length=312

 Score =   385 bits (989),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 228/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYS +C + LS IK  + SA+  E RMGAS+LRLHFHDCFV GCD S+LLDDT 
Sbjct  18    AQLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTS  77

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+ AN NS+RG +VID IK +LES CP  VSCADI++VAARDS V LGGPSW V
Sbjct  78    SFTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTV  137

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS S A+++LP P  +L+ LI+SF   GF+ +E+VALSG HTIG+A C  F
Sbjct  138   QLGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFF  197

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYND NID  FA++LQA CP +GGD+NL+P+D  TP TFDN YF++L  QKGLF SD
Sbjct  198   RTRIYNDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGLFSSD  257

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             QAL+NGGSTDS V+ Y+ +   FA DFA+AM+KM NL P+TG+ GQIR NC  +N
Sbjct  258   QALFNGGSTDSDVDEYSSDSSSFATDFANAMVKMGNLNPITGSNGQIRTNCRVIN  312



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 230/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+  FYSKSCP     +KS V SAIQ ETRMGASLLRL FHDCFVNGCDGS+ LDDT 
Sbjct  22    AQLTTGFYSKSCPKLYETVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ ++ N NS RG  VIDNIK+ +E  CPGVVSCADI+AV ARDS V+LGGP+W+V
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+ AA+N++P PT NLN+LISSFS  G S +++VALSG HTIG+ARCT+F
Sbjct  142   KLGRRDARTASQGAANNSIPTPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             R RIYN+T N+D   A   Q  CP++   GDNNL P+D  TPT FDN YF +L+ +KGL 
Sbjct  202   RGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFINLVNKKGLL  261

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV++Y+ NP  F  DF  AM+KM +  PLTG++G+IRKNC ++N
Sbjct  262   HSDQQLFNGGSVDSIVKSYSNNPSSFTSDFVTAMIKMGDNRPLTGSKGEIRKNCRRIN  319



>dbj|BAM05637.1| peroxidase 2 [Eucalyptus globulus subsp. globulus]
Length=333

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS + Y  +CP ALSI+++GV  AI+ ETR GASLLRLHFHDCFVNGCD SILLDDTP+
Sbjct  40    KLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPS  99

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNS+RG  VID IKA LE  CPGVVSCADIVA+AARDS V LGGPSW V 
Sbjct  100   FVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVS  159

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS+S A+ ++P PT NL+ LI+SF+  G S + +VALSG HTIG ARCT+FR
Sbjct  160   LGRRDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFR  219

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RIYND+NID  FA  LQ ICP+ G D+ L  +D  TPT FDN Y+ +LL++KGL HSDQ
Sbjct  220   GRIYNDSNIDTSFAHKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQ  279

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG S DS+V+ Y  +   F +DFA AM+KMS + P  G+ GQIRKNC KVN
Sbjct  280   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKVN  333



>ref|XP_003545648.1| PREDICTED: peroxidase 4 [Glycine max]
Length=325

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 223/295 (76%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+L A+FYS +CPN L I+K GV  AIQ E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  31    AELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILLDDTS  90

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              F GEQT+ ANN S RG NVI++IKA +E  CP VVSCADI+A++ARDS V LGGPSW V
Sbjct  91    NFIGEQTAAANNQSARGFNVINDIKASVEKECPRVVSCADILALSARDSVVYLGGPSWEV  150

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+S A+N++P P L+L  LI++F+  G S  +LVALSG HTIG A C  F
Sbjct  151   GLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAECKNF  210

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RA IYND+N+DP +   LQ+ CP+SG D  L P+D  TP  FDN YF++L+ +K L HSD
Sbjct  211   RAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKALLHSD  270

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NG STD++V  Y  N   F +DFA  MLKMSN+ PLTG++GQIR NCGKVN
Sbjct  271   QELFNGSSTDNLVRKYATNAAAFFEDFAKGMLKMSNIKPLTGSQGQIRINCGKVN  325



>emb|CAA62597.1| korean-radish isoperoxidase [Raphanus sativus]
Length=315

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 233/296 (79%), Gaps = 3/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCPN LS +KSGV SA+ ++ RMGAS+LRL FHDCFVNGCDGSILLDDT 
Sbjct  21    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDT-  79

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGEQ +  N NS RG NVIDNIK+ +E  CPGVVSCADI+A+AARDS V LGGP+WNV
Sbjct  80    SFTGEQNAGPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  139

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              +GRRD+ TAS++AA++N+PAP+++L+QLISSF   G S R++VALSG HTIG++RCT F
Sbjct  140   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFRAVGLSTRDMVALSGAHTIGQSRCTNF  199

Query  687   RARIYNDTNIDPLFASALQAICPQSG-GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHS  514
             R RIYN+TNI+  FA+  Q  CP++        P+D  +PT+FDN YF++L+ Q+GL HS
Sbjct  200   RTRIYNETNINAAFATLRQKSCPRAAFRRRKPQPLDINSPTSFDNSYFKNLMAQRGLLHS  259

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGSTDSIV  Y+ +P  F  DFA AM+KM ++ PLTG+ G+IRK CG+ N
Sbjct  260   DQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  315



>ref|XP_009419858.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=328

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS++FY+ SCPNAL II+S V +A+  E RMGASLLRLHFHDCFV GCDGS+LLDDT 
Sbjct  34    AQLSSSFYNTSCPNALPIIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTS  93

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+T+  NNNS+RG +V+D IK+KLES C  VVSCADI+AVAARDS V LGGPSW V
Sbjct  94    GFTGEKTAGPNNNSLRGFDVVDAIKSKLESDCKQVVSCADILAVAARDSVVALGGPSWTV  153

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S+A++++P P  NL  LIS+FS  G +  ++VALSG HTIG+ARCT+F
Sbjct  154   QLGRRDSTTASFSSANSDIPRPDFNLTDLISAFSDKGLTTTDMVALSGAHTIGQARCTSF  213

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             RARIYNDTNID   A++LQ+ CP SG D++L P+D  T T FD+CY+R+LL  KGL HSD
Sbjct  214   RARIYNDTNIDSSLAASLQSSCPSSGDDDSLAPLDASTSTAFDSCYYRNLLSNKGLLHSD  273

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+ GGSTDS V +Y  N   F +DFA AM+KM ++ PLTG+ G+IR +C K N
Sbjct  274   QQLHGGGSTDSQVSSYAANSAKFFRDFASAMVKMGSISPLTGSSGEIRTDCRKTN  328



>gb|KHG00581.1| hypothetical protein F383_17561 [Gossypium arboreum]
Length=663

 Score =   396 bits (1018),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 235/296 (79%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS N+YS +CP ALSI+K+ V +AI+ ETR+GASLLRLHFHDCFVNGCDGS+LLDD  
Sbjct  368   AQLSPNYYSSTCPQALSIVKAEVAAAIKNETRIGASLLRLHFHDCFVNGCDGSVLLDDNS  427

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GE+T+  NNNS RG NV+DNIKA+LE  CPGVVSCADI+A+AARDS V LGGPSW V
Sbjct  428   TFIGEKTAVPNNNSARGFNVVDNIKARLEKACPGVVSCADILAIAARDSVVRLGGPSWKV  487

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDST+AS+SAA+ ++P PT NL+ LISSFS  G S + LVALSG HTIG ARCT+F
Sbjct  488   RLGRRDSTSASRSAANTSIPPPTSNLSALISSFSAQGLSIKNLVALSGSHTIGLARCTSF  547

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R+ IYND+NIDP FA++L+ ICP+SG D+ L P+D  TPT FDN Y+++LL +KGL HSD
Sbjct  548   RSHIYNDSNIDPSFANSLRRICPRSGNDSVLAPLDRQTPTCFDNLYYKNLLDKKGLLHSD  607

Query  510   QALYNGGS-TDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q ++NG S TD +V+ Y  +  +  K+FA +M+KM N+ PLTG  G+IR NC K N
Sbjct  608   QEIFNGSSLTDGLVKKYAADTSLLFKEFAKSMIKMGNIKPLTGNAGEIRINCRKAN  663


 Score =   369 bits (947),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 179/293 (61%), Positives = 220/293 (75%), Gaps = 1/293 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             ++LS N+Y  +CP  LSI+K+   S ++ + RMGASLLRLHFHDCFVNGCDGSILLDD  
Sbjct  26    SKLSQNYYKSTCPQVLSIVKAKTESTLKKKPRMGASLLRLHFHDCFVNGCDGSILLDDNS  85

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GE+T+ ANNNS RG  ++D+IKA++E  CPGVVSCADI+A+AARDSTVVLGGPSW V
Sbjct  86    TFIGEKTALANNNSARGFELVDDIKAEVEKTCPGVVSCADILAIAARDSTVVLGGPSWKV  145

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
               GRRDS TAS++ A+  +PAP+  L+ L S+F   G S ++LVALSG HTIG ARCTTF
Sbjct  146   KSGRRDSITASRADANKFIPAPSFTLSALKSNFHAKGLSLKDLVALSGAHTIGLARCTTF  205

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RA IYND+NIDP FA +LQ  CP++G DN    +D  TP TFDN YFR+LLK+KGL  SD
Sbjct  206   RAHIYNDSNIDPSFAKSLQHKCPRNGKDNIHRRLDLRTPITFDNFYFRNLLKKKGLLRSD  265

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGK  352
             Q L+N  S DS+V+ Y  +   F K F  +M+KMSN+ PLTG  GQIR NC K
Sbjct  266   QELFNDKSADSLVKKYAADSSKFFKQFTKSMIKMSNIKPLTGNSGQIRINCRK  318



>gb|KEH29224.1| class III peroxidase [Medicago truncatula]
Length=338

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 227/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             ++LS+ FY   CP AL II+  +I+A+  + R+GASLLRLHFHDCFV GCD S+LL DTP
Sbjct  44    SELSSTFYGTRCPRALYIIRREIIAAVSRDRRLGASLLRLHFHDCFVQGCDASVLLKDTP  103

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GEQ ++ N NS+RG   ID++KAK+E+ CP VVSCADI+AVAARDS   LGGP W V
Sbjct  104   TFQGEQNARPNANSLRGFEFIDSLKAKIEAVCPNVVSCADILAVAARDSVATLGGPIWGV  163

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTA+ +AA+++LP+P LNL+ LI++F K GFSA E+VALSG HTIGKA+C  F
Sbjct  164   RLGRRDSTTANFNAANSDLPSPFLNLSGLIAAFKKKGFSADEMVALSGAHTIGKAKCAVF  223

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             + RIYN++NI+P +  +LQ  CP++GGDNNL  +D  TP  FD+ Y+R+LL ++GL HSD
Sbjct  224   KNRIYNESNINPYYRRSLQNTCPRNGGDNNLANLDSTTPAFFDSAYYRNLLFKRGLLHSD  283

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q LYNGGSTD  V  Y  NP++F  DFA AM+KM NL PLTG +GQIRK C +VN
Sbjct  284   QELYNGGSTDYKVLAYARNPYLFRFDFAKAMIKMGNLSPLTGNQGQIRKYCSRVN  338



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 230/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYSKSCP  LS ++S V SA+  E RMGASL+RL FHDCFV GCDGSILLDDT 
Sbjct  25    AQLSTSFYSKSCPKVLSTVESVVKSAVSKEKRMGASLVRLFFHDCFVKGCDGSILLDDTS  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+T+  NNNS+RG NV+D+IKAK+E  CPGVVSCADI+A+AARDS V+LGGP W+V
Sbjct  85    SFRGEKTAAPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADILALAARDSVVILGGPGWDV  144

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS +AA++  +P PT  L+QLI+ F   G SA+++VALSG HTIGKARC  
Sbjct  145   KLGRRDSKTASFAAANSGVIPPPTATLSQLINRFQARGLSAKDMVALSGAHTIGKARCVL  204

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FR RIYN+TNID  FA A Q+ CP++   GDNNL P+D  TP +FD  YF +LL +KGL 
Sbjct  205   FRDRIYNETNIDASFAKARQSSCPRTSGSGDNNLAPLDVATPNSFDLKYFNNLLNKKGLL  264

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGSTDS+V+TY+ N   F  DF  AM+KM ++ PLTG+ G+IRKNC K N
Sbjct  265   HSDQILFNGGSTDSLVKTYSSNTKKFYSDFVTAMIKMGDITPLTGSNGEIRKNCRKPN  322



>ref|XP_010067580.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=320

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             +LS + Y  +CP ALSI+++GV  AI+ ETR GASLLRLHFHDCFVNGCD SILLDDTP+
Sbjct  27    KLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPS  86

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F GE+T+  NNNS+RG  VID IKA LE  CPGVVSCADIVA+AARDS V LGGPSW V 
Sbjct  87    FVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVS  146

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGR+DS TAS+S A+ ++P PT NL+ LI+SF+  G S + +VALSG HTIG ARCT+FR
Sbjct  147   LGRKDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFR  206

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RIYND+NID  FA  LQ ICP+ G D+ L  +D  TPT FDN Y+ +LL++KGL HSDQ
Sbjct  207   RRIYNDSNIDTSFAHKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQ  266

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NG S DS+V+ Y  +   F +DFA AM+KMS + P  G+ GQIRKNC KVN
Sbjct  267   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKVN  320



>ref|XP_010921099.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=320

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 229/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL  +FY K CP AL  I+  V  A+  E RMGASLLRLHFHDCFVNGCDGSILLDDTP
Sbjct  23    AQLDPHFYDKLCPEALPTIRMMVEQAVAREPRMGASLLRLHFHDCFVNGCDGSILLDDTP  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPG-VVSCADIVAVAARDSTVVLGGPSWN  871
             TFTGE+T+  NNNS+RG +V+D+IKA + + C G VVSCADI+AVAARDS V LGGPS+ 
Sbjct  83    TFTGEKTAAPNNNSVRGFDVVDSIKAAVNTACKGNVVSCADILAVAARDSVVALGGPSYE  142

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V +GRRDS TAS+ AA+NN+PAPTLN + L+S+F  HG S ++LV LSGGHTIG+ARCT 
Sbjct  143   VQVGRRDSRTASRDAANNNIPAPTLNFSALLSNFQSHGLSMKDLVVLSGGHTIGQARCTN  202

Query  690   FRARIYNDT-NIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHS  514
             FR+R+YN+T  ID   ASAL+ +CP SGGDNNL+P+D TPT+FD  YF+ LL++KGL HS
Sbjct  203   FRSRLYNETATIDATLASALKPVCPISGGDNNLSPLDQTPTSFDGVYFKGLLQKKGLLHS  262

Query  513   DQALYN--GGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+N  G  +D +V  Y  NP  F +DF  +MLKM N+ PLTG  G+IR +C KVN
Sbjct  263   DQQLFNGDGSGSDGLVLYYGKNPDAFWEDFGVSMLKMGNMSPLTGPVGEIRMDCRKVN  320



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 226/298 (76%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFY  SCPN  S +KS V SAI  E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +F GE+ +  N NS RG  V+DNIK+ +E  CPGVVSCAD++A+AARDS  +LGGP W+V
Sbjct  84    SFRGEKRAAPNFNSARGFEVVDNIKSAVERACPGVVSCADVLAIAARDSVEILGGPRWDV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLN LIS FS  G SAR+LVALSG HTIG ARCT F
Sbjct  144   KLGRRDARTASQAAANNSIPPPTTNLNALISRFSAVGLSARDLVALSGSHTIGLARCTNF  203

Query  687   RARIYNDT-NIDPLFASALQAICP--QSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T N+D   A   Q+ CP     GDNNL P+D  TPT FDN YF++L+ ++GL 
Sbjct  204   RARIYNETNNLDSSLARTRQSNCPSVSGSGDNNLAPLDLQTPTNFDNNYFKNLVNRRGLL  263

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGSTDS V  Y+ NP  FA DFA AM+KM ++ PLTG+ G+IRKNC ++N
Sbjct  264   HSDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIKMGDIKPLTGSNGEIRKNCRRIN  321



>ref|XP_008650762.1| PREDICTED: peroxidase 70 isoform X1 [Zea mays]
 tpg|DAA64105.1| TPA: peroxidase 70 Precursor [Zea mays]
Length=321

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 225/291 (77%), Gaps = 3/291 (1%)
 Frame = -1

Query  1209  FYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTFTGEQ  1030
             FYS+SCP AL+ IK+ V +A+  E RMGASLLRLHFHDCFV GCDGS+LL+DT TFTGEQ
Sbjct  31    FYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQ  90

Query  1029  TSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLLGRRD  850
             T+  N  SIRG  V+DNIKA++E+ CPGVVSCADI+AVAARDS V LGGPSW VLLGRRD
Sbjct  91    TANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRD  150

Query  849   STTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRARIYN  670
             STTAS + A+++LPAP+L+L  L ++F+K   S  +LVALSG HTIG A+C  FRA IYN
Sbjct  151   STTASLTLANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQCKNFRAHIYN  210

Query  669   DTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQALY  499
             DTN++  FA+  +A CP +   GD NL P+D  TPT FDN Y+ +LL Q+GL HSDQ L+
Sbjct  211   DTNVNAAFATLRRANCPAAAGNGDGNLAPLDTATPTAFDNAYYTNLLAQRGLLHSDQQLF  270

Query  498   NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             NGG+TD +V TY   P  F+ DFA AM++M N+ PLTGT+GQIR+ C +VN
Sbjct  271   NGGATDGLVRTYASTPRRFSGDFAAAMIRMGNISPLTGTQGQIRRACSRVN  321



>ref|XP_002319407.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE95330.1| peroxidase family protein [Populus trichocarpa]
Length=302

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 231/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FY+ +CP ALS I++ V+ A+  E RMGASLLRLHFHDCF  GCD S+LLDDT 
Sbjct  9     AQLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCF-QGCDASVLLDDTS  67

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS+RG +VID IK++LES CPGVVSCADI+AVAARDS V L GPSW V
Sbjct  68    SFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTV  127

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS  AA+++LP+P ++L+ LI+SFS  GF+A+E+VALSG HTIG+ARC  F
Sbjct  128   QLGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLF  187

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R R+YN+T++D   A++L++ CP +G D++L+ +D  TP TFDN YF++L   KGL HSD
Sbjct  188   RNRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSD  247

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GG+TDS V+TY+ N   F  DFA AM+KM ++ PLTG+ GQIR NC KVN
Sbjct  248   QQLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  302



>ref|XP_004492537.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=316

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 225/295 (76%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+NFY K+CP  L+ IKS V  A+  E RMGASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  22    AQLSSNFYLKTCPLVLATIKSEVTLAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++  N NS+RG +VID IK+K+E  CP  VSCADI++VAARDS V LGGPSW+V
Sbjct  82    SFTGEKSAGPNANSLRGFDVIDTIKSKVEKLCPNTVSCADILSVAARDSVVALGGPSWSV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS S A+++LP P+ +L+ L ++FS  GF+  ELVALSG HTIG+  C  F
Sbjct  142   QLGRRDSTTASLSIANSDLPGPSSDLSDLKTAFSNKGFTLEELVALSGSHTIGEGSCRFF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RARIYN+ NIDP FA+ LQ  CP +GGD+NL+P+D  TP TFDN Y+R+L K KGLFHSD
Sbjct  202   RARIYNEKNIDPTFATLLQGNCPSTGGDSNLSPLDTTTPNTFDNAYYRNLQKLKGLFHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+N GSTD+ V +Y  NP  F  DFA+AM+KM  L PLTG+ GQIR  CG  N
Sbjct  262   QQLFNNGSTDTQVNSYVNNPASFRADFANAMVKMGRLSPLTGSSGQIRTKCGSTN  316



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 227/298 (76%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  30    AQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  NNNS RG  V+D IK+++E  CPGVVSCADI+A+A+RDS  +LGGPSW V
Sbjct  90    SFTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  149

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  +P PT  LN+L++ F   G S R+LVALSG HTIG+ARCTT
Sbjct  150   KLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTT  209

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRARIYN+TNID  FA   Q  CP++   GDNNL P+D  TP TFD  YF++L+ QKGL 
Sbjct  210   FRARIYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNQKGLL  269

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+N G+T+S+V++Y+ N   F  DFA AM+KM +  PLTG++G+IR NC K N
Sbjct  270   HSDQILFNSGATNSLVKSYSGNAETFNSDFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>gb|EPS58869.1| peroxidase, partial [Genlisea aurea]
Length=310

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 232/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FY+ +CPN  SI+KS V +A+  E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  17    AQLSPAFYASTCPNLPSIVKSAVAAAVAQEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  76

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+T+  N NS+RG +VID IK+++E+ CPG+VSCADIVA+AARDS V L GPSW V
Sbjct  77    TFTGEKTAFPNANSLRGFDVIDTIKSQVEAACPGIVSCADIVAIAARDSVVALNGPSWTV  136

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS +AA+++LP+P  +L QLIS+FS  G +  E+VALSG HTIG+ARC  F
Sbjct  137   GLGRRDSLTASLAAANSDLPSPASSLAQLISAFSAKGLTTAEMVALSGSHTIGQARCVVF  196

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHSD  511
             R RIYN+T +DP +A+ LQA CP++GGDNNL P+D  TPTTFD+ Y+RD++ QKGL HSD
Sbjct  197   RTRIYNET-MDPFYAARLQANCPKTGGDNNLAPLDAVTPTTFDSNYYRDIVLQKGLLHSD  255

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L +  ST + V  Y+ +  +F  DFA+ M+KMSNL PLTG++GQIR NC KVN
Sbjct  256   QQLLSSLSTAAQVTIYSVSDLLFFNDFANGMVKMSNLSPLTGSQGQIRTNCRKVN  310



>gb|ABK25962.1| unknown [Picea sitchensis]
Length=323

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 187/296 (63%), Positives = 227/296 (77%), Gaps = 3/296 (1%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS+ FY KSCP ALS++K+ V  A+  E RMGASLLRLHFHDCFVNGCDGS+LLDD+  
Sbjct  28    QLSSTFYDKSCPAALSVVKAAVKQAVAKEQRMGASLLRLHFHDCFVNGCDGSVLLDDSSK  87

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
              TGE+T+  N NS RG +VID IK+++E  C GVVSCADI+A+AARDS V LGGPSW VL
Sbjct  88    ITGEKTAVPNANSARGFDVIDTIKSQVEKSCSGVVSCADILAIAARDSVVELGGPSWTVL  147

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTASKS A+NN+P PT +L+++IS F   G SA+E+VAL+G HTIG+ARC  FR
Sbjct  148   LGRRDSTTASKSGANNNIPPPTSSLSKIISLFQAQGLSAKEMVALAGAHTIGQARCFNFR  207

Query  684   ARIYNDTNIDPLFASALQAICP--QSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHS  514
             A IYNDTNI   ++++L++ CP     GDNNL+P+D  +PT FD  Y+ +L  +KGL HS
Sbjct  208   AHIYNDTNILSTYSTSLRSKCPPTNGSGDNNLSPLDYVSPTAFDKNYYCNLKIKKGLLHS  267

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGSTDS V TY  N  IF  DFA AM+KM N+ PLTGT GQIRKNC K N
Sbjct  268   DQELFNGGSTDSQVTTYASNQNIFFSDFAAAMVKMGNIKPLTGTSGQIRKNCRKPN  323



>ref|XP_006843746.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
 gb|ERN05421.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
Length=318

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 230/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ ++Y+ SCP AL  I+S V SAI  + R+GA LLRL FHDCFVNGCDGS+LLDDT 
Sbjct  22    AQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TF GE+ ++ N NS RG N++DNIK+ +E  CPGVVSCAD +AVAARDS V+LGGP W V
Sbjct  82    TFIGEKNAQPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPDWQV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++P PT NLNQLI+SF+  G S +++VALSGGHT+G ARC   
Sbjct  142   KLGRRDARTASQAAANNSIPPPTFNLNQLINSFANQGLSQKDMVALSGGHTLGVARCINI  201

Query  687   RARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             R RIYN+TNIDP FA   Q+ CP++   GDNN+ P++  TPT FDN YF++L+ +KGL H
Sbjct  202   RDRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLELQTPTAFDNKYFKNLINKKGLLH  261

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NGGS DS+V +Y+ N  +F KDF  AM+KM ++ PLTG+ G+IRKNC K+N
Sbjct  262   SDQQLFNGGSADSLVRSYSSNSDLFNKDFVAAMIKMGDIKPLTGSNGEIRKNCRKIN  318



>ref|XP_004253400.1| PREDICTED: peroxidase 70-like [Solanum lycopersicum]
Length=319

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 229/293 (78%), Gaps = 1/293 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LS +FY+  CP AL  IK  V  A++ E RMGASLLRLHFHDCFVNGCD SILLD T T 
Sbjct  26    LSPSFYNHVCPEALPAIKRVVEDAVRKERRMGASLLRLHFHDCFVNGCDASILLDKTATI  85

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCC-PGVVSCADIVAVAARDSTVVLGGPSWNVL  865
               E+T+  NNNSIRG +VID IK++++ CC   +VSCADIVAVAARDS V LGGP+W V 
Sbjct  86    DSEKTAIPNNNSIRGFDVIDKIKSEVDKCCGRSIVSCADIVAVAARDSVVALGGPTWEVP  145

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDSTTAS++ A+N++P PTL+L  LI+SF K G + ++LVALSGGHT+G A+C+TFR
Sbjct  146   LGRRDSTTASRTKANNDIPPPTLDLPALINSFKKQGLNEKDLVALSGGHTLGFAQCSTFR  205

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQA  505
              RIYNDTNID  FAS  +A CP+SGG+ NL P+DPTP  FD+ YF +L+ +KGL HSDQA
Sbjct  206   NRIYNDTNIDSTFASQRKANCPRSGGNTNLAPLDPTPALFDSKYFSNLVSKKGLLHSDQA  265

Query  504   LYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             L+NGG TD++V+ Y+ N   F+KDFA++M+KM N+ PLTG +GQIR NC KVN
Sbjct  266   LFNGGQTDNLVKKYSTNLGSFSKDFAESMIKMGNIKPLTGNQGQIRVNCRKVN  318



>ref|XP_010066274.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   383 bits (983),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 226/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYS SCP+ALS IKS V SA++ E RMGASLLRL FHDCFVNGCD SILLDDT 
Sbjct  25    AQLSSTFYSTSCPSALSTIKSSVSSAVKNEARMGASLLRLDFHDCFVNGCDASILLDDTT  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              FTGE+ +  N NS+RG  VID IK++LES CPG+VSCADI+AV ARDS V + GPSW V
Sbjct  85    NFTGEKNAGPNANSMRGFEVIDTIKSELESKCPGIVSCADILAVVARDSIVAVSGPSWTV  144

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS++AA+ ++P PTLNL  LIS+FS  GF+A+E+VAL G HTIG+ARC TF
Sbjct  145   SLGRRDSTTASQTAANISIPPPTLNLRGLISAFSNKGFTAKEMVALLGSHTIGQARCLTF  204

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPT-PTTFDNCYFRDLLKQKGLFHSD  511
             R  +YN+ NID  FA++L+A CP SGGD+ L P D T PT+FDN +F++L   K   HSD
Sbjct  205   REHLYNENNIDTTFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTHKVFLHSD  264

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTD  V  Y+ N   F+ DFA+AM+KM NL PL G+  QIRKNC KVN
Sbjct  265   QQLFSGGSTDVHVNAYSSNLSTFSTDFANAMVKMGNLSPLIGSSDQIRKNCRKVN  319



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 227/298 (76%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS N+Y  +CP   S +KS V SAI  ETRMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSENYYYSACPKLYSTVKSTVQSAIAKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N NS RG  V+D+IKA +E  CPGVVSCADI+A+AA DS  +LGGPSWNV
Sbjct  84    SFTGEKKAAPNVNSARGFEVVDDIKAAVEKVCPGVVSCADILAIAAHDSVEILGGPSWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+  +P PT NLN LIS F+  G SA++LVALSG HTIG+ARCT F
Sbjct  144   KLGRRDARTASQAAANQTIPPPTTNLNGLISRFNSFGLSAKDLVALSGSHTIGQARCTNF  203

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T N+D   A   Q  CP++   GDNNL P+D  TPT FDN YF +L+ +KGL 
Sbjct  204   RARIYNETNNLDTSLARTRQGNCPRATGSGDNNLAPLDLETPTRFDNHYFVNLVSRKGLL  263

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ LYNGGSTD+IV  Y+ NP  FA DFA AM+KM ++ PLTG++G++R NC ++N
Sbjct  264   HSDQQLYNGGSTDTIVRGYSSNPGSFAADFAAAMIKMGDIKPLTGSKGEVRSNCRRIN  321



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/298 (62%), Positives = 233/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+  FYSKSCP     +KS V SA+Q ETRMGASLLRL FHDCFVNGCDGS+ LDD  
Sbjct  22    AQLTTGFYSKSCPKLYETVKSVVHSAVQKETRMGASLLRLFFHDCFVNGCDGSLFLDDIS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ ++ N NS RG  VID+IK+ +E  CPGVVSCADI+AV ARDS V+LGGP+W+V
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA++++P PT NLN+LISSF+  G S +++VALSG HTIG+ARCT+F
Sbjct  142   KLGRRDARTASQAAANSSIPPPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             RARIYN+T N+D   A   Q  CP++   GDNNL P+D  TPT FDN YF +L+ +KGL 
Sbjct  202   RARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGLL  261

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV++Y+ NP  FA DF  AM+KM ++ PLTG++G+IRKNC ++N
Sbjct  262   HSDQQLFNGGSADSIVKSYSDNPNSFAADFVTAMIKMGDIRPLTGSKGEIRKNCRRIN  319



>ref|NP_001241243.1| uncharacterized protein LOC100816056 precursor [Glycine max]
 gb|ACU20213.1| unknown [Glycine max]
 gb|KHN48394.1| Peroxidase 4 [Glycine soja]
Length=325

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 229/301 (76%), Gaps = 7/301 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFY K CP AL II+S V  AI  E R+GASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  25    AQLTPNFYKKVCPQALPIIRSVVHRAIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTH  84

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCC-PGVVSCADIVAVAARDSTVVLGGPS--  877
              FTGE+T+  N NSIRGL V+D IKA ++  C    VSCADI+A+AARDS  +LGGP   
Sbjct  85    NFTGEKTALPNLNSIRGLEVVDEIKAAVDKACNRPAVSCADILAIAARDSVAILGGPHLW  144

Query  876   WNVLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARC  697
             + VLLGRRD+ TASK AA+ NLP P  N +QL+S+F+ HG   ++LVALSGGHTIG ARC
Sbjct  145   YGVLLGRRDARTASKDAANANLPPPFFNFSQLLSNFNSHGLDLKDLVALSGGHTIGFARC  204

Query  696   TTFRARIYNDT--NIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGL  523
             TTFR RIYNDT  NI+P FA++L+  CP+ GGDNNL P+DPTP T D  YF++LL +KGL
Sbjct  205   TTFRDRIYNDTMANINPTFAASLRKTCPRVGGDNNLAPLDPTPATVDTSYFKELLCKKGL  264

Query  522   FHSDQALY--NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKV  349
              HSDQ LY  NG  +D +VE Y+ NPF FA+DF  +M+KM N+ PLTG +G+IR+NC +V
Sbjct  265   LHSDQELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRV  324

Query  348   N  346
             N
Sbjct  325   N  325



>ref|XP_007146853.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
 gb|ESW18847.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
Length=318

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS++FY+ SC +ALS IKS V SA+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  24    AQLSSDFYATSCSSALSTIKSKVKSAVSKERRMGASLLRLHFHDCFVNGCDASVLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+++ AN +S+RG +VID+IK++LE+ CPG+VSCADI+AVAARDS V LGG SW V
Sbjct  84    SFTGEKSAAANVDSLRGFDVIDDIKSQLETDCPGIVSCADILAVAARDSVVSLGGSSWTV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTASK AA  ++P+P L+L+ LI++FS  GF+ +E+V LSG HT G+A+C  F
Sbjct  144   GLGRRDSTTASKDAATTDIPSPQLDLSDLITAFSNKGFTTKEMVVLSGAHTTGQAKCQFF  203

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTT-FDNCYFRDLLKQKGLFHSD  511
             R RIYN+TNID  FA++ Q+ CP + GD+NL+P+D T    FDN YF++L+ +KGL HSD
Sbjct  204   RGRIYNETNIDSDFATSTQSNCPSTDGDSNLSPLDVTTNVLFDNSYFKNLVNKKGLLHSD  263

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L++GGSTDS V  Y+ +   F  DF+ AM+KM NL PLTG+ GQIR NC  VN
Sbjct  264   QQLFSGGSTDSQVTAYSTSSSSFYADFSSAMVKMGNLSPLTGSSGQIRTNCRAVN  318



>ref|XP_004249055.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=317

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 223/295 (76%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             ++LS +FY   CP AL  IK  V+ A++ E RMGASLLRLHFHDCFVNGCD SILLD T 
Sbjct  23    SELSDDFYHHICPKALPTIKRVVVDAVRKERRMGASLLRLHFHDCFVNGCDASILLDQTS  82

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPG-VVSCADIVAVAARDSTVVLGGPSWN  871
             T   E+TS+ANNNS RG  VID IK++++  C   VVSCADI+AVAARDS V L GPSW 
Sbjct  83    TINSEKTSRANNNSARGFEVIDKIKSEVDKVCGRPVVSCADILAVAARDSVVALHGPSWK  142

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V LGRRDSTTAS++AA+NN+P P ++L  LI +F K G   ++LVALSGGHT+G A+C T
Sbjct  143   VKLGRRDSTTASRTAANNNIPTPFMDLPALIKNFKKQGLDEKDLVALSGGHTLGFAQCFT  202

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSD  511
             FR RIYN+T IDP F    QA CP+SGGD+NL P+DPTP  FD+ YF DL  +KGL HSD
Sbjct  203   FRNRIYNETTIDPTFRRQRQANCPRSGGDSNLAPLDPTPALFDSKYFSDLRSKKGLLHSD  262

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             QAL++GG TD +VE Y+ +  +F+KDFA +M+KM N+ PLTG RGQIR NC KVN
Sbjct  263   QALFSGGKTDDLVEKYSKDLGMFSKDFAQSMIKMGNIKPLTGKRGQIRVNCRKVN  317



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 224/297 (75%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS  FYSKSCP     + S V SAIQ E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  24    AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N  S RG  VID IK+ +E  CPGVVSCADI+A+A+RDSTV LGGPSWNV
Sbjct  84    SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS++AA+N++PAPT NLN+LISSFS  G S  ++V LSG HTIG+ARCT F
Sbjct  144   KLGRRDARTASQAAANNSIPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN++NID  FA + +  CP++   GDNNL P+D  TP  FDN Y+ +L+ +KGL H
Sbjct  204   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+NG STDS V  Y+ NP  F  DFA AM+KM ++ PLTG  G+IRKNC + N
Sbjct  264   SDQQLFNGVSTDSTVRGYSTNPSKFKSDFAAAMIKMGDIKPLTGNNGEIRKNCRRRN  320



>emb|CBI18066.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   380 bits (975),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/263 (70%), Positives = 212/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  1131  MGASLLRLHFHDCFVNGCDGSILLDDTPTFTGEQTSKANNNSIRGLNVIDNIKAKLESCC  952
             MGASLLRLHFHDCFVNGCD SILLDDT  FTGE+T+  N NS+RG +VID IK+++ES C
Sbjct  1     MGASLLRLHFHDCFVNGCDASILLDDTSNFTGEKTAVPNANSVRGFDVIDTIKSQVESSC  60

Query  951   PGVVSCADIVAVAARDSTVVLGGPSWNVLLGRRDSTTASKSAADNNLPAPTLNLNQLISS  772
             PGVVSCADI+AV ARDS V LGGPSW V LGRRDSTTAS S A++++PAPTLNL+ LISS
Sbjct  61    PGVVSCADILAVVARDSVVALGGPSWTVRLGRRDSTTASLSTANSDIPAPTLNLSGLISS  120

Query  771   FSKHGFSARELVALSGGHTIGKARCTTFRARIYNDTNIDPLFASALQAICPQSGGDNNLT  592
             FS  GFSA E+VALSG HTIG+ARCT FR R+YN+TNID  F S+LQA CP SGGDNNL+
Sbjct  121   FSNKGFSANEMVALSGSHTIGQARCTNFRDRLYNETNIDASFQSSLQANCPSSGGDNNLS  180

Query  591   PMD-PTPTTFDNCYFRDLLKQKGLFHSDQALYNGGSTDSIVETYTFNPFIFAKDFADAML  415
             P+D  +PTTFDN YF +L+  KGL HSDQ L+NGGSTDS V TY+     F  DFA+A++
Sbjct  181   PLDTKSPTTFDNAYFTNLVNNKGLLHSDQQLFNGGSTDSQVTTYSTKSTTFFTDFANAIV  240

Query  414   KMSNLGPLTGTRGQIRKNCGKVN  346
             KM NL PLTGT GQIR NC K N
Sbjct  241   KMGNLSPLTGTSGQIRTNCRKTN  263



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 228/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ ++Y K+CP     ++S V SAI+ E RMGASL+RLHFHDCFV GCD S+LLDDT 
Sbjct  35    AQLTEDYYKKTCPKVFDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLLDDTS  94

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  NNNSIRG NV+D+IK+K+ES CPGVVSCADI+A+AARDS  +LGGP W+V
Sbjct  95    SFTGEKTAAPNNNSIRGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGPEWDV  154

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              +GRRDS TAS +AA++  +P PT  LN L++ F   G S +++VALSG HTIG+ARC+ 
Sbjct  155   KVGRRDSKTASLAAANSGVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQARCSL  214

Query  690   FRARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FR RIYN+TNID  FA   Q  CP++   GDNNL  +D  +PT FDN Y+++L+K+KGL 
Sbjct  215   FRTRIYNETNIDASFARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYKNLIKKKGLL  274

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ LYNGGSTDS++ETY+  P  F  DF  AM+KM ++ PLTG+ G+IRKNC + N
Sbjct  275   HSDQILYNGGSTDSLIETYSKKPETFNDDFVTAMIKMGDISPLTGSNGEIRKNCRRAN  332



>ref|XP_006848019.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
 gb|ERN09600.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
Length=318

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 229/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
              LS+NFY   CP+ALS I+S + SAI AE RMGASL+RLHFHDCFVNGCD S+LLDDT +
Sbjct  25    HLSSNFYDSFCPHALSTIRSKIRSAISAERRMGASLIRLHFHDCFVNGCDASLLLDDTSS  84

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             F+ E+ ++ANNNS RG  VID +K+K+ES CPGVVSCADI+AVAARDS+  +GGP+W V 
Sbjct  85    FSSEKNARANNNSTRGFEVIDAVKSKVESICPGVVSCADILAVAARDSSKAMGGPTWTVK  144

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRDS TAS++ A+ NLP+ T NL++LIS FS+ G + ++LVALSG HTIG+A+C+TFR
Sbjct  145   LGRRDSATASETDANANLPSFTDNLDELISLFSRKGLNTQDLVALSGSHTIGQAQCSTFR  204

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
              RI+N+ NID  FAS  Q  CP SG D NL P+D  TPT+FDN YF++LL+ KGL HSDQ
Sbjct  205   DRIHNEANIDSGFASTRQRGCPTSGSDTNLAPLDLVTPTSFDNNYFKNLLQLKGLLHSDQ  264

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+N GSTD +V TY+ +   F  DFA AM+KM ++GPLTG+ GQIR NCG  N
Sbjct  265   VLFNNGSTDGLVRTYSESRSTFYSDFASAMVKMGDIGPLTGSSGQIRTNCGVPN  318



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 224/297 (75%), Gaps = 3/297 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFYS SCP     IKS V SAI +E RMGASLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  24    AQLTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLDDTS  83

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+ +  N  S+RG +VID IK  +E  CPGVVSCADI+AV ARDS V+LGGP+WNV
Sbjct  84    SFTGEKNAIPNKGSVRGFDVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPTWNV  143

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS+S A+NN+P PT +L+ LIS FS  G SA+E+VAL G HTIG+ARCT F
Sbjct  144   KLGRRDSRTASQSGANNNIPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQARCTNF  203

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RA +YNDT+ID  FA   Q+ CP +   GDNNL P+D  TP  FDN YF++L+ +KGL H
Sbjct  204   RAHVYNDTDIDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVSKKGLLH  263

Query  516   SDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ +++GGST+S V TY+ +P  ++ DF  AM+KM ++ PLTG  G+IRKNC K N
Sbjct  264   SDQQVFSGGSTNSQVSTYSTSPSTWSSDFVAAMIKMGDISPLTGKSGEIRKNCRKTN  320



>ref|XP_006842568.1| hypothetical protein AMTR_s00077p00148760 [Amborella trichopoda]
 gb|ERN04243.1| hypothetical protein AMTR_s00077p00148760 [Amborella trichopoda]
Length=302

 Score =   380 bits (977),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 234/296 (79%), Gaps = 2/296 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FY+ +CP+    ++SGV SA+  E RMGAS++RL FHDCFVNGCDG ILLDDT 
Sbjct  7     AQLSVSFYANTCPSVFDTVRSGVQSAVNREPRMGASIIRLFFHDCFVNGCDGGILLDDTS  66

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCC-PGVVSCADIVAVAARDSTVVLGGPSWN  871
             +F GE+T+  NNNS+RG  VIDN+KA+++  C   VVSCADI+A+A RDS V LGGPS++
Sbjct  67    SFEGEKTAFGNNNSVRGFEVIDNLKAQVDRACGRSVVSCADILAIATRDSVVQLGGPSYS  126

Query  870   VLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
             V +GRRD+ TASKSAA+++LPAP  +L+ +I+ F++ GF+ RE+VALSG HT+G++RCT 
Sbjct  127   VPVGRRDARTASKSAANSDLPAPFEDLDPIIAKFNRKGFTPREMVALSGAHTVGQSRCTA  186

Query  690   FRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDP-TPTTFDNCYFRDLLKQKGLFHS  514
             FR RIYNDTNIDP FAS+ QA CP++GGD+NL P+DP +P  F N YF+ LL ++GL HS
Sbjct  187   FRDRIYNDTNIDPAFASSRQANCPRTGGDDNLAPLDPQSPNRFGNNYFQALLNRRGLLHS  246

Query  513   DQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             DQ L+NGGS DSIV TY+ N   F +DFA+AM+KM NLG LTGT+G++R NC + N
Sbjct  247   DQVLFNGGSVDSIVTTYSNNANTFFQDFANAMMKMGNLGVLTGTQGEVRTNCRRFN  302



>gb|KHN46627.1| Peroxidase 4 [Glycine soja]
Length=305

 Score =   380 bits (976),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 226/299 (76%), Gaps = 5/299 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+ NFY K CP AL II+S V   I  E R+GASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  6     AQLTPNFYKKVCPQALPIIRSVVHREIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTR  65

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPG-VVSCADIVAVAARDSTVVLGGP--S  877
              FTGE+T+  N NSIRGL V+D IK  ++  C   VVSCADI+A AARDS  +LGGP   
Sbjct  66    NFTGEKTALPNLNSIRGLEVVDEIKEAVDKACKRPVVSCADILATAARDSVAILGGPHLR  125

Query  876   WNVLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARC  697
             ++VLLGRRD+ TASK AA+ NLP P  + +QL+S+F  HG   ++LVALSGGHT+G ARC
Sbjct  126   YSVLLGRRDARTASKDAANANLPPPFFSFSQLLSNFKFHGLDLKDLVALSGGHTLGFARC  185

Query  696   TTFRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFH  517
             TTFR RIYNDTNI+P FA++L+  CP+ G DNNL P+DPTP T D  YF++LL +KGL H
Sbjct  186   TTFRDRIYNDTNINPTFAASLRKTCPRVGADNNLAPLDPTPATVDTSYFKELLCKKGLLH  245

Query  516   SDQALY--NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ LY  NG  +D +VE Y+ NPF FA+DF  +M+KM N+ PLTG +G+IR+NC +VN
Sbjct  246   SDQELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVN  304



>gb|AFK49124.1| unknown [Lotus japonicus]
Length=316

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 224/295 (76%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A+LS NFYS SCP  L I+ +GV  AIQ E R+GASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  22    AELSTNFYSCSCPKLLPIVNNGVAKAIQKEARIGASLLRLHFHDCFVNGCDASILLDDTN  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
              F GEQT+ ANN S RG NVID IKA LE  CPGVVSCAD++A+AARDS V LGGPSW V
Sbjct  82    NFIGEQTAAANNRSARGFNVIDGIKANLEKQCPGVVSCADVLALAARDSVVQLGGPSWEV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS+  A+N +P P L+L+ LI++F+  G S  +LVALSG HTIG A+C  F
Sbjct  142   GLGRRDSTTASRGTANNTIPGPFLSLSGLITNFANQGLSVTDLVALSGAHTIGLAQCKNF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             RA IYND+NID  +A  L++ CP+SG D+   P+D  TP  FDN YF++L+ +K L HSD
Sbjct  202   RAHIYNDSNIDASYAKFLKSKCPRSGNDDLNEPLDRQTPIHFDNLYFKNLMDKKVLLHSD  261

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             Q L+NGGSTD++V+ Y  +   F KDFA  M+K+SN+ PLTG++GQIR NCGKVN
Sbjct  262   QQLFNGGSTDNLVKKYATDRAAFFKDFAKGMVKLSNIKPLTGSKGQIRINCGKVN  316



>ref|XP_008354764.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=327

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 225/298 (76%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS NFYSKSCP     +KS V SA+  E RMGASLLRLHFHDCFVNGCDGS+LLDDT 
Sbjct  30    AQLSTNFYSKSCPQVFDAVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  89

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  NNNS RG  V+D IK+++E  CPGVVSCADI+A+A+RDS  +LGGPSW V
Sbjct  90    SFTGEKTALPNNNSXRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  149

Query  867   LLGRRDSTTASKSAADNN-LPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTT  691
              LGRRDS TAS SAA++  LP PT  LN+L + F   G S R+LVALSG HTIG+ARCTT
Sbjct  150   KLGRRDSKTASLSAANSGVLPPPTATLNELTTRFRAVGLSQRDLVALSGAHTIGQARCTT  209

Query  690   FRARIYNDTNIDPLFASALQAICPQSG--GDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             FRARIYN+TNID  FA   Q  CP++   GD+NL P D  TP TFD  YF++L+ QKGL 
Sbjct  210   FRARIYNETNIDASFARTRQNTCPRTAGSGDDNLAPFDITTPNTFDTAYFKNLVNQKGLL  269

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGG TDS+V++Y+ +   F  DFA AM+KM +  PLTG++G+IR NC K N
Sbjct  270   HSDQILFNGGPTDSLVKSYSGSANTFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score =   380 bits (977),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 229/298 (77%), Gaps = 4/298 (1%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQL+  FYSKSCP     +KS V SAIQ ETRMGASLLRL FHDCFVNGCDGS+ LDDT 
Sbjct  22    AQLTTGFYSKSCPKLYQTVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTS  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             TFTGE+ ++ N NS RG  VIDNIK+ +E  C GVVSCADI+AV ARDS V+LGGP+W+V
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCLGVVSCADILAVTARDSVVILGGPNWDV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRD+ TAS+ AA+N++P PT NLN+LISSF+  G S +++VALSG HTIG+ARCT+F
Sbjct  142   KLGRRDARTASQGAANNSIPTPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  687   RARIYNDT-NIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLF  520
             R RIYN+T N+D   A   Q  CP++   GDNNL P+D  TPT FDN YF +L+ +KGL 
Sbjct  202   RGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFINLVNKKGLL  261

Query  519   HSDQALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             HSDQ L+NGGS DSIV++Y+ NP  F  DF  AM+KM ++ PLTG+ G+IRKNC ++N
Sbjct  262   HSDQQLFNGGSVDSIVKSYSNNPSSFISDFVTAMIKMGDIRPLTGSNGEIRKNCRRIN  319



>ref|XP_009408894.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=318

 Score =   380 bits (976),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1224  QLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPT  1045
             QLS  FY  +CPN  SI++S +  A+  E RMGAS+LRL FHDCFVNGCDGSILLDDT +
Sbjct  25    QLSPTFYGSTCPNLQSIVRSAMRQAVNKEPRMGASILRLFFHDCFVNGCDGSILLDDTSS  84

Query  1044  FTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVL  865
             FTGE+++  N NS RG  VID IK+ +E+ C   VSCADI+A+AARD  V+LGGP+W V 
Sbjct  85    FTGEKSAGPNANSARGFEVIDTIKSNVEAACKATVSCADILALAARDGVVLLGGPTWTVQ  144

Query  864   LGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFR  685
             LGRRD+TTAS+SAA++NLP P  +L+QLISSF+  G SAR++ ALSG HTIG+ARCT+FR
Sbjct  145   LGRRDATTASQSAANSNLPGPGSSLSQLISSFAAKGLSARDMTALSGAHTIGQARCTSFR  204

Query  684   ARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQ  508
             + IYND N++  FA+  +  CP SGGD NL P+D  TPTTFDN Y+++L+ +KGL HSDQ
Sbjct  205   SHIYNDANVNASFAALRKQNCPSSGGDGNLAPLDLQTPTTFDNKYYQNLVVRKGLLHSDQ  264

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGS DS+V+ Y+ NP +F  DF  AM+KM N+ PLTGT+GQIR NC K N
Sbjct  265   ELFNGGSQDSLVQQYSTNPAVFNGDFTAAMVKMGNISPLTGTKGQIRLNCRKAN  318



>ref|XP_010264471.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=320

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/293 (64%), Positives = 228/293 (78%), Gaps = 1/293 (0%)
 Frame = -1

Query  1221  LSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  1042
             LS  FY  SCP ALS IK+ V +A+ AE RMGASLLRLHFHDCFVNGCD SILL D  TF
Sbjct  28    LSPTFYDTSCPTALSTIKTAVDAAVAAEARMGASLLRLHFHDCFVNGCDASILLVDNATF  87

Query  1041  TGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNVLL  862
             TGEQT+  NNNS+RG  VI++IK++LES CP VVSCADI+AVAARDS V LGG SW V L
Sbjct  88    TGEQTAPPNNNSVRGFEVINSIKSQLESICPSVVSCADILAVAARDSVVSLGGASWTVQL  147

Query  861   GRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTFRA  682
             GRRDSTTA+ + A+ +LP+P+LNL  LI++F+  GF+  E+ ALSG HTIG+ARC+ FR 
Sbjct  148   GRRDSTTANLTGANTDLPSPSLNLTDLITAFANKGFTTGEMAALSGSHTIGQARCSVFRD  207

Query  681   RIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSDQA  505
             RIYN+TNI+  +A++LQA CP+S GD+NL+P+D  TP  FDN YF +LL  KGL HSDQ 
Sbjct  208   RIYNETNINSTYAASLQANCPRSDGDDNLSPLDTTTPNVFDNAYFTNLLNMKGLLHSDQQ  267

Query  504   LYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             L++ GSTDS+V TY+ N   F  DFA+AM+KM NL PLTGT G+IR NC +VN
Sbjct  268   LFSNGSTDSLVTTYSTNAATFLTDFANAMVKMGNLSPLTGTSGEIRTNCSRVN  320



>gb|EYU20115.1| hypothetical protein MIMGU_mgv1a025851mg [Erythranthe guttata]
Length=318

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/299 (61%), Positives = 231/299 (77%), Gaps = 5/299 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS ++YSKSCPN  + +K+ V SAIQ E RMGASLLRL FHDCFVNGCDGSILLDDT 
Sbjct  20    AQLSTDYYSKSCPNLFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSILLDDTS  79

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+  N NS+RG N++DNIK+ +E  CP VVSCADI+AVA+RDS V+LGGP W V
Sbjct  80    SFTGEKTALPNRNSVRGFNIVDNIKSAVEKVCPNVVSCADILAVASRDSVVILGGPDWKV  139

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS +AA+N++P PT NLN LISSF+  G S ++LV LSG HTIG+ARCT+F
Sbjct  140   KLGRRDSRTASLAAANNSIPPPTSNLNTLISSFNSLGLSTKDLVVLSGSHTIGQARCTSF  199

Query  687   RARIYNDTNIDPLFASALQAICPQS--GGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFH  517
             RARIYN+TN+D  FA   +  CP++   GDNNL P+D  TP  FDN YF++L+ ++GL H
Sbjct  200   RARIYNETNLDASFAQTRRGNCPRAAGAGDNNLAPLDVQTPANFDNNYFKNLISRRGLLH  259

Query  516   SDQALY--NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             SDQ L+  +GG TDSIV +Y+ +   F  DFA AM+KM ++ P+TG+ G+IRKNC  +N
Sbjct  260   SDQQLFSGSGGRTDSIVRSYSSDSATFRSDFAAAMIKMGDIKPVTGSNGEIRKNCRILN  318



>gb|EYU46001.1| hypothetical protein MIMGU_mgv1a018175mg [Erythranthe guttata]
Length=309

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 231/302 (76%), Gaps = 8/302 (3%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLSAN YS SCP AL+ IK+ V+  +  + RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  8     AQLSANHYSTSCPKALTTIKTTVLKTLLKDRRMGASLLRLHFHDCFVNGCDASVLLDDTS  67

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +  GE+T+  NNNS+RG  VID+IK++LE+ CPGVVSCADI+AV+ARDS V +GGPSW V
Sbjct  68    SMIGEKTAAPNNNSLRGFEVIDSIKSQLETICPGVVSCADILAVSARDSVVAVGGPSWGV  127

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDSTTAS  +A+ ++P+PTL+L +LIS+FS  GF+ +E+VALSG HTIG+ARC  F
Sbjct  128   QLGRRDSTTASIDSANTDIPSPTLDLPELISAFSNKGFTPKEMVALSGAHTIGQARCVVF  187

Query  687   RARIYNDT---NIDPLFASALQAICPQSGGDNNLTPMDPTPT-TFDNCYFRDLLKQKGLF  520
             R RIYN+    NI   FA++L++ CP +GGD+NL+P+D T + +FD  YF++L+  KGL 
Sbjct  188   RERIYNNETNDNIPASFATSLKSNCPLTGGDDNLSPLDATSSLSFDTAYFKNLVSNKGLL  247

Query  519   HSDQALYNGG----STDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGK  352
             HSDQ L+ GG    STDS+V  Y  NP  F  DFA AM+KM NL PLTGT GQIR NC K
Sbjct  248   HSDQQLFGGGGATTSTDSLVSGYANNPPAFFSDFASAMIKMGNLSPLTGTNGQIRSNCRK  307

Query  351   VN  346
             +N
Sbjct  308   IN  309



>ref|XP_003615990.1| Peroxidase [Medicago truncatula]
 gb|AAB48986.1| peroxidase precursor [Medicago truncatula]
 gb|AES98948.1| peroxidase family protein [Medicago truncatula]
Length=325

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 230/298 (77%), Gaps = 5/298 (2%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             A L+ +FY   CP AL  IKS V+ AI  E R+GASLLRLHFHDCFVNGCDGS+LLDDTP
Sbjct  27    ALLTPHFYDNVCPQALPTIKSVVLHAILREKRIGASLLRLHFHDCFVNGCDGSVLLDDTP  86

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPG-VVSCADIVAVAARDSTVVLGGPS--  877
              FTGE+T+  N NSIRG +V+D IKA ++  C G VVSCADI+A AARDS  +LGGP   
Sbjct  87    NFTGEKTALPNINSIRGFSVVDEIKAAVDKVCKGPVVSCADILATAARDSVAILGGPQFF  146

Query  876   WNVLLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARC  697
             +NVLLGRRD+ TASK+AA+ NLP+PT N +QLIS+F   G + ++LVALSGGHTIG ARC
Sbjct  147   YNVLLGRRDARTASKAAANANLPSPTFNFSQLISNFKSQGLNVKDLVALSGGHTIGFARC  206

Query  696   TTFRARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFH  517
             TTFR RIYN+TNIDP+FA++L+  CP++GGDNNLTP+D TPT  +N Y+RDLL ++G+ H
Sbjct  207   TTFRNRIYNETNIDPIFAASLRKTCPRNGGDNNLTPLDFTPTRVENTYYRDLLYKRGVLH  266

Query  516   SDQALY--NGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKV  349
             SDQ L+   G  +D +V+ Y+ N F FA DF  +++KM N+ PLTG +G+IR NC +V
Sbjct  267   SDQQLFKGQGSESDKLVQLYSKNTFAFASDFKTSLIKMGNIKPLTGRQGEIRLNCRRV  324



>gb|AFK43134.1| unknown [Medicago truncatula]
Length=312

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 226/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS +FYS +C + LS IK  + SA+  E RMGAS+LRLHFHDCFV GCD S+LLDDT 
Sbjct  18    AQLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTS  77

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             +FTGE+T+ AN NS+RG +VID IK +LES CP  VSCADI++VAARDS V LGGPSW V
Sbjct  78    SFTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTV  137

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGRRDS TAS S A+++LP P  +L+ LI+SF   GF+ +E+VALSG HTIG+A C  F
Sbjct  138   QLGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFF  197

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMD-PTPTTFDNCYFRDLLKQKGLFHSD  511
             R RIY+D NID  FA++LQA CP +GGD+NL+P+D  TP TFDN YF++L  QKGLF SD
Sbjct  198   RTRIYDDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGLFSSD  257

Query  510   QALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
             QAL+NGGSTD  V+ Y+ +   FA DFA+AM+KM NL P+TG  GQIR NC  +N
Sbjct  258   QALFNGGSTDFDVDEYSSDSSSFATDFANAMVKMGNLNPITGFNGQIRTNCRVIN  312



>ref|XP_008450825.1| PREDICTED: peroxidase P7-like [Cucumis melo]
Length=315

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 224/294 (76%), Gaps = 0/294 (0%)
 Frame = -1

Query  1227  AQLSANFYSKSCPNALSIIKSGVISAIQAETRMGASLLRLHFHDCFVNGCDGSILLDDTP  1048
             AQLS+ FYSK+CP   SI+++G+  A+  E RMGAS+LRL FHDCFVNGCDGSILLDDTP
Sbjct  22    AQLSSRFYSKTCPKLESIVRAGMAKAVNQEKRMGASILRLFFHDCFVNGCDGSILLDDTP  81

Query  1047  TFTGEQTSKANNNSIRGLNVIDNIKAKLESCCPGVVSCADIVAVAARDSTVVLGGPSWNV  868
             T  GE+ +  N NS+RG  VID+IK ++E+ C G VSCADI+A+AARD   +LGGP+W V
Sbjct  82    TMRGEKNALPNRNSVRGFEVIDDIKTQVEAACNGTVSCADILALAARDGVDLLGGPNWVV  141

Query  867   LLGRRDSTTASKSAADNNLPAPTLNLNQLISSFSKHGFSARELVALSGGHTIGKARCTTF  688
              LGR+DS TAS+S A+NNLPAP+ NL+ LIS+F+  GF+ARE+ ALSG HTIG A+C  F
Sbjct  142   PLGRKDSRTASESEANNNLPAPSSNLSTLISTFAAQGFNAREMTALSGAHTIGMAQCRFF  201

Query  687   RARIYNDTNIDPLFASALQAICPQSGGDNNLTPMDPTPTTFDNCYFRDLLKQKGLFHSDQ  508
             R+RIYNDTNI   FA+  QA CP +GGDNNL P+D T + FDN Y+ DL  ++GLFHSDQ
Sbjct  202   RSRIYNDTNIYGAFAAQRQANCPINGGDNNLAPLDSTNSMFDNKYYVDLTNKRGLFHSDQ  261

Query  507   ALYNGGSTDSIVETYTFNPFIFAKDFADAMLKMSNLGPLTGTRGQIRKNCGKVN  346
              L+NGGS D +V  Y+ +  IF  DFA+AM+KM NL P +GT  +IRKNC  VN
Sbjct  262   ELFNGGSQDGLVRIYSLSSLIFRLDFANAMIKMGNLSPASGTVTEIRKNCRVVN  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3697415815374