BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86338_g1_i1 len=804 path=[1:0-803]

Length=804
                                                                      Score     E

ref|XP_011086669.1|  PREDICTED: high-affinity nitrate transporter...    258   2e-82   
ref|XP_010251031.1|  PREDICTED: high-affinity nitrate transporter...    250   2e-79   
ref|XP_010248677.1|  PREDICTED: high-affinity nitrate transporter...    245   2e-77   
ref|XP_009333929.1|  PREDICTED: high-affinity nitrate transporter...    240   1e-75   
ref|XP_008239345.1|  PREDICTED: high-affinity nitrate transporter...    236   4e-74   
ref|XP_011046245.1|  PREDICTED: high-affinity nitrate transporter...    236   1e-73   
ref|XP_011046246.1|  PREDICTED: high-affinity nitrate transporter...    235   2e-73   
ref|XP_010027193.1|  PREDICTED: high-affinity nitrate transporter...    234   3e-73   
emb|CDP12709.1|  unnamed protein product                                235   7e-73   
ref|XP_002279861.1|  PREDICTED: high-affinity nitrate transporter...    233   8e-73   Vitis vinifera
ref|XP_007209613.1|  hypothetical protein PRUPE_ppa011598mg             233   8e-73   
emb|CAN71077.1|  hypothetical protein VITISV_021663                     233   1e-72   Vitis vinifera
gb|KDP31017.1|  hypothetical protein JCGZ_11393                         232   3e-72   
ref|XP_009362926.1|  PREDICTED: high-affinity nitrate transporter...    231   4e-72   
ref|XP_007037769.1|  Nitrate transmembrane transporters                 231   4e-72   
ref|XP_008374376.1|  PREDICTED: high-affinity nitrate transporter...    229   2e-71   
ref|XP_002511305.1|  conserved hypothetical protein                     229   2e-71   Ricinus communis
dbj|BAI63584.1|  component of high affinity nitrate transporter         229   5e-71   Lotus japonicus
ref|XP_002321640.2|  hypothetical protein POPTR_0015s09660g             228   6e-71   Populus trichocarpa [western balsam poplar]
ref|XP_006476900.1|  PREDICTED: high-affinity nitrate transporter...    228   7e-71   
ref|XP_006374542.1|  hypothetical protein POPTR_0015s09670g             228   7e-71   
ref|XP_008392882.1|  PREDICTED: high-affinity nitrate transporter...    227   2e-70   
gb|KDO69464.1|  hypothetical protein CISIN_1g028785mg                   227   2e-70   
ref|NP_001267619.1|  high-affinity nitrate transporter 3.1-like p...    226   5e-70   
gb|KHG18250.1|  High-affinity nitrate transporter 3.2 -like protein     226   7e-70   
ref|XP_010102954.1|  hypothetical protein L484_018973                   226   9e-70   
gb|AFK48944.1|  unknown                                                 224   2e-69   
gb|EYU34506.1|  hypothetical protein MIMGU_mgv1a014017mg                224   3e-69   
emb|CDP12708.1|  unnamed protein product                                224   3e-69   
ref|XP_008360776.1|  PREDICTED: high-affinity nitrate transporter...    224   5e-69   
ref|XP_011015287.1|  PREDICTED: high-affinity nitrate transporter...    222   2e-68   
ref|XP_011101276.1|  PREDICTED: high-affinity nitrate transporter...    221   3e-68   
ref|XP_002318088.2|  hypothetical protein POPTR_0012s09110g             221   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011040463.1|  PREDICTED: high-affinity nitrate transporter...    220   8e-68   
dbj|BAP74416.1|  nitrate transporter                                    220   9e-68   
ref|XP_009798083.1|  PREDICTED: high-affinity nitrate transporter...    219   2e-67   
ref|XP_008439011.1|  PREDICTED: high-affinity nitrate transporter...    219   2e-67   
ref|XP_003549822.1|  PREDICTED: high-affinity nitrate transporter...    218   1e-66   
ref|XP_004299149.1|  PREDICTED: high-affinity nitrate transporter...    218   1e-66   
ref|XP_007155490.1|  hypothetical protein PHAVU_003G205900g             217   2e-66   
ref|XP_006344486.1|  PREDICTED: high-affinity nitrate transporter...    216   3e-66   
gb|EYU17760.1|  hypothetical protein MIMGU_mgv1a013981mg                215   1e-65   
ref|XP_006853022.1|  hypothetical protein AMTR_s00174p00057530          215   1e-65   
ref|XP_009610896.1|  PREDICTED: high-affinity nitrate transporter...    214   2e-65   
gb|EYU22195.1|  hypothetical protein MIMGU_mgv1a013911mg                214   3e-65   
gb|EYU22193.1|  hypothetical protein MIMGU_mgv1a019693mg                213   6e-65   
gb|AFK44790.1|  unknown                                                 211   6e-64   
gb|EYU22194.1|  hypothetical protein MIMGU_mgv1a026235mg                210   9e-64   
gb|EYU22284.1|  hypothetical protein MIMGU_mgv1a025936mg                209   2e-63   
ref|XP_004515861.1|  PREDICTED: high-affinity nitrate transporter...    208   6e-63   
ref|XP_006852328.1|  hypothetical protein AMTR_s00049p00207930          206   3e-62   
ref|XP_011071967.1|  PREDICTED: high-affinity nitrate transporter...    204   2e-61   
gb|AFK41592.1|  unknown                                                 202   2e-60   
ref|XP_011039571.1|  PREDICTED: high-affinity nitrate transporter...    200   2e-60   
ref|XP_009404237.1|  PREDICTED: high-affinity nitrate transporter...    199   2e-59   
ref|XP_003525590.1|  PREDICTED: high-affinity nitrate transporter...    196   2e-58   
ref|XP_008798750.1|  PREDICTED: high-affinity nitrate transporter...    197   3e-58   
ref|XP_009610897.1|  PREDICTED: high-affinity nitrate transporter...    194   9e-58   
ref|XP_009798081.1|  PREDICTED: high-affinity nitrate transporter...    194   9e-58   
ref|XP_004301016.1|  PREDICTED: high-affinity nitrate transporter...    195   1e-57   
ref|XP_010929915.1|  PREDICTED: high-affinity nitrate transporter...    194   1e-57   
gb|EYU28626.1|  hypothetical protein MIMGU_mgv1a0249302mg               192   1e-57   
ref|XP_009415973.1|  PREDICTED: high-affinity nitrate transporter...    193   2e-57   
ref|XP_008793734.1|  PREDICTED: high-affinity nitrate transporter...    191   3e-56   
ref|XP_010555506.1|  PREDICTED: high-affinity nitrate transporter...    191   3e-56   
ref|XP_009379949.1|  PREDICTED: high-affinity nitrate transporter...    186   1e-54   
gb|AAM12786.1|  unknown                                                 186   2e-54   Capsicum annuum
ref|XP_006344484.1|  PREDICTED: high-affinity nitrate transporter...    183   3e-53   
ref|XP_010319027.1|  PREDICTED: high-affinity nitrate transporter...    182   5e-53   
ref|XP_006647452.1|  PREDICTED: high-affinity nitrate transporter...    179   1e-51   
gb|EAY86523.1|  hypothetical protein OsI_07902                          177   5e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001047317.1|  Os02g0595900                                       177   5e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952977.1|  PREDICTED: high-affinity nitrate transporter...    174   7e-50   
gb|AAV35211.1|  NAR2.2                                                  173   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010910986.1|  PREDICTED: high-affinity nitrate transporter...    172   2e-49   
gb|AAP31851.1|  NAR2.2                                                  172   3e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004952978.1|  PREDICTED: high-affinity nitrate transporter...    172   7e-49   
gb|AAP31852.1|  NAR2.3                                                  171   9e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW72145.1|  high affinity nitrate transporter                       171   2e-48   
ref|NP_001105929.1|  high affinity nitrate transporter precursor        171   2e-48   Zea mays [maize]
ref|XP_003575282.1|  PREDICTED: high-affinity nitrate transporter...    171   2e-48   
gb|EMT31108.1|  hypothetical protein F775_20186                         169   5e-48   
gb|AAV35210.1|  NAR2.1                                                  169   7e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003575281.1|  PREDICTED: high-affinity nitrate transporter...    169   7e-48   
ref|XP_002454118.1|  hypothetical protein SORBIDRAFT_04g024870          169   1e-47   Sorghum bicolor [broomcorn]
ref|XP_010448529.1|  PREDICTED: high-affinity nitrate transporter...    169   1e-47   
ref|XP_010448530.1|  PREDICTED: high-affinity nitrate transporter...    168   1e-47   
gb|AAP31850.1|  NAR2.1                                                  168   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK26653.1|  hypothetical protein AALP_AA8G276000                    168   2e-47   
ref|XP_006281099.1|  hypothetical protein CARUB_v10027129mg             167   5e-47   
ref|XP_010441706.1|  PREDICTED: high-affinity nitrate transporter...    166   8e-47   
ref|XP_010438981.1|  PREDICTED: high-affinity nitrate transporter...    166   1e-46   
ref|XP_010448528.1|  PREDICTED: high-affinity nitrate transporter...    167   1e-46   
ref|XP_009789615.1|  PREDICTED: high-affinity nitrate transporter...    166   1e-46   
gb|EMS58629.1|  hypothetical protein TRIUR3_20504                       167   2e-46   
ref|XP_006284533.1|  hypothetical protein CARUB_v10005735mg             164   6e-46   
ref|XP_010446000.1|  PREDICTED: high-affinity nitrate transporter...    162   9e-46   
ref|XP_010438980.1|  PREDICTED: high-affinity nitrate transporter...    164   2e-45   
ref|XP_009138452.1|  PREDICTED: high-affinity nitrate transporter...    161   8e-45   
ref|XP_010667500.1|  PREDICTED: high-affinity nitrate transporter...    160   1e-44   
ref|XP_006402168.1|  hypothetical protein EUTSA_v10014669mg             160   2e-44   
ref|XP_010433734.1|  PREDICTED: high-affinity nitrate transporter...    160   2e-44   
ref|XP_002864044.1|  wound-responsive 3                                 159   4e-44   
emb|CDX83019.1|  BnaA01g20190D                                          159   8e-44   
ref|XP_010438982.1|  PREDICTED: high-affinity nitrate transporter...    158   1e-43   
emb|CDY34047.1|  BnaC03g27680D                                          158   1e-43   
ref|NP_199831.1|  high-affinity nitrate transporter 3.1                 158   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150665.1|  PREDICTED: high-affinity nitrate transporter...    158   2e-43   
emb|CAC36942.1|  putative component of high affinity nitrate tran...    158   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134048.1|  PREDICTED: high-affinity nitrate transporter...    157   2e-43   
emb|CDY64637.1|  BnaA03g57010D                                          157   3e-43   
emb|CDY03424.1|  BnaC01g16580D                                          157   3e-43   
gb|ACG30087.1|  component of high affinity nitrate transporter          157   3e-43   Zea mays [maize]
ref|NP_001105924.1|  high affinity nitrate transporter precursor        156   4e-43   Zea mays [maize]
tpg|DAA37306.1|  TPA: high affinity nitrate transporter                 156   4e-43   
ref|XP_006438234.1|  hypothetical protein CICLE_v10033654mg             155   4e-43   
sp|Q9SB67.1|NRT32_ARATH  RecName: Full=High-affinity nitrate tran...    157   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABF59166.1|  hypothetical protein At4g24720                          157   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190826.1|  calcineurin-like metallo-phosphoesterase sup...    157   6e-43   
ref|XP_010433732.1|  PREDICTED: high-affinity nitrate transporter...    156   7e-43   
gb|AAM62807.1|  putative component of high affinity nitrate trans...    156   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002978289.1|  hypothetical protein SELMODRAFT_152440             155   1e-42   
ref|XP_002966283.1|  hypothetical protein SELMODRAFT_227648             154   4e-42   
ref|XP_009118895.1|  PREDICTED: high-affinity nitrate transporter...    154   6e-42   
ref|XP_002448046.1|  hypothetical protein SORBIDRAFT_06g020180          153   1e-41   Sorghum bicolor [broomcorn]
ref|XP_009127362.1|  PREDICTED: high-affinity nitrate transporter...    153   2e-41   
emb|CDX91545.1|  BnaC02g16150D                                          152   2e-41   
emb|CDY34305.1|  BnaA01g14080D                                          153   3e-41   
emb|CDX71613.1|  BnaC09g26540D                                          151   5e-41   
ref|XP_006413394.1|  hypothetical protein EUTSA_v10027123mg             146   1e-39   
ref|NP_001053099.1|  Os04g0480200                                       143   6e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94557.1|  hypothetical protein OsI_16333                          143   9e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009138456.1|  PREDICTED: manganese-dependent ADP-ribose/CD...    148   1e-37   
ref|NP_194204.2|  calcineurin-like metallo-phosphoesterase superf...    146   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867650.1|  predicted protein                                  140   7e-37   
ref|XP_001771033.1|  predicted protein                                  137   1e-35   
ref|XP_006828371.1|  hypothetical protein AMTR_s00188p00033950          127   8e-33   
ref|XP_006828375.1|  hypothetical protein AMTR_s00188p00036850          127   9e-33   
gb|EMT33608.1|  hypothetical protein F775_27090                         127   2e-32   
ref|XP_006849233.1|  hypothetical protein AMTR_s00027p00233840          129   5e-32   
ref|XP_001755294.1|  predicted protein                                  126   2e-31   
ref|XP_001768154.1|  predicted protein                                  120   4e-29   
ref|XP_004301017.1|  PREDICTED: high-affinity nitrate transporter...    108   6e-25   
gb|EMS60424.1|  hypothetical protein TRIUR3_22380                       103   2e-23   
gb|EAZ31107.1|  hypothetical protein OsJ_15203                        99.0    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010438977.1|  PREDICTED: high-affinity nitrate transporter...  94.0    6e-20   
ref|XP_010497940.1|  PREDICTED: high-affinity nitrate transporter...  91.3    7e-20   
emb|CDY05799.1|  BnaA10g06210D                                        90.9    3e-19   
gb|EMT09919.1|  hypothetical protein F775_19205                       91.7    6e-19   
gb|KDO82197.1|  hypothetical protein CISIN_1g0417872mg                83.2    1e-16   
gb|KDO82198.1|  hypothetical protein CISIN_1g0417871mg                81.3    3e-16   
gb|AFG50499.1|  hypothetical protein CL2980Contig1_03                 77.8    5e-15   
gb|AGG68805.1|  putative nitrate transporter                          77.8    6e-15   
gb|AEW08990.1|  hypothetical protein CL2980Contig1_03                 76.6    1e-14   
gb|AFG50498.1|  hypothetical protein CL2980Contig1_03                 76.3    2e-14   
gb|EMT12905.1|  hypothetical protein F775_20267                       75.1    2e-13   
ref|XP_005646384.1|  hypothetical protein COCSUDRAFT_47957            50.4    3e-04   
ref|XP_003058320.1|  nitrate high-affinity transporter accessory ...  50.1    5e-04   



>ref|XP_011086669.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Sesamum 
indicum]
Length=203

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 142/184 (77%), Gaps = 8/184 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A TCYG VLFS+LPQTL VSASP +GQV+KAGED+I+++WGLNQS+  G D SY   K+ 
Sbjct  17   ADTCYGGVLFSTLPQTLAVSASPTDGQVLKAGEDNITVTWGLNQSFPDGTDSSYNEVKLM  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCY P SQADRGWRKTVD+LSKDKTCQF+I  R Y    + Q+F WMIE DVPTA+YFVR
Sbjct  77   LCYGPISQADRGWRKTVDNLSKDKTCQFTIAHRTYM--RETQNFTWMIERDVPTAVYFVR  134

Query  447  AYAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYAY+S+ NEVAYG T        LFKVQA SGRH SLDIA+ CFS FAL+SV GF   E
Sbjct  135  AYAYNSSRNEVAYGQTTDAKKSRNLFKVQAISGRHSSLDIASVCFSAFALLSVVGFMALE  194

Query  609  KRGR  620
            KRGR
Sbjct  195  KRGR  198



>ref|XP_010251031.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Nelumbo nucifera]
Length=205

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 143/182 (79%), Gaps = 7/182 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A++CYG VLFS+L  TL+VSASPKEG+V++AG+D I+++WG+NQS+  G DE+YK  KVK
Sbjct  17   AESCYGTVLFSTLQPTLVVSASPKEGEVLRAGDDKITVTWGMNQSFPVGTDEAYKQVKVK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DR WRKT DDLSKDKTCQF I+ RPY SS + QSF+WMIE DVPTA YFVR
Sbjct  77   LCYAPISQQDRAWRKTNDDLSKDKTCQFQIIVRPYNSSSQ-QSFDWMIERDVPTATYFVR  135

Query  447  AYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYAY+S G EVA+G +        LF +Q  SGRH SLD+AA CFS F+++S+FGF F E
Sbjct  136  AYAYNSDGREVAFGQSTDGQKKTNLFDIQGISGRHASLDVAAGCFSAFSVLSLFGFLFLE  195

Query  609  KR  614
            KR
Sbjct  196  KR  197



>ref|XP_010248677.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Nelumbo 
nucifera]
Length=206

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 142/182 (78%), Gaps = 8/182 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A++CYG VLFSSL +TL+V+ASPK+GQV++AGED I+++WG+NQS+  G DE+YK  KV+
Sbjct  19   AESCYGTVLFSSLQRTLVVTASPKDGQVLRAGEDKITVTWGMNQSFPVGTDEAYKKVKVQ  78

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DRGWRKT DDLSKDKTCQF IV R Y S++   SF+W IE DVPTA YFVR
Sbjct  79   LCYAPISQKDRGWRKTKDDLSKDKTCQFDIVARAYDSNQP--SFDWTIERDVPTATYFVR  136

Query  447  AYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYAY+S G +VA+G +        LF +Q  SGRH SLDIAA CFS F+++S+FGFF  E
Sbjct  137  AYAYNSDGQQVAFGQSTDGQKKTNLFDIQGISGRHASLDIAAGCFSAFSVLSLFGFFLVE  196

Query  609  KR  614
            KR
Sbjct  197  KR  198



>ref|XP_009333929.1| PREDICTED: high-affinity nitrate transporter 3.2 [Pyrus x bretschneideri]
Length=204

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            +QT YG VLFSSL  +LLV+AS  E QV+KAG D +++SWGLNQSYE G D ++KT KVK
Sbjct  18   SQTSYGIVLFSSLKDSLLVTASHTENQVLKAGIDKLTVSWGLNQSYEAGTDSTFKTIKVK  77

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LC+AP SQ DRGWRKTVD L+ DKTC F IVERPY S++ N SF+W+IE DVP A YFVR
Sbjct  78   LCFAPVSQVDRGWRKTVDKLAMDKTCLFKIVERPYTSNKSNDSFDWIIERDVPGATYFVR  137

Query  447  AYAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYA+++AG EVAYG T        LF V+  +GRHLSLDIA+  FS F+++S+ GFF AE
Sbjct  138  AYAFNAAGQEVAYGQTTDAKKTANLFVVEGITGRHLSLDIASVVFSAFSVLSLAGFFIAE  197

Query  609  KR  614
            KR
Sbjct  198  KR  199



>ref|XP_008239345.1| PREDICTED: high-affinity nitrate transporter 3.1 [Prunus mume]
Length=204

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 137/181 (76%), Gaps = 9/181 (5%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            +T +G VLFSSL QTL+V+AS KEGQV K G D +++SWGLNQS+  G D +YKT KVK 
Sbjct  19   ETSHG-VLFSSLKQTLIVTASHKEGQVYKTGIDKLTVSWGLNQSFPAGSDSTYKTIKVKF  77

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DRGWRKTVD LSKDKTCQF +V RPY SS  NQSFEW IE DVP+A YF+RA
Sbjct  78   CYAPVSQVDRGWRKTVDSLSKDKTCQFKVVARPYSSS--NQSFEWTIERDVPSATYFLRA  135

Query  450  YAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YAYD+A  EVAYG T        LF VQ  SGRH SLDIA+ CFS F+++S+ GFF AEK
Sbjct  136  YAYDAADVEVAYGQTTDAQKATNLFVVQGISGRHASLDIASICFSAFSVLSLAGFFIAEK  195

Query  612  R  614
            R
Sbjct  196  R  196



>ref|XP_011046245.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=204

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 134/183 (73%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CYG VL SSLP+TL V+ASP  GQV+K GED I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  20   CYGTVLLSSLPRTLEVTASPTSGQVLKGGEDKITVTWGLNQTVAAGTDSTYKTIKVKLCY  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DRGWRKTVDDL KD+TCQ  IV RPY  +    QS EW +E DVPTA YF+RAY
Sbjct  80   APISQVDRGWRKTVDDLKKDRTCQHKIVARPYNPANSTAQSHEWTVERDVPTATYFIRAY  139

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AYD+   EVAYG       T  LF+VQA SGRH+++D  + CFS F++VS+FGFF+ EKR
Sbjct  140  AYDADEKEVAYGQTTDAGRTTNLFQVQAISGRHVTVDTCSICFSVFSVVSLFGFFYNEKR  199

Query  615  GRR  623
              +
Sbjct  200  NAK  202



>ref|XP_011046246.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=204

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 134/183 (73%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CYG VL SSLP+TL V+ASP  GQV+K GED I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  20   CYGTVLLSSLPRTLEVTASPTSGQVLKGGEDKITVTWGLNQTVAAGTDSTYKTIKVKLCY  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DRGWRKTVDDL KD+TCQ  IV RPY  +    QS EW +E DVPTA YF+RAY
Sbjct  80   APISQVDRGWRKTVDDLKKDRTCQHKIVARPYNPANSTAQSHEWTVERDVPTATYFIRAY  139

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AYD+   EVAYG       T  LF+VQA SGRH+++D  + CFS F++VS+FGFF+ EKR
Sbjct  140  AYDADEKEVAYGQTTDAGRTTNLFQVQAISGRHVTVDTCSICFSVFSVVSLFGFFYNEKR  199

Query  615  GRR  623
              +
Sbjct  200  NAK  202



>ref|XP_010027193.1| PREDICTED: high-affinity nitrate transporter 3.1 [Eucalyptus 
grandis]
 gb|KCW83278.1| hypothetical protein EUGRSUZ_B00213 [Eucalyptus grandis]
Length=205

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 8/191 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            AQ CYG VLFSSL  TL+VSAS + GQV+KAGED I+++W  NQS+  G D +YKT +VK
Sbjct  17   AQACYGNVLFSSLQGTLIVSASSQPGQVLKAGEDKITVTWRYNQSFPAGTDSAYKTVQVK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DR WRKTVD+L+KDKTCQ +I  RPY  S  +QS+EW+++ DVP A YFVR
Sbjct  77   LCYAPVSQVDRAWRKTVDNLAKDKTCQHAITSRPY--SPADQSYEWLVQKDVPEATYFVR  134

Query  447  AYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYA ++ G +V +G       T  LF+VQA +GRH SLDIA+ACFS F++VS+ GFF AE
Sbjct  135  AYALNAEGVQVGFGQTTDKNKTTDLFQVQAITGRHASLDIASACFSAFSVVSLIGFFIAE  194

Query  609  KRGRRLMAANN  641
            KR  +  +A+N
Sbjct  195  KRKAKPSSASN  205



>emb|CDP12709.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 134/180 (74%), Gaps = 8/180 (4%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            T YGA  FSSL +TL+V+ASP  GQVVK+GED I++SW  N ++ RG D +YKT KVKLC
Sbjct  79   TSYGAT-FSSLMRTLVVTASPAAGQVVKSGEDKITVSWSYNNTFARGTDSTYKTIKVKLC  137

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DR WRKTVDDLSKDKTCQF+IV +PY  S  N +F W +E D PTA YFVRAY
Sbjct  138  YAPISQVDRAWRKTVDDLSKDKTCQFNIVTKPYNPSN-NNTFTWTVERDTPTATYFVRAY  196

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AY+SA  EV +G       T  LF+V A SGRH SLDIA+ CFS F++VS+FGFFF EKR
Sbjct  197  AYNSAEEEVGFGQTTDSHKTTNLFEVHAISGRHTSLDIASICFSAFSVVSLFGFFFIEKR  256



>ref|XP_002279861.1| PREDICTED: high-affinity nitrate transporter 3.1 [Vitis vinifera]
 emb|CBI14929.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   233 bits (594),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 137/185 (74%), Gaps = 9/185 (5%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            Q C GA  FSSL +TL+V+ASPK G+V+K+GED I+++WGLNQSY  G D +YKT KVKL
Sbjct  18   QICSGA-YFSSLQRTLIVTASPKAGEVLKSGEDKITVTWGLNQSYPAGTDSAYKTVKVKL  76

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DR WRKTVD L+KDKTCQ  IV +PY +S  N S EW IE DVPTA YF+RA
Sbjct  77   CYAPISQVDRAWRKTVDHLTKDKTCQHKIVSQPYKAS--NNSVEWTIEKDVPTATYFIRA  134

Query  450  YAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YAYD+   EVAYG       T  LF ++A +GRH SLDIAA CFS F++VS+ GFF+ EK
Sbjct  135  YAYDAEDQEVAYGQTTDAHKTTNLFGIEAITGRHASLDIAAVCFSAFSVVSLCGFFWVEK  194

Query  612  RGRRL  626
            R  R+
Sbjct  195  RKSRV  199



>ref|XP_007209613.1| hypothetical protein PRUPE_ppa011598mg [Prunus persica]
 gb|EMJ10812.1| hypothetical protein PRUPE_ppa011598mg [Prunus persica]
Length=204

 Score =   233 bits (595),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 137/181 (76%), Gaps = 9/181 (5%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            +T +G VL SSL QTL+V+AS KEGQV K G D +++SWGLNQS+  G D +YKT KVK 
Sbjct  19   ETSHG-VLLSSLKQTLIVTASHKEGQVYKTGIDKLTVSWGLNQSFPAGSDSTYKTIKVKF  77

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DRGWRKTVD L+KDKTCQF +V RPY SS  NQSFEW IE DVP+A YF+RA
Sbjct  78   CYAPVSQVDRGWRKTVDSLNKDKTCQFKVVARPYSSS--NQSFEWTIERDVPSATYFLRA  135

Query  450  YAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YAYD+A  EVAYG T        LF VQA +GRH SLDIA+ CFS F+++S+ GFF AEK
Sbjct  136  YAYDAADVEVAYGQTTDAQKETNLFVVQAITGRHASLDIASVCFSVFSVLSLAGFFIAEK  195

Query  612  R  614
            R
Sbjct  196  R  196



>emb|CAN71077.1| hypothetical protein VITISV_021663 [Vitis vinifera]
Length=201

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 137/185 (74%), Gaps = 9/185 (5%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            Q C GA  FSSL +TL+V+ASPK G+V+K+GED I+++WGLNQSY  G D +YKT KVKL
Sbjct  18   QICSGA-YFSSLQRTLIVTASPKAGEVLKSGEDKITVTWGLNQSYPAGTDSAYKTVKVKL  76

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DR WRKTVD L+KDKTCQ  IV +PY +S  N S EW IE DVPTA YF+RA
Sbjct  77   CYAPISQVDRAWRKTVDHLTKDKTCQHKIVSQPYKAS--NNSVEWTIEKDVPTATYFIRA  134

Query  450  YAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YAYD+   EVAYG       T  LF ++A +GRH SLDIAA CFS F+++S+ GFF+ EK
Sbjct  135  YAYDAEDQEVAYGQTTDAHKTTNLFGIEAITGRHASLDIAAVCFSAFSVISLCGFFWVEK  194

Query  612  RGRRL  626
            R  R+
Sbjct  195  RKSRV  199



>gb|KDP31017.1| hypothetical protein JCGZ_11393 [Jatropha curcas]
Length=206

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 134/178 (75%), Gaps = 6/178 (3%)
 Frame = +3

Query  99   YGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            YG + FSSL +TLLV+ASP  GQV+KAG D+I+++WGLNQS   G D +YKT K+KLCYA
Sbjct  21   YGVIHFSSLQKTLLVTASPSPGQVLKAGVDNITVTWGLNQSLPAGTDSAYKTIKIKLCYA  80

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAY  458
            P SQ DR WRKT D+LSKDKTCQ  IV +PY S+ KN SF W +E DVPTA YFVRAYA+
Sbjct  81   PVSQKDRAWRKTEDNLSKDKTCQVKIVTKPYSSANKNNSFTWTVERDVPTATYFVRAYAF  140

Query  459  DSAGNEVAYGHTIAL------FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            ++   EVAYG T  +      F +QA +GRH SLDIA+ CFS F++V++FGFF+ EKR
Sbjct  141  NANEQEVAYGQTTDVHKTTNFFDIQAITGRHASLDIASVCFSVFSVVALFGFFYIEKR  198



>ref|XP_009362926.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Pyrus 
x bretschneideri]
Length=203

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 136/181 (75%), Gaps = 7/181 (4%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            QT YG VLFSSL  +L V+AS  E QV+KAG D +++SWGLNQSYE G D ++KT KVKL
Sbjct  19   QTSYGIVLFSSLKDSLFVTASHTENQVMKAGIDKLTVSWGLNQSYEAGTDSTFKTIKVKL  78

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DRGWRKTVD+L+KDKTC F IVER  Y+S+ N + EW IE DVP A YFVRA
Sbjct  79   CYAPVSQVDRGWRKTVDNLAKDKTCLFKIVERS-YTSKSNDTVEWTIERDVPGATYFVRA  137

Query  450  YAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YA+++AG EVAYG T        LF V+  SGRH+SLDIA+  FS F+++S+ GFF AEK
Sbjct  138  YAFNAAGQEVAYGQTTNAKKTANLFVVEGISGRHVSLDIASVVFSVFSVLSLAGFFIAEK  197

Query  612  R  614
            R
Sbjct  198  R  198



>ref|XP_007037769.1| Nitrate transmembrane transporters [Theobroma cacao]
 gb|EOY22270.1| Nitrate transmembrane transporters [Theobroma cacao]
Length=202

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 10/182 (5%)
 Frame = +3

Query  99   YGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            YG + FSSLP+TL+V+AS ++G ++KA ED I++ WGLNQS+  G D +Y T KVKLCYA
Sbjct  21   YGMISFSSLPRTLVVTASHRQG-LLKADEDKITVIWGLNQSFPAGTDSAYTTIKVKLCYA  79

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAY  458
            P SQ DR WRKTVD LSKDKTCQF IV RPY  S  NQ+F+W IE DVPTA YFVRAYA+
Sbjct  80   PISQVDRAWRKTVDHLSKDKTCQFKIVSRPY--SNTNQTFQWTIERDVPTATYFVRAYAF  137

Query  459  DSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR-G  617
            ++  +EVAYG       T  LF++QA +GRH+SLDIA+ CFS F++V++ GFFFAEKR G
Sbjct  138  NAEDHEVAYGQNTDAKKTTNLFEIQAITGRHVSLDIASVCFSAFSIVALMGFFFAEKRKG  197

Query  618  RR  623
            R+
Sbjct  198  RK  199



>ref|XP_008374376.1| PREDICTED: high-affinity nitrate transporter 3.2 [Malus domestica]
 ref|XP_008364596.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Malus 
domestica]
Length=204

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            +QT YG VLFSSL  +LLV+AS  E QV+KAG D +++SWGLNQSYE G D ++KT KV 
Sbjct  18   SQTSYGIVLFSSLKDSLLVTASHTENQVLKAGIDKLTVSWGLNQSYEAGTDSTFKTIKVN  77

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LC+A  SQ DRGWRKTVD+L+KDKTC   IVERPY SS+ N SF+W+IE DVP A YFVR
Sbjct  78   LCFAQVSQVDRGWRKTVDNLAKDKTCLVKIVERPYTSSKSNDSFDWIIERDVPGATYFVR  137

Query  447  AYAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYA+D+A  +VAYG T        LF V+  +GRHLSLDI +  FS F+++S+  FF AE
Sbjct  138  AYAFDAADQQVAYGQTTDAKKTANLFVVEGITGRHLSLDITSVAFSAFSVLSLACFFIAE  197

Query  609  KR  614
            KR
Sbjct  198  KR  199



>ref|XP_002511305.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51907.1| conserved hypothetical protein [Ricinus communis]
Length=207

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 133/178 (75%), Gaps = 6/178 (3%)
 Frame = +3

Query  99   YGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            YG + FSSL  TL+V+A+P   QV+K G D+I+++WG+NQS   G D ++KT  VKLCYA
Sbjct  22   YGFIFFSSLKNTLVVTATPSSKQVLKGGVDNITVTWGVNQSLPSGTDSAFKTIDVKLCYA  81

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAY  458
            P SQ DR WRKT D+L KDKTCQF IV RPY S+ K +S  W IE DVP+A YFVRAYA+
Sbjct  82   PVSQTDRAWRKTEDELEKDKTCQFKIVSRPYSSANKKESLTWTIERDVPSATYFVRAYAH  141

Query  459  DSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            DS G+EVAYG       T  LF+VQA +GRH+SLDIA+ CFS F++VS+FGFF+ EKR
Sbjct  142  DSHGHEVAYGQSTDTHKTTNLFEVQAITGRHVSLDIASVCFSVFSVVSLFGFFYNEKR  199



>dbj|BAI63584.1| component of high affinity nitrate transporter [Lotus japonicus]
Length=202

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 136/185 (74%), Gaps = 7/185 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A TCYG VLFSSL +TL V+ASPK GQVV+AG D+I+++W LN++   G D SYKT KVK
Sbjct  17   AGTCYGKVLFSSLKKTLDVTASPKHGQVVEAGLDTITVTWALNKTLPAGTDSSYKTIKVK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT D+LS+DKTCQ  IV +PY +S K   +FEW+IE DVP A YFV
Sbjct  77   LCYAPISQQDRAWRKTEDELSRDKTCQHKIVAKPYDASNKTVHTFEWLIERDVPEATYFV  136

Query  444  RAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA DS   +V YG       T  LFK+QA +GRHLSLDI +ACFS F++VS+  FF+ 
Sbjct  137  RAYALDSNDVQVGYGQTSDAKKTSNLFKIQAITGRHLSLDICSACFSAFSVVSLIFFFYI  196

Query  606  EKRGR  620
            EKR +
Sbjct  197  EKRKK  201



>ref|XP_002321640.2| hypothetical protein POPTR_0015s09660g [Populus trichocarpa]
 gb|EEF05767.2| hypothetical protein POPTR_0015s09660g [Populus trichocarpa]
Length=206

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CYG VLFSSL +TL V+ASP  GQV+K G D I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  21   CYGTVLFSSLQRTLEVTASPTSGQVLKGGVDKITVTWGLNQTVAAGTDSTYKTIKVKLCY  80

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DRGWRKTVD+L KD+TCQ  IV RPY ++    QS EW +E DVPTA YFVRAY
Sbjct  81   APISQVDRGWRKTVDNLKKDRTCQHKIVARPYNAANSTAQSHEWTVERDVPTATYFVRAY  140

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AYD+    VAYG       T  LF+VQA SGRH+++D  + CFS F++VS+FGFF+ EKR
Sbjct  141  AYDADEKVVAYGQTTDARKTTNLFRVQAISGRHVTMDTCSICFSVFSVVSLFGFFYNEKR  200



>ref|XP_006476900.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Citrus 
sinensis]
Length=204

 Score =   228 bits (582),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 135/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CYG  LFSSL +TL V+ + K GQV+KAGED ++++WGLNQS   G D +YKT KV+LC+
Sbjct  20   CYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGLNQSLAAGTDSAYKTVKVQLCF  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYA  455
            AP SQ DR WRKT D L+KDKTC F IVE+PY  S   Q+ +W+IE+DVPTA YFVRAYA
Sbjct  80   APVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSL--QTLDWIIESDVPTATYFVRAYA  137

Query  456  YDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRG  617
             ++  +EVAYG       T  LF +QA +GRH SLDIA+ CFS F++V++FGFFF EKR 
Sbjct  138  LNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDIASVCFSVFSIVALFGFFFHEKRK  197

Query  618  RRL  626
             R+
Sbjct  198  ARM  200



>ref|XP_006374542.1| hypothetical protein POPTR_0015s09670g [Populus trichocarpa]
 gb|ERP52339.1| hypothetical protein POPTR_0015s09670g [Populus trichocarpa]
Length=205

 Score =   228 bits (582),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CYG VLFSSL +TL+V+ASP  GQV+K G D I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  20   CYGIVLFSSLHRTLVVTASPTSGQVLKGGVDKITVTWGLNQTVAAGTDSTYKTIKVKLCY  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DRGWRKTVD+L KD+TCQ  IV RPY  +    QS EW +E DVPTA YFVRAY
Sbjct  80   APISQVDRGWRKTVDNLKKDRTCQHKIVARPYNPANSTAQSHEWTVERDVPTATYFVRAY  139

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AYD+    VAYG       T  LF+VQA SGRH+++D  + CFS F++VS+FGFF+ EKR
Sbjct  140  AYDADEKVVAYGQTTDAHKTTNLFQVQAISGRHVTMDTCSICFSVFSVVSLFGFFYNEKR  199



>ref|XP_008392882.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Malus 
domestica]
Length=203

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 134/181 (74%), Gaps = 7/181 (4%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            QT YG VLFSSL  +L V+AS  E QV+KAG D +++SWGLNQS E G D ++KT KVKL
Sbjct  19   QTSYGIVLFSSLKDSLFVTASHAENQVLKAGIDKLTVSWGLNQSSEAGTDSTFKTIKVKL  78

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DRGWRKTVD+L+KDKTC   IVER  Y+S+ N S EW IE DVP A YFVRA
Sbjct  79   CYAPVSQVDRGWRKTVDNLAKDKTCLLKIVERS-YTSKSNDSVEWTIERDVPGATYFVRA  137

Query  450  YAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YA+++AG EVAYG T        LF V+  SGRH+SLDIA+  FS F+++S+ GFF AEK
Sbjct  138  YAFNAAGQEVAYGQTTNAKKTANLFVVEGISGRHMSLDIASVVFSVFSVLSLGGFFIAEK  197

Query  612  R  614
            R
Sbjct  198  R  198



>gb|KDO69464.1| hypothetical protein CISIN_1g028785mg [Citrus sinensis]
Length=204

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 135/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CYG  LFSSL +TL V+ + K GQV+KAGED ++++WGLNQS   G D +YKT K++LC+
Sbjct  20   CYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGLNQSLAAGTDSAYKTMKLQLCF  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYA  455
            AP SQ DR WRKT D L+KDKTC F IVE+PY  S   Q+ +W+IE+DVPTA YFVRAYA
Sbjct  80   APVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSL--QTLDWIIESDVPTATYFVRAYA  137

Query  456  YDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRG  617
             ++  +EVAYG       T  LF +QA +GRH SLDIA+ CFS F++V++FGFFF EKR 
Sbjct  138  LNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDIASVCFSVFSIVALFGFFFHEKRK  197

Query  618  RRL  626
             R+
Sbjct  198  ARM  200



>ref|NP_001267619.1| high-affinity nitrate transporter 3.1-like precursor [Cucumis 
sativus]
 ref|XP_004157776.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cucumis 
sativus]
 gb|ACV33078.2| high-affinity nitrate transport system component [Cucumis sativus]
 gb|KGN64351.1| High-affinity nitrate transport system component [Cucumis sativus]
Length=211

 Score =   226 bits (577),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 135/179 (75%), Gaps = 7/179 (4%)
 Frame = +3

Query  99   YGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            +G + FSSLP+TL V+ASPK GQV+KAG D IS++W LN++ + G D SYK  K KLCYA
Sbjct  21   HGNIHFSSLPRTLEVTASPKPGQVLKAGVDKISVTWVLNETVKAGSDSSYKNIKAKLCYA  80

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAYA  455
            P SQ DR WRKT DDL KDKTCQFSIVE+ Y  + K  QSFEW ++ D+PT  +FVRAY 
Sbjct  81   PVSQVDRAWRKTEDDLKKDKTCQFSIVEKQYNPANKTVQSFEWTVKRDIPTGTFFVRAYV  140

Query  456  YDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
             +SAG EVAYG T        LF++++ +GRH+SLDIA+ACFS F++VS+FGFFF +KR
Sbjct  141  LNSAGEEVAYGQTTDAKKGTNLFQIESITGRHISLDIASACFSAFSVVSLFGFFFIDKR  199



>gb|KHG18250.1| High-affinity nitrate transporter 3.2 -like protein [Gossypium 
arboreum]
Length=203

 Score =   226 bits (575),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 9/185 (5%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A+TCYG + FSSL +TL+V+AS ++G ++KAGED I++ WGLNQS+  G   SYKT KV+
Sbjct  18   AETCYGVISFSSLQRTLVVTASHRQG-LLKAGEDKITVRWGLNQSFPAGTYSSYKTIKVQ  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DR WRKT D L+KDKTCQF IV++PY  +  N++ EW IE DVPTA +F+R
Sbjct  77   LCYAPISQVDRAWRKTEDHLNKDKTCQFKIVKKPY--TNVNETLEWTIERDVPTATFFIR  134

Query  447  AYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYA DS  +EVAYG          LF++QA +GRH+SLDIA+ CFS F++VS+ GFFF E
Sbjct  135  AYALDSDDHEVAYGQNTDAEKKTNLFEIQAITGRHVSLDIASVCFSAFSVVSLMGFFFME  194

Query  609  KRGRR  623
            KR  R
Sbjct  195  KRKAR  199



>ref|XP_010102954.1| hypothetical protein L484_018973 [Morus notabilis]
 gb|EXB94472.1| hypothetical protein L484_018973 [Morus notabilis]
Length=224

 Score =   226 bits (576),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 140/196 (71%), Gaps = 22/196 (11%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQ--------------VVKAGEDSISMSWGLNQSY  224
            A+  +G VLFSSL +TL+V+ASPKEGQ              V+KAGED I+++WGLN+++
Sbjct  23   AEISFGKVLFSSLKRTLVVTASPKEGQASIIRATSNVIEFAVLKAGEDKITVNWGLNKTF  82

Query  225  ERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEW  404
              G D +YKT KVKLCYAP SQ DR WRKT +DLSKDKTCQF IV R Y +S+  QSFEW
Sbjct  83   PAGTDSAYKTIKVKLCYAPISQEDRAWRKTKEDLSKDKTCQFKIVSRAYTASD--QSFEW  140

Query  405  MIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFS  566
             +E  VP A YFVRAYAYD+  + VAYG       T  LF ++A +GRH SLDIA+ CFS
Sbjct  141  TVERYVPLATYFVRAYAYDANDDPVAYGQSTDGKKTTNLFDIKAITGRHASLDIASICFS  200

Query  567  GFALVSVFGFFFAEKR  614
             F++VS+FGFF+AEKR
Sbjct  201  AFSVVSLFGFFYAEKR  216



>gb|AFK48944.1| unknown [Lotus japonicus]
Length=202

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 134/185 (72%), Gaps = 7/185 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A TCYG VLFSSL +TL V+ASPK GQVV+AG D+I+++W LN++   G D SYKT KVK
Sbjct  17   AGTCYGKVLFSSLKKTLDVTASPKHGQVVEAGLDAITVTWALNKTLPAGTDSSYKTIKVK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT D+LS+DKTCQ  IV +PY +S K   +FEW+IE DVP A YFV
Sbjct  77   LCYAPISQQDRAWRKTEDELSRDKTCQHKIVAKPYDASNKTVHTFEWLIERDVPEATYFV  136

Query  444  RAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA DS   +V YG       T  LFK+QA +GRHLSLD  +AC S F++VS+  FF+ 
Sbjct  137  RAYALDSNDVQVGYGQTSDAKKTSNLFKIQAITGRHLSLDTCSACLSAFSVVSLIFFFYI  196

Query  606  EKRGR  620
            EKR +
Sbjct  197  EKRKK  201



>gb|EYU34506.1| hypothetical protein MIMGU_mgv1a014017mg [Erythranthe guttata]
Length=203

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 134/185 (72%), Gaps = 7/185 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A TC GA  FSSL QTL+V+ASP+  QV+KAGED I+++W LN ++  GVD SYKT  +K
Sbjct  15   AATCRGAT-FSSLQQTLIVTASPQPAQVLKAGEDEITVTWSLNSTFPAGVDSSYKTVTIK  73

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DRGWRKTVD+L KDKTCQ  IV    Y    N +F   +  DVPTA YF+R
Sbjct  74   LCYAPISQKDRGWRKTVDNLVKDKTCQHKIVANKPYIFPSNNTFTSTVLRDVPTATYFIR  133

Query  447  AYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYA +S G+EVAYG T      + LF++QA +GRH+SLDIA+ CFS F++VS+FGFFF E
Sbjct  134  AYAQNSEGDEVAYGQTTDSHKAVNLFEIQAITGRHVSLDIASICFSAFSIVSLFGFFFLE  193

Query  609  KRGRR  623
            KR  +
Sbjct  194  KRKSK  198



>emb|CDP12708.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 130/177 (73%), Gaps = 8/177 (5%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
              V FSSL +TL+V ASP +GQV+KAGED I+++W  N +   G D +YKT KVKLCYAP
Sbjct  21   NGVTFSSLQRTLIVRASPTQGQVLKAGEDKITVTWSYNNTLAPGTDSTYKTIKVKLCYAP  80

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             SQ DR WRKTVDDL+KDKTCQF IV +PY +S  N +  W IE D PTA YF+RAYA++
Sbjct  81   ISQVDRAWRKTVDDLAKDKTCQFKIVAKPYSAS--NSTITWTIERDTPTATYFLRAYAFN  138

Query  462  SAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            SA  EVA+G       T  LF+V+A SGRH SLDIAA CFS F+++S+FGFFF EKR
Sbjct  139  SAEEEVAFGQTTDAHKTTNLFQVEAISGRHASLDIAAICFSSFSVLSLFGFFFIEKR  195



>ref|XP_008360776.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Malus 
domestica]
Length=203

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 133/181 (73%), Gaps = 7/181 (4%)
 Frame = +3

Query  90   QTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            QT YG VLFSSL  +L V+AS  E QV+KAG D +++SWGLNQS E G D ++KT KVKL
Sbjct  19   QTSYGIVLFSSLKDSLFVTASHAENQVLKAGIDKLTVSWGLNQSSEAGTDSTFKTIKVKL  78

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ DRGWRKTVD+L+KDKTC   IVE   Y+S+ N S EW IE DVP A YFVRA
Sbjct  79   CYAPVSQVDRGWRKTVDNLAKDKTCLXKIVEXS-YTSKSNDSVEWTIERDVPGATYFVRA  137

Query  450  YAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            YA+++AG EVAYG T        LF V+  SGRH+SLDIA+  FS F+++S+ GFF AEK
Sbjct  138  YAFNAAGQEVAYGQTTNAKKTANLFVVEGISGRHMSLDIASVVFSVFSVLSLGGFFIAEK  197

Query  612  R  614
            R
Sbjct  198  R  198



>ref|XP_011015287.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=200

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CY AVLFSSL +TL V+ASP  GQV+K G D I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  20   CYVAVLFSSLQKTLAVTASPTSGQVLKGGVDKITVTWGLNQTLAAGTDSTYKTIKVKLCY  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DR WRKTVD + KD+TCQ  IV RPY S+ K  QS EW ++ DVPTA YF+RAY
Sbjct  80   APMSQVDRAWRKTVDRIKKDRTCQHKIVARPYNSANKTFQSLEWTVQRDVPTATYFIRAY  139

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AY++  +EVAYG       T  LF+V++ +GRH+++D+ + CFS F++VS+  FF+ EKR
Sbjct  140  AYNADESEVAYGQTTDAHKTTNLFQVESITGRHMAMDVCSVCFSVFSVVSLLVFFYIEKR  199



>ref|XP_011101276.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Sesamum 
indicum]
Length=203

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 134/180 (74%), Gaps = 9/180 (5%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            +C G V FSSL  TL+V+ASP+ GQV+KAGED I+++W LN S+  G+D +Y T KVKLC
Sbjct  19   SCCG-VTFSSLQDTLIVTASPQPGQVLKAGEDKITVTWALNTSFPAGIDSAYGTIKVKLC  77

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            +AP SQ DR WRKTVD+L KDKTC   IV +PY +S  N +F W ++ DVPTA YF+RAY
Sbjct  78   FAPISQQDRAWRKTVDNLKKDKTCLHKIVAKPYSTS--NNTFTWTVQRDVPTATYFIRAY  135

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            A +SA  EVAYG       T  LF+VQA SGRH+SLDIA+ CFS F+++S+FGFFF EKR
Sbjct  136  ACNSADEEVAYGQTTDSHKTTNLFEVQAISGRHVSLDIASVCFSAFSILSLFGFFFLEKR  195



>ref|XP_002318088.2| hypothetical protein POPTR_0012s09110g [Populus trichocarpa]
 gb|EEE96308.2| hypothetical protein POPTR_0012s09110g [Populus trichocarpa]
Length=205

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CY AVLFSSL +TL V+ASP  GQV+K G D I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  20   CYEAVLFSSLQKTLAVTASPTSGQVLKGGVDKITVTWGLNQTLAAGTDSTYKTIKVKLCY  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DR WRKTVD + KD+TCQ  IV RPY S+ K  QS EW ++ DVPTA YF+RAY
Sbjct  80   APLSQVDRAWRKTVDRIKKDRTCQHKIVARPYNSANKTFQSLEWTVQRDVPTATYFIRAY  139

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AY++  +EVAYG       T  LF+V++ +GRH+++D+ + CFS F++VS+  FF+ EKR
Sbjct  140  AYNADESEVAYGQTTDAHKTTNLFQVESITGRHMAMDVCSICFSVFSVVSLLVFFYIEKR  199



>ref|XP_011040463.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=200

 Score =   220 bits (561),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            CY A+LFSSL +TL V+ASP  GQV+K G D I+++WGLNQ+   G D +YKT KVKLCY
Sbjct  20   CYVALLFSSLQKTLAVTASPTSGQVLKGGLDKITVTWGLNQTLAAGTDSTYKTIKVKLCY  79

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAY  452
            AP SQ DR WRKTVD + KD+TCQ  IV RPY S+ K  QS EW ++ DVPTA YF+RAY
Sbjct  80   APMSQVDRAWRKTVDRIKKDRTCQHKIVARPYNSANKTFQSLEWTVQRDVPTATYFIRAY  139

Query  453  AYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AY++  +EVAYG       T  LF+V++ +GRH+++D+ + CFS F++VS+  FF+ EKR
Sbjct  140  AYNADESEVAYGQTTDAHKTTNLFQVESITGRHMAMDVCSVCFSVFSVVSLLVFFYIEKR  199



>dbj|BAP74416.1| nitrate transporter [Chrysanthemum sp. CSG-2014]
Length=199

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 130/178 (73%), Gaps = 10/178 (6%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
            G VLFSSLP++L VSASP EGQV+KAGE+ I +++GLNQ+     +  YK  +VKLCYAP
Sbjct  21   GDVLFSSLPRSLSVSASPTEGQVLKAGENDIVLAFGLNQTVANQTNGLYKKMEVKLCYAP  80

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAYAY  458
             SQ DR WRKTVD+L KDKTCQF+I ++PY   E N + F W IE D+PTA YFVRAYAY
Sbjct  81   ISQVDRKWRKTVDNLKKDKTCQFTIYDKPY---ETNVEGFRWKIEKDIPTATYFVRAYAY  137

Query  459  DSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
             S G E+AYG T        LF++Q  SGRH SLDIA+ CFS FALVS+FGFF  EKR
Sbjct  138  GSNGEEIAYGQTTNDKKTDNLFRIQGISGRHASLDIASVCFSVFALVSLFGFFMIEKR  195



>ref|XP_009798083.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Nicotiana sylvestris]
Length=205

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 135/182 (74%), Gaps = 9/182 (5%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A T Y A LFSSL QTL++++SP +GQV++AGE  ++++W LN+S   G D +YKT KVK
Sbjct  19   ALTAYSA-LFSSLHQTLILNSSPSQGQVLQAGEGQVTITWSLNKSNPAGTDSNYKTVKVK  77

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DRGWRK+ D+L KDK+C+++IV  PY S   N +F W +  DVPTA YF+R
Sbjct  78   LCYAPISQVDRGWRKSDDNLEKDKSCKYNIVTMPYNS--LNNNFTWTVNKDVPTATYFIR  135

Query  447  AYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AY YDSAG EVAYG T        LF++ A +GRH++LDI AACFS F+++S+FGFFF E
Sbjct  136  AYVYDSAGEEVAYGQTTDSHKKTNLFQILAITGRHVTLDICAACFSTFSIISLFGFFFIE  195

Query  609  KR  614
            KR
Sbjct  196  KR  197



>ref|XP_008439011.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cucumis 
melo]
Length=213

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 129/176 (73%), Gaps = 7/176 (4%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
            G +  SSLP+TL V+ASPK GQV+KAG D I ++W LN + + G D SYK  K KLCYAP
Sbjct  22   GNIHLSSLPRTLEVTASPKPGQVLKAGVDKIRVTWVLNGTVKAGSDSSYKNIKAKLCYAP  81

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAYAY  458
             SQ DR WRKT DDL KDKTCQF IVE+PY  + K  QSFEW +E DVPT  +FVRAY +
Sbjct  82   VSQVDRAWRKTEDDLKKDKTCQFDIVEKPYNPANKTAQSFEWTVERDVPTGTFFVRAYVF  141

Query  459  DSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            +SAG EVAYG T        LF++++ +GRH+SLDIA+ CFS F++VS+FGFFF +
Sbjct  142  NSAGQEVAYGQTTDDKKGTNLFQIESITGRHVSLDIASVCFSAFSVVSLFGFFFID  197



>ref|XP_003549822.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Glycine 
max]
Length=208

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 132/183 (72%), Gaps = 7/183 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A +CYG V FSSL +TL V+ASPK+ QV++AG D I+++W LN++   G D +YKT K+K
Sbjct  18   AGSCYGKVHFSSLKRTLDVTASPKQEQVLEAGLDKITVTWALNKTLPAGTDSAYKTIKLK  77

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT D+L +DKTCQ  IV +PY +S K  Q FEW++E DVP A YFV
Sbjct  78   LCYAPISQKDRAWRKTEDELKRDKTCQHKIVAKPYDASNKTVQRFEWLVERDVPKATYFV  137

Query  444  RAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA+DS   EVAYG T        LF++ A SGRH SLDI + CFS F++VS+F FF+ 
Sbjct  138  RAYAFDSNDEEVAYGQTTDAKKSTNLFEINAVSGRHASLDICSICFSAFSVVSLFVFFYI  197

Query  606  EKR  614
            EKR
Sbjct  198  EKR  200



>ref|XP_004299149.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Fragaria 
vesca subsp. vesca]
Length=210

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 132/183 (72%), Gaps = 11/183 (6%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSAS--PKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTK  260
            A T YG VLFSSL QTL+V+ +     G ++KAGED IS++WGLNQS   G D +YKT K
Sbjct  19   AGTSYG-VLFSSLKQTLVVTTTHVAANGTLLKAGEDKISVTWGLNQSLPAGTDSAYKTVK  77

Query  261  VKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYF  440
            VKLCYAP SQ DRGWRKTVD+L KDKTCQ  IV RPY +S   ++FEW IE DVPT  YF
Sbjct  78   VKLCYAPVSQVDRGWRKTVDNLVKDKTCQKKIVARPYNAS--TETFEWTIERDVPTGKYF  135

Query  441  VRAYAYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFF  602
            VR YA+D+ G EVAYG          LF+VQ+ +GRH++LDI + CFS F+++S+ GFF 
Sbjct  136  VRTYAFDAEGVEVAYGQNTGAKKDSNLFEVQSITGRHVTLDIVSVCFSAFSVLSLAGFFI  195

Query  603  AEK  611
            AEK
Sbjct  196  AEK  198



>ref|XP_007155490.1| hypothetical protein PHAVU_003G205900g [Phaseolus vulgaris]
 gb|ESW27484.1| hypothetical protein PHAVU_003G205900g [Phaseolus vulgaris]
Length=207

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 132/183 (72%), Gaps = 7/183 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A +CYG V FSSL  TL V+ASPK+GQV++AG D I+++W LN++   G D +YKT KVK
Sbjct  17   AGSCYGKVHFSSLKNTLDVTASPKQGQVLEAGTDKITVTWALNKTVSTGADSAYKTIKVK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT ++LS+DKTCQ  IV +PY +S K  Q FEW+IE D+P A YFV
Sbjct  77   LCYAPISQKDRAWRKTEEELSRDKTCQHKIVAKPYDASNKTVQRFEWVIEKDIPKATYFV  136

Query  444  RAYAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA++S   EVA+G T        LF + + SGRH SLDI + CFS F++VS+F FF+ 
Sbjct  137  RAYAFNSNDEEVAFGQTTDAKKSSNLFDINSISGRHASLDICSICFSAFSVVSLFVFFYI  196

Query  606  EKR  614
            EKR
Sbjct  197  EKR  199



>ref|XP_006344486.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Solanum 
tuberosum]
Length=207

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = +3

Query  105  AVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPE  284
            A LFSSL QTLL+++SP +GQV++AGE  ++++W LN SY  G D +YKT  VKLCYAP 
Sbjct  25   AALFSSLQQTLLINSSPSQGQVLQAGEAQVTITWSLNNSYPTGTDTNYKTVNVKLCYAPV  84

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DRGWRK+ ++L KDKTCQ ++V  PY  S  N +F W I  DVPTA YF+RAY YDS
Sbjct  85   SQLDRGWRKSNNNLKKDKTCQINLVTMPYKPS--NNNFTWTIHKDVPTATYFIRAYVYDS  142

Query  465  AGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
             G  VAYG T        LFK+ A +GRH+++D+ AACFS F+++S+ GF+F EKR
Sbjct  143  TGEVVAYGQTTDAHKKTNLFKITAITGRHITIDVCAACFSVFSIISLVGFYFVEKR  198



>gb|EYU17760.1| hypothetical protein MIMGU_mgv1a013981mg [Erythranthe guttata]
Length=204

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 137/186 (74%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A TC GA  FSSL QTL+V+ASP+  QV+KAGED I+++W LN ++  GVD SYKT  +K
Sbjct  15   AATCRGAT-FSSLQQTLIVTASPQPAQVLKAGEDEITVTWSLNSTFPAGVDSSYKTVTIK  73

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIV-ERPYYSSEKNQSFEWMIETDVPTALYFV  443
            LCYAP SQ  RGWRKTVD+L KDKTCQ  IV  +PY SS  N +F   +  DVPTA YF+
Sbjct  74   LCYAPISQKYRGWRKTVDNLVKDKTCQHKIVANKPYISSSSNNTFTSTVLRDVPTATYFI  133

Query  444  RAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA +S G+EVAYG T      + LF++QA +GRH+SLDIA+ CFS F+++S+FGFFF 
Sbjct  134  RAYAQNSEGDEVAYGQTTDSHKAVNLFEIQAITGRHVSLDIASICFSAFSILSLFGFFFL  193

Query  606  EKRGRR  623
            EKR  +
Sbjct  194  EKRKSK  199



>ref|XP_006853022.1| hypothetical protein AMTR_s00174p00057530 [Amborella trichopoda]
 gb|ERN14489.1| hypothetical protein AMTR_s00174p00057530 [Amborella trichopoda]
Length=205

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 122/176 (69%), Gaps = 6/176 (3%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
            G VLFS+L  TL+V ASPK G V+  GED I+++W LNQS   G D+ YK   +KLCYAP
Sbjct  21   GEVLFSTLNPTLVVQASPKAGNVLNVGEDHITVTWSLNQSLPHGTDQQYKRITIKLCYAP  80

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             SQ DR WRKTVDD+ KDKTCQF I  +PY  +    +  W+IE D+PTA YF+RAYA D
Sbjct  81   LSQKDRAWRKTVDDMKKDKTCQFKIAAQPYNPNNSTVTVSWLIERDIPTATYFIRAYASD  140

Query  462  SAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            S  N++AYG       T  LF++Q  +GRH SLDIAAACFS F++ S+FGFF  EK
Sbjct  141  SQDNKLAYGQTTNKNKTTNLFEIQGITGRHASLDIAAACFSAFSVFSLFGFFIREK  196



>ref|XP_009610896.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Nicotiana 
tomentosiformis]
Length=205

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 135/185 (73%), Gaps = 9/185 (5%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A T YGA LFSSL QTL++++SP +GQV+++GE  ++++W LN+S     D +YK  KVK
Sbjct  19   ALTAYGA-LFSSLHQTLVLNSSPTQGQVLQSGEGQVTVTWSLNKSNPGRTDSNYKRVKVK  77

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DRGWRK+ D+L KDK+C+++IV  PY S   N +F W+I+ DVPTA YF+R
Sbjct  78   LCYAPISQVDRGWRKSDDNLKKDKSCKYNIVTMPYNS--LNNNFTWIIDKDVPTATYFIR  135

Query  447  AYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AY YDS G EVAYG T      I LF + A +GRH+++DI AACFS F+++S+ GFFF E
Sbjct  136  AYVYDSVGEEVAYGQTTDSHKKINLFHILAITGRHVTIDICAACFSAFSIISLVGFFFIE  195

Query  609  KRGRR  623
            KR  +
Sbjct  196  KRKTK  200



>gb|EYU22195.1| hypothetical protein MIMGU_mgv1a013911mg [Erythranthe guttata]
Length=206

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 133/188 (71%), Gaps = 7/188 (4%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            TCYG V F +L  TL V+A+ KEG V+KAG D+I+++W L+ S   G D SYKT KVKLC
Sbjct  20   TCYGGVSFKTLQTTLAVTATHKEG-VLKAGLDNITVTWALDPSAPAGADASYKTIKVKLC  78

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DRGWRKT DDL+KDKTC   IV +PY +     +  W ++ DVPTA YFVRAY
Sbjct  79   YAPVSQVDRGWRKTKDDLTKDKTCSHKIVAKPYIAGGAVATATWTVQRDVPTAKYFVRAY  138

Query  453  AYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            A+D+A  E+AYG T +      LF ++A +GRH+SLDIA+ CFS F++VS+FGFFF E+R
Sbjct  139  AHDAADVELAYGQTTSVDKKTNLFDIEAVTGRHVSLDIASICFSAFSVVSLFGFFFLERR  198

Query  615  GRRLMAAN  638
              R+  A 
Sbjct  199  KTRIAEAK  206



>gb|EYU22193.1| hypothetical protein MIMGU_mgv1a019693mg [Erythranthe guttata]
Length=206

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 133/188 (71%), Gaps = 7/188 (4%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            TCYG V F SL  TL V+A+ KEG V+KAG D+I+++W L+ S   G D SYKT KVKLC
Sbjct  20   TCYGGVSFKSLHPTLTVTATHKEG-VLKAGLDNITVTWALDPSAPAGTDASYKTIKVKLC  78

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DRGWRKT DDL+KDKTC   IV +PY +     +  W ++ DVPTA YFVRAY
Sbjct  79   YAPVSQVDRGWRKTKDDLTKDKTCSHKIVAKPYIAGGAVATATWTVQRDVPTAKYFVRAY  138

Query  453  AYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            A++++  EVAYG T +      LF ++A +GRH+SLDIA+ CFS F++VS+FGFFF E+R
Sbjct  139  AHNASDMEVAYGQTTSTEKKTNLFDIEAVTGRHVSLDIASICFSAFSVVSLFGFFFLERR  198

Query  615  GRRLMAAN  638
              R+  A 
Sbjct  199  KTRIAEAK  206



>gb|AFK44790.1| unknown [Medicago truncatula]
 gb|KEH31764.1| component of high affinity nitrate transporter [Medicago truncatula]
Length=206

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 7/183 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A+ CYG  LFSSL +T+ V+ASPK+GQV+ +G D IS +W LN+++  G D SYKT K+K
Sbjct  17   AEICYGKDLFSSLKRTIDVTASPKQGQVLLSGVDKISGTWALNKTFPAGTDSSYKTIKLK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT D+LS+DKTCQ  ++  PY +S K  Q+FEW+I+ DVP A YFV
Sbjct  77   LCYAPISQKDRAWRKTEDELSRDKTCQHKMLAMPYNASNKTVQTFEWLIQRDVPQATYFV  136

Query  444  RAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA+DS   EVAYG T        LF++ A SGRH +LDI +  FS F++VS+  FF+ 
Sbjct  137  RAYAFDSNDKEVAYGQTTNAGKSTNLFEINAISGRHATLDICSVVFSAFSVVSLGVFFYI  196

Query  606  EKR  614
            EKR
Sbjct  197  EKR  199



>gb|EYU22194.1| hypothetical protein MIMGU_mgv1a026235mg [Erythranthe guttata]
Length=206

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 7/188 (4%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            TCYG V F SL  TL V+A+ KEG V+KAG D+++++W L+ S   G D SYKT KVKLC
Sbjct  20   TCYGGVSFKSLQPTLTVTATHKEG-VLKAGLDNVTVTWALDPSAPAGSDASYKTIKVKLC  78

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DRGWRKT DDL+KDKTC   IV +PY +     +  W +  DVPTA YFVRAY
Sbjct  79   YAPVSQVDRGWRKTKDDLTKDKTCSHKIVAKPYIAGGAVATATWTVLRDVPTAKYFVRAY  138

Query  453  AYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            A+D+A  E+ YG T +      LF ++A +GRH+SLDIA+ CFS F++VS+FGFFF E+R
Sbjct  139  AHDAADVELTYGQTTSADKKTNLFDIEAVTGRHVSLDIASICFSAFSVVSLFGFFFLERR  198

Query  615  GRRLMAAN  638
              R+  A 
Sbjct  199  KTRIAEAK  206



>gb|EYU22284.1| hypothetical protein MIMGU_mgv1a025936mg [Erythranthe guttata]
Length=205

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 132/188 (70%), Gaps = 7/188 (4%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            TC G V F+SL  TL V+A+ K G V+KAG D+++++W L+ S   G D SYKT KVKLC
Sbjct  19   TCDGIVSFNSLKPTLTVTATHK-GGVLKAGVDNVTVTWMLDPSVPAGTDSSYKTIKVKLC  77

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DRGWRKT DDLSKDKTC   IV +PY +     +  W ++ DVPTA YFVRAY
Sbjct  78   YAPVSQVDRGWRKTKDDLSKDKTCSHKIVAKPYVAGGAVATATWTVQRDVPTAKYFVRAY  137

Query  453  AYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            A+D+A  EVAYG T +      LF ++A +GRH+SLDIA+ CFS F++VS+FGFFF E+R
Sbjct  138  AHDAADMEVAYGQTTSADKKTNLFDIEAVTGRHVSLDIASVCFSAFSVVSLFGFFFLERR  197

Query  615  GRRLMAAN  638
              ++  A 
Sbjct  198  KTKIAEAK  205



>ref|XP_004515861.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cicer 
arietinum]
Length=205

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 131/183 (72%), Gaps = 7/183 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A+TCYG VLF+SL +TL V+ASPK GQV+ AGED IS +W LN+++  G D SYKT K+K
Sbjct  17   AETCYGKVLFTSLKRTLDVTASPKLGQVLLAGEDKISGTWVLNKTFPAGTDSSYKTIKLK  76

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT ++LS+DKTC   ++   Y +S K   +FEW+I+ DVP A YF+
Sbjct  77   LCYAPISQRDRAWRKTENELSRDKTCPHKMLAMHYDASNKTVHTFEWLIKKDVPQATYFI  136

Query  444  RAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA DS   +VAYG T        LF++ A SGRH++LDI + CFS F+++S+  FF+ 
Sbjct  137  RAYAVDSNDVQVAYGQTTNTNKSTNLFQINAISGRHITLDICSICFSAFSVLSLLVFFYI  196

Query  606  EKR  614
            EKR
Sbjct  197  EKR  199



>ref|XP_006852328.1| hypothetical protein AMTR_s00049p00207930 [Amborella trichopoda]
 gb|ERN13795.1| hypothetical protein AMTR_s00049p00207930 [Amborella trichopoda]
Length=202

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 120/176 (68%), Gaps = 9/176 (5%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
            G VLFS+L  TL+V ASP+ G V+  GED I+++W LNQS+ +G+D+ YK  KVKLCYAP
Sbjct  21   GGVLFSTLKPTLVVQASPRAGSVLNVGEDRITVTWSLNQSFPKGMDQQYKKIKVKLCYAP  80

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             SQ DR WRKTVDD+ KDKTCQF I  +PY S+    +  W+IE D PTA YF+R YA D
Sbjct  81   ISQKDRAWRKTVDDIKKDKTCQFKIAAQPYNSTA---TVAWLIERDTPTATYFIRTYALD  137

Query  462  SAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            S  NEV YG       T  LF +Q  SGR  SLD+AAA FS F++ S+F FF  EK
Sbjct  138  SQDNEVTYGQTTNKNKTTNLFVIQGISGRQASLDVAAAVFSVFSVFSLFAFFIREK  193



>ref|XP_011071967.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Sesamum 
indicum]
Length=204

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 125/179 (70%), Gaps = 8/179 (4%)
 Frame = +3

Query  105  AVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPE  284
            AV FSSLP+TL++S S  +G V++AGED+I+++W LN S   G D  YKT K+KLCYAP 
Sbjct  23   AVTFSSLPRTLVLSVSTTQGHVLRAGEDNITLAWSLNTSLPVGTDSGYKTVKLKLCYAPI  82

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DR WRKTVDDL+KDKTCQ  I  + Y  S  + +F W ++ DVPT  YFVRAY ++S
Sbjct  83   SQKDRAWRKTVDDLAKDKTCQHKIASQAY--SSSSSTFTWTLQKDVPTGTYFVRAYVHNS  140

Query  465  AGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            A   VAYG T        LF +QA SG H+SL +A+ CFS F++VS+FGFFF EKR  +
Sbjct  141  ADEVVAYGQTTDAHKATNLFDIQAISGSHVSLHVASVCFSAFSVVSLFGFFFLEKRKSK  199



>gb|AFK41592.1| unknown [Medicago truncatula]
 gb|KEH31763.1| component of high affinity nitrate transporter [Medicago truncatula]
Length=206

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 126/179 (70%), Gaps = 7/179 (4%)
 Frame = +3

Query  99   YGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            YG  LFSSL +TL V+ASPK GQV+ +G D IS +W LN+++  G D SYKT K+KLCYA
Sbjct  21   YGKDLFSSLKRTLDVTASPKHGQVLLSGVDKISGTWALNKTFPAGTDSSYKTIKLKLCYA  80

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAYA  455
              SQ DR WRKT D+LS+DKTCQ  ++  PY +S K  Q+FEW+I+ DVP A YFVRAYA
Sbjct  81   AISQKDRAWRKTEDELSRDKTCQHKMLAMPYNASNKTVQTFEWLIQRDVPQATYFVRAYA  140

Query  456  YDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            +DS   EVAYG T        LF++ A SGRH +LDI +  FS F++VS+  FF+ EKR
Sbjct  141  FDSNDKEVAYGQTTNAGKSTNLFEINAISGRHATLDICSVVFSAFSVVSLGVFFYIEKR  199



>ref|XP_011039571.1| PREDICTED: high-affinity nitrate transporter 3.1-like, partial 
[Populus euphratica]
Length=168

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = +3

Query  168  VVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQ  347
            V+K GED I+++WGLNQ+   G D +YKT KVKLCYAP SQ DRGWRKTVDDL KD+TCQ
Sbjct  7    VLKGGEDKITVTWGLNQTVAAGTDSTYKTIKVKLCYAPISQVDRGWRKTVDDLKKDRTCQ  66

Query  348  FSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALF  506
              IV RPY  +    QS EW +E DVPTA YF+RAYAYD+   EVAYG       T  LF
Sbjct  67   HKIVARPYNPANNTAQSHEWTVERDVPTATYFIRAYAYDADEKEVAYGQTTDAGRTTNLF  126

Query  507  KVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRG  617
            +VQA SGRH+++D  + CFS F++VS+FGFF+ EKR 
Sbjct  127  QVQAISGRHVTVDTCSICFSVFSVVSLFGFFYNEKRN  163



>ref|XP_009404237.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Musa acuminata subsp. malaccensis]
Length=200

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 121/183 (66%), Gaps = 13/183 (7%)
 Frame = +3

Query  96   CY----GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKV  263
            CY     AVLFSSLPQTL V+ASP  GQV+ AG D I+++W LNQS   G D  YK  KV
Sbjct  17   CYIGPSAAVLFSSLPQTLRVTASPSPGQVLHAGVDEITVTWALNQSLPAGTDSGYKKVKV  76

Query  264  KLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFV  443
             LCYAP SQ DRGWRKT D L KDKTCQF +  RPY ++    +  + +E ++PTA +FV
Sbjct  77   TLCYAPVSQTDRGWRKTDDHLKKDKTCQFKMATRPYAAT---GTVTYTVERNIPTATFFV  133

Query  444  RAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAY  D++  EVAYG       T  LF +   +GRH SLDIAAACFS F++V++  FF  
Sbjct  134  RAYVLDASDTEVAYGQSTDPKKTTNLFDIAGITGRHASLDIAAACFSAFSVVALAFFFVI  193

Query  606  EKR  614
            EKR
Sbjct  194  EKR  196



>ref|XP_003525590.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Glycine 
max]
Length=208

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 134/183 (73%), Gaps = 7/183 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A +CYG V FS+L +TL V+ASPK+GQV++AG D I+++W LN++   G D +YKT K+K
Sbjct  18   AGSCYGKVHFSTLKRTLDVTASPKQGQVLEAGLDKITVTWALNKTLPAGTDSAYKTIKLK  77

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFV  443
            LCYAP SQ DR WRKT D+L++DKTCQ  IV +PY +S K  Q +EW++E DVP A YFV
Sbjct  78   LCYAPISQKDRAWRKTEDELNRDKTCQHKIVAKPYDASNKTVQRYEWLVERDVPKATYFV  137

Query  444  RAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA+DS   EVAYG T        LF++ A SGRH SLDI + CFS F++VS+F FF+ 
Sbjct  138  RAYAFDSNDAEVAYGQTTDGKKSTNLFEINAVSGRHASLDICSICFSVFSVVSLFFFFYI  197

Query  606  EKR  614
            EKR
Sbjct  198  EKR  200



>ref|XP_008798750.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Phoenix 
dactylifera]
Length=230

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A    G VLFS+LP+TL+VSASPK+G V+ AGED I++SWGLN+S   G DE+YK  +V+
Sbjct  45   AGPAVGGVLFSTLPKTLMVSASPKQGYVLGAGEDKITVSWGLNRSLPAGADEAYKEVEVR  104

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQADRGWRKT DDLSKDKTCQF +  RP Y++  + SFE+ +  ++PTA YF+R
Sbjct  105  LCYAPASQADRGWRKTDDDLSKDKTCQFGVAVRP-YTTTNSTSFEYELSRELPTATYFIR  163

Query  447  AYAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACF  563
            AY  D  G  VAYG T        LF+V   SGR LSLDIAA CF
Sbjct  164  AYVLDFDGKVVAYGQTTDDRKAADLFEVVGISGRSLSLDIAAGCF  208



>ref|XP_009610897.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Nicotiana 
tomentosiformis]
Length=204

 Score =   194 bits (494),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 120/180 (67%), Gaps = 9/180 (5%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            +C+  +LFSSL ++L +SAS +EG V+ AGED I + W  N+++  G D SYK  KV LC
Sbjct  20   SCHAEILFSSLKKSLDISASHREG-VLMAGEDQIILEWSFNKTFPAGADSSYKKVKVHLC  78

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DR WRKT D L KDKTCQF+IV  PY SS    SF W IE DVPT  YF+RAY
Sbjct  79   YAPISQKDRLWRKTEDHLKKDKTCQFNIVTMPYKSS--GNSFNWTIERDVPTGTYFIRAY  136

Query  453  AYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
              DS G+E  +G          LF +QA SGRH +LDI +  FS F++VS+FGFF+ EKR
Sbjct  137  VLDSDGHETGFGQNTDEKKIDNLFDIQAISGRHSTLDICSIVFSVFSVVSLFGFFYMEKR  196



>ref|XP_009798081.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Nicotiana 
sylvestris]
Length=204

 Score =   194 bits (494),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 120/180 (67%), Gaps = 9/180 (5%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            +C+  +LFSSL ++L VSAS +EG V+ AGED + + W  N+++  G D SYK  KV+LC
Sbjct  20   SCHAEILFSSLKRSLDVSASHREG-VLMAGEDQLILKWSFNKTFPAGADSSYKKVKVQLC  78

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            YAP SQ DR WRKT D L KDKTCQ +IV  PY SS    SF W IE D+PT  YFVRAY
Sbjct  79   YAPVSQKDRAWRKTEDHLKKDKTCQLNIVTMPYKSS--GNSFNWTIERDIPTGTYFVRAY  136

Query  453  AYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
              DS G+E  +G          LF +QA SGRH +LDI +  FS F++VS+FGFF+ EKR
Sbjct  137  VLDSDGHETGFGQNTDDKKIDNLFDIQAISGRHATLDICSIVFSVFSVVSLFGFFYMEKR  196



>ref|XP_004301016.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Fragaria 
vesca subsp. vesca]
Length=224

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 127/192 (66%), Gaps = 22/192 (11%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKE--------------GQVVKAGEDSISMSWGLNQSYERGV-  236
            G VLFSSLP T+ +  SP +              G ++KAGED +S+SW LNQS+  G  
Sbjct  27   GVVLFSSLPNTIEMIVSPHKPEQVVKPAEGSWTFGGMLKAGEDKLSISWRLNQSFSAGTT  86

Query  237  DESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPY-YSSEKNQSFEWMIE  413
            D +YKT KVKLCYAP SQ DRGWRKTVD+L+KDKTCQF I  R Y + S K +  +W I+
Sbjct  87   DSAYKTVKVKLCYAPVSQVDRGWRKTVDNLAKDKTCQFKIETRAYKHGSSKWKYVDWTIK  146

Query  414  TDVPTALYFVRAYAYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFA  575
             DVPTA YFVRAYAYD AG  VAYG +        +F+VQ  +GRH +LD+ + CFS F+
Sbjct  147  RDVPTASYFVRAYAYDGAGVAVAYGQSTGPKKNYNIFEVQGITGRHKTLDVVSICFSAFS  206

Query  576  LVSVFGFFFAEK  611
            ++S+ GFF  EK
Sbjct  207  VLSLVGFFVIEK  218



>ref|XP_010929915.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1 [Elaeis guineensis]
Length=203

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 121/184 (66%), Gaps = 14/184 (8%)
 Frame = +3

Query  96   CY-----GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTK  260
            CY     G+  FS L +TL+V+ASPK GQV+ AGED I+++W LN S   G D +YK  K
Sbjct  19   CYVGSSMGSAHFSDLKRTLIVTASPKPGQVLYAGEDKITVTWKLNSSLPAGTDAAYKKVK  78

Query  261  VKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYF  440
            VKLCYAP SQ DRGWRKT D+L KDKTCQF +  +PY  S    SF + I+  VPTA YF
Sbjct  79   VKLCYAPVSQKDRGWRKTDDNLKKDKTCQFKVTTQPYAGS---GSFVYTIDRTVPTATYF  135

Query  441  VRAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFF  602
            VRAY  D++  E+AYG T        LF +   +GRH SLDIAA CFS F++V++  FF 
Sbjct  136  VRAYVVDASDTELAYGQTTDAKKSTNLFDIVGITGRHASLDIAAGCFSAFSVVALLFFFV  195

Query  603  AEKR  614
             EKR
Sbjct  196  MEKR  199



>gb|EYU28626.1| hypothetical protein MIMGU_mgv1a0249302mg, partial [Erythranthe 
guttata]
Length=162

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 113/157 (72%), Gaps = 6/157 (4%)
 Frame = +3

Query  171  VKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQF  350
            +KAGED I+++W LN ++  GVD SYKT  +KLCYAP SQ DRGWRKTVD+L KDKTCQ 
Sbjct  1    LKAGEDEITVTWSLNSTFPAGVDSSYKTVTIKLCYAPISQKDRGWRKTVDNLVKDKTCQH  60

Query  351  SIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHT------IALFKV  512
             IV    Y    N +F   +  DVPTA YF+RAYA +S G+EVAYG T      + LF++
Sbjct  61   KIVANKPYIFPSNNTFTSTVLRDVPTATYFIRAYAQNSEGDEVAYGQTTDSHKAVNLFEI  120

Query  513  QATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            QA +GRH+SLDIA+ CFS F++VS+FGFFF EKR  +
Sbjct  121  QAITGRHVSLDIASICFSAFSIVSLFGFFFLEKRKSK  157



>ref|XP_009415973.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1 [Musa acuminata subsp. malaccensis]
Length=198

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 116/183 (63%), Gaps = 11/183 (6%)
 Frame = +3

Query  93   TCYG---AVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKV  263
            +C G   AVLFSSLP TL V++SP  GQV+ AG D I +SW LNQS     D  YK  KV
Sbjct  14   SCIGSSMAVLFSSLPNTLTVTSSPAAGQVLHAGVDQIKVSWKLNQSTPASADSGYKKVKV  73

Query  264  KLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFV  443
             LCY P SQADRGWRKT D L KDKTCQF +  +PY  S    SF + +E  +PT  YFV
Sbjct  74   LLCYDPVSQADRGWRKTDDHLKKDKTCQFKVTTQPY--SSGGGSFVYTVERSIPTGTYFV  131

Query  444  RAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFA  605
            RAYA DS   EVAYG       T  LF V   +GRH SLDIAA CFS F+++++  FF  
Sbjct  132  RAYALDSGDTEVAYGQTTNAAKTTNLFDVVGITGRHASLDIAAGCFSAFSILALVFFFVV  191

Query  606  EKR  614
            EKR
Sbjct  192  EKR  194



>ref|XP_008793734.1| PREDICTED: high-affinity nitrate transporter 3.2 [Phoenix dactylifera]
Length=201

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 120/184 (65%), Gaps = 14/184 (8%)
 Frame = +3

Query  96   CY-----GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTK  260
            CY     G+V FS L +TL+V+ASPK GQV+ AGED I+++W LN S     D +Y+  K
Sbjct  17   CYVGSSMGSVHFSDLKETLIVTASPKSGQVLYAGEDKITVTWKLNSSLPASTDAAYEKVK  76

Query  261  VKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYF  440
            VKLCYAP SQ DRGWRKT D+L KDKTCQF I  +PY       SFE+ ++  VPTA YF
Sbjct  77   VKLCYAPVSQKDRGWRKTEDNLKKDKTCQFKITNQPYAG---GGSFEYTVDRSVPTATYF  133

Query  441  VRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFF  602
            VRAY  D++  E+AYG       T  LF V   +G H SLDIAA CFS F++V++  FF 
Sbjct  134  VRAYVVDASDTELAYGQTTDAKKTTNLFDVVGITGHHASLDIAAGCFSAFSVVALLFFFV  193

Query  603  AEKR  614
             EK+
Sbjct  194  MEKK  197



>ref|XP_010555506.1| PREDICTED: high-affinity nitrate transporter 3.1 [Tarenaya hassleriana]
Length=207

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = +3

Query  111  LFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQ  290
            LF+ L  TL V+A P    V+  G+D +S++W LN +   G D  YKT  VKLCYAP SQ
Sbjct  28   LFTDLQHTLAVTAKPSRQGVLDPGKDKVSVTWRLNSTAAPGSDSDYKTVAVKLCYAPVSQ  87

Query  291  ADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAG  470
             DR WRKT ++L KDKTC  +IV RPY  +   QSF+W IE D+PTA YFVRAYA DS G
Sbjct  88   VDRPWRKTSNELFKDKTCPHNIVSRPYDGTP--QSFDWTIERDIPTASYFVRAYALDSKG  145

Query  471  NEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             + AYG +        LF VQA SGRH SLDIA+ CFS F++V++FGFF  EKR  +L
Sbjct  146  EKAAYGQSTDASKSANLFSVQAISGRHASLDIASICFSVFSVVALFGFFANEKRKAKL  203



>ref|XP_009379949.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Musa acuminata subsp. malaccensis]
Length=204

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
             AVLFSSLP+T++V+ASP  GQV+ AG D ++++W +NQS       +YK  KV  CYAP
Sbjct  27   AAVLFSSLPKTIIVTASPSPGQVLYAGVDQMNVTWAINQSLPGATVSAYKKVKVSFCYAP  86

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             SQADRGWRKT D+L KDKTCQF I  +PY ++    S  + +E  +PTA +FVRAY  D
Sbjct  87   ASQADRGWRKTDDNLKKDKTCQFKITTQPYATAG---SVAYTVERSIPTATFFVRAYVLD  143

Query  462  SAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            S   EVAYG       T  LF V   +GRH SL IAAACFS F++V++  FF  EKR
Sbjct  144  SEDAEVAYGQSTNAQKTTNLFDVVGITGRHSSLGIAAACFSAFSVVALAFFFVVEKR  200



>gb|AAM12786.1| unknown [Capsicum annuum]
Length=202

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 118/181 (65%), Gaps = 9/181 (5%)
 Frame = +3

Query  99   YGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            +  +LFSSL ++L V+   + G V+ AGED++ + W LN+++  G D +YKT K+KLCYA
Sbjct  22   HAEILFSSLKKSLEVTVKHRAG-VLMAGEDTLEIDWFLNKTFPAGTDSAYKTIKLKLCYA  80

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAY  458
            P SQ DR WRKT D + KDKTCQF +   PY SS  N  F W IE DVPT  +FVRAY  
Sbjct  81   PISQKDRAWRKTEDHIKKDKTCQFQVDSTPYKSS--NNKFNWTIERDVPTGTFFVRAYIL  138

Query  459  DSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +  G+E+ YG          LF +QA SGRH +LDI +  FS FA+VS+FGFF+ EKR  
Sbjct  139  NGDGHEIGYGQNTDDKKVNNLFDIQAISGRHATLDICSVVFSAFAVVSLFGFFYMEKRNA  198

Query  621  R  623
            +
Sbjct  199  K  199



>ref|XP_006344484.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Solanum 
tuberosum]
Length=203

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            C G +LFS+L + L V A  K G V+ AGED ++  W LN +   G D  YK+ K++LCY
Sbjct  22   CDGEILFSTLKKALEVKADHKAG-VLMAGEDILTFKWSLNTTLSAGADSGYKSVKLQLCY  80

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYA  455
            AP SQ DR WRKT D L KDKTCQF IV  PY SS  N ++ W I+ D+PTA YFVRAY 
Sbjct  81   APISQKDRAWRKTEDHLKKDKTCQFKIVTVPYKSS--NNNYTWTIKRDIPTATYFVRAYV  138

Query  456  YDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
             ++ G E+ YG          LF +QA SGRH +LDI +  FS F++V++F FF+ EKR
Sbjct  139  LNANGEEIGYGQNTDDKKVDNLFSIQAISGRHATLDICSIVFSVFSVVALFAFFYMEKR  197



>ref|XP_010319027.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Solanum 
lycopersicum]
Length=203

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = +3

Query  96   CYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCY  275
            C G +LFS+L +++ V A  K G V+ AG D++++ W LN +   G D  YK+ K++LCY
Sbjct  22   CEGDILFSTLKKSIEVKADHKAG-VLMAGVDALTLKWSLNTTLPAGSDSGYKSVKLELCY  80

Query  276  APESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYA  455
            AP SQ DR WRKT D L KDKTCQF I   PY SS  N ++ W I+ D+PTA YFVRAY 
Sbjct  81   APISQKDRAWRKTEDHLKKDKTCQFKIATVPYKSS--NNNYNWTIKRDIPTATYFVRAYV  138

Query  456  YDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRG  617
             +  G E+ YG          LF +QA SGRH +LDI +  FS F++VS+F FF+ EKR 
Sbjct  139  LNGNGEEIGYGQNTDDKKVDNLFSIQAISGRHATLDICSVVFSAFSVVSLFAFFYMEKRK  198

Query  618  RR  623
             R
Sbjct  199  AR  200



>ref|XP_006647452.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Oryza 
brachyantha]
Length=208

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 114/171 (67%), Gaps = 2/171 (1%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  S LP+ L+V+AS K G+V+ AGE++++++W LN +   G D ++K+ KVKLCYAP S
Sbjct  34   VFLSKLPKALVVAASAKHGEVLHAGENTVTVTWSLNSTEPAGADAAFKSVKVKLCYAPAS  93

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            + DRGWRK  DDL KDK CQF +   PY +      F++++  DVPTA YFVRAYA D++
Sbjct  94   RKDRGWRKASDDLHKDKACQFKVTALPYAAGGGGGRFDYVVARDVPTASYFVRAYAVDAS  153

Query  468  GNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            G EVAYG T   A F V   +G H SL +AA  FS F++ ++  FF  EKR
Sbjct  154  GTEVAYGQTSPDAAFDVAGITGIHASLKVAAGVFSTFSIAALAFFFVVEKR  204



>gb|EAY86523.1| hypothetical protein OsI_07902 [Oryza sativa Indica Group]
Length=206

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  S LP+ L+V  SPK G+VV AGE++++++W LN S   G D ++K+ KVKLCYAP S
Sbjct  34   VFLSKLPKALVVGVSPKHGEVVHAGENTVTVTWSLNTSEPAGADAAFKSVKVKLCYAPAS  93

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            + DRGWRK  DDL KDK CQF +  +PY +      F++++  D+PTA YFVRAYA D++
Sbjct  94   RTDRGWRKASDDLHKDKACQFKVTVQPYAAGAGR--FDYVVARDIPTASYFVRAYAVDAS  151

Query  468  GNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            G EVAYG +   A F V   +G H SL +AA  FS F++ ++  FF  EKR +
Sbjct  152  GTEVAYGQSSPDAAFDVAGITGIHASLKVAAGVFSTFSIAALAFFFVVEKRKK  204



>ref|NP_001047317.1| Os02g0595900 [Oryza sativa Japonica Group]
 sp|Q6ZI50.1|NAR21_ORYSJ RecName: Full=High-affinity nitrate transporter-activating protein 
2.1; Short=OsNAR2.1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD16835.1| component of high affinity nitrate transporter-like protein [Oryza 
sativa Japonica Group]
 dbj|BAF09231.1| Os02g0595900 [Oryza sativa Japonica Group]
 gb|EAZ23664.1| hypothetical protein OsJ_07366 [Oryza sativa Japonica Group]
Length=206

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  S LP+ L+V  SPK G+VV AGE++++++W LN S   G D ++K+ KVKLCYAP S
Sbjct  34   VFLSKLPKALVVGVSPKHGEVVHAGENTVTVTWSLNTSEPAGADAAFKSVKVKLCYAPAS  93

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            + DRGWRK  DDL KDK CQF +  +PY +      F++++  D+PTA YFVRAYA D++
Sbjct  94   RTDRGWRKASDDLHKDKACQFKVTVQPYAAGAGR--FDYVVARDIPTASYFVRAYAVDAS  151

Query  468  GNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            G EVAYG +   A F V   +G H SL +AA  FS F++ ++  FF  EKR +
Sbjct  152  GTEVAYGQSSPDAAFDVAGITGIHASLKVAAGVFSTFSIAALAFFFVVEKRKK  204



>ref|XP_004952977.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Setaria 
italica]
Length=203

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  S+LP+ L V+ASPK GQV+ AG D+++++W LN +   G D +YK  KV LCYAP S
Sbjct  30   VHLSTLPKALAVTASPKPGQVLHAGVDTVTVTWSLNTTEPAGADAAYKNVKVNLCYAPVS  89

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DRGWRK+ DDLSKDK CQF + ++ Y +  + +SF++ +  D+P+  Y+VRAYA D++
Sbjct  90   QKDRGWRKSEDDLSKDKACQFKLTQQAYAAGAR-RSFDYAVAKDIPSGTYYVRAYALDAS  148

Query  468  GNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            G +VAYG T   A F V   +G H S+ +AA  FS F++V++  FF  E R + 
Sbjct  149  GTQVAYGQTGPEAAFVVAGITGIHASIKVAAGVFSAFSVVALAFFFVIENRKKN  202



>gb|AAV35211.1| NAR2.2 [Triticum aestivum]
Length=199

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 112/171 (65%), Gaps = 4/171 (2%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP TL V ASP  GQV+ AGED I+++W LN S   G D +YK  KV LCYAP SQ 
Sbjct  29   LSKLPVTLDVIASPSPGQVLHAGEDVITVTWALNASRPAGDDAAYKNVKVSLCYAPASQK  88

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF + ++PY  +      E+ +  D+PTA Y+VRAYA D++G 
Sbjct  89   EREWRKTHDDLKKDKTCQFKVAQQPYAGA--GGRVEYRVALDIPTATYYVRAYALDASGT  146

Query  474  EVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T   A F V + +G   S+ +AA  FS F++VS+  FFF EKR +
Sbjct  147  QVAYGQTAPAAAFNVVSITGVTTSIKVAAGVFSTFSVVSLAFFFFIEKRKK  197



>ref|XP_010910986.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like, partial [Elaeis guineensis]
Length=159

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 105/154 (68%), Gaps = 7/154 (5%)
 Frame = +3

Query  171  VKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQF  350
            ++AGED I +SWGLNQS+  G DE+Y+  KV+LCYAP SQADRGWRKT DDLSKDKTCQF
Sbjct  1    LRAGEDQIMVSWGLNQSFPAGTDEAYRKVKVRLCYAPVSQADRGWRKTEDDLSKDKTCQF  60

Query  351  SIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHT------IALFKV  512
             +  R Y ++    SFE  +  ++PTA YFVRAYA D  G   AYG T        LF+V
Sbjct  61   DVAVRSYTTTTLT-SFECKLSRELPTATYFVRAYALDYNGRVAAYGQTTDDHKATNLFEV  119

Query  513  QATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
               SGR L LDIAA CFSGF++ S   FF A+KR
Sbjct  120  VGISGRSLWLDIAAGCFSGFSVGSRVVFFVADKR  153



>gb|AAP31851.1| NAR2.2 [Hordeum vulgare subsp. vulgare]
Length=201

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S L  TL V+ASP  GQV+ AGED I+++W LN +   G D +YK+ KV LCYAP SQ 
Sbjct  29   LSKLTVTLDVTASPTPGQVLHAGEDVITVTWALNATRPAGDDAAYKSVKVSLCYAPASQK  88

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF + ++PY +       E+ +  D+PTA Y+VRAYA D++G 
Sbjct  89   EREWRKTHDDLKKDKTCQFKVTQQPYAAGAAGGRVEYRVALDIPTAAYYVRAYALDASGT  148

Query  474  EVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T     F V + +G   S+ +AA  FS F++VS+  FFF EKR +
Sbjct  149  QVAYGQTAPATAFDVVSITGVTTSIKVAAGVFSTFSVVSLAFFFFIEKRKK  199



>ref|XP_004952978.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Setaria 
italica]
Length=203

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 117/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  S+LP+ L V+ASPK GQV+ AG D+++++W LN +   G D ++K  KV LCYAP S
Sbjct  30   VHLSTLPKALDVTASPKPGQVLHAGVDTVTVTWSLNTTEPAGADAAFKNVKVNLCYAPVS  89

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DRGWRK+ DDLSKDK CQF + ++ Y +  + +SF++ +  D+P+  Y+VRAYA D++
Sbjct  90   QKDRGWRKSEDDLSKDKACQFKLTQQAYAAGAR-RSFDYAVAKDIPSGTYYVRAYALDAS  148

Query  468  GNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            G +VAYG T   A F V   +G H S+ +AA  FS F++V++  FF  E R +
Sbjct  149  GTQVAYGQTGPEAAFVVAGITGIHASIKVAAGVFSAFSVVALAFFFVIENRKK  201



>gb|AAP31852.1| NAR2.3 [Hordeum vulgare subsp. vulgare]
Length=198

 Score =   171 bits (433),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP TL V+ASP  GQV+ AGED I+++W LN S   G D  YK  KV LCYAP SQ 
Sbjct  29   LSKLPVTLDVTASPTPGQVLHAGEDVITVTWALNASQPAGKDADYKNVKVSLCYAPVSQK  88

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF I ++ Y  + K    E+ +  D+PTA Y+VRAYA D++G 
Sbjct  89   EREWRKTHDDLKKDKTCQFKITQQAYPGAGK---VEYRVALDIPTATYYVRAYALDASGT  145

Query  474  EVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T   A F V + +G   S+ +AA  FS F++ S+  FFF EKR +
Sbjct  146  QVAYGQTAPTAAFNVVSITGVTTSIKVAAGVFSAFSVASLAFFFFIEKRKK  196



>gb|AFW72145.1| high affinity nitrate transporter [Zea mays]
Length=203

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  SSLP+ L V+ S K GQV+ AG DS++++W LN +   G D  YK  KVKLCYAP S
Sbjct  30   VHLSSLPKALDVTTSAKPGQVLHAGVDSLTVTWSLNATEPAGADAGYKGVKVKLCYAPAS  89

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DRGWRK+ DD+SKDK CQF + E+ Y ++    SF++ +  DVP+  Y++RA+A D++
Sbjct  90   QKDRGWRKSEDDISKDKACQFKVTEQAYAAAAPG-SFQYAVARDVPSGSYYLRAFATDAS  148

Query  468  GNEVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            G EVAYG T   A F V   +G H SL IAA  FS F++V++  FF  E R +
Sbjct  149  GAEVAYGQTAPTAAFDVAGITGIHASLKIAAGVFSAFSVVALAFFFVIETRKK  201



>ref|NP_001105929.1| high affinity nitrate transporter precursor [Zea mays]
 gb|AAY40796.1| high affinity nitrate transporter [Zea mays]
Length=203

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 114/174 (66%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  SSLP+ L V+ S K GQV+ AG DS++++W LN +   G D  YK  KVKLCYAP S
Sbjct  30   VHLSSLPKALDVTTSAKPGQVLHAGVDSLTVTWSLNATEPAGADAGYKGVKVKLCYAPAS  89

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DRGWRK+ DD+SKDK CQF + E+ Y ++    SF++ +  DVP+  Y++RA+A D++
Sbjct  90   QKDRGWRKSEDDISKDKACQFKVTEQAYAAAAPG-SFQYAVARDVPSGSYYLRAFATDAS  148

Query  468  GNEVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            G EVAYG T   A F V   +G H SL IAA  FS F++V++  FF  E R + 
Sbjct  149  GAEVAYGQTAPTAAFDVAGITGIHASLKIAAGVFSAFSVVALAFFFVIETRKKN  202



>ref|XP_003575282.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Brachypodium distachyon]
Length=201

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 114/176 (65%), Gaps = 3/176 (2%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
             A   S LP  L V+ASPK GQV+  GED  +++W LN +   G D +YK+ KV LCYAP
Sbjct  26   AAAYLSKLPVALDVTASPKPGQVLHGGEDVFTVTWSLNATQPAGADAAYKSVKVSLCYAP  85

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             SQ +R WRKT DDL KDKTCQF + ++PY +  + +  E+ +  D+PTA Y+VRAYA D
Sbjct  86   VSQKEREWRKTNDDLKKDKTCQFKVAQQPYAAGSQGK-VEYRVALDIPTATYYVRAYALD  144

Query  462  SAGNEVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            ++G +VAYG T     F+V + +G   S+ +AA  FS F++VS+  FFF E R + 
Sbjct  145  ASGTQVAYGQTKLADAFEVVSITGVTTSIKVAAGVFSAFSVVSLAFFFFIENRKKN  200



>gb|EMT31108.1| hypothetical protein F775_20186 [Aegilops tauschii]
Length=201

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP TL V+ASP  GQV+ AGED I+++W LN S   G D  YK  KV LCYAP SQ 
Sbjct  32   LSKLPVTLDVTASPSPGQVLHAGEDVITVTWALNASQPAGKDAEYKNVKVSLCYAPVSQK  91

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF + ++ Y  + K    E+ +  D+PTA Y+VRAYA D++G 
Sbjct  92   EREWRKTHDDLKKDKTCQFKVTQQAYPGTGK---VEYRVALDIPTATYYVRAYALDASGT  148

Query  474  EVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T   + F V + +G   S+ +AA  FS F++ S+  FFF EKR +
Sbjct  149  QVAYGQTAPASAFNVVSITGVTTSIKVAAGVFSAFSVASLAFFFFIEKRKK  199



>gb|AAV35210.1| NAR2.1 [Triticum aestivum]
Length=198

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP TL V+ASP  GQV+ AGED I+++W LN S   G D  YK  KV LCYAP SQ 
Sbjct  29   LSKLPVTLDVTASPSPGQVLHAGEDVITVTWALNASQPAGKDVDYKNVKVSLCYAPVSQK  88

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF + ++ Y  + K    E+ +  D+PTA Y+VRAYA D++G 
Sbjct  89   EREWRKTHDDLKKDKTCQFKVTQQAYPGTGK---VEYRVALDIPTATYYVRAYALDASGT  145

Query  474  EVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T   + F V + +G   S+ +AA  FS F++ S+  FFF EKR +
Sbjct  146  QVAYGQTAPSSAFNVVSITGVTTSIKVAAGVFSAFSVASLAFFFFIEKRKK  196



>ref|XP_003575281.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Brachypodium distachyon]
Length=200

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 113/171 (66%), Gaps = 3/171 (2%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP  L V+ASPK GQV+  GED  +++W LN +   G D +YK+ KV LCYAP SQ 
Sbjct  29   LSKLPVALDVTASPKPGQVLHGGEDVFTVTWSLNATQPAGADAAYKSVKVSLCYAPVSQK  88

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF + ++PY +  + +  E+ +  D+PTA Y+VRAYA D++G 
Sbjct  89   EREWRKTNDDLKKDKTCQFKVAQQPYAAGSQGK-VEYRVALDIPTATYYVRAYALDASGT  147

Query  474  EVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T     F+V + +G   S+ +AA  FS F++VS+  FFF E R +
Sbjct  148  QVAYGQTKLADAFEVVSITGVTTSIKVAAGVFSAFSVVSLAFFFFIENRKK  198



>ref|XP_002454118.1| hypothetical protein SORBIDRAFT_04g024870 [Sorghum bicolor]
 gb|EES07094.1| hypothetical protein SORBIDRAFT_04g024870 [Sorghum bicolor]
Length=211

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 114/175 (65%), Gaps = 3/175 (2%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            V  S+LP+ L V+AS K GQV+ AG DS++++W L  +   G D +YK  KVKLCYAP S
Sbjct  36   VHLSTLPEALAVTASAKPGQVLHAGVDSVTVTWSLKSTEPAGADAAYKDVKVKLCYAPAS  95

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPY-YSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            Q DRGWRK+ DDLSKDK CQF + ++ Y  ++    SF +++  DVP+  Y +RAYA D+
Sbjct  96   QKDRGWRKSEDDLSKDKACQFKVTQQAYAAAAGGGGSFTYVVARDVPSGSYHLRAYATDA  155

Query  465  AGNEVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            +G EVAYG T   A F V   +G H SL +AA  FS F++V++  FF  E R + 
Sbjct  156  SGTEVAYGQTSPAAAFDVAGITGIHASLKVAAGVFSAFSVVALAFFFVIENRKKN  210



>ref|XP_010448529.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X2 [Camelina sativa]
Length=208

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 117/179 (65%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF+ L  ++ V+A P ++G V++AG+D +++ W L  S +   D ++KT +VKLCYAP S
Sbjct  28   LFAELQNSIEVAAKPIQDGVVLEAGKDMVTVKWKLKSSAKVDADATFKTIQVKLCYAPIS  87

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC + IV +PY   +  QS +W +E D+PT  YFVR Y  D  
Sbjct  88   QVDRPWRKTHNELLKDKTCPYEIVSKPY--DKTPQSLDWTVELDIPTGTYFVRVYGIDGD  145

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G+EVAYG       T  LF +QA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  146  GHEVAYGQSSDEGRTTNLFSIQAISGGHVSLDIASILFSVFSVVSLLVFFVKEKKKAKL  204



>ref|XP_010448530.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X3 [Camelina sativa]
Length=203

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 117/179 (65%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF+ L  ++ V+A P ++G V++AG+D +++ W L  S +   D ++KT +VKLCYAP S
Sbjct  23   LFAELQNSIEVAAKPIQDGVVLEAGKDMVTVKWKLKSSAKVDADATFKTIQVKLCYAPIS  82

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC + IV +PY   +  QS +W +E D+PT  YFVR Y  D  
Sbjct  83   QVDRPWRKTHNELLKDKTCPYEIVSKPY--DKTPQSLDWTVELDIPTGTYFVRVYGIDGD  140

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G+EVAYG       T  LF +QA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  141  GHEVAYGQSSDEGRTTNLFSIQAISGGHVSLDIASILFSVFSVVSLLVFFVKEKKKAKL  199



>gb|AAP31850.1| NAR2.1 [Hordeum vulgare subsp. vulgare]
Length=197

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 117/180 (65%), Gaps = 7/180 (4%)
 Frame = +3

Query  93   TCYGAVLF-SSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKL  269
            T  GAV + S LP TL V+ASP  GQV+ AGED I+++W LN + + G D  YK  KV L
Sbjct  21   TSAGAVAYLSKLPVTLDVTASPSPGQVLHAGEDVITVTWALNTT-QAGKDADYKNVKVSL  79

Query  270  CYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            CYAP SQ +R WRKT DDL KDKTCQF + ++ Y  + K    E+ +  D+PTA Y+VRA
Sbjct  80   CYAPVSQKEREWRKTHDDLKKDKTCQFKVTQQAYPGAGK---VEYRVALDIPTATYYVRA  136

Query  450  YAYDSAGNEVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
            YA D++G +VAYG T   A F V + +G   S+ +AA  FS F++ S+  FFF EKR + 
Sbjct  137  YALDASGTQVAYGQTAPTAAFNVVSITGVTTSIKVAAGVFSAFSVASLAFFFFIEKRKKN  196



>gb|KFK26653.1| hypothetical protein AALP_AA8G276000 [Arabis alpina]
Length=205

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 115/179 (64%), Gaps = 12/179 (7%)
 Frame = +3

Query  111  LFSSLPQTLL-VSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LFS L +  L V+A P    V+ AG+D +S+SW L+       D  +KT KVKLCYAP S
Sbjct  28   LFSELRKDALEVTAKPSRDGVLDAGKDKVSISWKLSSG---ASDADFKTIKVKLCYAPSS  84

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT D+L KDKTC   IV +PY   +  QS ++ +E D+PT  YFVRAYA D  
Sbjct  85   QLDRPWRKTHDELFKDKTCPHKIVAKPY--DKTAQSMDYTLERDIPTGAYFVRAYAVDEN  142

Query  468  GNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G+EVA+G +        +FKVQA SGRH SLDIA+ CFS F+++++  FF  EKR  R+
Sbjct  143  GHEVAFGQSTDVAKNNNIFKVQAISGRHASLDIASICFSVFSVLALVVFFVNEKRKARI  201



>ref|XP_006281099.1| hypothetical protein CARUB_v10027129mg [Capsella rubella]
 gb|EOA13997.1| hypothetical protein CARUB_v10027129mg [Capsella rubella]
Length=211

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 117/182 (64%), Gaps = 13/182 (7%)
 Frame = +3

Query  111  LFSSLPQ-TLLVSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            LFS L + +L V+  P    EG V+ AG D IS++W L+ +  +   E +KT KVKLCYA
Sbjct  29   LFSDLEKGSLEVTTKPSREGEGVVLDAGIDKISITWKLSSTGSKKEAE-FKTIKVKLCYA  87

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAY  458
            P SQ DR WRKT D+L KDKTC   IV RPY   +  QS +W +E D+PT  YFVRAYA 
Sbjct  88   PTSQVDRPWRKTHDELFKDKTCPHKIVARPY--DKTTQSIDWTLERDIPTGTYFVRAYAV  145

Query  459  DSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            D+  +EVA+G +        LF VQA SGRH SLDIA+ CFS F++V++  FF  EKR  
Sbjct  146  DANDHEVAFGQSTDAAKKTGLFSVQAISGRHKSLDIASVCFSVFSVVALLVFFVNEKRKA  205

Query  621  RL  626
            ++
Sbjct  206  KI  207



>ref|XP_010441706.1| PREDICTED: high-affinity nitrate transporter 3.1 [Camelina sativa]
 ref|XP_010482331.1| PREDICTED: high-affinity nitrate transporter 3.1 [Camelina sativa]
Length=210

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 122/192 (64%), Gaps = 16/192 (8%)
 Frame = +3

Query  90   QTCYGA---VLFSSLPQ-TLLVSASPKE---GQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LFS L + +L V+  P     G V+ AG D IS++W L+ +  +   E +
Sbjct  18   QSSHGAEKERLFSELEKGSLEVTTKPSREGAGVVLDAGIDKISITWKLSSTGSKKEAE-F  76

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPT  428
            KT KVKLCYAP SQ DR WRKT D+L KDKTC   IV RPY   +  QS +W++E D+PT
Sbjct  77   KTIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIVARPY--DKTTQSIDWILERDIPT  134

Query  429  ALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVF  590
              YFVRAYA D   +EVA+G       T +LF VQA SGRH SLDIA+ CFS F+++++ 
Sbjct  135  GTYFVRAYAVDEHDHEVAFGQSTNEAKTTSLFSVQAISGRHKSLDIASVCFSVFSVLALL  194

Query  591  GFFFAEKRGRRL  626
             FF  EKR  ++
Sbjct  195  VFFVNEKRKAKI  206



>ref|XP_010438981.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X2 [Camelina sativa]
Length=208

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LFS L  +L V+  P ++G V++AG+D +++ W L  S +   D ++KT +VKLCYAP S
Sbjct  28   LFSVLQNSLDVTGKPVQDGVVLEAGKDMVTIKWKLKSSGKVDADATFKTIQVKLCYAPIS  87

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC   IV +PY   +  QS +W ++ D+PT  YFVRAY  D  
Sbjct  88   QVDRPWRKTHNELFKDKTCPHEIVSKPY--DKTPQSLDWTVDLDIPTGTYFVRAYGIDGD  145

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G EVAYG       T  LF VQA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  146  GQEVAYGQSSDEGRTKNLFSVQAISGGHVSLDIASILFSVFSVVSLLVFFVKEKKKAKL  204



>ref|XP_010448528.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X1 [Camelina sativa]
Length=228

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF+ L   + V+  P ++G V++AG+D +++ W L  S +   D ++KT +VKLCYAP S
Sbjct  48   LFTELQNLIEVTTKPMQDGVVLEAGKDMVTVKWKLKSSAKVDADATFKTIQVKLCYAPIS  107

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC + IV +PY   +  QS +W +E D+PT  YFVR Y  D  
Sbjct  108  QVDRPWRKTHNELLKDKTCPYEIVSKPY--DKTPQSLDWTVELDIPTGTYFVRVYGIDGD  165

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G+EVAYG       T  LF +QA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  166  GHEVAYGQSSDEGRTTNLFSIQAISGGHVSLDIASILFSVFSVVSLLVFFVKEKKKAKL  224



>ref|XP_009789615.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Nicotiana 
sylvestris]
Length=203

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 126/182 (69%), Gaps = 9/182 (5%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            A T +G +LFSSL  +LLVSAS ++G V+KAGE  I+++W    S   G D +YKT K+K
Sbjct  17   AATSHGEILFSSLKSSLLVSASHRQG-VLKAGEGDITLTWSYKSSNLAGTDSTYKTVKLK  75

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LCYAP SQ DR WR+T D L KDKTCQF IV +PY S+  N +F W IE DVPT  YFVR
Sbjct  76   LCYAPISQKDRAWRRTEDHLKKDKTCQFDIVTKPYKSA--NNNFTWTIERDVPTGTYFVR  133

Query  447  AYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AYA +SAG E  YG       T  LF+VQA SGRH +LDI +  FS F++VS+FGFF+ E
Sbjct  134  AYALNSAGEESGYGQNTNAEKTDDLFEVQAISGRHATLDICSVVFSVFSVVSLFGFFYME  193

Query  609  KR  614
            KR
Sbjct  194  KR  195



>gb|EMS58629.1| hypothetical protein TRIUR3_20504 [Triticum urartu]
Length=251

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP +L V+ASP  GQV+ AGED I+++W LN S   G D  YK  KV LCYAP SQ 
Sbjct  82   LSKLPVSLDVTASPSPGQVLHAGEDVITVTWALNASQPAGKDADYKNVKVSLCYAPVSQK  141

Query  294  DRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGN  473
            +R WRKT DDL KDKTCQF + ++ Y  + K    E+ +  D+PTA Y+VRAYA D++G 
Sbjct  142  EREWRKTHDDLKKDKTCQFKVTQQAYPGTGK---VEYRVALDIPTATYYVRAYALDASGT  198

Query  474  EVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            +VAYG T   + F V + +G   S+ +AA  FS F++ S+  FFF EKR +
Sbjct  199  QVAYGQTAPASAFNVVSITGVTTSIKVAAGVFSAFSVASLAFFFFIEKRKK  249



>ref|XP_006284533.1| hypothetical protein CARUB_v10005735mg [Capsella rubella]
 gb|EOA17431.1| hypothetical protein CARUB_v10005735mg [Capsella rubella]
Length=208

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            L S L  +L V+A P ++G V++AG+D ++++W L  S +   D ++KT +VKLCYAP S
Sbjct  28   LLSELQNSLDVTAKPAQDGVVLEAGKDMVTITWKLKSSAKVDADAAFKTIQVKLCYAPIS  87

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L +DKTC   IV + Y      QS +W ++ D+PT  YFVRAY  D  
Sbjct  88   QVDRPWRKTYNELRRDKTCPHEIVSKLY--DRTPQSLDWTVQLDIPTGTYFVRAYGIDGD  145

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G+EVAYG       T  LF VQA SG H+SLDIA+  FS F++VS+  FF  EKR  +L
Sbjct  146  GHEVAYGQSSDEGRTTNLFSVQAISGGHVSLDIASIFFSVFSVVSLLVFFVREKRKAKL  204



>ref|XP_010446000.1| PREDICTED: high-affinity nitrate transporter 3.1-like, partial 
[Camelina sativa]
Length=169

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = +3

Query  162  GQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKT  341
            G V+ AG D IS++W L+ +  +   E +KT KVKLCYAP SQ DR WRKT D+L KDKT
Sbjct  8    GVVLDAGIDKISITWKLSSTGSKKEAE-FKTIKVKLCYAPPSQVDRPWRKTHDELFKDKT  66

Query  342  CQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIAL  503
            C   IV RPY   +  QS +W++E D+PT  YFVRAYA D   +EVA+G       T +L
Sbjct  67   CPHKIVARPY--DKTTQSIDWILERDIPTGTYFVRAYAVDEHDHEVAFGQSTNEAKTTSL  124

Query  504  FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            F VQA SGRH SLDIA+ CFS F+++++  FF  EKR  ++
Sbjct  125  FSVQAISGRHKSLDIASVCFSVFSVLALLVFFVNEKRKAKI  165



>ref|XP_010438980.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X1 [Camelina sativa]
Length=241

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASPKEGQVV-KAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF+ L   L V+A P +  +V +AG+D +++ W L  S +   D ++KT +VKLCYAP S
Sbjct  61   LFTELQNLLEVTAKPVQDVIVLEAGKDMVTIKWKLKSSGKVDADATFKTIQVKLCYAPIS  120

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC   IV +PY   +  QS +W ++ D+PT  YFVRAY  D  
Sbjct  121  QVDRPWRKTHNELFKDKTCPHEIVSKPY--DKTPQSLDWTVDLDIPTGTYFVRAYGIDGD  178

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G EVAYG       T  LF VQA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  179  GQEVAYGQSSDEGRTKNLFSVQAISGGHVSLDIASILFSVFSVVSLLVFFVKEKKKAKL  237



>ref|XP_009138452.1| PREDICTED: high-affinity nitrate transporter 3.2 isoform X1 [Brassica 
rapa]
Length=209

 Score =   161 bits (408),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF++L  +L V+A P ++G V++AG+D + ++W L  S +   D ++KT +VKLCYAP S
Sbjct  29   LFTNLENSLEVTAKPLRDGVVLEAGKDMVRITWMLKSSGKVDGDTAFKTVEVKLCYAPIS  88

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++LS+D++C   IV +PY   +  QS  W I+ + PT  YFVRAY  D  
Sbjct  89   QVDRPWRKTHNELSRDRSCPHKIVSKPY--DKIPQSLNWTIDRETPTGTYFVRAYGTDVN  146

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G EVAYG       T  LF V+  SGRH SLDIA+ CFS F+  S+  F   EKR  +L
Sbjct  147  GQEVAYGQSSDAEKTTNLFSVEGISGRHTSLDIASICFSVFSFGSLLVFLVKEKRKAKL  205



>ref|XP_010667500.1| PREDICTED: high-affinity nitrate transporter 3.2 [Beta vulgaris 
subsp. vulgaris]
Length=198

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = +3

Query  93   TCYGAVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            TCY   +F+ L  TL VSASP     ++AG D I++SW LN++       +Y    VKLC
Sbjct  19   TCYSKGVFADLRNTLTVSASPSGRVDLRAGIDQITVSWRLNRNISNTDSATYSKVDVKLC  78

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            Y  ESQ DR WR+T +DLS+DKTCQFS+V++ Y SS    S  + ++ ++PTA YFVR Y
Sbjct  79   YHLESQKDRPWRRTEEDLSRDKTCQFSMVKKDYNSS--TDSVTYTVKKNIPTAHYFVRVY  136

Query  453  AYDSAGNEVAYGHTIAL-FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
              ++   E+AYG T  L   ++  SGR  S+D+AA+ FSGF+++S+  FFF EKR
Sbjct  137  VRNADNREIAYGQTNGLDLNIKGISGRSTSIDVAASVFSGFSVLSLAFFFFLEKR  191



>ref|XP_006402168.1| hypothetical protein EUTSA_v10014669mg [Eutrema salsugineum]
 gb|ESQ43621.1| hypothetical protein EUTSA_v10014669mg [Eutrema salsugineum]
Length=211

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 121/193 (63%), Gaps = 17/193 (9%)
 Frame = +3

Query  90   QTCYGAV---LFSSLPQ-TLLVSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LFS L +    V+  P    EG V+ AG D +S++W LN + +      +
Sbjct  18   QSSHGATKERLFSDLEKGAFEVTTKPSREGEGVVLDAGIDKLSITWKLNSTAKEA---EF  74

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVP  425
            KT KVKLCYAP SQ DR WRKT ++L KDK+C   IV RPY SS K  Q+ ++ +E D+P
Sbjct  75   KTIKVKLCYAPISQVDRPWRKTENELFKDKSCPHKIVARPYDSSVKTAQTIDYTLERDIP  134

Query  426  TALYFVRAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSV  587
            T  YFVRAYA D+  +EVA+G +        LF VQA SGRH SLDIA+ CFS F+++++
Sbjct  135  TGTYFVRAYAVDAHDHEVAFGQSTDEDKKTNLFSVQAISGRHKSLDIASICFSVFSVLAL  194

Query  588  FGFFFAEKRGRRL  626
              FF  EKR  ++
Sbjct  195  LVFFVNEKRKAKI  207



>ref|XP_010433734.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X3 [Camelina sativa]
Length=208

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
             F+ L  +L V+A P ++G V++AG+D +++ W L  S +   D+++K  +VKLCYAP S
Sbjct  28   FFTELQNSLEVTAKPVQDGLVLEAGKDMVTIKWKLKSSAKVDADDTFKKIQVKLCYAPIS  87

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC   IV + Y   +  QS +W ++ D+PT  YFVRAY  D  
Sbjct  88   QVDRPWRKTHNELFKDKTCPHEIVSKSY--DKTPQSLDWTVDLDIPTGTYFVRAYGIDGD  145

Query  468  GNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G EVAYG +        LF VQA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  146  GQEVAYGQSSDEGRKKNLFSVQAISGGHVSLDIASILFSIFSVVSLLVFFVKEKKKAKL  204



>ref|XP_002864044.1| wound-responsive 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40303.1| wound-responsive 3 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 120/192 (63%), Gaps = 16/192 (8%)
 Frame = +3

Query  90   QTCYGA---VLFSSLPQTLL-VSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LF  L +  L V+  P    +G V+ AG+D+++++W L+    +   E +
Sbjct  18   QSSHGAEKVRLFKELDKGALDVTTQPSRQGDGVVLDAGKDTLNITWKLSAIGSKREAE-F  76

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPT  428
            K  KVKLCYAP SQ DR WRKT D+L KDKTC   I+ +PY   +  QS  W +E D+PT
Sbjct  77   KIIKVKLCYAPPSQLDRPWRKTHDELFKDKTCPHKIIAKPY--DKTPQSTVWTVERDIPT  134

Query  429  ALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVF  590
              YFVRAYA D+ G+EVAYG       T  LF VQA SGRH SLDIA+ CFS F++V++ 
Sbjct  135  GTYFVRAYAVDAIGHEVAYGQSTDDAKTTNLFSVQAISGRHTSLDIASICFSVFSVVALV  194

Query  591  GFFFAEKRGRRL  626
             FF  EKR  ++
Sbjct  195  VFFVNEKRKAKI  206



>emb|CDX83019.1| BnaA01g20190D [Brassica napus]
Length=206

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 115/179 (64%), Gaps = 11/179 (6%)
 Frame = +3

Query  111  LFSSLPQTLL-VSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LFS L +  L V+A P    V+ AG D +S++W L+ + ++  +  + T KVKLCYAP S
Sbjct  28   LFSDLEKDALDVTAKPSRQGVLDAGIDKLSITWKLSSTAKKQAN--FTTIKVKLCYAPVS  85

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC   I+ R Y  S  +QSF++ ++ D+PT  YFVR YA D+ 
Sbjct  86   QVDRPWRKTENELFKDKTCPHKIITRAYNKS--SQSFKYTLDRDIPTGTYFVRTYAVDAK  143

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             +EVA+G       T  LF VQA SGRH SLDIA+ CFS F+++++  FF  EKR  +L
Sbjct  144  DHEVAFGQSTNEAKTTNLFSVQAISGRHKSLDIASVCFSVFSVLALLVFFVNEKRKAKL  202



>ref|XP_010438982.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X3 [Camelina sativa]
Length=200

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 111/178 (62%), Gaps = 15/178 (8%)
 Frame = +3

Query  111  LFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQ  290
            LFS L  +L V+       V++AG+D +++ W L  S +   D ++KT +VKLCYAP SQ
Sbjct  28   LFSVLQNSLDVT-------VLEAGKDMVTIKWKLKSSGKVDADATFKTIQVKLCYAPISQ  80

Query  291  ADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAG  470
             DR WRKT ++L KDKTC   IV +PY   +  QS +W ++ D+PT  YFVRAY  D  G
Sbjct  81   VDRPWRKTHNELFKDKTCPHEIVSKPY--DKTPQSLDWTVDLDIPTGTYFVRAYGIDGDG  138

Query  471  NEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             EVAYG       T  LF VQA SG H+SLDIA+  FS F++VS+  FF  EK+  +L
Sbjct  139  QEVAYGQSSDEGRTKNLFSVQAISGGHVSLDIASILFSVFSVVSLLVFFVKEKKKAKL  196



>emb|CDY34047.1| BnaC03g27680D [Brassica napus]
Length=206

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 118/189 (62%), Gaps = 14/189 (7%)
 Frame = +3

Query  90   QTCYGAV---LFSSLPQ-TLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTT  257
            Q  +GA    LFS L +  L V+A P    V+ AG D +S++W L+ +  +  +  + T 
Sbjct  18   QISHGATKERLFSDLEKGALEVTAKPSRESVLDAGIDKLSITWKLSSTATKEAE--FTTI  75

Query  258  KVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALY  437
            KVKLCYAP SQ DR WRKT ++L KDK+C   I+ R Y  S   QSFE+ +E D+PT  Y
Sbjct  76   KVKLCYAPVSQVDRPWRKTENELFKDKSCPHKIITRAYDKSP--QSFEYTLERDIPTGTY  133

Query  438  FVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFF  599
            FVRAYA D+  +EVA+G       +  LF VQA SGRH SLDIA+ CFS F+++++  FF
Sbjct  134  FVRAYAVDAKDHEVAFGQSTDEAKSTNLFSVQAISGRHKSLDIASVCFSVFSVLALLVFF  193

Query  600  FAEKRGRRL  626
              EKR  ++
Sbjct  194  VNEKRKAKI  202



>ref|NP_199831.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 ref|NP_851159.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 ref|NP_851160.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 sp|Q9FGS5.1|NRT31_ARATH RecName: Full=High-affinity nitrate transporter 3.1; AltName: 
Full=Protein WOUND-RESPONSIVE 3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09391.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAC36292.1| putative component of high affinity nitrate transporter [Arabidopsis 
thaliana]
 gb|AED95909.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 gb|AED95910.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 gb|AED95911.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
Length=210

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 16/192 (8%)
 Frame = +3

Query  90   QTCYGA---VLFSSLPQTLL-VSASPKE---GQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LF  L +  L V+  P     G V+ AG+D+++++W L+ S     +  +
Sbjct  18   QSIHGAEKVRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTLS-SIGSKREAEF  76

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPT  428
            K  KVKLCYAP SQ DR WRKT D+L KDKTC   I+ +PY   +  QS  W +E D+PT
Sbjct  77   KIIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIIAKPY--DKTLQSTTWTLERDIPT  134

Query  429  ALYFVRAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVF  590
              YFVRAYA D+ G+EVAYG +        LF VQA SGRH SLDIA+ CFS F++V++ 
Sbjct  135  GTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDIASICFSVFSVVALV  194

Query  591  GFFFAEKRGRRL  626
             FF  EKR  ++
Sbjct  195  VFFVNEKRKAKI  206



>ref|XP_009150665.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Brassica 
rapa]
Length=206

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 115/179 (64%), Gaps = 11/179 (6%)
 Frame = +3

Query  111  LFSSLPQTLL-VSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LFS L +  L V+A P    V+ AG D +S++W L  + ++  +  + T KVKLCYAP S
Sbjct  28   LFSDLEKDALDVTAKPSRQGVLDAGIDKLSITWKLRSTAKKQAN--FTTIKVKLCYAPVS  85

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++L KDKTC   I+ R Y  S  +QSF++ ++ D+PT  YFVR YA D+ 
Sbjct  86   QVDRPWRKTENELFKDKTCPHKIITRAYNKS--SQSFKYTLDRDIPTGTYFVRTYAVDAK  143

Query  468  GNEVAYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             +EVA+G + +      LF VQA SGRH SLDIA+ CFS F+++++  FF  EKR  +L
Sbjct  144  DHEVAFGQSTSEAKPTKLFSVQAISGRHKSLDIASVCFSVFSVLALLVFFVNEKRKAKL  202



>emb|CAC36942.1| putative component of high affinity nitrate transporter [Arabidopsis 
thaliana]
Length=210

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 16/192 (8%)
 Frame = +3

Query  90   QTCYGA---VLFSSLPQTLL-VSASPKE---GQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LF  L +  L V+  P     G V+ AG+D+++++W L+ S     +  +
Sbjct  18   QSIHGAEKLRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTLS-SIGSKREAEF  76

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPT  428
            K  KVKLCYAP SQ DR WRKT D+L KDKTC   I+ +PY   +  QS  W +E D+PT
Sbjct  77   KIIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIIAKPY--DKTLQSTTWTLERDIPT  134

Query  429  ALYFVRAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVF  590
              YFVRAYA D+ G+EVAYG +        LF VQA SGRH SLDIA+ CFS F++V++ 
Sbjct  135  GTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDIASICFSVFSVVALV  194

Query  591  GFFFAEKRGRRL  626
             FF  EKR  ++
Sbjct  195  VFFVNEKRKAKI  206



>ref|XP_009134048.1| PREDICTED: high-affinity nitrate transporter 3.1 [Brassica rapa]
Length=206

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 118/189 (62%), Gaps = 14/189 (7%)
 Frame = +3

Query  90   QTCYGAV---LFSSLPQ-TLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTT  257
            Q  +GA    LFS L +  L V+A P    V+ AG D +S++W L+ +  +  +  + T 
Sbjct  18   QISHGATKERLFSDLEKGALEVTAKPSREGVLDAGIDKLSITWKLSSTATK--EAEFTTI  75

Query  258  KVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALY  437
            KVKLCYAP SQ DR WRKT ++L KDK+C   I+ R Y  S   QSFE+ +E D+PT  Y
Sbjct  76   KVKLCYAPVSQVDRPWRKTENELFKDKSCPHKIITRAYDKSP--QSFEYTLERDIPTGTY  133

Query  438  FVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFF  599
            FVRAYA D+  +EVA+G       +  LF VQA SGRH SLDIA+ CFS F+++++  FF
Sbjct  134  FVRAYAVDAKDHEVAFGQSTNEAKSTNLFSVQAISGRHKSLDIASVCFSVFSVLALLVFF  193

Query  600  FAEKRGRRL  626
              EKR  ++
Sbjct  194  VNEKRKAKI  202



>emb|CDY64637.1| BnaA03g57010D [Brassica napus]
Length=206

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 118/189 (62%), Gaps = 14/189 (7%)
 Frame = +3

Query  90   QTCYGAV---LFSSLPQ-TLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTT  257
            Q  +GA    LFS L +  L V+A P    V+ AG D +S++W L+ +  +  +  + T 
Sbjct  18   QISHGATKERLFSDLEKGALEVTAKPSREGVLDAGIDKLSITWKLSSTATK--EAEFTTI  75

Query  258  KVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALY  437
            KVKLCYAP SQ DR WRKT ++L KDK+C   I+ R Y  S   QSFE+ +E D+PT  Y
Sbjct  76   KVKLCYAPVSQVDRPWRKTENELFKDKSCPHKIITRAYDKSP--QSFEYTLERDIPTGTY  133

Query  438  FVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFF  599
            FVRAYA D+  +EVA+G       +  LF VQA SGRH SLDIA+ CFS F+++++  FF
Sbjct  134  FVRAYAVDAKDHEVAFGQSTNEAKSTNLFSVQAISGRHKSLDIASICFSVFSVLALLVFF  193

Query  600  FAEKRGRRL  626
              EKR  ++
Sbjct  194  VNEKRKAKI  202



>emb|CDY03424.1| BnaC01g16580D [Brassica napus]
Length=208

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF++L  +L V+A P + G V +AG+D + ++W L  S +   D ++KT +VKLCYAP S
Sbjct  28   LFTNLENSLEVTAKPTRVGVVWEAGKDIVRITWMLKSSAKVNDDAAFKTVEVKLCYAPIS  87

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRKT ++LS+D++C   IV +PY   +  QS  W I+ + PT  YF+RAY  D  
Sbjct  88   QVDRPWRKTHNELSRDRSCPHKIVSKPY--DKIPQSLNWTIDRETPTGTYFIRAYGTDVN  145

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            G EVAYG       T  LF V+  SGRH SLDIA+ CFS F+  S+  F   EKR  +L
Sbjct  146  GYEVAYGQSSDAEKTTNLFSVEGISGRHTSLDIASICFSVFSFGSLLVFLVKEKRKAKL  204



>gb|ACG30087.1| component of high affinity nitrate transporter [Zea mays]
Length=197

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = +3

Query  105  AVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPE  284
            AV  S+L +TL+V ASPK GQV+ AGED+I+++W LN S        YK  +V LCYAP 
Sbjct  27   AVHLSALGRTLIVEASPKAGQVLHAGEDTITVTWHLNASAS---SVGYKALEVTLCYAPA  83

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DRGWRK  DDLSKDK CQF I    Y   +   +  + +  DVPTA Y VRAYA D+
Sbjct  84   SQEDRGWRKANDDLSKDKACQFRIARHAYAGGQG--TLRYRVARDVPTASYHVRAYALDA  141

Query  465  AGNEVAYGHTIAL--FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            +G  V YG T     F V   SG H SL +AAA  S F++ ++  F   EKR
Sbjct  142  SGAPVGYGQTAPAYYFHVAGVSGVHASLRVAAAVLSAFSIAALAFFVVVEKR  193



>ref|NP_001105924.1| high affinity nitrate transporter precursor [Zea mays]
 gb|AAY40797.1| high affinity nitrate transporter [Zea mays]
Length=195

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = +3

Query  105  AVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPE  284
            AV  S+L +TL+V ASPK GQV+ AGED+I+++W LN S        YK  +V LCYAP 
Sbjct  25   AVHLSALGRTLIVEASPKAGQVLHAGEDTITVTWHLNASAS---SVGYKALEVTLCYAPA  81

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DRGWRK  DDLSKDK CQF I    Y   +   +  + +  DVPTA Y VRAYA D+
Sbjct  82   SQEDRGWRKANDDLSKDKACQFRIARHAYAGGQG--TLRYRVARDVPTASYHVRAYALDA  139

Query  465  AGNEVAYGHTIAL--FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            +G  V YG T     F V   SG H SL +AAA  S F++ ++  F   EKR
Sbjct  140  SGAPVGYGQTAPAYYFHVAGVSGVHASLRVAAAVLSAFSIAALAFFVVVEKR  191



>tpg|DAA37306.1| TPA: high affinity nitrate transporter [Zea mays]
Length=197

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = +3

Query  105  AVLFSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPE  284
            AV  S+L +TL+V ASPK GQV+ AGED+I+++W LN S        YK  +V LCYAP 
Sbjct  27   AVHLSALGRTLIVEASPKAGQVLHAGEDTITVTWHLNASAS---SVGYKALEVTLCYAPA  83

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DRGWRK  DDLSKDK CQF I    Y   +   +  + +  DVPTA Y VRAYA D+
Sbjct  84   SQEDRGWRKANDDLSKDKACQFRIARHAYAGGQG--TLRYRVARDVPTASYHVRAYALDA  141

Query  465  AGNEVAYGHTIAL--FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            +G  V YG T     F V   SG H SL +AAA  S F++ ++  F   EKR
Sbjct  142  SGAPVGYGQTAPAYYFHVAGVSGVHASLRVAAAVLSAFSIAALAFFVVVEKR  193



>ref|XP_006438234.1| hypothetical protein CICLE_v10033654mg, partial [Citrus clementina]
 gb|ESR51474.1| hypothetical protein CICLE_v10033654mg, partial [Citrus clementina]
Length=154

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 17/157 (11%)
 Frame = +3

Query  171  VKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQF  350
            +KAG+D I++SW LN+S+ R  D+ YK  KV LCYAP SQ D  W KT DD++KD+TCQF
Sbjct  1    LKAGDDKITVSWSLNRSF-RATDDLYKKVKVTLCYAPASQVDGAWSKTEDDMTKDRTCQF  59

Query  351  SIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHTIA------LFKV  512
            +I          N S   MIE D P A YFV  YA DSAG EV +G T        LF++
Sbjct  60   TI----------NHSLGSMIENDAPEASYFVTVYASDSAGKEVGFGQTFGARKSSNLFEI  109

Query  513  QATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
             A S RHLSL+I++ CFS F  VS+FGF+F E+  R+
Sbjct  110  HAISERHLSLEISSMCFSFFPAVSLFGFYFVERSKRK  146



>sp|Q9SB67.1|NRT32_ARATH RecName: Full=High-affinity nitrate transporter 3.2; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA22991.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79382.1| hypothetical protein [Arabidopsis thaliana]
Length=209

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 113/180 (63%), Gaps = 10/180 (6%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYER-GVDESYKTTKVKLCYAPE  284
            LF+ L  ++ V+A P K+  V++AG+D ++++W L  S  +   D ++KT +VKLCYAP 
Sbjct  28   LFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKLCYAPI  87

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DR WRKT + L KD++C   IV + Y   +  QS +W I  D+PT  YFVRAY  D 
Sbjct  88   SQVDRPWRKTDNKLFKDRSCPHEIVSKAY--DKTPQSLDWTIGLDIPTGTYFVRAYGIDG  145

Query  465  AGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             G+EVAYG       T  LF V A SG H+ LDIA+  FS F++VS+F FF  EKR  +L
Sbjct  146  DGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIASTFFSVFSVVSLFVFFVMEKRKAKL  205



>gb|ABF59166.1| hypothetical protein At4g24720 [Arabidopsis thaliana]
Length=231

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 113/180 (63%), Gaps = 10/180 (6%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYER-GVDESYKTTKVKLCYAPE  284
            LF+ L  ++ V+A P K+  V++AG+D ++++W L  S  +   D ++KT +VKLCYAP 
Sbjct  50   LFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKLCYAPI  109

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DR WRKT + L KD++C   IV + Y   +  QS +W I  D+PT  YFVRAY  D 
Sbjct  110  SQVDRPWRKTDNKLFKDRSCPHEIVSKAY--DKTPQSLDWTIGLDIPTGTYFVRAYGIDG  167

Query  465  AGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             G+EVAYG       T  LF V A SG H+ LDIA+  FS F++VS+F FF  EKR  +L
Sbjct  168  DGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIASTFFSVFSVVSLFVFFVMEKRKAKL  227



>ref|NP_001190826.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
 gb|AEE84949.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
Length=231

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 113/180 (63%), Gaps = 10/180 (6%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYER-GVDESYKTTKVKLCYAPE  284
            LF+ L  ++ V+A P K+  V++AG+D ++++W L  S  +   D ++KT +VKLCYAP 
Sbjct  50   LFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKLCYAPI  109

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DR WRKT + L KD++C   IV + Y   +  QS +W I  D+PT  YFVRAY  D 
Sbjct  110  SQVDRPWRKTDNKLFKDRSCPHEIVSKAY--DKTPQSLDWTIGLDIPTGTYFVRAYGIDG  167

Query  465  AGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             G+EVAYG       T  LF V A SG H+ LDIA+  FS F++VS+F FF  EKR  +L
Sbjct  168  DGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIASTFFSVFSVVSLFVFFVMEKRKAKL  227



>ref|XP_010433732.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X1 [Camelina sativa]
 ref|XP_010433733.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X2 [Camelina sativa]
Length=208

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 13/181 (7%)
 Frame = +3

Query  111  LFSSLPQTLLVSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAP  281
            LF+ L ++L V+  PK   +G V++AG+D +++ W L  S +   D+++K  +VKLCYAP
Sbjct  28   LFTELQKSLEVT--PKHVQDGVVLEAGKDMVTIKWKLKSSAKVDADDTFKKIQVKLCYAP  85

Query  282  ESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             SQ DR WRKT ++L KDKTC   IV + Y   +  QS +W ++ D+PT  YFVRAY  D
Sbjct  86   ISQVDRPWRKTHNELFKDKTCPHEIVSKSY--DKTPQSLDWTVDLDIPTGTYFVRAYGID  143

Query  462  SAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
              G EVAYG +        LF VQA SG H+SLDIA+  FS F++VS+  FF  EK+  +
Sbjct  144  GDGQEVAYGQSSDEGRKKNLFSVQAISGGHVSLDIASILFSIFSVVSLLVFFVKEKKKAK  203

Query  624  L  626
            L
Sbjct  204  L  204



>gb|AAM62807.1| putative component of high affinity nitrate transporter [Arabidopsis 
thaliana]
Length=210

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 118/192 (61%), Gaps = 16/192 (8%)
 Frame = +3

Query  90   QTCYGA---VLFSSLPQTLL-VSASPKE---GQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LF  L +  L V+  P     G V+ AG+D+++++W L+ S     +  +
Sbjct  18   QSIHGAEKLRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTLS-SIGSKREAEF  76

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPT  428
            K  KVKLCYAP SQ DR WRKT D+  KDKTC   I+ +PY   +  QS  W +E D+PT
Sbjct  77   KIIKVKLCYAPPSQVDRPWRKTHDEFFKDKTCPHKIIAKPY--DKTLQSTTWTLERDIPT  134

Query  429  ALYFVRAYAYDSAGNEVAYGHT------IALFKVQATSGRHLSLDIAAACFSGFALVSVF  590
              YFVRAYA D+ G+EVAYG +        LF VQA SGRH SLDIA+ CFS F++V++ 
Sbjct  135  GTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDIASICFSVFSVVALV  194

Query  591  GFFFAEKRGRRL  626
             FF  EKR  ++
Sbjct  195  VFFVNEKRKAKI  206



>ref|XP_002978289.1| hypothetical protein SELMODRAFT_152440 [Selaginella moellendorffii]
 gb|EFJ20946.1| hypothetical protein SELMODRAFT_152440 [Selaginella moellendorffii]
Length=208

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 121/193 (63%), Gaps = 16/193 (8%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEG----QVVKAGEDSISMSWGLNQSYERGVDESYKT  254
            A++ +G V F+SLP++L+V+ +  E       V++G+D + ++W +N S       ++K 
Sbjct  18   ARSVHGGVSFASLPRSLVVTVAMNEQGRFLNSVESGKDRLLINWSVNSSVP--APTNFKN  75

Query  255  TKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTAL  434
             K+KLCYAP SQ +RGWRK+ DDL KDKTCQF I  + Y  +  N S EW+I  D+P AL
Sbjct  76   IKLKLCYAPPSQENRGWRKSTDDLKKDKTCQFDIATQSYAGAAGN-STEWLISKDIPGAL  134

Query  435  YFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGF  596
            YFVRAYA +S G++VAYG       T  +F V   +GR  SL IA ACFS F++ S+  F
Sbjct  135  YFVRAYAINSTGSQVAYGQSTNAAKTENIFTVIPITGRPKSLYIATACFSLFSVGSLAIF  194

Query  597  FFAEKRGRRLMAA  635
            F  E   R+L AA
Sbjct  195  FTIE---RKLAAA  204



>ref|XP_002966283.1| hypothetical protein SELMODRAFT_227648 [Selaginella moellendorffii]
 gb|EFJ32310.1| hypothetical protein SELMODRAFT_227648 [Selaginella moellendorffii]
Length=208

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 120/193 (62%), Gaps = 16/193 (8%)
 Frame = +3

Query  87   AQTCYGAVLFSSLPQTLLVSASPKEG----QVVKAGEDSISMSWGLNQSYERGVDESYKT  254
            A++ +G V F+SLP++L+V+ +  E       V++G+D + ++W +N S       ++K 
Sbjct  18   ARSVHGGVSFASLPRSLVVTVAMNEQGRFLNSVESGKDRLLINWSVNSSVP--APTNFKN  75

Query  255  TKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTAL  434
             K+KLCYAP SQ +RGWRK+ DDL KDKTCQF I  + Y  +  N S EW+I  D P AL
Sbjct  76   IKLKLCYAPPSQQNRGWRKSTDDLKKDKTCQFDIATQSYAGAAGN-STEWLISKDTPGAL  134

Query  435  YFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGF  596
            YFVRAYA +S G++VAYG       T  +F V   +GR  SL IA ACFS F++ S+  F
Sbjct  135  YFVRAYAINSTGSQVAYGQSTNAAKTENIFTVIPITGRPKSLYIATACFSLFSVGSLAIF  194

Query  597  FFAEKRGRRLMAA  635
            F  E   R+L AA
Sbjct  195  FTIE---RKLAAA  204



>ref|XP_009118895.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Brassica 
rapa]
Length=212

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 117/183 (64%), Gaps = 13/183 (7%)
 Frame = +3

Query  111  LFSSLPQTLL-VSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            LFS L ++ L V+A+P    EG V+ AG D +S++W ++ +  +  +  +K  KVKLCYA
Sbjct  28   LFSDLEKSALEVTATPSRVGEGVVLAAGVDKLSITWKVSSTATK--EPEFKAIKVKLCYA  85

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEK-NQSFEWMIETDVPTALYFVRAYA  455
            P SQ DR WRKT ++L KDK+C   I    Y  + K  QSF++ +E D+PT  YFVRAYA
Sbjct  86   PASQVDRPWRKTENELFKDKSCPHKISSWSYDPAMKAGQSFDYTLERDIPTGTYFVRAYA  145

Query  456  YDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRG  617
             D+  +EVA+G       T  LF VQA SGRH SLDIA+ CFS F++V++  FF  EKR 
Sbjct  146  VDTKDHEVAFGQSTNEDKTTNLFSVQAISGRHKSLDIASVCFSVFSVVALLVFFVNEKRK  205

Query  618  RRL  626
             ++
Sbjct  206  AKI  208



>ref|XP_002448046.1| hypothetical protein SORBIDRAFT_06g020180 [Sorghum bicolor]
 gb|EES12374.1| hypothetical protein SORBIDRAFT_06g020180 [Sorghum bicolor]
Length=216

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 103/177 (58%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S+L +TL+V ASP+ GQV+ AGED+I+++W LN S   G D  YK  KV LCYAP SQ 
Sbjct  36   LSALGRTLVVEASPEAGQVLHAGEDTITVTWRLNASAPAGADAGYKAVKVTLCYAPASQE  95

Query  294  DRGWRKTVDDLSKDKTCQFSI--------VERPYYSSEKNQSFEWMIETDVPTALYFVRA  449
            DRGWRK  DDLSKDK CQF I               +    +  + +  DVPTA Y VRA
Sbjct  96   DRGWRKANDDLSKDKACQFEIAQPQPYAYAAAAGPGTGAGTTLRYRVARDVPTASYHVRA  155

Query  450  YAYDSAGNEVAYGHTIAL--FKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            YA D++G  V YG T     F+V   +G H SL +AAA  S  ++ ++  F   EKR
Sbjct  156  YALDASGAPVGYGQTAPAYYFRVAGVTGIHASLRVAAAVLSALSVAALAFFAVVEKR  212



>ref|XP_009127362.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Brassica 
rapa]
 emb|CDY16372.1| BnaA02g11760D [Brassica napus]
Length=212

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 122/193 (63%), Gaps = 16/193 (8%)
 Frame = +3

Query  90   QTCYGAV---LFSSLPQ-TLLVSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LF+ L +  L ++A+P    EG V+ AG D +S++W ++ +  +  +  +
Sbjct  18   QSSHGATKERLFTDLEKGALEITATPSRTGEGVVLAAGIDKLSITWKVSSTATK--EPEF  75

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVP  425
            KT KVKLCYAP SQ DR WRKT ++L KDK+C   I    Y  + K  QSF++ +E D+P
Sbjct  76   KTIKVKLCYAPISQVDRPWRKTENELFKDKSCPHKISSFSYDPTVKTAQSFDYTLERDIP  135

Query  426  TALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSV  587
            T  Y+VRAYA D+  +EVA+G       T  LF VQA SGRH SLDIA+ CFS F++V++
Sbjct  136  TGTYYVRAYAVDAKDHEVAFGQSTNQDKTTNLFSVQAISGRHKSLDIASVCFSVFSVVAL  195

Query  588  FGFFFAEKRGRRL  626
              FF  EKR  ++
Sbjct  196  LVFFVNEKRKAKI  208



>emb|CDX91545.1| BnaC02g16150D [Brassica napus]
Length=212

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 123/193 (64%), Gaps = 16/193 (8%)
 Frame = +3

Query  90   QTCYGAV---LFSSLPQ-TLLVSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESY  248
            Q+ +GA    LF+ L + +L ++A+P    EG V+ AG D +S++W ++ +  +  +  +
Sbjct  18   QSSHGATKERLFTDLEKGSLEITATPSRTGEGVVLAAGIDKLSITWKVSSTATK--EPEF  75

Query  249  KTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVP  425
            KT KVKLCYAP SQ DR WRKT ++L KDK+C   I    Y  + K  QSF++ +E D+P
Sbjct  76   KTIKVKLCYAPVSQVDRPWRKTHNELFKDKSCPHKISSFSYDPTVKTAQSFDYTLERDIP  135

Query  426  TALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSV  587
            T  Y+VRAYA D+  +EVA+G       T  LF VQA SGRH SLDIA+ CFS F++V++
Sbjct  136  TGTYYVRAYAVDAIDHEVAFGQSTNEAKTTNLFSVQAISGRHKSLDIASVCFSVFSVVAL  195

Query  588  FGFFFAEKRGRRL  626
              FF  EKR  ++
Sbjct  196  VVFFVNEKRKAKI  208



>emb|CDY34305.1| BnaA01g14080D [Brassica napus]
Length=262

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 107/180 (59%), Gaps = 10/180 (6%)
 Frame = +3

Query  111  LFSSLPQTLLVSASPKEGQVV--KAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPE  284
            LF++L  +L V+A P    VV  +AG+D + ++W L  S +   D S+KT +VKLCYAP 
Sbjct  81   LFTNLENSLEVTAKPTRVGVVVLEAGKDMVRITWMLKSSAKVNDDASFKTVEVKLCYAPI  140

Query  285  SQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDS  464
            SQ DR WRKT ++LS+D++C   IV +PY   +  QS  W I+ + PT  YFVR Y    
Sbjct  141  SQVDRPWRKTHNELSRDRSCPHKIVSKPY--DKIPQSLNWTIDRETPTGTYFVRVYGIGV  198

Query  465  AGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             G EVAYG       T  LF V+  SGRH SLDIA+ CFS F+  ++  F   EKR   L
Sbjct  199  NGQEVAYGQSSDAEKTTNLFSVEGISGRHTSLDIASICFSVFSFGTLLVFLVKEKRKANL  258



>emb|CDX71613.1| BnaC09g26540D [Brassica napus]
Length=212

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 116/183 (63%), Gaps = 13/183 (7%)
 Frame = +3

Query  111  LFSSLPQTLL-VSASPK---EGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            LFS L ++ L V+A+P    EG V+ AG D +S++W ++ +  +  +  +   KVKLCYA
Sbjct  28   LFSDLEKSALEVTATPSRVGEGVVLAAGVDKLSITWKVSSTATK--EPEFNAIKVKLCYA  85

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKN-QSFEWMIETDVPTALYFVRAYA  455
            P SQ DR WRKT ++L KDK+C   I    Y  + K  QSF++ +E D+PT  YFVRAYA
Sbjct  86   PASQVDRPWRKTENELFKDKSCPHKISSWSYDPAMKTAQSFDYTLERDIPTGTYFVRAYA  145

Query  456  YDSAGNEVAYGH------TIALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRG  617
             D+  +EVA+G       T  LF VQA SGRH SLDIA+ CFS F++V++  FF  EKR 
Sbjct  146  VDAKDHEVAFGQSTNEDKTSNLFSVQAISGRHKSLDIASVCFSVFSVVALLVFFVNEKRK  205

Query  618  RRL  626
             ++
Sbjct  206  AKI  208



>ref|XP_006413394.1| hypothetical protein EUTSA_v10027123mg, partial [Eutrema salsugineum]
 gb|ESQ54847.1| hypothetical protein EUTSA_v10027123mg, partial [Eutrema salsugineum]
Length=145

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 7/148 (5%)
 Frame = +3

Query  171  VKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQF  350
            +++G+D I ++W L  S +  VD + KT  V+LCYAP SQ DR WR++ ++L KDKTC +
Sbjct  1    LESGKDIIRVTWKLKSSVKIDVDAAIKTVDVRLCYAPISQVDRPWRQSHNELFKDKTCPY  60

Query  351  SIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHTIALFKVQATSGR  530
             IV +PY   + +QS  W+IE D+PT  YFVR Y  D+ G+E     T  LF V+A  GR
Sbjct  61   KIVSKPY--DKISQSLNWIIERDIPTGTYFVRVYGIDANGHE-----TTNLFSVEAIDGR  113

Query  531  HLSLDIAAACFSGFALVSVFGFFFAEKR  614
            H+SLD A+ CFS F++V++  FF  E+R
Sbjct  114  HISLDAASICFSIFSVVALLVFFMRERR  141



>ref|NP_001053099.1| Os04g0480200 [Oryza sativa Japonica Group]
 sp|Q7XK12.1|NAR22_ORYSJ RecName: Full=Probable high-affinity nitrate transporter-activating 
protein 2.2; Short=OsNAR2.2; Flags: Precursor [Oryza 
sativa Japonica Group]
 emb|CAE05891.1| OSJNBa0044K18.32 [Oryza sativa Japonica Group]
 dbj|BAF15013.1| Os04g0480200 [Oryza sativa Japonica Group]
 emb|CAH66874.1| OSIGBa0158F13.5 [Oryza sativa Indica Group]
 dbj|BAG98803.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 103/169 (61%), Gaps = 8/169 (5%)
 Frame = +3

Query  129  QTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKT---TKVKLCYAPESQADR  299
            + L+V ASP+ GQV+ AGED+I+++W LN +       +       KV LCYAP SQ  R
Sbjct  43   KALVVEASPRAGQVLHAGEDAITVTWSLNATAAAAAAGADAGYKAVKVTLCYAPASQVGR  102

Query  300  GWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEV  479
            GWRK  DDLSKDK CQF I ++PY  + K   FE+ +  DVPTA Y+VRAYA D++G  V
Sbjct  103  GWRKAHDDLSKDKACQFKIAQQPYDGAGK---FEYTVARDVPTASYYVRAYALDASGARV  159

Query  480  AYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            AYG T   A F V   +G   S+++AA   S F++ ++  F   E + +
Sbjct  160  AYGETAPSASFAVAGITGVTASIEVAAGVLSAFSVAALAVFLVLENKKK  208



>gb|EAY94557.1| hypothetical protein OsI_16333 [Oryza sativa Indica Group]
Length=210

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 103/169 (61%), Gaps = 8/169 (5%)
 Frame = +3

Query  129  QTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKT---TKVKLCYAPESQADR  299
            + L+V ASP+ GQV+ AGED+I+++W LN +       +       KV LCYAP SQ  R
Sbjct  43   KALVVEASPRAGQVLHAGEDAITVTWSLNATAAAAAAGADAGYKAVKVTLCYAPASQVGR  102

Query  300  GWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEV  479
            GWRK  DDLSKDK CQF I ++PY  + K   FE+ +  DVPTA Y+VRAYA D++G  V
Sbjct  103  GWRKAHDDLSKDKACQFKIAQQPYDGAGK---FEYTVARDVPTASYYVRAYALDASGARV  159

Query  480  AYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGR  620
            AYG T   A F V   +G   S+++AA   S F++ ++  F   E + +
Sbjct  160  AYGETAPSASFAVAGITGVTASIEVAAGVLSAFSVAALAVFLALENKKK  208



>ref|XP_009138456.1| PREDICTED: manganese-dependent ADP-ribose/CDP-alcohol diphosphatase 
isoform X2 [Brassica rapa]
Length=444

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 99/159 (62%), Gaps = 8/159 (5%)
 Frame = +3

Query  168  VVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQ  347
            V++AG+D + ++W L  S +   D ++KT +VKLCYAP SQ DR WRKT ++LS+D++C 
Sbjct  284  VLEAGKDMVRITWMLKSSGKVDGDTAFKTVEVKLCYAPISQVDRPWRKTHNELSRDRSCP  343

Query  348  FSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFK  509
              IV +PY   +  QS  W I+ + PT  YFVRAY  D  G EVAYG       T  LF 
Sbjct  344  HKIVSKPY--DKIPQSLNWTIDRETPTGTYFVRAYGTDVNGQEVAYGQSSDAEKTTNLFS  401

Query  510  VQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
            V+  SGRH SLDIA+ CFS F+  S+  F   EKR  +L
Sbjct  402  VEGISGRHTSLDIASICFSVFSFGSLLVFLVKEKRKAKL  440



>ref|NP_194204.2| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
 gb|AEE84947.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
Length=443

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 101/160 (63%), Gaps = 9/160 (6%)
 Frame = +3

Query  168  VVKAGEDSISMSWGLNQSYER-GVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTC  344
            V++AG+D ++++W L  S  +   D ++KT +VKLCYAP SQ DR WRKT + L KD++C
Sbjct  282  VLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKLCYAPISQVDRPWRKTDNKLFKDRSC  341

Query  345  QFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALF  506
               IV + Y   +  QS +W I  D+PT  YFVRAY  D  G+EVAYG       T  LF
Sbjct  342  PHEIVSKAY--DKTPQSLDWTIGLDIPTGTYFVRAYGIDGDGHEVAYGQSTDEGRTTNLF  399

Query  507  KVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRRL  626
             V A SG H+ LDIA+  FS F++VS+F FF  EKR  +L
Sbjct  400  SVHAISGHHVGLDIASTFFSVFSVVSLFVFFVMEKRKAKL  439



>ref|XP_002867650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 101/155 (65%), Gaps = 10/155 (6%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF+ L  ++ V+A P K+  V++ G+D ++++W L  S +  +D ++KT ++KLCYAP S
Sbjct  28   LFTELQNSIEVTAKPVKDSGVLEGGKDMVTITWKLKSSTKVDMDAAFKTIQIKLCYAPIS  87

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSA  467
            Q DR WRK+ + LSKD +C   IV +PY  +   QS +W +E D+PT  YFVRAY  D  
Sbjct  88   QVDRPWRKSDNKLSKDNSCPHEIVSKPYDMTP--QSLDWTVERDIPTGTYFVRAYGIDGD  145

Query  468  GNEVAYGH------TIALFKVQATSGRHLSLDIAA  554
            G+EVAYG       T  LF VQA SG H++LDIA+
Sbjct  146  GHEVAYGQSTDEGRTTNLFSVQA-SGHHVALDIAS  179



>ref|XP_001771033.1| predicted protein [Physcomitrella patens]
 dbj|BAE06052.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 dbj|BAE45930.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 gb|EDQ64188.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 106/178 (60%), Gaps = 14/178 (8%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQ---VVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            G VLFS LP++L+V+A+  +G+   VVK GEDSI + W +N S +    +     K KLC
Sbjct  26   GQVLFSKLPKSLVVTATLPDGKPIGVVKTGEDSILVKWAVNTSAQIPASK----VKTKLC  81

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            +A ESQ  RGWR T DDL KDKTC ++I  + Y ++       +M+   +P A YFVRAY
Sbjct  82   FAVESQLLRGWRATKDDLKKDKTCLYNIATQDYTTA--GGEVTYMLAKSIPGAKYFVRAY  139

Query  453  AYDSAGNEVAYGHT-----IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
            A ++ G +VA G +        F V   SGRH S+DIA    S F++ S+FGFF  E+
Sbjct  140  AVNADGVQVATGQSSPNKVANTFTVIPISGRHASIDIAVGVLSVFSVGSLFGFFILER  197



>ref|XP_006828371.1| hypothetical protein AMTR_s00188p00033950 [Amborella trichopoda]
 gb|ERM95787.1| hypothetical protein AMTR_s00188p00033950 [Amborella trichopoda]
Length=128

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 6/115 (5%)
 Frame = +3

Query  192  ISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPY  371
            +S SW  NQSY  G D  YK TK+KLC AP SQ DR  RK VD L KDKTCQF I  +PY
Sbjct  5    VSPSWSSNQSYPHGTDLQYKKTKIKLCSAPLSQKDRAGRKIVDALKKDKTCQFKIAAQPY  64

Query  372  YSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHTIA------LFKVQA  518
              +    +  W+IE D+P+A YFVRAYA DS  NE+AYG T        LF++QA
Sbjct  65   NPNNSTTTVSWLIERDIPSATYFVRAYALDSQDNELAYGQTTNENKTTYLFEIQA  119



>ref|XP_006828375.1| hypothetical protein AMTR_s00188p00036850 [Amborella trichopoda]
 gb|ERM95791.1| hypothetical protein AMTR_s00188p00036850 [Amborella trichopoda]
Length=128

 Score =   127 bits (319),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 73/115 (63%), Gaps = 6/115 (5%)
 Frame = +3

Query  192  ISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPY  371
            +S SW  N S+  G D  YK  K+KLC AP SQ DR  RKTVDDL KDKTCQF I  +PY
Sbjct  5    VSPSWSSNPSFPHGTDLQYKKIKIKLCSAPLSQKDRAGRKTVDDLKKDKTCQFKIAAQPY  64

Query  372  YSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFKVQA  518
              +    +  W+IE D+P+A YF+RAYA DS  NE+AYG       T  LF+VQA
Sbjct  65   NPNNSRTTVSWLIERDIPSATYFIRAYALDSQDNELAYGQATNKNKTTNLFEVQA  119



>gb|EMT33608.1| hypothetical protein F775_27090 [Aegilops tauschii]
Length=141

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = +3

Query  234  VDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIE  413
            +D  YK  KV LCYAP SQ +R WRKT DDL KDKTCQF + ++ Y  + K    E+ + 
Sbjct  12   LDAKYKNVKVSLCYAPVSQKEREWRKTHDDLKKDKTCQFKVTQQAYPGTGK---VEYRVA  68

Query  414  TDVPTALYFVRAYAYDSAGNEVAYGHT--IALFKVQATSGRHLSLDIAAACFSGFALVSV  587
             D+PTA Y+VRAYA D++G +VAYG T   + F V + +G   S+ +AA  FS F++ S+
Sbjct  69   LDIPTATYYVRAYALDASGTQVAYGQTAPASAFNVVSITGVTTSIKVAAGVFSAFSVASL  128

Query  588  FGFFFAEKRGR  620
              FFF EKR +
Sbjct  129  AFFFFIEKRKK  139



>ref|XP_006849233.1| hypothetical protein AMTR_s00027p00233840 [Amborella trichopoda]
 gb|ERN10814.1| hypothetical protein AMTR_s00027p00233840 [Amborella trichopoda]
Length=255

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 6/111 (5%)
 Frame = +3

Query  300  GWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEV  479
             WRKTVDDL KDKTCQF I  +PY  ++   +  W+IE D+ TA YF+RAYA DS  N++
Sbjct  45   AWRKTVDDLKKDKTCQFKIAAQPYNPNDSTTTVSWLIERDIRTATYFIRAYALDSQENDM  104

Query  480  AYGHTIA------LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            AYG T        LF++Q  +G H SLDIAAACFS F +  +FGFF  E R
Sbjct  105  AYGQTTGKNKTTNLFEIQGITGTHASLDIAAACFSAFLVFCLFGFFIRENR  155



>ref|XP_001755294.1| predicted protein [Physcomitrella patens]
 dbj|BAE06053.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 dbj|BAE45931.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 gb|EDQ79774.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 103/177 (58%), Gaps = 14/177 (8%)
 Frame = +3

Query  102  GAVLFSSLPQTLLVSASPKEGQV---VKAGEDSISMSWGLNQSYERGVDESYKTTKVKLC  272
            G VLFS+LP++L+V+A+  +G+    VK GEDSI + W +N +    VD      K KLC
Sbjct  26   GQVLFSTLPKSLVVTAALPDGKPIGEVKTGEDSILVKWTVNSTAS--VDAV--KLKTKLC  81

Query  273  YAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAY  452
            +A ESQ  RGWR T DDL KDKTC + I  + +  +    +++  +   +P A YFVRAY
Sbjct  82   FASESQVLRGWRATNDDLKKDKTCLYDIATQDFSRTGGETTYK--LSKSIPGAKYFVRAY  139

Query  453  AYDSAGNEVAYGHT-----IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            A ++ G +VA G T        F V   SGR  S+DIA    S F++ ++FGFF  E
Sbjct  140  AINAEGKQVATGQTSPNKVANTFTVIPISGRSTSIDIAVGVLSIFSVSALFGFFIFE  196



>ref|XP_001768154.1| predicted protein [Physcomitrella patens]
 dbj|BAE06054.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 dbj|BAE45932.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 gb|EDQ67027.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 102/179 (57%), Gaps = 15/179 (8%)
 Frame = +3

Query  102  GAVLFSSL--PQTLLVSASPKEGQVVK---AGEDSISMSWGLNQSYERGVDESYKTTKVK  266
            G V F+SL   +TL+V+ S      +K    G+DSI ++W +N S    VD   KT + +
Sbjct  26   GFVSFNSLSSKRTLVVTVSMANNSDIKEVHTGQDSILVNWSVNASAPAIVDA--KTVETR  83

Query  267  LCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVR  446
            LC+A ESQ  RGWRKT D+L KDKTC + I  +PY  +    S  + +   +P A YFVR
Sbjct  84   LCFAKESQTLRGWRKTDDNLKKDKTCLYKIQRQPYAPA---GSVTYALPKSIPGAKYFVR  140

Query  447  AYAYDSAGNEVAYGHTIA-----LFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAE  608
            AY ++S+  ++AYG +        F V   SGRH S+D A   FS F++ S+F FF  E
Sbjct  141  AYVFNSSDLQIAYGQSSPNKINNTFTVIPISGRHGSIDAAVGVFSIFSVGSLFAFFIFE  199



>ref|XP_004301017.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Fragaria 
vesca subsp. vesca]
Length=189

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 81/179 (45%), Gaps = 52/179 (29%)
 Frame = +3

Query  231  GVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMI  410
            G D +YKT  +KLCYAP SQ  +  RKT DDL KDKTCQ      PY SS   Q +E  +
Sbjct  2    GTDTAYKTVNLKLCYAPVSQVGKPERKTEDDLDKDKTCQIEFYTGPYNSSSNWQFYESTL  61

Query  411  ETDVPTALYFVRAYAYDSAGNEVAYGHT--------------------------------  494
            +  VP   YFVRAY  DSAG  VAYG +                                
Sbjct  62   DRHVPIGSYFVRAYVTDSAGVLVAYGQSTGQEKDYNIFEVSGSHKRLEMVSIIWFRHIAY  121

Query  495  --------------------IALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEK  611
                                + +F VQ  +GRH  LD+ + CFS F+++S+ GFF  EK
Sbjct  122  VYDGAGVAVAYGQSTNAKKDLNIFDVQGITGRHKRLDVVSICFSVFSVLSLVGFFAIEK  180



>gb|EMS60424.1| hypothetical protein TRIUR3_22380 [Triticum urartu]
Length=151

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  114  FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
             S LP TL V+ASP  GQV+ AGED I+++W LN +   G D +YK+ KV LCYAP SQ 
Sbjct  29   LSKLPVTLDVTASPSAGQVLHAGEDVITVTWALNATGPAGDDAAYKSVKVSLCYAPASQK  88

Query  294  DRGWRKTVDDLSKDKTCQF  350
            +R WRKT DDL KDKTCQF
Sbjct  89   EREWRKTHDDLKKDKTCQF  107



>gb|EAZ31107.1| hypothetical protein OsJ_15203 [Oryza sativa Japonica Group]
Length=212

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 90/173 (52%), Gaps = 18/173 (10%)
 Frame = +3

Query  129  QTLLVSASPKEGQVVKAGE-----DSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQA  293
            + L+V ASP+ GQV+ AGE     D ++ S G            YK  KV LCYAP SQ 
Sbjct  43   KALVVEASPRAGQVLHAGEGRHHRDMVAESEGGGGRRPG-RIPGYKAVKVTLCYAPASQV  101

Query  294  DRGWRKTVDDLSKDKTCQFSIVER----PYYSSEKNQSFEWMIETDVPTALYFVRAYAYD  461
             RGWRK      + +  Q  +  R    PY  + K   FE+ +  DVPTA Y+VRAYA D
Sbjct  102  GRGWRKA---PRRPEQGQGRVSSRSPQQPYDGAGK---FEYTVARDVPTASYYVRAYALD  155

Query  462  SAGNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFFAEKR  614
            ++G  VAYG T   A F V   +G   S+++AA   S F++ ++  F   E +
Sbjct  156  ASGARVAYGETAPSASFAVAGITGVTASIEVAAGVLSAFSVAALAVFLVLENK  208



>ref|XP_010438977.1| PREDICTED: high-affinity nitrate transporter 3.2-like, partial 
[Camelina sativa]
Length=147

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (62%), Gaps = 15/112 (13%)
 Frame = +3

Query  111  LFSSLPQTLLVSASP-KEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPES  287
            LF+ + ++L V+A P ++G V++AG+D +++ W L  S +   D+++K  +VKLCYAP S
Sbjct  49   LFTEVQKSLEVTAKPVQDGVVLEAGKDMVTIKWKLKSSAKVDADDTFKKIQVKLCYAPIS  108

Query  288  QADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFV  443
            Q DR WRKT  +L KDKTC               QS +W ++ D+PT  YFV
Sbjct  109  QVDRPWRKTHSELFKDKTCP--------------QSLDWTVDLDIPTGTYFV  146



>ref|XP_010497940.1| PREDICTED: high-affinity nitrate transporter 3.1-like, partial 
[Camelina sativa]
Length=72

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +3

Query  237  DESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIET  416
            +  +KT KVKLCYAP SQ DR WRKT D+L KDKTC   IV RPY   +  QS +W++E 
Sbjct  4    EAEFKTIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIVARPY--DKTTQSIDWILER  61

Query  417  DVPTALYFVRA  449
            D+PT  YFVRA
Sbjct  62   DIPTGTYFVRA  72



>emb|CDY05799.1| BnaA10g06210D [Brassica napus]
Length=113

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +3

Query  390  QSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLDIA  551
            QSF++ +E D+PT  YFVRAYA D+  +EVA+G       T  LF VQA SGRH SLDIA
Sbjct  25   QSFDYTLERDIPTGTYFVRAYAVDTKDHEVAFGQSTNEDKTTNLFSVQAISGRHKSLDIA  84

Query  552  AACFSGFALVSVFGFFFAEKRGRRL  626
            + CFS F++V++  FF  EKR  ++
Sbjct  85   SVCFSVFSVVALLVFFVNEKRKAKI  109



>gb|EMT09919.1| hypothetical protein F775_19205 [Aegilops tauschii]
Length=168

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 89/170 (52%), Gaps = 30/170 (18%)
 Frame = +3

Query  102  GAVL-FSSLPQTLLVSASPKEGQVVKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYA  278
            GAV   S LP TL V+ASP  GQ       +I  ++    S +    ES           
Sbjct  24   GAVASLSKLPVTLDVTASPSPGQ-----GATIVYAFLFFDSKDLREHES-----------  67

Query  279  PESQADRGWRKTVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAY  458
                     RKT ++L KDKTCQ+ + E+PY  +      E+ +  D+PTA Y+VRAYA 
Sbjct  68   ---------RKTHENLDKDKTCQYKVTEQPY--TGAGGKVEYRVALDIPTATYYVRAYAL  116

Query  459  DSAGNEVAYGHTI--ALFKVQATSGRHLSLDIAAACFSGFALVSVFGFFF  602
            D++G +VAYG T+  A F + +  G + S+ +A+  FS F+ VS+  FFF
Sbjct  117  DASGTQVAYGQTLRTATFNIVSIRGINTSIKVASGVFSTFSAVSLVFFFF  166



>gb|KDO82197.1| hypothetical protein CISIN_1g0417872mg, partial [Citrus sinensis]
Length=93

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +3

Query  387  NQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHTIA------LFKVQATSGRHLSLDI  548
            N S   MIE D P A YFV  YA DSAG EV  G T        LF++ A S RHLSL+I
Sbjct  1    NHSLGSMIENDAPEASYFVTVYASDSAGKEVGVGQTFGARKSSNLFEIHAISERHLSLEI  60

Query  549  AAACFSGFALVSVFGFFFAEKRGRR  623
            ++ CFS F  VS+FGF+F E+  R+
Sbjct  61   SSMCFSFFPAVSLFGFYFVERSKRK  85



>gb|KDO82198.1| hypothetical protein CISIN_1g0417871mg, partial [Citrus sinensis]
Length=61

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  171  VKAGEDSISMSWGLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKTCQF  350
            +KAG+D I++SW LN+S+ R  D+ YK  KV LCYAP SQ D  W KT DD++KD+TCQF
Sbjct  1    LKAGDDKITVSWSLNRSF-RATDDLYKKVKVTLCYAPASQVDGAWSKTEDDMTKDRTCQF  59

Query  351  SI  356
            +I
Sbjct  60   TI  61



>gb|AFG50499.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50500.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50501.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50504.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50505.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50507.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50509.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50512.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
Length=71

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 6/69 (9%)
 Frame = +3

Query  384  KNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLD  545
            +N +  W +E DVPTA+YFVRAY  D++G +VAYG       T  LFK+Q+ SGRH+SLD
Sbjct  3    QNNTVAWTVERDVPTAIYFVRAYILDASGIQVAYGQSTNKAKTANLFKIQSISGRHVSLD  62

Query  546  IAAACFSGF  572
            IA+A FS F
Sbjct  63   IASAVFSAF  71



>gb|AGG68805.1| putative nitrate transporter, partial [Populus simonii x (Populus 
nigra x Salix matsudana)]
 gb|AGG68806.1| putative nitrate transporter, partial [Populus alba x Populus 
glandulosa]
Length=76

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  423  PTALYFVRAYAYDSAGNEVAYGHTI------ALFKVQATSGRHLSLDIAAACFSGFALVS  584
            PTA YF+RAYAY++  +EVAYG T       +LF+V++ +GRH+++DI + CFS F++VS
Sbjct  1    PTATYFIRAYAYNADESEVAYGQTTDAHKTTSLFQVESITGRHMAMDICSICFSVFSVVS  60

Query  585  VFGFFFAEKR  614
            +  FF+ EKR
Sbjct  61   LLVFFYIEKR  70



>gb|AEW08990.1| hypothetical protein CL2980Contig1_03, partial [Pinus radiata]
Length=71

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = +3

Query  384  KNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLD  545
            +N +  W +E DVPTA+YFVRAY  D++G +V YG       T  LFK+Q+ SGRH+SLD
Sbjct  3    QNNTVAWTVERDVPTAIYFVRAYILDASGIQVVYGQSTNKAKTANLFKIQSISGRHVSLD  62

Query  546  IAAACFSGF  572
            IA+A FS F
Sbjct  63   IASAVFSAF  71



>gb|AFG50498.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50502.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50503.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50506.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50508.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50510.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50511.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
Length=71

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = +3

Query  384  KNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGH------TIALFKVQATSGRHLSLD  545
            +N +  W +E DVPTA+YFVR Y  D++G +VAYG       T  LFK+Q+ SGRH+SLD
Sbjct  3    QNNTVAWTVERDVPTAIYFVRTYILDASGIQVAYGQSTNKAKTANLFKIQSISGRHVSLD  62

Query  546  IAAACFSGF  572
            IA+A FS F
Sbjct  63   IASAVFSAF  71



>gb|EMT12905.1| hypothetical protein F775_20267 [Aegilops tauschii]
Length=142

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = +3

Query  339  TCQFSIVERPYYSSEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHT--IALFKV  512
            T  F + ++ Y  + K    E+ +  D+PTA Y+VRAYA D++G +VAYG T   A F V
Sbjct  48   TTVFKVTQQAYPGTGK---VEYRVALDIPTATYYVRAYALDASGTQVAYGQTAPAAAFNV  104

Query  513  QATSGRHLSLDIAAACFSGFALVSVFGFFFAEKRGRR  623
             + +G   S+ +AA  FS F++VS+  FFF EKR + 
Sbjct  105  VSITGVTTSIKVAAGVFSTFSVVSLAFFFFIEKRKKN  141



>ref|XP_005646384.1| hypothetical protein COCSUDRAFT_47957 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21840.1| hypothetical protein COCSUDRAFT_47957 [Coccomyxa subellipsoidea 
C-169]
Length=211

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 87/194 (45%), Gaps = 29/194 (15%)
 Frame = +3

Query  108  VLFSSLPQTLLVSASPKE--GQVVKAGEDSISMSWGLNQSY--ERGV-----------DE  242
            +  +SLP+ + V  +  E  G+++KAG   +  ++G   S   E GV            +
Sbjct  23   IKLASLPKNITVKVTGFEEHGEMMKAGPPCMDQTFGHCPSVQAEEGVVMVSYSVPDFLQK  82

Query  243  SYKTTKVKLCYAPESQADRGWRK-TVDDLSKDKTCQFSIVERPYYSSEKNQSFEWMIETD  419
               T  +  C++  SQ DR WRK    +L+  K CQ ++ ++   +   N +F       
Sbjct  83   PNATVSIVACFSTFSQYDRAWRKGNPLNLAAAKDCQ-NVAKKGLTAFSGNVTFTP--NEK  139

Query  420  VPTALYFVRAYAY----DSAGNEVAYGHTIALFKVQATSGRHLSLDIA---AACFSGFAL  578
            VP +  ++RAY      D +    AYG++   F+VQ  +   + L++A     C S   L
Sbjct  140  VPHSTMYMRAYLKCLQPDGSMQYCAYGNSAGYFEVQKVNDIPIGLEVAVGICCCISPIML  199

Query  579  VSVFGFFFAEKRGR  620
            V     +F EK+ +
Sbjct  200  VIA---YFIEKKKK  210



>ref|XP_003058320.1| nitrate high-affinity transporter accessory protein [Micromonas 
pusilla CCMP1545]
 gb|EEH58271.1| nitrate high-affinity transporter accessory protein [Micromonas 
pusilla CCMP1545]
Length=213

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 11/114 (10%)
 Frame = +3

Query  165  QVVKAGEDSISMSW-GLNQSYERGVDESYKTTKVKLCYAPESQADRGWRKTVDDLSKDKT  341
            Q+  A  D+I+++W G   + E  +        +K+CY  +   +R WRK VD + K+K 
Sbjct  52   QLAGAHSDTITVAWTGFTSNSEASL-------TIKMCYTDDMIVNRPWRKYVDAVDKNKQ  104

Query  342  C-QFSIVERPYYS--SEKNQSFEWMIETDVPTALYFVRAYAYDSAGNEVAYGHT  494
            C Q   + +  +S  +  + S    I T+ P + Y+ +    D++G  V+YG +
Sbjct  105  CWQIPEMTKTLHSGIATADGSKTITIPTNTPASTYYFQVIGVDASGGYVSYGES  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1499838010448