BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86155_g1_i1 len=617 path=[1:0-616]

Length=617
                                                                      Score     E

gb|AAC28935.1|  polyphenol oxidase precursor                            144   8e-37   Prunus armeniaca
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             144   2e-36   
gb|ACN78382.1|  polyphenol oxidase                                      142   2e-36   Solanum quitoense [lulo]
ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    142   4e-36   
ref|XP_011044088.1|  PREDICTED: polyphenol oxidase, chloroplastic...    140   6e-36   
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             142   8e-36   Populus trichocarpa [western balsam poplar]
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       141   8e-36   Populus trichocarpa x Populus deltoides
gb|ACM09905.1|  polyphenol oxidase 1/4                                  142   9e-36   Trifolium pratense [peavine clover]
ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    141   1e-35   
ref|XP_006377743.1|  hypothetical protein POPTR_0011s10940g             139   3e-35   
gb|AAW58109.2|  polyphenol oxidase                                      140   4e-35   Prunus salicina var. cordata
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    140   4e-35   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                139   5e-35   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    139   5e-35   
gb|AAK13242.1|  polyphenol oxidase                                      139   5e-35   Trifolium pratense [peavine clover]
gb|ACL31300.1|  polyphenol oxidase                                      133   7e-35   Cichorium intybus [radicchio]
ref|XP_003593515.1|  Polyphenol oxidase                                 139   7e-35   
ref|XP_003605686.1|  Polyphenol oxidase                                 138   9e-35   
gb|AAU12257.1|  polyphenol oxidase                                      139   1e-34   Populus trichocarpa x Populus deltoides
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             139   1e-34   Populus trichocarpa [western balsam poplar]
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         139   1e-34   
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 139   1e-34   
gb|AES87883.2|  polyphenoloxidase                                       138   1e-34   
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            138   1e-34   Populus tremuloides
ref|XP_008345878.1|  PREDICTED: polyphenol oxidase, chloroplastic...    136   1e-34   
gb|AEL95440.1|  polyphenol oxidase                                      138   2e-34   
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    138   2e-34   
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                138   2e-34   
gb|AES87890.2|  polyphenoloxidase                                       138   2e-34   
ref|XP_003605693.1|  Polyphenol oxidase A1                              137   2e-34   
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    138   2e-34   
gb|ABI96938.1|  putative polyphenol oxidase                             137   3e-34   Lyonothamnus floribundus
gb|AAP33165.1|  polyphenol oxidase                                      137   4e-34   Medicago sativa [alfalfa]
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    137   4e-34   
gb|AAT75166.1|  polyphenol oxidase                                      136   6e-34   Camellia sinensis [black tea]
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    136   6e-34   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    136   6e-34   
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    136   7e-34   
gb|ABI96925.1|  putative polyphenol oxidase                             135   7e-34   Adenostoma fasciculatum [chamise]
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    136   7e-34   
gb|ABS88291.1|  polyphenol oxidase                                      136   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_010100574.1|  Polyphenol oxidase                                 136   9e-34   
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    136   9e-34   
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    136   1e-33   
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    135   1e-33   
gb|AEQ30073.1|  polyphenol oxidase                                      135   1e-33   
gb|AFL03159.1|  polyphenol oxidase                                      135   2e-33   
gb|ADR78836.1|  polyphenol oxidase                                      135   2e-33   
ref|XP_003593517.1|  Polyphenol oxidase A1                              135   2e-33   
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             135   2e-33   
emb|CDP22269.1|  unnamed protein product                                134   2e-33   
gb|ABI96946.1|  putative polyphenol oxidase                             134   2e-33   Pyrus communis subsp. caucasica
gb|ABI96931.1|  putative polyphenol oxidase                             134   2e-33   Exochorda racemosa
gb|AEG78292.1|  polyphenol oxidase                                      135   2e-33   
gb|ABI96943.1|  putative polyphenol oxidase                             134   2e-33   Prinsepia sinensis
gb|AEE61322.1|  polyphenol oxidase I                                    135   3e-33   
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      135   3e-33   
gb|AFC36521.1|  polyphenol oxidase                                      135   3e-33   
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                134   3e-33   
dbj|BAB64530.1|  polyphenol oxidase                                     134   3e-33   Pyrus pyrifolia [sha li]
gb|ABI96929.1|  putative polyphenol oxidase                             133   4e-33   Chamaebatiaria millefolium
gb|ABI96933.1|  putative polyphenol oxidase                             133   4e-33   Gillenia stipulata [American-ipecac]
emb|CDO99592.1|  unnamed protein product                                134   4e-33   
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    134   5e-33   
gb|ACN86310.1|  polyphenol oxidase                                      134   5e-33   Juglans regia
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    134   5e-33   
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                134   5e-33   
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                134   6e-33   
ref|XP_006370119.1|  hypothetical protein POPTR_0001s39670g             132   7e-33   
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             134   7e-33   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   134   7e-33   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    134   7e-33   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       133   8e-33   Taraxacum officinale [dandelion]
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    133   9e-33   Solanum lycopersicum
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     133   9e-33   
gb|ABI96934.1|  putative polyphenol oxidase                             132   9e-33   Gillenia trifoliata [Bowman's root]
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             132   1e-32   
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             132   1e-32   
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     132   1e-32   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             132   1e-32   
gb|AAB22610.1|  polyphenoloxidase                                       132   1e-32   Solanum lycopersicum
gb|AAU12256.1|  polyphenol oxidase                                      132   1e-32   Populus trichocarpa x Populus deltoides
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             132   1e-32   
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    132   2e-32   Solanum lycopersicum
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             132   2e-32   
gb|AHC98007.1|  PPO                                                     132   2e-32   
gb|ACJ04908.1|  polyphenol oxidase                                      132   2e-32   Camellia sinensis [black tea]
gb|ADP89908.1|  polyphenol oxidase                                      131   2e-32   
gb|ABI96924.1|  putative polyphenol oxidase                             129   3e-32   Frangula californica [California buckthorn]
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    132   3e-32   
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    132   3e-32   
gb|ADC92563.1|  polyphenol oxidase                                      132   3e-32   
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    132   3e-32   
gb|ACR82078.1|  polyphenol oxidase                                      132   3e-32   Camellia sinensis [black tea]
gb|ABF19602.1|  polyphenol oxidase                                      132   3e-32   Camellia sinensis var. assamica [Assam tea]
gb|ACJ04909.1|  polyphenol oxidase                                      132   3e-32   
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    132   3e-32   
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 132   4e-32   
gb|AGC54425.1|  polyphenol oxidase 1                                    132   4e-32   
gb|ABI96935.1|  putative polyphenol oxidase                             130   4e-32   Heteromeles arbutifolia
gb|AII22007.1|  polyphenol oxidase-5                                    132   4e-32   
gb|ABI96948.1|  putative polyphenol oxidase                             130   4e-32   Sorbus californica
gb|ABI96927.1|  putative polyphenol oxidase                             130   4e-32   Chaenomeles speciosa [boke]
gb|ABI96930.1|  putative polyphenol oxidase                             130   4e-32   Crataegus monogyna
gb|ABR10907.1|  polyphenol oxidase                                      131   4e-32   Camellia sinensis [black tea]
gb|ABY84850.1|  polyphenol oxidase                                      130   4e-32   Cydonia oblonga [wen po]
emb|CDP06093.1|  unnamed protein product                                131   4e-32   
gb|ABI96945.1|  putative polyphenol oxidase                             130   4e-32   Prunus mexicana [Mexican plum]
gb|ACN38060.1|  polyphenol oxidase                                      131   4e-32   Camellia sinensis [black tea]
gb|ACF17425.1|  polyphenol oxidase                                      131   5e-32   Camellia sinensis [black tea]
gb|ABR57236.1|  polyphenol oxidase                                      131   5e-32   Camellia sinensis [black tea]
gb|ABR24120.1|  polyphenol oxidase                                      131   5e-32   Camellia sinensis [black tea]
gb|ABN13632.1|  polyphenol oxidase                                      131   5e-32   Doritis pulcherrima x Phalaenopsis hybrid cultivar
gb|AAK29783.1|  polyphenol oxidase                                      129   5e-32   Ananas comosus
gb|ABI96939.1|  putative polyphenol oxidase                             130   5e-32   Neillia thyrsiflora
ref|XP_007025703.1|  Larreatricin hydroxylase                           131   5e-32   
gb|ABI96941.1|  putative polyphenol oxidase                             130   6e-32   Physocarpus capitatus
ref|XP_010100570.1|  Polyphenol oxidase                                 131   6e-32   
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       131   6e-32   
gb|ABI96937.1|  putative polyphenol oxidase                             130   6e-32   Kageneckia oblonga
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    131   6e-32   
gb|ABI96926.1|  putative polyphenol oxidase                             130   7e-32   Cercocarpus betuloides
gb|AAA02877.1|  propolyphenol oxidase                                   130   8e-32   Solanum tuberosum [potatoes]
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    130   8e-32   
gb|ABI96928.1|  putative polyphenol oxidase                             130   8e-32   Chamaebatia foliolosa
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       130   8e-32   
gb|ABF19601.1|  polyphenol oxidase                                      130   8e-32   Camellia ptilophylla
gb|AII22006.1|  polyphenol oxidase-4                                    130   9e-32   
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        130   9e-32   
pdb|1BT1|A  Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet...    128   1e-31   
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    130   1e-31   
gb|AAK13244.1|  polyphenol oxidase                                      130   1e-31   Trifolium pratense [peavine clover]
gb|AAC69365.1|  polyphenol oxidase                                      129   1e-31   Diospyros kaki [Japanese persimmon]
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    131   1e-31   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             130   1e-31   
gb|AEY78528.1|  polyphenol oxidase                                      130   1e-31   
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    130   1e-31   
gb|ACM43505.1|  polyphenoloxidase                                       130   1e-31   Camellia nitidissima
dbj|BAO79387.1|  polyphenol_oxidase                                     130   1e-31   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     130   1e-31   Vitis vinifera
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    130   1e-31   
gb|ABI96940.1|  putative polyphenol oxidase                             129   2e-31   Oemleria cerasiformis [Oregon plum]
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    129   2e-31   Ipomoea batatas [batate]
gb|KHN07288.1|  Polyphenol oxidase, chloroplastic                       129   2e-31   
gb|ACB45128.1|  polyphenol oxidase                                      127   2e-31   Fragaria x ananassa
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             129   2e-31   
gb|ABX09994.1|  chloroplast polyphenol oxidase                          129   2e-31   Taraxacum officinale [dandelion]
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    129   3e-31   Ricinus communis
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    129   3e-31   
dbj|BAA21677.1|  polyphenol oxidase                                     129   3e-31   Malus domestica [apple tree]
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    129   3e-31   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    129   3e-31   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    129   3e-31   
dbj|BAA21676.1|  polyphenol oxidase                                     129   3e-31   Malus domestica [apple tree]
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    129   3e-31   Solanum tuberosum [potatoes]
gb|ABI96944.1|  putative polyphenol oxidase                             128   4e-31   Prunus dulcis [sweet almond]
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    129   4e-31   
gb|ABI96951.1|  putative polyphenol oxidase                             127   4e-31   Vauquelinia californica
gb|AHF20575.1|  polyphenol oxidase                                      129   4e-31   
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             129   4e-31   
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             129   5e-31   
gb|AAO16865.1|  polyphenol oxidase                                      128   5e-31   Ananas comosus
gb|ABI96949.1|  putative polyphenol oxidase                             127   5e-31   Spiraea cantoniensis
gb|ABI96947.1|  putative polyphenol oxidase                             127   5e-31   Rhodotypos scandens [jetbead]
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    128   6e-31   
emb|CAC83610.1|  catechol oxidase                                       127   6e-31   Ipomoea batatas [batate]
emb|CAC29040.1|  catechol oxidase                                       127   6e-31   Ipomoea batatas [batate]
gb|ABI96950.1|  putative polyphenol oxidase                             127   7e-31   Spiraea densiflora
gb|ADI44162.1|  polyphenol oxidase 1                                    128   7e-31   
emb|CAC83609.1|  catechol oxidase                                       127   7e-31   Ipomoea batatas [batate]
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    128   7e-31   
gb|KHN07285.1|  Polyphenol oxidase A1, chloroplastic                    127   8e-31   
sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    128   9e-31   Ipomoea batatas [batate]
ref|XP_007214683.1|  hypothetical protein PRUPE_ppa022943mg             127   9e-31   
gb|ABM68051.1|  polyphenol oxidase                                      128   9e-31   Trifolium pratense [peavine clover]
dbj|BAA92317.1|  polyphenol oxidase I                                   127   9e-31   Ipomoea batatas [batate]
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    128   1e-30   
gb|AHH92831.1|  polyphenol oxidase                                      127   1e-30   
gb|ABR57235.1|  polyphenol oxidase                                      127   1e-30   Camellia sinensis [black tea]
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    128   1e-30   Vicia faba [broad bean]
gb|AAW65103.1|  polyphenol oxidase                                      127   1e-30   Prunus salicina var. cordata
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             127   1e-30   
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    127   1e-30   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    127   1e-30   
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    127   1e-30   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    127   1e-30   
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    127   1e-30   
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    127   2e-30   
gb|AFH00996.1|  polyphenol oxidase II                                   127   2e-30   
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             127   2e-30   
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    127   2e-30   
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213             127   2e-30   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    126   3e-30   
gb|ABI96932.1|  putative polyphenol oxidase                             125   3e-30   Fallugia paradoxa
dbj|BAA85119.1|  polyphenol oxidase-like protein                        122   3e-30   Solanum melongena [aubergine]
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    126   4e-30   
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    126   4e-30   
gb|ABI96942.1|  putative polyphenol oxidase                             125   4e-30   Dasiphora fruticosa
gb|ABM68052.1|  polyphenol oxidase                                      126   4e-30   Trifolium pratense [peavine clover]
gb|AAW78869.1|  polyphenol oxidase                                      126   4e-30   Ipomoea batatas [batate]
ref|XP_002980680.1|  hypothetical protein SELMODRAFT_178277             125   6e-30   
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    125   8e-30   
dbj|BAM15848.1|  hypothetical protein                                   125   1e-29   
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    125   1e-29   
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    125   1e-29   
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    125   1e-29   
ref|XP_002990879.1|  hypothetical protein SELMODRAFT_11755              124   1e-29   
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    125   1e-29   
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    124   1e-29   
ref|XP_002976812.1|  hypothetical protein SELMODRAFT_175861             124   1e-29   
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     125   2e-29   
ref|XP_002976938.1|  hypothetical protein SELMODRAFT_175858             124   2e-29   
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    124   2e-29   
ref|XP_002980542.1|  hypothetical protein SELMODRAFT_178281             124   2e-29   
gb|ADI44161.1|  polyphenol oxidase 2                                    124   2e-29   
gb|AEO00529.1|  polyphenol oxidase                                      124   2e-29   
gb|AFW59500.1|  putative polyphenol oxidase family protein              124   3e-29   
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    124   3e-29   
gb|ABK35497.1|  polyphenol oxidase                                      116   4e-29   Triticum aestivum [Canadian hard winter wheat]
gb|ABE96885.1|  polyphenol oxidase                                      122   4e-29   Nicotiana tabacum [American tobacco]
gb|ABK35512.1|  polyphenol oxidase                                      116   5e-29   Triticum aestivum [Canadian hard winter wheat]
gb|ABK35498.1|  polyphenol oxidase                                      116   5e-29   Triticum monococcum [einkorn wheat]
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   6e-29   
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    122   6e-29   
gb|AII22011.1|  polyphenol oxidase-9                                    122   7e-29   
emb|CAA73103.1|  polyphenol oxidase                                     122   7e-29   Nicotiana tabacum [American tobacco]
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   7e-29   
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   7e-29   
gb|KHN08552.1|  Polyphenol oxidase A1, chloroplastic                    122   8e-29   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    121   8e-29   
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   8e-29   
ref|XP_002990878.1|  hypothetical protein SELMODRAFT_429255             122   9e-29   
pdb|2P3X|A  Chain A, Crystal Structure Of Grenache (Vitis Vinifer...    120   9e-29   
gb|AII22009.1|  polyphenol oxidase-7                                    122   1e-28   
ref|XP_010100567.1|  Polyphenol oxidase                                 122   1e-28   
gb|AAA85122.1|  polyphenol oxidase                                      122   1e-28   Solanum tuberosum [potatoes]
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   1e-28   
gb|ABI96936.1|  putative polyphenol oxidase                             121   1e-28   Holodiscus microphyllus
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    121   1e-28   
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    122   1e-28   
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    121   1e-28   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...    122   1e-28   
dbj|BAO79386.1|  polyphenol_oxidase                                     122   1e-28   
gb|EYU34162.1|  hypothetical protein MIMGU_mgv1a005754mg                120   1e-28   
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  122   1e-28   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    122   1e-28   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg                122   2e-28   
gb|ADF59059.2|  polyphenol oxidase V                                    122   2e-28   
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 122   2e-28   
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    122   2e-28   
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    122   2e-28   Solanum lycopersicum
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684             121   2e-28   
dbj|BAJ10872.1|  polyphenol oxidase                                     121   2e-28   
gb|AGK83468.1|  polyphenol oxidase                                      121   2e-28   
dbj|BAK03848.1|  predicted protein                                      121   2e-28   
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                121   2e-28   Malus domestica [apple tree]
gb|ABK35495.1|  polyphenol oxidase                                      114   2e-28   Triticum aestivum [Canadian hard winter wheat]
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    121   2e-28   Solanum lycopersicum
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870          121   2e-28   Sorghum bicolor [broomcorn]
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154             121   2e-28   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    121   2e-28   
gb|ABK35502.1|  polyphenol oxidase                                      114   2e-28   Triticum aestivum [Canadian hard winter wheat]
gb|EMT09670.1|  Polyphenol oxidase, chloroplastic                       119   3e-28   
gb|EEC78047.1|  hypothetical protein OsI_17486                          120   3e-28   Oryza sativa Indica Group [Indian rice]
gb|ABK35500.1|  polyphenol oxidase                                      114   3e-28   Aegilops tauschii
ref|NP_001149552.1|  polyphenol oxidase II                              120   3e-28   Zea mays [maize]
gb|ABK35504.1|  polyphenol oxidase                                      114   3e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    120   3e-28   
gb|ABK35496.1|  polyphenol oxidase                                      114   3e-28   Triticum aestivum [Canadian hard winter wheat]
gb|AAK13243.1|  polyphenol oxidase                                      121   3e-28   Trifolium pratense [peavine clover]
gb|ABK35494.1|  polyphenol oxidase                                      114   4e-28   Triticum turgidum subsp. durum
gb|AED02598.1|  polyphenol oxidase                                      120   4e-28   
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    120   4e-28   Vitis vinifera
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    120   5e-28   Antirrhinum majus [garden snapdragon]
gb|KHN07286.1|  Polyphenol oxidase, chloroplastic                       117   5e-28   
gb|AHX26182.1|  polyphenol oxidase                                      120   5e-28   
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    120   5e-28   
gb|AEM45935.1|  polyphenol oxidase                                      120   5e-28   
gb|ABK35503.1|  polyphenol oxidase                                      113   5e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002990877.1|  hypothetical protein SELMODRAFT_132508             120   5e-28   
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    120   6e-28   
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...    120   6e-28   
gb|ABK35507.1|  polyphenol oxidase                                      113   7e-28   
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             120   7e-28   
gb|ABK35506.1|  polyphenol oxidase                                      113   7e-28   
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    120   7e-28   
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       119   8e-28   
ref|XP_009352971.1|  PREDICTED: polyphenol oxidase, chloroplastic...    118   8e-28   
emb|CAN62983.1|  hypothetical protein VITISV_035472                     120   8e-28   
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          119   8e-28   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    120   8e-28   
gb|AAT06526.1|  polyphenol oxidase                                      117   8e-28   
ref|XP_010110268.1|  Polyphenol oxidase A1                              119   9e-28   
emb|CAE03509.2|  OSJNBa0053K19.17                                       115   9e-28   
dbj|BAJ10871.1|  polyphenol oxidase                                     119   9e-28   
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...    119   1e-27   
gb|ADG85002.1|  polyphenol oxidase                                      119   1e-27   
gb|AGU01537.1|  polyphenol oxidase                                      120   1e-27   
ref|NP_001053931.2|  Os04g0624400                                       114   1e-27   
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          119   1e-27   
gb|AHX26181.1|  polyphenol oxidase                                      119   1e-27   
emb|CAH66801.1|  H0215F08.12                                            118   1e-27   
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                119   1e-27   
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     119   1e-27   
gb|ABK35505.1|  polyphenol oxidase                                      112   1e-27   
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                119   1e-27   
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    119   1e-27   
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    119   1e-27   
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    119   1e-27   
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    119   1e-27   
gb|AII22010.1|  polyphenol oxidase-8                                    119   2e-27   
gb|AII22005.1|  polyphenol oxidase-3                                    119   2e-27   
gb|AFN53703.1|  putative phenol oxidase                                 117   2e-27   
gb|AII22008.1|  polyphenol oxidase-6                                    119   2e-27   
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    119   2e-27   
gb|AEM45936.1|  polyphenol oxidase                                      118   2e-27   
gb|ABK62804.1|  polyphenol oxidase                                      118   2e-27   
gb|ABK35508.1|  polyphenol oxidase                                      112   2e-27   
gb|EAZ32043.1|  hypothetical protein OsJ_16223                          115   2e-27   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          118   2e-27   
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          118   2e-27   
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    118   2e-27   
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          118   2e-27   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          118   2e-27   
gb|ADF59058.2|  polyphenol oxidase IV                                   118   3e-27   
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    118   3e-27   
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                118   3e-27   
gb|ABK35510.1|  polyphenol oxidase                                      111   4e-27   
gb|AEY79825.1|  polyphenol oxidase                                      117   4e-27   
gb|AHZ59731.1|  copper-containing polyphenol oxidase                    117   4e-27   
gb|AEM45931.1|  polyphenol oxidase                                      117   4e-27   
ref|XP_002982245.1|  hypothetical protein SELMODRAFT_116300             118   4e-27   
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    118   4e-27   
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       117   4e-27   
gb|ABA62017.1|  polyphenol oxidase                                      117   4e-27   
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    117   4e-27   
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       117   5e-27   
ref|XP_006574243.1|  PREDICTED: polyphenol oxidase, chloroplastic...    114   5e-27   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             117   6e-27   
gb|AAO16863.1|  polyphenol oxidase                                      117   6e-27   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg                117   6e-27   
gb|ABK35514.1|  polyphenol oxidase                                      110   7e-27   
gb|AEY79826.1|  polyphenol oxidase                                      117   7e-27   
gb|AHN09736.1|  aurone synthase                                         117   8e-27   
dbj|BAA08235.1|  polyphenol oxidase                                     115   8e-27   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   8e-27   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   9e-27   
ref|XP_004170850.1|  PREDICTED: polyphenol oxidase, chloroplastic...    115   9e-27   
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            117   1e-26   
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    117   1e-26   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    116   1e-26   
dbj|BAH36895.1|  polyphenol oxidase                                     116   1e-26   
gb|AHA91117.1|  polyphenol oxidase                                      111   1e-26   
gb|ABK35511.1|  polyphenol oxidase                                      110   1e-26   
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    116   2e-26   
ref|XP_004146641.1|  PREDICTED: polyphenol oxidase, chloroplastic...    115   2e-26   
ref|XP_008446626.1|  PREDICTED: polyphenol oxidase I, chloroplast...    117   2e-26   
ref|XP_007042162.1|  Uncharacterized protein isoform 4                  115   2e-26   
gb|AHX26180.1|  polyphenol oxidase                                      115   2e-26   
gb|AAT06527.1|  polyphenol oxidase                                      114   2e-26   
dbj|BAM15846.1|  hypothetical protein                                   115   2e-26   
gb|KHN03178.1|  Polyphenol oxidase II, chloroplastic                    114   2e-26   
gb|ACS15325.1|  polyphenol oxidase                                      114   2e-26   
gb|ACS15320.1|  polyphenol oxidase                                      114   2e-26   
ref|XP_007042160.1|  Uncharacterized protein isoform 2                  115   2e-26   
gb|ABG23081.1|  polyphenol oxidase                                      115   3e-26   
ref|XP_007042159.1|  Uncharacterized protein isoform 1                  115   3e-26   
gb|EEC78048.1|  hypothetical protein OsI_17489                          115   4e-26   
gb|AHA91116.1|  polyphenol oxidase                                      109   4e-26   
ref|NP_001053932.1|  Os04g0624500                                       115   4e-26   
gb|ABG23067.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23072.1|  polyphenol oxidase                                      115   4e-26   
ref|XP_010100565.1|  Polyphenol oxidase                                 115   4e-26   
gb|ABG23045.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23087.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23093.1|  polyphenol oxidase                                      115   4e-26   
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     115   4e-26   
gb|ABG23085.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23090.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23047.1|  polyphenol oxidase                                      115   4e-26   
emb|CAE03510.2|  OSJNBa0053K19.18                                       115   4e-26   
gb|ABG23097.1|  polyphenol oxidase                                      115   4e-26   
gb|ACS15326.1|  polyphenol oxidase                                      114   4e-26   
emb|CAH66802.1|  H0215F08.13                                            115   4e-26   
gb|ABG23077.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23073.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23057.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23066.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23059.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23083.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23098.1|  polyphenol oxidase                                      115   4e-26   
gb|AAT06525.1|  polyphenol oxidase                                      113   4e-26   
gb|ACS15330.1|  polyphenol oxidase                                      114   4e-26   
gb|ABG23062.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23092.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23060.1|  polyphenol oxidase                                      114   4e-26   
gb|ABG23086.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23070.1|  polyphenol oxidase                                      115   4e-26   
gb|ACS15337.1|  polyphenol oxidase                                      114   4e-26   
gb|ACS15319.1|  polyphenol oxidase                                      114   4e-26   
gb|ABG23061.1|  polyphenol oxidase                                      115   4e-26   
gb|ABG23084.1|  polyphenol oxidase                                      115   4e-26   
gb|AEM45934.1|  polyphenol oxidase                                      114   4e-26   
gb|ABG23075.1|  polyphenol oxidase                                      114   5e-26   
gb|ABG23042.1|  polyphenol oxidase                                      114   5e-26   
gb|AAA85121.1|  polyphenol oxidase                                      115   5e-26   
gb|ABG23065.1|  polyphenol oxidase                                      114   5e-26   
gb|AEM45933.1|  polyphenol oxidase                                      114   5e-26   
gb|ACB12087.1|  truncated polyphenol oxidase                            113   5e-26   
dbj|BAP82256.1|  polyphenol oxidase                                     114   6e-26   
dbj|BAP82254.1|  polyphenol oxidase                                     114   6e-26   
dbj|BAP82255.1|  polyphenol oxidase                                     114   7e-26   
dbj|BAP82257.1|  polyphenol oxidase                                     114   7e-26   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    114   8e-26   
dbj|BAM15845.1|  hypothetical protein                                   114   8e-26   
gb|AAS00454.1|  polyphenol oxidase                                      114   8e-26   
gb|ACB12081.1|  polyphenol oxidase                                      114   9e-26   
gb|AGC55012.1|  polyphenoloxidase                                       114   9e-26   
gb|KCW45574.1|  hypothetical protein EUGRSUZ_L00687                     112   9e-26   
gb|ACB12083.1|  polyphenol oxidase                                      114   9e-26   
gb|AEY79824.1|  polyphenol oxidase                                      114   9e-26   
gb|ACB12082.1|  polyphenol oxidase                                      114   9e-26   
gb|ABK62801.1|  polyphenol oxidase                                      114   9e-26   
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...    114   9e-26   
dbj|BAH36896.1|  polyphenol oxidase                                     113   1e-25   
gb|ACB12084.1|  polyphenol oxidase                                      114   1e-25   
gb|ABK35513.1|  polyphenol oxidase                                      107   1e-25   
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...    114   1e-25   
gb|ABK62803.1|  polyphenol oxidase                                      114   1e-25   
gb|ACB12086.1|  polyphenol oxidase                                      113   1e-25   
gb|AFS28698.1|  putative polyphenol oxidase                             112   1e-25   
gb|AFS28697.1|  putative polyphenol oxidase                             112   1e-25   
emb|CDP06099.1|  unnamed protein product                                113   1e-25   
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    113   1e-25   
dbj|BAH36897.1|  polyphenol oxidase                                     113   2e-25   
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)             113   2e-25   
dbj|BAM15849.1|  hypothetical protein                                   113   2e-25   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    113   3e-25   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...    112   3e-25   
gb|AAW58110.1|  polyphenol oxidase                                      108   3e-25   
ref|XP_010099505.1|  Polyphenol oxidase                                 111   3e-25   
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...    112   3e-25   
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg                112   4e-25   
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    112   4e-25   
gb|ABJ90144.1|  polyphenol oxidase                                      112   4e-25   
emb|CAN68528.1|  hypothetical protein VITISV_044225                     108   4e-25   
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...    112   5e-25   
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...    112   5e-25   
ref|XP_007211883.1|  hypothetical protein PRUPE_ppa003608mg             111   7e-25   
ref|XP_009380367.1|  PREDICTED: polyphenol oxidase I, chloroplast...    111   8e-25   
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...    111   8e-25   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220          111   1e-24   
ref|XP_010110269.1|  Polyphenol oxidase                                 110   1e-24   
gb|ABK62802.1|  polyphenol oxidase                                      110   1e-24   
gb|ACM48249.1|  polyphenol oxidase                                      106   2e-24   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   2e-24   
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    110   2e-24   
ref|XP_010099507.1|  Polyphenol oxidase                                 108   3e-24   
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    110   3e-24   
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   3e-24   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...    109   3e-24   
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   4e-24   
gb|AGT28746.1|  aurone synthase                                         109   6e-24   
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   6e-24   
gb|AGT28745.1|  aurone synthase                                         109   6e-24   
gb|ADB44003.1|  polyphenol oxidase                                      103   6e-24   
ref|XP_001760137.1|  predicted protein                                  106   8e-24   
ref|XP_010100566.1|  Polyphenol oxidase                                 108   1e-23   
ref|XP_010263628.1|  PREDICTED: aureusidin synthase-like                108   1e-23   
gb|EPS59410.1|  polyphenoloxidase                                       108   1e-23   
dbj|BAA08234.1|  polyphenol oxidase                                     108   1e-23   
ref|NP_001147867.1|  polyphenol oxidase precursor                       107   2e-23   
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    107   2e-23   
gb|AFW87458.1|  putative polyphenol oxidase family protein              107   2e-23   
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             107   2e-23   
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    107   2e-23   
ref|XP_004170849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    105   3e-23   
ref|XP_010686564.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   3e-23   
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg                107   3e-23   
ref|XP_008446638.1|  PREDICTED: polyphenol oxidase, chloroplastic...    106   4e-23   
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             106   4e-23   
ref|XP_010100573.1|  Polyphenol oxidase                                 103   5e-23   
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          106   5e-23   
gb|ACR61398.1|  polyphenol oxidase                                      106   6e-23   
gb|ACR61399.1|  polyphenol oxidase                                      105   6e-23   
ref|XP_006370123.1|  hypothetical protein POPTR_0001s39900g             103   1e-22   
dbj|BAP82258.1|  polyphenol oxidase                                     105   1e-22   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg             105   1e-22   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...    105   2e-22   
ref|XP_009388018.1|  PREDICTED: polyphenol oxidase, chloroplastic...    104   2e-22   
ref|XP_004146643.1|  PREDICTED: aureusidin synthase-like                101   2e-22   
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...    104   2e-22   
gb|ABL67929.1|  polyphenol oxidase                                      100   2e-22   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                104   2e-22   
gb|ACJ65307.1|  polyphenol oxidase                                    98.6    3e-22   
ref|XP_009388329.1|  PREDICTED: polyphenol oxidase, chloroplastic...    103   4e-22   
dbj|BAA75623.1|  polyphenol oxidase                                   99.8    4e-22   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...    103   6e-22   
gb|ADF59060.1|  polyphenol oxidase 6 precursor                          103   6e-22   
gb|AFH00998.1|  polyphenol oxidase III                                  103   6e-22   



>gb|AAC28935.1| polyphenol oxidase precursor [Prunus armeniaca]
Length=597

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G   GT+ N+PHN++H WVGDP   H EDMGNFYSA +DP+FY HH+NVDRMW IWKTLG
Sbjct  330  GKYPGTIENMPHNNIHIWVGDPSQTHQEDMGNFYSAGRDPLFYAHHANVDRMWNIWKTLG  389

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR DI D ++L++EFLFYDEN  LV+VK+ DS 
Sbjct  390  GKRKDITDTDWLDAEFLFYDENAELVRVKVRDSL  423



>ref|XP_007214660.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
 gb|AFI08585.1| polyphenol oxidase II [Prunus persica]
 gb|EMJ15859.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
Length=596

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            GT+ N+PHN++H WVGDP   H EDMGNFYSA +DP+FY HH NVDRMWTIWKTLGGKR 
Sbjct  333  GTIENMPHNNIHLWVGDPNQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWTIWKTLGGKRQ  392

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            DI D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  393  DITDTDWLDAEFLFYDENAELVNCKVRDSL  422



>gb|ACN78382.1| polyphenol oxidase [Solanum quitoense]
Length=472

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P  GT+ N+PHN+VH WVGDPR P+ EDMGNFYS+  +P F+CHHSNVDRMW  WK +G
Sbjct  218  SPGMGTIENIPHNAVHVWVGDPRQPNGEDMGNFYSSGLEPAFFCHHSNVDRMWNEWKAIG  277

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D+ADK++LN+EFLFYDEN+ L +V++ D  
Sbjct  278  GKRRDLADKDWLNTEFLFYDENRKLFRVRVRDCL  311



>ref|XP_009603530.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P  GT+ NVPHNS+HRWVGDPR P+ EDMGNFYS+ KDP F+  H+NVDRMWTIWKTLG
Sbjct  308  SPGMGTIENVPHNSIHRWVGDPRQPNQEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLG  367

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR DI+D +YL++EF FYDE     +V+++D  
Sbjct  368  GKRKDISDPDYLDTEFFFYDEKAKPFRVRVQDCL  401



>ref|XP_011044088.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=393

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P +GT+ N PHN++HRW GDP   + EDMGNFYSA++DP+F+CHHSNVDRMWTIWKT+ G
Sbjct  127  PGAGTIENSPHNNIHRWAGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIPG  186

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            G R DI+D ++LNSEFLFY+EN  LV+ K+ D  
Sbjct  187  GIRRDISDPDWLNSEFLFYNENAELVRCKVRDCL  220



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P +GT+   PHN++HRW GDP   +NEDMGNFYSA++DP+F+CHHSNVDRMWTIWKT+ 
Sbjct  296  SPGAGTIETTPHNNIHRWTGDPTQENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIP  355

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG R DI+D ++LNSEFLFY+EN  LV+ K+ D  
Sbjct  356  GGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCL  390



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P +GT+   PHN++HRW GDP   +NEDMGNFYSA++DP+F+CHHSNVDRMWTIWKT+ 
Sbjct  296  SPGAGTIETTPHNNIHRWTGDPTQENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIP  355

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG R DI+D ++LNSEFLFY+EN  LV+ K+ D  
Sbjct  356  GGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCL  390



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
             +G++ N+PH  +H W GDPR PH EDMG+FY+A +DP+FY HH+NVDRMW++WKTLG K
Sbjct  332  GAGSLENIPHTPIHIWTGDPRQPHGEDMGHFYAAGRDPLFYAHHANVDRMWSVWKTLGKK  391

Query  426  RMDIADKNYLNSEFLFYDENKNLVKVKIEDS  334
            R D  D ++L SEFLFYDENKNLVKVK++DS
Sbjct  392  RKDFTDPDWLESEFLFYDENKNLVKVKVKDS  422



>ref|XP_009628381.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P  GT+ NVPHNS+HRWVGDPR P+ EDMGNFYS+ KDP F+  H+NVDRMWTIWKTLG
Sbjct  308  SPGMGTIENVPHNSIHRWVGDPRQPNEEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLG  367

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR DI+D +YL++EF FYDE     +V++ D  
Sbjct  368  GKRKDISDPDYLDTEFFFYDEKAKPFRVRVRDCL  401



>ref|XP_006377743.1| hypothetical protein POPTR_0011s10940g [Populus trichocarpa]
 gb|ERP55540.1| hypothetical protein POPTR_0011s10940g [Populus trichocarpa]
Length=432

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P +GT+   PHN++HRW GDP   + EDMGNFYSA++DP+F+CHHSNVDRMWTIWKT+
Sbjct  154  SSPGAGTIETTPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTI  213

Query  435  -GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             GG R DI+D+++LNSEF+FY+EN  LV+ K+ D  
Sbjct  214  PGGTRRDISDRDWLNSEFIFYNENAELVRCKVRDCL  249



>gb|AAW58109.2| polyphenol oxidase [Prunus salicina var. cordata]
Length=597

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            GT+ N+PHN++H WVGDP   H+EDMGNFYSA +DP+FY HH NVDRMW IWKTLGGKR 
Sbjct  334  GTIENMPHNNIHIWVGDPTQTHHEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLGGKRK  393

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            DI D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  394  DITDTDWLDAEFLFYDENAELVNCKVRDSL  423



>ref|XP_008225003.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=597

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            GT+ N+PHN +H WVGDP   H+EDMGNFYSA +DP+FY HH NVDRMW IWKTLGGKR 
Sbjct  334  GTIENMPHNDIHIWVGDPTQTHHEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLGGKRK  393

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            DI D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  394  DITDTDWLDAEFLFYDENAELVNCKVRDSL  423



>gb|ADY18410.1| chloroplast polyphenol oxidase precursor, partial [Solanum melongena]
Length=584

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            P  GT+ N+PH  VH W GD PR P+ EDMGNFYSA  DPVFYCHH+NVDRMW  WK +G
Sbjct  316  PGMGTIENIPHTPVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKAIG  375

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D+ADK++LNSEF FYDEN+N  KVK+ D  
Sbjct  376  GKRRDLADKDWLNSEFFFYDENRNPFKVKVRDCL  409



>ref|XP_011016645.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=560

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P +GT+ N PHN++HRW GDP   + EDMGNFYSA++DP+F+CHHSNVDRMWT+WKT+ G
Sbjct  294  PGAGTIENSPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTLWKTIPG  353

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            G R DI+D ++LNSEFLFY+EN  LV+ K+ D  
Sbjct  354  GIRRDISDPDWLNSEFLFYNENAELVRCKVRDCL  387



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
             +G++ N+PH  +H W GDPR PH EDMG+F++A +DP+FY HH+NVDRMW++WKTLG K
Sbjct  332  GAGSLENIPHTPIHIWTGDPRQPHGEDMGHFWAAGRDPLFYAHHANVDRMWSVWKTLGKK  391

Query  426  RMDIADKNYLNSEFLFYDENKNLVKVKIEDS  334
            R D  D ++L SEFLFYDENKNLVKVK++DS
Sbjct  392  RKDFTDPDWLESEFLFYDENKNLVKVKVKDS  422



>gb|ACL31300.1| polyphenol oxidase [Cichorium intybus]
Length=190

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P  G++ ++PH  VH W GD   P+ EDMGNFYSA++DP+FY HH+N+DRMW++WKTL
Sbjct  88   ASPGGGSLESIPHGPVHIWTGDRNQPNGEDMGNFYSAARDPIFYAHHANIDRMWSVWKTL  147

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG+R D  DK++L+S FLFYDEN +LV+VK+ D  
Sbjct  148  GGRRNDFTDKDWLDSSFLFYDENADLVRVKVRDCL  182



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NVPH  VHRW GD   P+ E+MG FY+A++DP+F+ HHSN+DR W++WKTLGG
Sbjct  326  PGAGSIENVPHGPVHRWSGDNTQPNFENMGTFYAAARDPIFFSHHSNIDRFWSVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  DK++L SEFLFYDENKNLVKVK++DS 
Sbjct  386  KRKDFKDKDWLESEFLFYDENKNLVKVKVKDSL  418



>ref|XP_003605686.1| Polyphenol oxidase [Medicago truncatula]
Length=479

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -3

Query  597  TVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRMD  418
            ++ NVPHN++H W GD R P++E+MGNFYSA++DPVF+ HHSN+DR+W+IWKTLGGKR D
Sbjct  256  SIENVPHNTIHTWSGDNRQPNHENMGNFYSAARDPVFFSHHSNIDRLWSIWKTLGGKRKD  315

Query  417  IADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              DK++L SEFLFYDENKNLVKV ++D  
Sbjct  316  FNDKDWLESEFLFYDENKNLVKVNVKDCL  344



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            GP  G + N+PH  VH W GD   P++EDMGNFYSA++DP+F+CHHSNVDRMW++WKTLG
Sbjct  310  GPEPGPIENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG  369

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            G+R D+ D ++LN+ F FYDEN N V+VK+ D    R
Sbjct  370  GRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSR  406



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            GP  G + N+PH  VH W GD   P++EDMGNFYSA++DP+F+CHHSNVDRMW++WKTLG
Sbjct  310  GPEPGPIENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG  369

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            G+R D+ D ++LN+ F FYDEN N V+VK+ D    R
Sbjct  370  GRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSR  406



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+F+ HH+NVDRMWT+WKTLGG
Sbjct  313  PGAGSIENIPHGPVHLWTGDSTQPNKEDMGNFYSAGRDPIFFAHHANVDRMWTLWKTLGG  372

Query  429  -KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             KR +I D ++LN+EFLFYDEN NLV+VK++DS 
Sbjct  373  SKRTEITDTDWLNAEFLFYDENANLVRVKVKDSI  406



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  +H W GD R P+ EDMGNFYSA +DP+FY HHSNVDRMW++WKTLGG
Sbjct  326  PGAGSLENIPHGPIHIWCGDNRQPNLEDMGNFYSAGRDPIFYAHHSNVDRMWSVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D  D ++L+S FLFYDEN NLV+VK+ D    R
Sbjct  386  KRTDFTDSDWLDSGFLFYDENANLVRVKVRDCLDTR  421



>gb|AES87883.2| polyphenoloxidase [Medicago truncatula]
Length=467

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  597  TVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRMD  418
            ++ NVPHN++H W GD R P++E+MGNFYSA++DPVF+ HHSN+DR+W+IWKTLGGKR D
Sbjct  256  SIENVPHNTIHTWSGDNRQPNHENMGNFYSAARDPVFFSHHSNIDRLWSIWKTLGGKRKD  315

Query  417  IADKNYLNSEFLFYDENKNLVKVKIED  337
              DK++L SEFLFYDENKNLVKV ++D
Sbjct  316  FNDKDWLESEFLFYDENKNLVKVNVKD  342



>gb|AAK53414.1|AF368291_1 polyphenol oxidase [Populus tremuloides]
Length=563

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P +GT+ + PHN++HRW GDP   + EDMGNFYSA++DP+F+CHHSNVDRMWTIWKT+ G
Sbjct  297  PGAGTIESSPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIPG  356

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            G R DI D ++LNSEFLFY+EN  LV+ K+ D  
Sbjct  357  GLRRDITDPDWLNSEFLFYNENAELVRCKVRDCL  390



>ref|XP_008345878.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=353

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G  +GT+ N PHN++H W GDP  P+ EDMGNFYSA +DP+FY HH NVDRMW IWKTLG
Sbjct  86   GKYAGTIENNPHNNIHLWCGDPNQPNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLG  145

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  146  GKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSI  179



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            GP +G + N+PH  VH W GD   P+ EDMGNFYSA++DP+F+CHHSNVDRMW++WKTLG
Sbjct  310  GPEAGPIENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG  369

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            G+R D+ D ++LN+ F FYDEN N V+VK+ D    R
Sbjct  370  GRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTR  406



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            GP +G + N+PH  VH W GD   P+ EDMGNFYSA++DP+F+CHHSNVDRMW++WKTLG
Sbjct  310  GPEAGPIENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG  369

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            G+R D+ D ++LN+ F FYDEN N V+VK+ D    R
Sbjct  370  GRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTR  406



>gb|ADY18411.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=586

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PHN VH W GD PR P+ EDMGNFYSA  DPVFYCHH+NVDRMW  WK +
Sbjct  316  SPGMGTIENIPHNPVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKAI  375

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+ADK++LNSE  FYDEN+N  KVK+ D  
Sbjct  376  GGKRRDLADKDWLNSESFFYDENRNPFKVKVRDCL  410



>gb|AES87890.2| polyphenoloxidase [Medicago truncatula]
Length=606

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
             +G+V  VPHN+VH W GD R P++E+MG FYSA++DPVF+ HHSN+DR+W+IWKTLGGK
Sbjct  322  CAGSVEIVPHNTVHNWSGDTRQPNHENMGTFYSAARDPVFFSHHSNIDRLWSIWKTLGGK  381

Query  426  RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            R D  DK++L SEFLFYDENKNLVKV ++D  
Sbjct  382  RKDFYDKDWLESEFLFYDENKNLVKVNVKDCL  413



>ref|XP_003605693.1| Polyphenol oxidase A1 [Medicago truncatula]
Length=460

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
             +G+V  VPHN+VH W GD R P++E+MG FYSA++DPVF+ HHSN+DR+W+IWKTLGGK
Sbjct  176  CAGSVEIVPHNTVHNWSGDTRQPNHENMGTFYSAARDPVFFSHHSNIDRLWSIWKTLGGK  235

Query  426  RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            R D  DK++L SEFLFYDENKNLVKV ++D  
Sbjct  236  RKDFDDKDWLESEFLFYDENKNLVKVNVKDCL  267



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NVPH  VH W GD   P+ EDMGNFYSA++DP+FY HH+NVDRMWTIWKTLGG
Sbjct  332  PGNGSLENVPHGPVHLWAGDRNQPNVEDMGNFYSAARDPIFYAHHANVDRMWTIWKTLGG  391

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L+S FLFYDEN  LVKVK+ D  
Sbjct  392  KRRDFTDPDWLDSAFLFYDENAELVKVKVRDCL  424



>gb|ABI96938.1| putative polyphenol oxidase [Lyonothamnus floribundus]
Length=454

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P SG++   PH+ +H W GD   P+ EDMGNFYSA KDP+FY HHSNVDRMW IWKTLGG
Sbjct  233  PGSGSIEGTPHSQIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWCIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI+D ++LNS FLFY+EN  LV+VK++DS 
Sbjct  293  KRTDISDSDWLNSGFLFYNENSELVRVKVKDSL  325



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NVPH  VHRW GD   P+ E+MG FY+A++DP+F+ HHSN+DR W+IWKTLGG
Sbjct  326  PGAGSIENVPHGPVHRWSGDNTQPNFENMGVFYAAARDPIFFSHHSNIDRFWSIWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  DK++L SEFLFYDENKNLVKVK++D  
Sbjct  386  KRKDFKDKDWLESEFLFYDENKNLVKVKVKDCL  418



>ref|XP_006365391.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
tuberosum]
Length=604

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            GT+ NVPHNSVHRWVG+P     E+MG FYSA++DP+FY HH+NVDRMWTIWKTLGG R 
Sbjct  333  GTIENVPHNSVHRWVGNPNNKFRENMGTFYSAARDPIFYAHHANVDRMWTIWKTLGGNRR  392

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            D  D+++L+S FLFYDEN+ LVKV ++D  
Sbjct  393  DFNDRDWLDSAFLFYDENRTLVKVTVQDCI  422



>gb|AAT75166.1| polyphenol oxidase [Camellia sinensis]
Length=575

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HHSNVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHSNVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRARYKI  307
            KR D  D ++LNSEF FYDEN  LV VK+++S   R R ++
Sbjct  386  KRNDFKDPDWLNSEFTFYDENAQLVTVKVKESLDHRKRLRL  426



>ref|XP_004246041.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
lycopersicum]
Length=589

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            GT+ NVPHNSVHRWVG+P     E+MG FYSA++DP+FY HH+NVDRMWTIWKTLGG R 
Sbjct  320  GTIENVPHNSVHRWVGNPNNKFRENMGTFYSAARDPIFYAHHANVDRMWTIWKTLGGNRR  379

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIED  337
            D  D+++L+S FLFYDEN+ LVKV ++D
Sbjct  380  DYNDRDWLDSAFLFYDENRTLVKVTVQD  407



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V NVPH  VH W GD   P+ E+MG FYSA++DP+FY HHSN+DRMW+IWKTLGG
Sbjct  326  PGFGSVENVPHGPVHLWTGDINQPNIENMGTFYSAARDPIFYSHHSNIDRMWSIWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D  D ++L S FLFYDENKNLV+VK++DS   R
Sbjct  386  KRRDFTDSDWLESAFLFYDENKNLVRVKVKDSLDTR  421



>ref|XP_003522849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
 gb|KHN32510.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V + PH  VH W GD   P  EDMGN Y+A++DP+FYCHHSNVDRMW+IWKTLGG
Sbjct  322  PGGGSVESTPHGPVHAWTGDINHPTMEDMGNLYAAARDPIFYCHHSNVDRMWSIWKTLGG  381

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D+ D ++L S FLFYDENKNLV+VK +D    R
Sbjct  382  KRRDLTDPDWLESAFLFYDENKNLVRVKTKDCLDTR  417



>gb|ABI96925.1| putative polyphenol oxidase [Adenostoma fasciculatum]
Length=454

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PH  +H W GD   P+ EDMGNFYSA KDP+FY HHSNVDRMW+IWKTLGG
Sbjct  233  PGAGSIEGTPHGPIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI DK++L+S FLFY+EN  LV+VK+ DS 
Sbjct  293  KRTDITDKDWLDSGFLFYNENAELVRVKVRDSL  325



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G  +GT+ N PHN++H W GDP  P+ EDMGNFYSA +DP+FY HH NVDRMW IWKTLG
Sbjct  333  GKYAGTIENNPHNNIHLWCGDPNQPNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLG  392

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  393  GKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSI  426



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH SVH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ADK++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLADKDWLDSGFLFYNENAELVRVKVRDCL  409



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+  N+PH SVH W GD   P+ EDMGNFYSA +DP+F+ HHSN+DRMW +WKTLGG
Sbjct  330  PGPGSFENIPHGSVHTWTGDNTQPYGEDMGNFYSAGRDPIFFAHHSNIDRMWNVWKTLGG  389

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D  D ++L++ FLFYDEN  LV+VK+ DS   R
Sbjct  390  KRQDFTDPDWLDASFLFYDENSQLVRVKVRDSLDSR  425



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G  +GT+ N PHN++H W GDP   H EDMGNFYSA +DP+FY HH NVDRMW +WKTLG
Sbjct  333  GTYAGTIENSPHNNIHLWCGDPNQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWNVWKTLG  392

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  393  GKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSL  426



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V NVPH SVH W GD   P+ EDMG FYSA++DP+F+ HHSN+DRMW+IWKTLGG
Sbjct  325  PGFGSVENVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGG  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L S FLFYDENKNLV+VK++D  
Sbjct  385  KRKDFTDSDWLESGFLFYDENKNLVRVKVKDCL  417



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V NVPH SVH W GD   P+ EDMG FYSA++DP+F+ HHSN+DRMW+IWKTLGG
Sbjct  325  PGFGSVENVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGG  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L S FLFYDENKNLV+VK++D  
Sbjct  385  KRKDFTDSDWLESGFLFYDENKNLVRVKVKDCL  417



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G + N+PH  +H W GD + P+ E+MGNFYSA++DP+FY HHSNVDRMWT+WKTLGG
Sbjct  325  PGAGALENLPHGPIHLWCGDTKQPNFENMGNFYSAARDPIFYAHHSNVDRMWTVWKTLGG  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR +  D ++LN+ FLFYDEN NLV+VK+ D  
Sbjct  385  KRTNFTDPDWLNAGFLFYDENANLVRVKVRDCL  417



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH SVH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IW+TLGG
Sbjct  317  PGGGSIEGTPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWRTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ADK++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLADKDWLDSGFLFYNENAELVRVKVRDCL  409



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+P+  VH W GD   P+ E+MGNFYSA++DP+F+ HHSNVDRMWTIWKTLGG
Sbjct  317  PGAGSIENIPYGPVHLWSGDNTQPNLENMGNFYSAARDPMFFAHHSNVDRMWTIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++LN+ FLFYDENK LV+VK+ D  
Sbjct  377  KRKDITDPDWLNAGFLFYDENKQLVRVKVRDCL  409



>ref|XP_003593517.1| Polyphenol oxidase A1 [Medicago truncatula]
 gb|ABN08604.1| Tyrosinase [Medicago truncatula]
 gb|AES63768.1| polyphenoloxidase [Medicago truncatula]
Length=608

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V  VPHN VH W GD   P+ EDMG+FYSA++DP+F+ HHSN+DR W+IWKTLGG
Sbjct  324  PGAGSVEIVPHNIVHLWSGDDTQPNFEDMGDFYSAARDPIFFSHHSNIDRFWSIWKTLGG  383

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  DK++L SEFLFYDENKNLVKV ++D  
Sbjct  384  KRKDFNDKDWLESEFLFYDENKNLVKVNVKDCL  416



>ref|XP_007159290.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
 gb|ESW31284.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
Length=594

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P +G++ +VPH  VH W GDPR P+ EDMG FYSA KDP+FY HH+NVDR+W+IWKT+ G
Sbjct  315  PGAGSLEHVPHIPVHSWCGDPREPNREDMGVFYSAGKDPIFYAHHANVDRVWSIWKTIPG  374

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            GKR D  D ++L S FLFYDENKNLV+VK++DS   R
Sbjct  375  GKRRDFTDPDWLESSFLFYDENKNLVRVKVKDSLDTR  411



>emb|CDP22269.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++  +PH  +HRWVGDPR P+ EDMGNFYSA +D VFY HH+NVDRMWTIW+ LGG
Sbjct  160  PGAGSIEAIPHIPIHRWVGDPRQPNGEDMGNFYSAGRDIVFYSHHANVDRMWTIWQQLGG  219

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR ++ D ++LNS F+FYDEN   V VK+ D F
Sbjct  220  KRKEVPDPDWLNSSFIFYDENAQPVCVKVGDCF  252



>gb|ABI96946.1| putative polyphenol oxidase [Pyrus communis subsp. caucasica]
Length=453

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ADK++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLADKDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|ABI96931.1| putative polyphenol oxidase [Exochorda racemosa]
Length=459

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ N+PH  +H W GD   P+ E+MGNFYSA KDP+FY HHSNVDRMW IWKTLGG
Sbjct  236  PGGGSIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWKTLGG  295

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++LNS FLFY+EN  LV+VK++DS 
Sbjct  296  KRTDLTDSDWLNSGFLFYNENAELVRVKVKDSL  328



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ADK++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLADKDWLDSGFLFYNENAELVRVKVRDCL  409



>gb|ABI96943.1| putative polyphenol oxidase [Prinsepia sinensis]
Length=457

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ N+PH  +H W GD   P+ E+MGNFYSA KDP+FY HHSNVDRMW IWKTLGG
Sbjct  236  PGGGSIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWKTLGG  295

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++LNS FLFY+EN  LV+VK++DS 
Sbjct  296  KRTDLTDSDWLNSGFLFYNENAELVRVKVKDSL  328



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ADK++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLADKDWLDSGFLFYNENAELVRVKVRDCL  409



>gb|AFO55219.1| chloroplast polyphenol oxidase III [Eriobotrya japonica]
Length=614

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G  +GT+ N PHN++H W GDP   + EDMGNFYSA +DP+FY HH NVDRMW IWKTLG
Sbjct  347  GTYAGTIENTPHNNIHLWCGDPNQTNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLG  406

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  407  GKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSL  440



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  G++ N PH +VHRWVGD R P +EDMGNFYSA +DP+F+ HHSNVDR+W+IW+TL 
Sbjct  322  SPGMGSIENNPHTAVHRWVGDKRQPFSEDMGNFYSAGRDPLFFAHHSNVDRLWSIWRTLP  381

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            G KR D  D ++L+S FLFYDEN NLV+VK+ DS 
Sbjct  382  GKKRTDFTDTDWLDSSFLFYDENANLVRVKVRDSL  416



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P SG+V N+PH  VH W GDP  P+ E+MGNFYSA +DP+FY HHSN+DR+W++WK LGG
Sbjct  313  PGSGSVENIPHGPVHVWTGDPTQPNGENMGNFYSAGRDPIFYAHHSNIDRLWSLWKGLGG  372

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R DI D ++L++ FLFYDEN  +V+VK  D  
Sbjct  373  RRQDITDPDFLDASFLFYDENGQMVRVKTRDCL  405



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ADK++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLADKDWLDSGFLFYNENAELVRVKVRDCL  409



>gb|ABI96929.1| putative polyphenol oxidase [Chamaebatiaria millefolium]
Length=453

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  +H W GD   P+ EDMGNFYSA +DP+FY HHSNVDRMW IWKTLGG
Sbjct  232  PGGGSIEGTPHGPIHLWTGDNTQPNFEDMGNFYSAGRDPIFYSHHSNVDRMWAIWKTLGG  291

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI DK++L+S FLFY+EN  LV+VK+ DS 
Sbjct  292  KRTDITDKDWLDSGFLFYNENAELVRVKVRDSL  324



>gb|ABI96933.1| putative polyphenol oxidase [Gillenia stipulata]
Length=453

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH SVH W GD   P+ EDMGNFYSA +DP+FY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGSPHGSVHLWTGDTTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDITDSDWLDSGFLFYNENAELVRVKVRDCL  325



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G + N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HHSN+DRMWT+WKTLGG
Sbjct  309  PGAGQLENIPHGPVHVWTGDRTQPNLEDMGNFYSAGRDPIFYAHHSNIDRMWTLWKTLGG  368

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R DI D ++LN+ F+FYDEN  +V+V++ D  
Sbjct  369  RRQDITDTDWLNASFVFYDENAQMVRVRVRDCL  401



>ref|XP_009334541.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
            +GT+ N PHN++H W GDP  P+ EDMGNFYS+ +DP+FY HH NVDRMW IWKTLGGKR
Sbjct  336  AGTIENNPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKR  395

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  396  KDPTDTDWLDAEFLFYDENAELVSCKVRDSI  426



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GT+ + PHN++H W GD   P+ E+MGNFYSA +DP+F+ HHSNVDRMWTIWKTLGG
Sbjct  329  PGAGTIESTPHNNIHLWTGDDTQPNIENMGNFYSAGRDPIFFAHHSNVDRMWTIWKTLGG  388

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIED  337
            KR DI D ++LNS F FYDEN + V+VK++D
Sbjct  389  KRKDITDPDWLNSSFFFYDENADPVRVKVKD  419



>ref|XP_009334704.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
            +GT+ N PHN++H W GDP  P+ EDMGNFYS+ +DP+FY HH NVDRMW IWKTLGGKR
Sbjct  336  AGTIENNPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKR  395

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  D ++L++EFLFYDEN  LV  K+ DS 
Sbjct  396  KDPTDTDWLDAEFLFYDENAELVSCKVRDSI  426



>gb|ADY18412.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=584

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            P  GT+ N+PHN+VH W GD PR P+ E MG FYSA  DPVFY HH+NVDRMW  WK +G
Sbjct  315  PGMGTIENIPHNAVHNWTGDQPRQPNGEHMGTFYSAGLDPVFYSHHANVDRMWNEWKAIG  374

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D+ADK++LNSEF FYDEN+N  KVK+ D  
Sbjct  375  GKRRDLADKDWLNSEFFFYDENRNPFKVKVRDCL  408



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P SG++ N+PH  VH W GD   P+ E+MGNFYSA +DP+FY HHSN+DR+W+IWKTLGG
Sbjct  314  PGSGSIENIPHGPVHVWTGDRNQPNFENMGNFYSAGRDPIFYAHHSNIDRLWSIWKTLGG  373

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R DI D+++L++ F+FYDEN  +V+VK+ D  
Sbjct  374  RRQDITDRDFLDASFVFYDENAQMVRVKVRDCL  406



>ref|XP_006370119.1| hypothetical protein POPTR_0001s39670g [Populus trichocarpa]
 gb|ERP66688.1| hypothetical protein POPTR_0001s39670g [Populus trichocarpa]
Length=416

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + G
Sbjct  148  PGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDMWKKIPG  207

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  208  GKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTL  241



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P SG++ N PHN VH W GD   P+ E+MGNFYSA +DP+F+ HHSN+DRMWTIW+TLGG
Sbjct  315  PGSGSIENTPHNPVHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGG  374

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR +  + ++L+S FLFYDEN NLV+VK+ D  
Sbjct  375  KRTNFTEPDWLDSAFLFYDENANLVRVKVRDCL  407



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P SG++ N PHN VH W GD   P+ E+MGNFYSA +DP+F+ HHSN+DRMWTIW+TLGG
Sbjct  315  PGSGSIENAPHNPVHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGG  374

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR +  + ++L+S FLFYDEN NLV+VK+ D  
Sbjct  375  KRTNFTEPDWLDSAFLFYDENANLVRVKVRDCL  407



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P SG++ N PHN VH W GD   P+ E+MGNFYSA +DP+F+ HHSN+DRMWTIW+TLGG
Sbjct  315  PGSGSIENAPHNPVHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGG  374

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR +  + ++L+S FLFYDEN NLV+VK+ D  
Sbjct  375  KRTNFTEPDWLDSAFLFYDENANLVRVKVRDCL  407



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P  G++ ++PH  VH W GD   P+ EDMGNFYSA++DP+FY HH+N+DRMW++WKTL
Sbjct  318  ANPGGGSLESIPHGPVHIWTGDRNQPNGEDMGNFYSAARDPIFYAHHANIDRMWSVWKTL  377

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG+R D  DK++L+S FLFYDEN  LV+VK+ D+ 
Sbjct  378  GGRRNDFTDKDWLDSAFLFYDENAELVRVKVRDAL  412



>sp|Q08307.1|PPOE_SOLLC RecName: Full=Polyphenol oxidase E, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78299.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=587

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + EDMGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  317  SPGQGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNEWKLI  376

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+ DK++LNSEF FYDEN+N  +VK+ D  
Sbjct  377  GGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCL  411



>ref|XP_010325653.1| PREDICTED: polyphenol oxidase E, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + EDMGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  317  SPGQGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNEWKLI  376

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+ DK++LNSEF FYDEN+N  +VK+ D  
Sbjct  377  GGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCL  411



>gb|ABI96934.1| putative polyphenol oxidase [Gillenia trifoliata]
Length=453

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PH SVH W GD   P+ EDMGNFYSA +DP+FY HHSNVDRMW+IWKTLGG
Sbjct  233  PGTGSIEGSPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>ref|XP_006370117.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
 gb|ERP66686.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
Length=543

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  274  SPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  333

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  334  GGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTL  368



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  372  GGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTL  406



>ref|XP_004246033.1| PREDICTED: polyphenol oxidase F, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            P  GT+ N+PH  VH W GD PR  H EDMGNFYSA  DP+FYCHH+NVDRMW  WK +G
Sbjct  318  PGMGTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEWKLIG  377

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D+++K++LNSEF FYDEN+N  +VK+ D  
Sbjct  378  GKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCL  411



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  372  GGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTL  406



>gb|AAB22610.1| polyphenoloxidase (chloroplast) [Solanum lycopersicum]
Length=587

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + EDMGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  317  SPGQGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNEWKLI  376

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIED  337
            GGKR D+ DK++LNSEF FYDEN+N  +VK+ D
Sbjct  377  GGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRD  409



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  372  GGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTL  406



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  372  GGKREDIEDSDWLNSEFLFWDENKELVRVKVKDTL  406



>sp|Q08296.1|PPOF_SOLLC RecName: Full=Polyphenol oxidase F, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78300.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=585

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            P  GT+ N+PH  VH W GD PR  H EDMGNFYSA  DP+FYCHH+NVDRMW  WK +G
Sbjct  316  PGMGTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEWKLIG  375

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D+++K++LNSEF FYDEN+N  +VK+ D  
Sbjct  376  GKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCL  409



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP     E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTQIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF+DENK LV+VK++D+ 
Sbjct  372  GGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTL  406



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++  +PH  VH W GD   P+ E+MGNFYSA++DP+FY HHSN+DRMW++WKTLGG
Sbjct  318  PGGGSIEGIPHGPVHVWTGDRTQPNTENMGNFYSAARDPIFYAHHSNIDRMWSVWKTLGG  377

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R DI D ++L++ FLFYDEN  +V+VK+ D  
Sbjct  378  RRQDITDPDFLDAAFLFYDENAKMVRVKVRDCL  410



>gb|ACJ04908.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDSDWLNSEFTFYDENAQLVTVKVKESL  418



>gb|ADP89908.1| polyphenol oxidase [Nelumbo nucifera]
Length=500

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ NVPH  VH W GD   P+ E+MGNFYSA++DP+FY HHSNVDRMWTIWK LGG
Sbjct  274  PGFGSLENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGG  333

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R D  D ++LN+ FL YDENK LV+VK+ D  
Sbjct  334  RRKDFKDPDWLNAGFLLYDENKQLVRVKVRDCL  366



>gb|ABI96924.1| putative polyphenol oxidase [Frangula californica]
Length=312

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
             G+V N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HHSN+DRMW IWKTLGG+R
Sbjct  100  QGSVENIPHGPVHIWCGDNTQPNLEDMGNFYSAGRDPIFYAHHSNIDRMWKIWKTLGGRR  159

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  D ++LN+ FLFYDEN   V+VK++D  
Sbjct  160  QDFTDPDWLNASFLFYDENAQPVRVKVKDCL  190



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ NVPH  VH W GD   P+ E+MGNFYSA++DP+FY HHSNVDRMWTIWK LGG
Sbjct  327  PGFGSLENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGG  386

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R D  D ++LN+ FL YDENK LV+VK+ D  
Sbjct  387  RRKDFKDPDWLNAGFLLYDENKQLVRVKVRDCL  419



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V  VPH  VH W GD   P+ E+MG+FYSA++DP+FY HHSNVDRMW+IWKTLGG
Sbjct  320  PGGGSVEGVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIWKTLGG  379

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D  D ++L S  LFYDENKNLV+VK++D    R
Sbjct  380  KRRDFTDSDWLESGLLFYDENKNLVRVKVKDCLDTR  415



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ NVPH  VH W GD   P+ E+MGNFYSA++DP+FY HHSNVDRMWTIWK LGG
Sbjct  327  PGFGSLENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGG  386

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R D  D ++LN+ FL YDENK LV+VK+ D  
Sbjct  387  RRKDFKDPDWLNAGFLLYDENKQLVRVKVRDCL  419



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD R P+ EDMGNFYSA++DP+F+ HHSNVDRMWT+WKTLGG
Sbjct  329  PGAGSLENIPHGPVHVWCGDNRQPNLEDMGNFYSAARDPIFFSHHSNVDRMWTVWKTLGG  388

Query  429  -KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             +R+D  D ++LN+ FLFYDEN   V+VK++D  
Sbjct  389  SRRIDFTDPDWLNAAFLFYDENAQAVRVKVKDCL  422



>gb|ACR82078.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PVAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDPDLLNSEFTFYDENAQLVTVKVKESL  418



>gb|ABF19602.1| polyphenol oxidase [Camellia sinensis var. assamica]
Length=599

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PVAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDPDLLNSEFTFYDENAQLVTVKVKESL  418



>gb|ACJ04909.1| polyphenol oxidase [synthetic construct]
Length=600

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++LNSEF FYDEN  LV VK++  F
Sbjct  386  KRNDFKDSDWLNSEFTFYDENAQLVTVKVKREF  418



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V  VPH  VH W GD   P+ E+MG+FYSA++DP+FY HHSNVDRMW+IWKTLGG
Sbjct  320  PGGGSVEGVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIWKTLGG  379

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D  D ++L S  LFYDENKNLV+VK++D    R
Sbjct  380  KRRDFTDSDWLESGLLFYDENKNLVRVKVKDCLDTR  415



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G+V NVPH  VH W GD   P+ EDMG FYSA++DP+FY HHSNVDRMW +WKTLG KR 
Sbjct  345  GSVENVPHGPVHVWCGDNTQPNGEDMGTFYSAARDPIFYAHHSNVDRMWAVWKTLGKKRK  404

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            D  D ++LN+ FLFYDEN NLV+VK+ D  
Sbjct  405  DFTDPDWLNASFLFYDENANLVRVKVRDCL  434



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  G+V N PH +VHRWVGD R P +EDMGNFYSA +DP+FY HH NVDR+W IWK+L 
Sbjct  340  SPGMGSVENNPHTAVHRWVGDKREPFSEDMGNFYSAGRDPLFYAHHCNVDRLWNIWKSLP  399

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA  319
            G KR D  D ++L+S FLFYDEN NLV+VK+ D    R 
Sbjct  400  GKKRTDFTDTDWLDSSFLFYDENANLVRVKVRDCLNSRT  438



>gb|ABI96935.1| putative polyphenol oxidase [Heteromeles arbutifolia]
Length=453

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  G++ N PH +VHRWVGD R P +EDMGNFYSA +DP+FY HHS+VDR+W+IW+TL 
Sbjct  322  SPGMGSIENNPHTAVHRWVGDKRQPFSEDMGNFYSAGRDPLFYAHHSDVDRLWSIWRTLP  381

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            G KR D    ++L+S FLFYDEN NLV+VK+ DS 
Sbjct  382  GKKRTDFTGTDWLDSSFLFYDENANLVRVKVRDSL  416



>gb|ABI96948.1| putative polyphenol oxidase [Sorbus californica]
Length=453

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|ABI96927.1| putative polyphenol oxidase [Chaenomeles speciosa]
Length=453

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|ABI96930.1| putative polyphenol oxidase [Crataegus monogyna]
Length=453

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|ABR10907.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDSDCLNSEFTFYDENAQLVTVKVKESL  418



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  228  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  287

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  288  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  320



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
            +G++   PH  +HRWVGDPR P+ ED+GNFYSA +D +FY HH+NVDRMWTIW+ LGGKR
Sbjct  319  AGSIEASPHIPLHRWVGDPRQPNGEDLGNFYSAGRDVLFYSHHANVDRMWTIWQQLGGKR  378

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             ++ D ++LNS F+FYDEN   V+VK+ DSF
Sbjct  379  KEVPDPDWLNSSFIFYDENAQPVRVKVRDSF  409



>gb|ABI96945.1| putative polyphenol oxidase [Prunus mexicana]
Length=452

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA  319
            KR DI+  ++L+S FLFY+EN  LV+VK+ DS   ++
Sbjct  293  KRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKS  329



>gb|ACN38060.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDSDCLNSEFTFYDENAQLVTVKVKESL  418



>gb|ACF17425.1| polyphenol oxidase [Camellia sinensis]
 gb|ACS88249.1| polyphenol oxidase [Camellia sinensis]
 gb|AFU35561.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDSDCLNSEFTFYDENAQLVTVKVKESL  418



>gb|ABR57236.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDSDCLNSEFTFYDENAQLVTVKVKESL  418



>gb|ABR24120.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D + LNSEF FYDEN  LV VK+++S 
Sbjct  386  KRNDFKDSDCLNSEFTFYDENAQLVTVKVKESL  418



>gb|ABN13632.1| polyphenol oxidase [Doritis pulcherrima x Phalaenopsis hybrid 
cultivar]
Length=549

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NVPH +VH W GD R P+ EDMG FY+A++DP+F+ HHSN+DR+W +WK+LGG
Sbjct  293  PGAGSLENVPHGTVHIWTGDSRQPNREDMGVFYTAARDPIFFAHHSNIDRLWDVWKSLGG  352

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF---LCRARYK  310
            +R D  D ++LN+ F FYDEN  LVKVK++D     L R +Y+
Sbjct  353  QRKDFTDADWLNTGFYFYDENAKLVKVKVKDCLSTELLRYKYQ  395



>gb|AAK29783.1| polyphenol oxidase [Ananas comosus]
Length=351

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GT+  VPHN++H W GDP  P++EDMG FY+A++DP+F+ HH NVDRMW +W+ LGG
Sbjct  91   PGAGTLELVPHNTMHLWTGDPNQPNDEDMGTFYAAARDPIFFAHHGNVDRMWYVWRKLGG  150

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA-RY  313
               D  D ++LN+ FLFYDEN  LV+VK++D     A RY
Sbjct  151  THRDFTDPDWLNASFLFYDENAQLVRVKVKDCLSADALRY  190



>gb|ABI96939.1| putative polyphenol oxidase [Neillia thyrsiflora]
Length=451

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PHN VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDR+W IWKTLGG
Sbjct  233  PGAGSIELTPHNPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRLWIIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDITDSDWLDSGFLFYNENAELVRVKVRDCL  325



>ref|XP_007025703.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28325.1| Larreatricin hydroxylase [Theobroma cacao]
Length=605

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
            G P  G+V    H ++HRWVGDPR  +NEDMGNFYSA +DPVFY HH NVDRMW+IWKTL
Sbjct  327  GSPGGGSVELGCHTAIHRWVGDPRQTYNEDMGNFYSAGRDPVFYAHHGNVDRMWSIWKTL  386

Query  435  -GGKRMDIADKNYLNSEFLFYDENKNLVKVKIED  337
             G KR D +D ++L++ F+FYDEN NLV+VK+ D
Sbjct  387  PGTKRNDFSDTDWLDASFVFYDENANLVRVKVRD  420



>gb|ABI96941.1| putative polyphenol oxidase [Physocarpus capitatus]
Length=451

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ + PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDR+W+IWKTLGG
Sbjct  233  PGGGSIESTPHGPVHLWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++L+S FLFY+EN  LV+VK+ DS 
Sbjct  293  KRTDITDSDWLDSGFLFYNENAELVRVKVRDSL  325



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P  G++ NVPH  VH W GD   P+ E+MGNFYSA++DP+F+ HHSN+DR+W++WKTLG
Sbjct  317  SPGPGSLENVPHGPVHLWTGDSTQPNFENMGNFYSAARDPIFFSHHSNIDRLWSVWKTLG  376

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++LNS FLFYDENK LV+V++ D  
Sbjct  377  GKRNDFTDPDWLNSGFLFYDENKQLVRVRVGDCL  410



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  314  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGG  373

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA  319
            KR DI+  ++L+S FLFY+EN  LV+VK+ DS   ++
Sbjct  374  KRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKS  410



>gb|ABI96937.1| putative polyphenol oxidase [Kageneckia oblonga]
Length=453

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+FY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|KHN46329.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=624

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P +G++ NVPH  VH W GD R P+ E+MG FYSA++DP+F+ HH+NVDRMW+IWKT+ G
Sbjct  346  PGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVDRMWSIWKTIPG  405

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            GKR D  D ++L S F FYDENKNLV+VK++DS   R
Sbjct  406  GKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTR  442



>gb|ABI96926.1| putative polyphenol oxidase [Cercocarpus betuloides]
Length=455

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDR+W+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++L+S FLFYDEN  +V+VK+ D  
Sbjct  293  KRTDITDTDWLDSGFLFYDENAQMVRVKVRDCL  325



>gb|AAA02877.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=583

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + E+MGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  313  SPGQGTIENIPHTPVHIWTGDKPRQKNGENMGNFYSAGLDPLFYCHHANVDRMWDEWKLI  372

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+++K++LNSEF FYDEN+N  +VK+ DS 
Sbjct  373  GGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSL  407



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTEIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF++ENK LV+VK++D+ 
Sbjct  372  GGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTL  406



>gb|ABI96928.1| putative polyphenol oxidase [Chamaebatia foliolosa]
Length=455

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDR+W+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++L+S FLFYDEN  +V+VK+ D  
Sbjct  293  KRTDITDTDWLDSGFLFYDENAQMVRVKVRDCL  325



>ref|XP_006355239.1| PREDICTED: catechol oxidase B, chloroplastic [Solanum tuberosum]
Length=589

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + E+MGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  319  SPGMGTIENIPHTPVHIWTGDTPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDEWKLI  378

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+++K++LNSEF FYDEN+N  +VK+ DS 
Sbjct  379  GGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSL  413



>gb|ABF19601.1| polyphenol oxidase [Camellia ptilophylla]
Length=595

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH   H W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTLGG
Sbjct  322  PGAGSLENIPHGPAHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGG  381

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++LNSEF FYDEN  LV VK+++S 
Sbjct  382  KRNDFKDPDWLNSEFTFYDENAQLVTVKVKESL  414



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD    + E+MGNFYSA +DP+FY HHSNVDRMW++WKTLGG
Sbjct  310  PGAGSLENIPHGLVHIWCGDNTQQNFENMGNFYSAGRDPIFYAHHSNVDRMWSVWKTLGG  369

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L+S FLFYDEN NLV+VK+ D  
Sbjct  370  KRTDFTDSDWLDSAFLFYDENANLVRVKVRDCL  402



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW IWKTLGG
Sbjct  317  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWNIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  409



>pdb|1BT1|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT1|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT2|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT2|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT3|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BUG|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
 pdb|1BUG|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
Length=345

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PH  +HRWVGDPR  +NEDMGNFYSA +D  FYCHHSNVDRMWTIW+ L G
Sbjct  230  PGAGSIETSPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAG  289

Query  429  K--RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  + D  D ++LN+ FLFYDEN   VKV+I DS 
Sbjct  290  KPRKRDYTDSDWLNATFLFYDENGQAVKVRIGDSL  324



>ref|XP_011014565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP     E+MGNFYSA +DP+FYCHHSNVDRMW +WK + 
Sbjct  312  SPGMGTIETTPHTEIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIP  371

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR DI D ++LNSEFLF++ENK LV+VK++D+ 
Sbjct  372  GGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTL  406



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G   G +   PHN+VH W GD + P+ EDMGNFYS+ +DP+FY  H+NVDR+W+IWKTLG
Sbjct  327  GKGHGALEMSPHNNVHIWSGDAKQPYREDMGNFYSSGRDPLFYALHANVDRLWSIWKTLG  386

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L SEFLFYDENKNLVKVK++D  
Sbjct  387  GKRKDPTDDDWLESEFLFYDENKNLVKVKVKDGL  420



>gb|AAC69365.1| polyphenol oxidase [Diospyros kaki]
Length=393

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + E+MGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  186  SPGMGTIENIPHTPVHIWTGDSPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDEWKLI  245

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+++K++LNSEF FYDEN+N  +VK+ D  
Sbjct  246  GGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCL  280



>ref|XP_006594327.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=670

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P +G++ NVPH  VH W GD R P+ E+MG FYSA++DP+F+ HH+NVDRMW+IWKT+ G
Sbjct  392  PGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVDRMWSIWKTIPG  451

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            GKR D  D ++L S F FYDENKNLV+VK++DS   R
Sbjct  452  GKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTR  488



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  314  PGGGSIEGTPHGPVHLWTGDNTQPNLEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGG  373

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA  319
            KR DI+  ++L+S FLFY+EN  LV+VK+ DS   ++
Sbjct  374  KRTDISHSDWLDSGFLFYNENAELVRVKVRDSLESKS  410



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ N+PH  VH W GD   P+ EDMGNFYSA++DP+FY HHSN+DRMWTIWKTLGG
Sbjct  329  PGLGSIENIPHGPVHLWCGDKTQPNLEDMGNFYSAARDPIFYSHHSNIDRMWTIWKTLGG  388

Query  429  -KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             KR +  D ++L++ FLFYDEN NLV+VK+ D  
Sbjct  389  KKRKEFTDPDWLDAGFLFYDENANLVRVKVRDCL  422



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  GT+ N+PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMWT+WK LGG
Sbjct  326  PGQGTLENIPHGPVHIWCGDRTQPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L++ F+FYDEN  LV+VK+ D  
Sbjct  386  KRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCL  418



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +D +FY HH+NVDRMW+IWKTLGG
Sbjct  323  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDSIFYGHHANVDRMWSIWKTLGG  382

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            KR D  D ++LN+ F+FYDEN  LV+VK++D    R
Sbjct  383  KRQDFTDPDWLNAGFVFYDENAQLVRVKVKDCLDSR  418



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  GT+ N+PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMWT+WK LGG
Sbjct  327  PGQGTLENIPHGPVHIWCGDRTQPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGG  386

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L++ F+FYDEN  LV+VK+ D  
Sbjct  387  KRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCL  419



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  GT+ N+PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMWT+WK LGG
Sbjct  326  PGQGTLENIPHGPVHIWCGDRTQPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L++ F+FYDEN  LV+VK+ D  
Sbjct  386  KRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCL  418



>ref|XP_008778193.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NVPH +VH W GD   P+ EDMG  YSAS+DP+FY HHSNVDRMW +WK LGG
Sbjct  325  PGAGSLENVPHGTVHLWTGDRNQPNGEDMGILYSASRDPIFYAHHSNVDRMWYVWKKLGG  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LN+ FLFYDEN ++V+VKI+D  
Sbjct  385  KHKDFDDKDWLNTSFLFYDENADIVRVKIKDCL  417



>gb|ABI96940.1| putative polyphenol oxidase [Oemleria cerasiformis]
Length=457

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++  +PH  VH W GD    + EDMGNFYS  KDP+FY HHSNVDRMW IWKTLGG
Sbjct  236  PGGGSIEGIPHGPVHLWTGDNTQLNFEDMGNFYSXGKDPIFYSHHSNVDRMWNIWKTLGG  295

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++LNS FLFY+EN  LV+VK++DS 
Sbjct  296  KRTDLTDSDWLNSGFLFYNENAELVRVKVKDSL  328



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PH  +HRWVGDPR  +NEDMGNFYSA +D  FYCHHSNVDRMWTIW+ L G
Sbjct  230  PGAGSIETSPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAG  289

Query  429  K--RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  + D  D ++LN+ FLFYDEN   VKV+I DS 
Sbjct  290  KPRKRDYTDSDWLNATFLFYDENGQAVKVRIGDSL  324



>gb|KHN07288.1| Polyphenol oxidase, chloroplastic [Glycine soja]
Length=504

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-GGKR  424
            GTV   PH ++HRW GDPR P+ EDMG FYSA +DP+FY HH+NVDRMW IWKT+  GKR
Sbjct  224  GTVELGPHTALHRWTGDPRQPNKEDMGRFYSAGRDPIFYSHHANVDRMWNIWKTIPTGKR  283

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  ++++L + F FYDENKNLV VK++DS 
Sbjct  284  RDFKNRDWLETTFFFYDENKNLVSVKVKDSL  314



>gb|ACB45128.1| polyphenol oxidase [Fragaria x ananassa]
Length=324

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G +   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDR+W++WKTLGG
Sbjct  136  PGGGAIETTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSVWKTLGG  195

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L+S FLFYDEN N+V+VK+ D  
Sbjct  196  KREDFTDSDWLDSGFLFYDENANMVRVKVRDCL  228



>ref|XP_007148200.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
 gb|ESW20194.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
Length=576

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V NVPH  VH W GD   P+ E+MG FYSA++DP+F+ HHSN+DRMW+IWKTLGG
Sbjct  324  PGGGSVENVPHGPVHVWTGDIDQPNIENMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGG  383

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D +D ++L S  LFYDE+KNLV+VK++D  
Sbjct  384  KRRDFSDSDWLESGLLFYDEDKNLVRVKVKDCL  416



>gb|ABX09994.1| chloroplast polyphenol oxidase [Taraxacum officinale]
Length=599

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  GT+ N+PH  VH W GD   P+ E+MGNFYSA KDP+FY HH+NVDRMW+IWKTLGG
Sbjct  323  PGGGTLENIPHGPVHIWTGDRNQPNGENMGNFYSAGKDPIFYAHHANVDRMWSIWKTLGG  382

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R D  D ++L+S F FYDEN   V+VK+ D  
Sbjct  383  RRKDFTDSDWLDSSFSFYDENAEFVRVKVRDCL  415



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMWTIWKTLGG
Sbjct  309  PGAGSIENIPHGPVHVWCGDNTQPNLEDMGNFYSAARDPIFFAHHSNVDRMWTIWKTLGG  368

Query  429  -KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             KR +  D ++L++EF+FYDEN N V+VK+ D  
Sbjct  369  NKRTEFTDPDWLDAEFIFYDENANPVRVKVRDCI  402



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V NVPH +VH W GD   P+ EDMG FYSA++DP+F+ HHSN+DR+W+IWKTLGG
Sbjct  321  PGAGSVENVPHGTVHGWSGDKTQPNREDMGVFYSAARDPIFFSHHSNIDRLWSIWKTLGG  380

Query  429  K-RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K R D  D ++L S FLFYDENKNLV VK++D  
Sbjct  381  KNRKDFTDSDWLESGFLFYDENKNLVNVKVKDCL  414



>dbj|BAA21677.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRADLTDSDWLDSGFLFYNENAELVRVKVRDCL  409



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  409



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ NVPH +VH W GD   P+ EDMG  YSA++DP+F+ HHSNVDRMW +WK LGG
Sbjct  326  PGGGSLENVPHGTVHVWTGDRNQPNGEDMGTLYSAARDPIFFAHHSNVDRMWYVWKMLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LN+ FLFYDEN +LV+VKI+D  
Sbjct  386  KHKDFEDKDWLNTSFLFYDENADLVRVKIKDCL  418



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P  G++ N+PHN+VH W GD R P  EDMG FYSA +DP+F+ HHSNVDRMWT+WKTL
Sbjct  321  ASPGRGSIENMPHNTVHDWCGDYRQPKREDMGIFYSAGRDPLFFAHHSNVDRMWTLWKTL  380

Query  435  GG-KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG KR D  D ++LN+ FLFYDEN   ++VK++D  
Sbjct  381  GGRKRTDFTDPDWLNATFLFYDENAQAMRVKVKDCL  416



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  317  PGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKTLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  377  KRADLTDSDWLDSGFLFYNENAELVRVKVRDCL  409



>sp|Q06355.1|PPOB_SOLTU RecName: Full=Catechol oxidase B, chloroplastic; AltName: Full=Polyphenol 
oxidase; Short=PPO; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA02879.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=588

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGD-PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
             P  GT+ N+PH  VH W GD PR  + E+MGNFYSA  DP+FYCHH+NVDRMW  WK +
Sbjct  318  SPGMGTIENIPHTPVHIWTGDSPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDEWKLI  377

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D+++K++LNSEF FYDEN+N  +VK+ D  
Sbjct  378  GGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCL  412



>gb|ABI96944.1| putative polyphenol oxidase [Prunus dulcis]
Length=451

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHS+VDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSSVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA  319
            KR DI+  ++L+S FLFY+EN  LV+VK+ DS   ++
Sbjct  293  KRTDISHSDWLDSGFLFYNENAELVRVKVRDSLESKS  329



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P  G +   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDR+WT+WKTLG
Sbjct  326  SPGGGAIETTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWTVWKTLG  385

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L+S FLFYDEN N+V+VK+ D  
Sbjct  386  GKREDFTDSDWLDSGFLFYDENANMVRVKVRDCL  419



>gb|ABI96951.1| putative polyphenol oxidase [Vauquelinia californica]
Length=453

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH   H W GD   P+ EDMGNFYSA +DPVFY HHSNVDRMW+IWKTLGG
Sbjct  233  PGGGSIEGTPHGPGHLWTGDHTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D+ D ++L+S FLFY+EN  LV+VK+ D  
Sbjct  293  KRTDLTDSDWLDSGFLFYNENAELVRVKVRDCL  325



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PHN +H W GD    + E+MGNFYSA +DP+FY HHSNVDRMWTIWKTLGG
Sbjct  323  PGAGSIENIPHNPLHVWTGDNFQRNLENMGNFYSAGRDPIFYAHHSNVDRMWTIWKTLGG  382

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR +  D ++L++ FL YDEN NLV+VK+ D  
Sbjct  383  KRTEFTDPDWLDAAFLLYDENANLVRVKVRDCI  415



>ref|XP_007139960.1| hypothetical protein PHAVU_008G073200g [Phaseolus vulgaris]
 gb|ESW11954.1| hypothetical protein PHAVU_008G073200g [Phaseolus vulgaris]
Length=582

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V   PHN+VH WVG   TP++EDMG FY+A++DP+FY HHSN+DRMW IWKTLG 
Sbjct  316  PGPGSVEAAPHNTVHTWVGGAETPNHEDMGTFYTAARDPIFYGHHSNLDRMWAIWKTLGE  375

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIED  337
             R D +D+++L+SEF FYDEN N V+VK+ D
Sbjct  376  GRKDYSDEDWLDSEFFFYDENANFVRVKVRD  406



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P +G++ N+PH+ VH W GD    + E MGNFYSA++DP+FY HH+N+DRMW+IWKTL
Sbjct  324  ANPGAGSIENIPHDPVHIWTGDRSQRNGEHMGNFYSAARDPIFYAHHANIDRMWSIWKTL  383

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG+R D  DK++L+S F FYDEN +LV+VK+ D  
Sbjct  384  GGRRKDFTDKDWLDSSFSFYDENADLVRVKVRDCL  418



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GT+  VPHN++H W GDP  P++EDMG FY+A++DP+F+ HH NVDRMW +W+ LGG
Sbjct  317  PGAGTLELVPHNTMHLWTGDPNQPNDEDMGTFYAAARDPIFFAHHGNVDRMWYVWRKLGG  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA-RY  313
               D  D ++LN+ FLFYDEN  LV+VK++D     A RY
Sbjct  377  THRDFTDPDWLNASFLFYDENAQLVRVKVKDCLEADALRY  416



>gb|ABI96949.1| putative polyphenol oxidase [Spiraea cantoniensis]
Length=455

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V N PH  +H W GD   P+ E+MGNFYSA KDP+FY HHSNVDRMW +WK LGG
Sbjct  234  PGGGSVENTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPLFYSHHSNVDRMWDLWKGLGG  293

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++LNS FLFY+EN  LV+V ++D  
Sbjct  294  KRADITDSDWLNSGFLFYNENAELVRVTVKDCL  326



>gb|ABI96947.1| putative polyphenol oxidase [Rhodotypos scandens]
Length=447

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKT-LG  433
            P  G++   PH  +H W GD   P+ EDMGNFYSA +DP+FY HHSNVDRMWTIWKT LG
Sbjct  234  PGGGSIEGTPHGPIHLWCGDNTHPNFEDMGNFYSAGRDPIFYSHHSNVDRMWTIWKTKLG  293

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR DI D ++LNS FLFY+E   LV+VK++DS 
Sbjct  294  GKRTDITDSDWLNSGFLFYNEKAELVRVKVKDSL  327



>ref|XP_010910924.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=555

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NV HN+VH W GD   P+ E+MG  YSA++DP+FY HHSNVDRMW +WK LGG
Sbjct  283  PGAGSLENVXHNTVHVWTGDRNQPNGENMGALYSAARDPIFYAHHSNVDRMWYVWKMLGG  342

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LNS FLFYDEN  LV+VK++D  
Sbjct  343  KHKDFEDKDWLNSSFLFYDENAGLVRVKVKDCL  375



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGD--PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
            G++ N+PH  VHRWVGD  PRT + EDMGNFYSA +D +FYCHHSNVDRMWTIW+ LGGK
Sbjct  235  GSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGK  294

Query  426  --RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              R D  D ++L++ F+FYDENK  V+V++ D+ 
Sbjct  295  GRRRDFTDSDWLDATFIFYDENKQAVRVRVGDAL  328



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGD--PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
            G++ N+PH  VHRWVGD  PRT + EDMGNFYSA +D +FYCHHSNVDRMWTIW+ LGGK
Sbjct  235  GSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGK  294

Query  426  --RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              R D  D ++L++ F+FYDENK  V+V++ D+ 
Sbjct  295  GRRRDFTDSDWLDATFIFYDENKQAVRVRVGDAL  328



>gb|ABI96950.1| putative polyphenol oxidase [Spiraea densiflora]
Length=454

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V N PH  +H W GD   P+ E+MGNFYSA KDP+FY HHSNVDRMW +WK LGG
Sbjct  233  PGGGSVENTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPIFYSHHSNVDRMWDLWKGLGG  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI D ++LNS FLFY+EN  +V+V ++D  
Sbjct  293  KRTDITDSDWLNSGFLFYNENAEMVRVTVKDCL  325



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P  G +   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDR+W++WKTLG
Sbjct  326  SPGGGAIETTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSVWKTLG  385

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR D  D ++L+S FLFYDEN N+V+VK+ D  
Sbjct  386  GKREDFTDSDWLDSGFLFYDENANMVRVKVRDCL  419



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PH  +HRWVGDPR  +NEDMGNFYSA +D  FYCHHSNVDRMW IW+ L G
Sbjct  230  PGAGSIETSPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWAIWQQLAG  289

Query  429  K--RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  + D  D ++LN+ FLFYDEN   VKV+I DS 
Sbjct  290  KPRKRDYTDSDWLNATFLFYDENGQAVKVRIGDSL  324



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V NVPH +VH W GD   P+ EDMGNFYSA++DP+FY HH+N+DRMW+IWKTLGG
Sbjct  327  PGGGSVENVPHGTVHVWTGDRNQPNFEDMGNFYSAARDPLFYAHHANIDRMWSIWKTLGG  386

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             R D  + ++L++ F+FYDEN   V+V++ D  
Sbjct  387  NRQDFTETDWLDASFIFYDENAQAVRVRVRDCL  419



>gb|KHN07285.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=572

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-GGKR  424
            GTV   PH ++HRW GDPR P+ EDMG FYSA +DP+FY HH+NVDRMW IWKT+  GKR
Sbjct  319  GTVELGPHTALHRWTGDPRQPNKEDMGRFYSAGRDPIFYSHHANVDRMWNIWKTIPTGKR  378

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  ++++L + F FYDENKNLV VK++DS 
Sbjct  379  RDFKNRDWLETTFFFYDENKNLVSVKVKDSL  409



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGD--PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
            G++ N+PH  VHRWVGD  PRT + EDMGNFYSA +D +FYCHHSNVDRMWTIW+ LGGK
Sbjct  323  GSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGK  382

Query  426  --RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              R D  D ++L++ F+FYDENK  V+V++ D+ 
Sbjct  383  GRRRDFTDSDWLDATFIFYDENKQAVRVRVGDAL  416



>ref|XP_007214683.1| hypothetical protein PRUPE_ppa022943mg [Prunus persica]
 gb|EMJ15882.1| hypothetical protein PRUPE_ppa022943mg [Prunus persica]
Length=539

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V  VPH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW+IWK LG 
Sbjct  258  PGAGSVEAVPHGPVHLWSGDNTQPNFEDMGNFYSAARDPIFFAHHSNVDRMWSIWKNLGS  317

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            K  D++DK++L+S FLFY+EN  LV+VK+ D    R
Sbjct  318  KNKDLSDKDWLDSGFLFYNENAELVRVKVRDCLDSR  353



>gb|ABM68051.1| polyphenol oxidase [Trifolium pratense]
Length=604

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G++   PH  +H W GDP+ P  EDMGNFYSA +DP+FY HH NVDRMW+IWKTL G   
Sbjct  338  GSIELTPHTPIHIWTGDPKQPVGEDMGNFYSAGRDPLFYAHHGNVDRMWSIWKTLPGISK  397

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIED  337
            D  D ++L+SEFLFYDENKNLVKVK++D
Sbjct  398  DCNDNDWLDSEFLFYDENKNLVKVKVKD  425



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGD--PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
            G++ N+PH  VHRWVGD  PRT + EDMGNFYSA +D +FYCHHSNVDRMWTIW+ LGGK
Sbjct  323  GSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGK  382

Query  426  --RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              R D  D ++L++ F+FYDENK  V+V++ D+ 
Sbjct  383  GRRRDFTDSDWLDATFIFYDENKQAVRVRVGDAL  416



>ref|XP_006595376.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=660

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-GGKR  424
            GTV   PH +VHRW GDPR P+ EDMG FYSA +DP FY HH+NVDRMW IWKT+  GKR
Sbjct  339  GTVELGPHTAVHRWTGDPRQPNKEDMGRFYSAGRDPAFYSHHANVDRMWNIWKTIPSGKR  398

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  ++++L + F FYDENK LV+VK++DS 
Sbjct  399  RDFKNRDWLETSFFFYDENKTLVRVKVKDSL  429



>gb|AHH92831.1| polyphenol oxidase [Musa acuminata AAA Group]
Length=588

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW +WK LGG
Sbjct  320  PGAGSLENIPHGPVHGWTGDRSQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLGG  379

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LN+ FLFYDEN +LV+V ++D  
Sbjct  380  KHQDFNDKDWLNTTFLFYDENADLVRVTLKDCL  412



>gb|ABR57235.1| polyphenol oxidase [Camellia sinensis]
Length=598

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDR+WT+WKTL G
Sbjct  326  PGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLEG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++LNSEF FYDEN  +V VK+++S 
Sbjct  386  KRNDFKDPDWLNSEFTFYDENAQVVTVKVKESL  418



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
             +G++ NVPH  VH W GD    + EDMG FYSA++DP+FY HHSNVDR+W IWKTLGGK
Sbjct  324  GAGSIENVPHAPVHTWTGDNTQTNIEDMGIFYSAARDPIFYSHHSNVDRLWYIWKTLGGK  383

Query  426  RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            + D  DK++L S FLFYDENKNLV+V ++DS 
Sbjct  384  KHDFTDKDWLESGFLFYDENKNLVRVNVKDSL  415



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD    + EDMGNFYSA++DP+F+ HHSNVDRMW+IWKTLGG
Sbjct  314  PGGGSIEGTPHGPVHLWTGDNTQSNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGG  373

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR DI+  ++L+S FLFY+EN  LV+VK+ DS 
Sbjct  374  KRTDISQSDWLDSGFLFYNENAELVRVKVRDSL  406



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  GT+   PH  +H W GDP   + E+MGNFYSA +DP+F+CHHSNVDRMW +WK + 
Sbjct  306  SPGMGTIETTPHTEIHFWTGDPNQTNGENMGNFYSAGRDPIFFCHHSNVDRMWDLWKKIP  365

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GGKR D  D ++LNSEFLF++ENK LV+VK++D+ 
Sbjct  366  GGKRKDFKDPDWLNSEFLFWNENKELVRVKVKDTL  400



>ref|XP_009414395.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ N+PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW +WK LGG
Sbjct  322  PGAGSLENIPHGPVHGWTGDRNQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLGG  381

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LN+ FLFYDEN +LV+V ++D  
Sbjct  382  KHQDFNDKDWLNTTFLFYDENADLVRVTLKDCL  414



>ref|XP_003529305.2| PREDICTED: polyphenol oxidase A1, chloroplastic [Glycine max]
Length=626

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-GGKR  424
            GTV   PH ++HRW GDPR P+ EDMG FYSA +DP+FY HH+NVDRMW IWKT+  GKR
Sbjct  346  GTVELGPHTALHRWTGDPRQPNKEDMGRFYSAGRDPIFYSHHANVDRMWNIWKTIPTGKR  405

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  ++++L + F FYDENKNLV VK++DS 
Sbjct  406  RDFKNRDWLETTFFFYDENKNLVSVKVKDSL  436



>gb|KHN46328.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=620

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-GGKR  424
            GTV   PH +VHRW GDPR P+ EDMG FYSA +DP FY HH+NVDRMW IWKT+  GKR
Sbjct  340  GTVELGPHTAVHRWTGDPRQPNKEDMGRFYSAGRDPAFYSHHANVDRMWNIWKTIPSGKR  399

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  ++++L + F FYDENK LV+VK++DS 
Sbjct  400  RDFKNRDWLETSFFFYDENKTLVRVKVKDSL  430



>ref|XP_003541548.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=608

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-GGKR  424
            GTV   PH +VHRW GDPR P+ EDMG FYSA +DP FY HH+NVDRMW IWKT+  GKR
Sbjct  340  GTVELGPHTAVHRWTGDPRQPNKEDMGRFYSAGRDPAFYSHHANVDRMWNIWKTIPSGKR  399

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  ++++L + F FYDENK LV+VK++DS 
Sbjct  400  RDFKNRDWLETSFFFYDENKTLVRVKVKDSL  430



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ NVPH +VH W GD   P+ EDMG  YSA++D +FY HHSNVDRMW +WK LGG
Sbjct  326  PGAGSLENVPHGTVHVWTGDRNQPNGEDMGTLYSAARDAIFYAHHSNVDRMWNVWKMLGG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LNS FLFYDEN +LV+VK+++  
Sbjct  386  KHKDFEDKDWLNSSFLFYDENADLVRVKVKNCL  418



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V  +PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW+IWK LG 
Sbjct  305  PGAGSVEAIPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFAHHSNVDRMWSIWKNLGT  364

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            K  D++DK++L+S FLFY+EN  LV+VK+ D    R
Sbjct  365  KNKDLSDKDWLDSGFLFYNENAELVRVKVRDCLDSR  400



>gb|AFH00996.1| polyphenol oxidase II [Pyrus x bretschneideri]
 gb|AFH00997.1| polyphenol oxidase II [Pyrus x bretschneideri]
Length=600

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
            G  +GT+ N PHN++H W GDP  P+ EDMGNFYS+ +DP+FY HH NVDRMW IWKTLG
Sbjct  333  GTYAGTIENNPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLG  392

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GKR       +L++EFLFYDEN  LV  K+ DS 
Sbjct  393  GKRKVPYRHRWLDAEFLFYDENAELVSCKVRDSI  426



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G + NVPH  VH W GD   P+ EDMGNFYSA +DP+FY HH+NVDRMW+IWK+L G
Sbjct  326  PGGGIMENVPHTPVHNWTGDRSQPNVEDMGNFYSAGRDPIFYAHHANVDRMWSIWKSLVG  385

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R D  D ++L+S FLFYDEN +LV+VK+ D  
Sbjct  386  ERKDYTDTDWLDSLFLFYDENADLVRVKVRDCL  418



>ref|XP_008779317.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+  NVPH +VH W GD   P+ EDMG  YSAS+DP+FY +HSNVDRMW +WK LGG
Sbjct  325  PGGGSFENVPHGTVHEWTGDRNQPNGEDMGVLYSASRDPIFYAYHSNVDRMWYVWKKLGG  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  D  DK++LN+ FLFYDEN ++V+VKI+D  
Sbjct  385  KHKDFDDKDWLNTSFLFYDENADIVRVKIKDCL  417



>ref|XP_002974314.1| hypothetical protein SELMODRAFT_101213 [Selaginella moellendorffii]
 gb|EFJ24536.1| hypothetical protein SELMODRAFT_101213 [Selaginella moellendorffii]
Length=589

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G V   PHN++H + G P  P+NEDMGNFYSA KDP+FYCHH NVDRMW +W++LG   M
Sbjct  327  GGVERAPHNAMHIFCGSPNQPNNEDMGNFYSAGKDPLFYCHHGNVDRMWDVWRSLGN--M  384

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            D  D +YLN+EFLF+DE ++LV+VK++DS 
Sbjct  385  DFTDPDYLNTEFLFFDEKQDLVRVKVKDSL  414



>ref|XP_004293563.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G + ++PHN++H W GDP   + EDMG FYSA +DP+FY HH+NVDRMW+I+K  GG
Sbjct  325  PGAGNIESIPHNNIHLWTGDPTQTNGEDMGAFYSAGRDPIFYSHHANVDRMWSIYKARGG  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
               DI  K++L++EFLFYDENKNLV+VK+ DS 
Sbjct  385  --TDITKKDWLDTEFLFYDENKNLVRVKVRDSL  415



>gb|ABI96932.1| putative polyphenol oxidase [Fallugia paradoxa]
Length=452

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW+IWKTL  
Sbjct  233  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLAT  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI D ++L+S FLFYDEN N+V+VK+ D  
Sbjct  293  KNKDITDSDWLDSGFLFYDENANMVRVKVRDCL  325



>dbj|BAA85119.1| polyphenol oxidase-like protein [Solanum melongena]
Length=266

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 8/100 (8%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPR--------TPHNEDMGNFYSASKDPVFYCHHSNVDRMWT  451
            A GTV  +PH  VH WVG  R        T + EDMGNFYSA  DPVFYCHHSNVDRMW 
Sbjct  56   APGTVEVIPHIPVHIWVGTARGSKFPDGSTSYGEDMGNFYSAGLDPVFYCHHSNVDRMWN  115

Query  450  IWKTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             WK +GGKR DI+ +++LNSEF F+DENKN  +V++ D  
Sbjct  116  EWKQIGGKRRDISQRDWLNSEFFFFDENKNPYRVRVRDCL  155



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P SG++ + PH  VH W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW++WKTLG
Sbjct  322  SPGSGSIESTPHGPVHVWTGDNTQPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTLG  381

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
                DI D ++L++ FLFYDEN  LV+VK+ D  
Sbjct  382  ATNKDITDPDWLDTGFLFYDENAQLVRVKVRDCL  415



>ref|XP_009624738.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=601

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHN----EDMGNFYSASKDPVFYCHHSNVDRMWTIWK  442
            P  G + N+PH  VH WVG     +N    EDMGNFYSA KDP FY HH+NVDRMWTIWK
Sbjct  328  PGQGAIENIPHTPVHIWVGSKPNENNCKNGEDMGNFYSAGKDPAFYSHHANVDRMWTIWK  387

Query  441  TLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            TLGGKR DI   +YLNSEF FYDE KN   VK+ D  
Sbjct  388  TLGGKRKDINKPDYLNSEFFFYDEKKNPFLVKVRDCL  424



>gb|ABI96942.1| putative polyphenol oxidase [Dasiphora fruticosa]
Length=452

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ + PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW+IWKTL  
Sbjct  233  PGGGSIESTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAP  292

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI D ++L+S FLFYDEN N+V+VK+ D  
Sbjct  293  KNKDITDSDWLDSGFLFYDENANMVRVKVRDCL  325



>gb|ABM68052.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G +   PHN +H W GDP   + EDMG+FYS+ +DP+FY  H+NVDR+W+IWKTLGG
Sbjct  333  PGAGQLEINPHNHIHVWCGDPNQKNREDMGHFYSSGRDPLFYALHANVDRLWSIWKTLGG  392

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            KR D  D ++L +EFLFYDENKNLVKVK++D  
Sbjct  393  KRKDPTDDDWLETEFLFYDENKNLVKVKVKDGL  425



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 4/94 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGD--PRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
            G++ N+PH  VHRWVGD  PRT + EDMGNFYSA +D +FYCHHSNVDRMWTIW+ LGGK
Sbjct  323  GSIENIPHTPVHRWVGDVQPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGK  382

Query  426  --RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              R D  D ++L++ F+FYDENK   +V++ D+ 
Sbjct  383  GRRRDFTDSDWLDATFIFYDENKQAYRVRVGDAL  416



>ref|XP_002980680.1| hypothetical protein SELMODRAFT_178277 [Selaginella moellendorffii]
 gb|EFJ18331.1| hypothetical protein SELMODRAFT_178277 [Selaginella moellendorffii]
Length=588

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 4/109 (4%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGK  427
            A G++   PH +VH + G P  P+ ED+GNFYSA KDP+FYCHH NVDRMW +W++LG +
Sbjct  328  ADGSLEKAPHTAVHIFGGSPNNPNGEDLGNFYSAGKDPLFYCHHGNVDRMWDVWRSLGNQ  387

Query  426  RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF--LCRARYKI*ILPMTK  286
              D  D +YLN+EFLF+DEN++LV+VK++DS     + +YK   +P  K
Sbjct  388  --DFTDADYLNTEFLFFDENQDLVRVKVKDSIDNQTKLKYKYASMPQDK  434



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P +G++  +PHN+VH W GD R P+ EDMG  YSA++DP+F+ HHSNVDRMWT+WKTL
Sbjct  321  ANPGAGSIELMPHNTVHNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTL  380

Query  435  GG-KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG KR D    ++LN+ FLFYDENK  V+VK++D  
Sbjct  381  GGPKRTDFTHPDWLNASFLFYDENKQAVRVKVKDCL  416



>dbj|BAM15848.1| hypothetical protein [Portulaca oleracea]
Length=600

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -3

Query  615  GGP-ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKT  439
            G P   G++ NVPH  VH W GD   P+ EDMGNFYSA++DP+FY HHSN+DRMW+IWKT
Sbjct  318  GSPRGGGSLENVPHGPVHIWTGDRNQPNTEDMGNFYSAARDPIFYAHHSNIDRMWSIWKT  377

Query  438  LGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            LG  R++  D ++L++ F+FYDEN   VK+++ D  
Sbjct  378  LGANRVEFTDSDWLDASFVFYDENAQAVKIRVRDCL  413



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW+IWKTL  
Sbjct  317  PGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAP  376

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI D ++L+S FLFYDEN N+V+VK+ D  
Sbjct  377  KNKDITDSDWLDSGFLFYDENANMVRVKVRDCL  409



>ref|XP_009791071.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=600

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHN----EDMGNFYSASKDPVFYCHHSNVDRMWTIWK  442
            P  G + N+PH  VH WVG     +N    EDMGNFYSA KDP FY HH+NVDRMWTIWK
Sbjct  327  PGQGAIENIPHTPVHIWVGSKPNENNCKNGEDMGNFYSAGKDPAFYSHHANVDRMWTIWK  386

Query  441  TLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            TLGGKR DI   +YLN+EF FYDE KN   VK+ D  
Sbjct  387  TLGGKRKDINKPDYLNTEFFFYDEKKNPYLVKVRDCL  423



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
            +G++ N+PH  VH W GD   P+ E+MG+FYSA++DP+FY HHSN+DR+W++WKTLGG+R
Sbjct  334  AGSLENIPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLGGRR  393

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  D ++LN+ FLFYDE   +V++++ D  
Sbjct  394  QDFTDPDFLNASFLFYDEKAQMVRIRVRDCL  424



>ref|XP_002990879.1| hypothetical protein SELMODRAFT_11755, partial [Selaginella moellendorffii]
 gb|EFJ08152.1| hypothetical protein SELMODRAFT_11755, partial [Selaginella moellendorffii]
Length=448

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G V   PHN++H + G P+ P  EDMGNFYSA +DP+FYCHH NVDRMW +W++LG K  
Sbjct  203  GGVERAPHNALHIFCGSPKEPGYEDMGNFYSAGRDPLFYCHHGNVDRMWDVWRSLGNK--  260

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            D  D +YLN+EFLF+DEN++LV+VK++DS 
Sbjct  261  DFTDPDYLNTEFLFFDENQDLVRVKVKDSL  290



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
            +G++ N+PH  VH W GD   P+ E+MG+FYSA++DP+FY HHSN+DR+W++WKTLGG+R
Sbjct  336  AGSLENIPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLGGRR  395

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  D ++LN+ FLFYDE   +V++++ D  
Sbjct  396  QDFTDPDFLNASFLFYDEKAQMVRIRVRDCL  426



>ref|XP_009590067.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVG----DPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIW  445
             P  GT+ N+PH  VH WVG    +  T H EDMGNFYSA  DP+FY HH+NVDRMW+ W
Sbjct  315  SPGMGTIENIPHTPVHIWVGSRLDENNTKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW  374

Query  444  KTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K LGGKR D+  K++LNSEF FYDEN+N  +VK+ D  
Sbjct  375  KALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCL  412



>ref|XP_002976812.1| hypothetical protein SELMODRAFT_175861 [Selaginella moellendorffii]
 gb|EFJ21922.1| hypothetical protein SELMODRAFT_175861 [Selaginella moellendorffii]
Length=586

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G++   PH +VH + G P  P+ ED+GNFYSA KDP+FYCHH NVDRMW +W++LG +  
Sbjct  328  GSLEKAPHTAVHVFGGSPNNPNGEDLGNFYSAGKDPLFYCHHGNVDRMWDVWRSLGNQ--  385

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF--LCRARYKI*ILPMTK  286
            D  D +YLN+EFLF+DEN++LV+VK++DS     + +YK   +P  K
Sbjct  386  DFTDADYLNTEFLFFDENQDLVRVKVKDSIDNQTKLKYKYASMPQDK  432



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P +G++  +PHN+VH W GD R P+ EDMG  YSA++DP+F+ HHSNVDRMWT+WKTL
Sbjct  385  ANPGAGSIELMPHNTVHNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTL  444

Query  435  GG-KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG KR D    ++LN+ FLFYDENK  V+VK++D  
Sbjct  445  GGPKRTDFTHPDWLNASFLFYDENKQAVRVKVKDCL  480



>ref|XP_002976938.1| hypothetical protein SELMODRAFT_175858 [Selaginella moellendorffii]
 gb|EFJ22048.1| hypothetical protein SELMODRAFT_175858 [Selaginella moellendorffii]
Length=586

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G++   PH +VH + G P  P+ ED+GNFYSA KDP+FYCHH NVDRMW +W++LG +  
Sbjct  328  GSLEKAPHTAVHVFGGSPNNPNGEDLGNFYSAGKDPLFYCHHGNVDRMWDVWRSLGNQ--  385

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF--LCRARYKI*ILPMTK  286
            D  D +YLN+EFLF+DEN++LV+VK++DS     + +YK   +P  K
Sbjct  386  DFTDADYLNTEFLFFDENQDLVRVKVKDSIDNQTKLKYKYASMPQDK  432



>ref|XP_004246029.2| PREDICTED: polyphenol oxidase A, chloroplastic-like [Solanum 
lycopersicum]
Length=606

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 8/100 (8%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVG--------DPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWT  451
            A+GTV N+PH+ VH WVG        D +  + EDMGNFYSA  DP+FYCHHSNVDRMW 
Sbjct  332  AAGTVENIPHSPVHIWVGTRRGSVLPDGKISNGEDMGNFYSAGLDPLFYCHHSNVDRMWN  391

Query  450  IWKTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             WK  GGKR DI +K++LNSEF FYDEN N  KV++ D  
Sbjct  392  EWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCL  431



>ref|XP_002980542.1| hypothetical protein SELMODRAFT_178281 [Selaginella moellendorffii]
 gb|EFJ18193.1| hypothetical protein SELMODRAFT_178281 [Selaginella moellendorffii]
Length=586

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G++   PH +VH + G P  P+ ED+GNFYSA KDP+FYCHH NVDRMW +W++LG +  
Sbjct  328  GSLEKAPHTAVHIFGGSPNNPNGEDLGNFYSAGKDPLFYCHHGNVDRMWDVWRSLGNQ--  385

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF--LCRARYKI*ILPMTK  286
            D  D +YLN+EFLF+DEN++LV+VK++DS     + +YK   +P  K
Sbjct  386  DFTDADYLNTEFLFFDENQDLVRVKVKDSIDNQTKLKYKYASMPQDK  432



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLG  433
             P SG++ + PH  +H W GD   P+ EDMGNFYSA++DP+F+ HHSNVDRMW++WKT G
Sbjct  322  SPGSGSIESTPHGPIHVWTGDNTQPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTFG  381

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
                DI D ++L++ FLFYDEN  LV+VK+ D  
Sbjct  382  ATNKDITDPDWLDTGFLFYDENAQLVRVKVRDCL  415



>gb|AEO00529.1| polyphenol oxidase [Nicotiana benthamiana]
Length=588

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVG----DPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIW  445
             P  GT+ N+PH  VH WVG    +    H EDMGNFYSA  DP+FY HH+NVDRMW+ W
Sbjct  315  SPGMGTIENIPHTPVHIWVGSRPNENNVSHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW  374

Query  444  KTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K LGGKR D+ +K++LNSEF FYDEN+N  +VK+ D  
Sbjct  375  KALGGKRRDLTNKDWLNSEFFFYDENRNPFRVKVRDCL  412



>gb|AFW59500.1| putative polyphenol oxidase family protein [Zea mays]
Length=629

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GTV NVPH  +H WVGDP  P+ EDMGNFYSA++DPVF+ HH N+DR+W +W+ L  
Sbjct  362  PGAGTVENVPHGPLHVWVGDPTQPNGEDMGNFYSAARDPVFFAHHGNIDRLWHVWRGLSP  421

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIED  337
            +  D AD ++L++ F FYDE   LV+ ++ D
Sbjct  422  RNTDFADADWLDASFHFYDEEARLVRARVRD  452



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  SGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKR  424
            +G++ N+PH +VH W GD   P+ E+MG FY+A +DP+FY HHSN+DR+W++WKTLGG+R
Sbjct  334  AGSLENIPHGTVHVWTGDRTQPNFENMGVFYAAGRDPIFYAHHSNIDRLWSVWKTLGGRR  393

Query  423  MDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             D  D ++LNS FLFYDE   +V++++ D  
Sbjct  394  QDFTDPDFLNSSFLFYDEKAQMVRIRVRDCL  424



>gb|ABK35497.1| polyphenol oxidase, partial [Triticum aestivum]
Length=144

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V NVPH ++H W GDP  P+NEDMGNFYSA++DP+F+ HH N+DR+W +W+ L  
Sbjct  55   PGAGSVENVPHGTMHTWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRP  114

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKI  343
               D AD ++L++ FLFYDE    V+V++
Sbjct  115  SNTDFADADWLDTAFLFYDEEARPVRVRV  143



>gb|ABE96885.1| polyphenol oxidase [Nicotiana tabacum]
Length=502

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVG----DPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIW  445
             P  GT+ N+PH  VH WVG    +    H EDMGNFYSA  DP+FY HH+NVDRMW+ W
Sbjct  229  SPGMGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW  288

Query  444  KTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K LGGKR D+  K++LNSEF FYDEN+N  +VK+ D  
Sbjct  289  KALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCL  326



>gb|ABK35512.1| polyphenol oxidase, partial [Triticum aestivum]
Length=144

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V NVPH +VH W GDPR P+ EDMGNFYSA++DP+F+ HH N+DR+W +W+ L  
Sbjct  55   PGAGSVENVPHGTVHGWTGDPRQPNGEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRP  114

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIE  340
               D  D ++L++ FLFYDE    V+V++ 
Sbjct  115  SNADFTDPDWLDAAFLFYDEEARPVRVRVR  144



>gb|ABK35498.1| polyphenol oxidase, partial [Triticum monococcum]
 gb|ABK35499.1| polyphenol oxidase, partial [Triticum monococcum]
 gb|ABK35501.1| polyphenol oxidase, partial [Triticum urartu]
Length=144

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G+V NVPH ++H W GDP  P+NEDMGNFYSA++DP+F+ HH N+DR+W +W+ L  
Sbjct  55   PGAGSVENVPHGTMHTWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRP  114

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIE  340
               D  D ++LN+ FLFYDE    V+V++ 
Sbjct  115  SNTDFTDADWLNTAFLFYDEEARPVRVRVR  144



>ref|XP_008224999.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKT-LG  433
            P +G + ++PHN++H W GD    + EDMG FYSA +DP+FY HHSNVDRMW+I+K+ LG
Sbjct  325  PGAGNIESIPHNNIHLWTGDTTQTNGEDMGAFYSAGRDPLFYAHHSNVDRMWSIYKSKLG  384

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            G   DI  K+YL++EFLFYDE KNLV+VK+ DS 
Sbjct  385  G--TDIEKKDYLDAEFLFYDEKKNLVRVKVRDSL  416



>ref|XP_009767375.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=591

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVG----DPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIW  445
             P  GT+ N+PH  VH WVG    +    H EDMGNFYSA  DP+FY HH+NVDRMW+ W
Sbjct  318  SPGMGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW  377

Query  444  KTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K LGGKR D+  K++LNSEF FYDEN+N  +VK+ D  
Sbjct  378  KALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCL  415



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG-  430
             SG++ NVPH  VH W GD + P+ EDMG FYSA++DP+FY HHSNVDRMW++WKT+   
Sbjct  305  GSGSIENVPHGPVHVWCGDDKQPNGEDMGTFYSAARDPIFYAHHSNVDRMWSVWKTIENI  364

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             R D  D ++LN+ FLFYDEN NLV+VK+ D  
Sbjct  365  NRKDFDDPDWLNASFLFYDENANLVRVKVRDCL  397



>emb|CAA73103.1| polyphenol oxidase [Nicotiana tabacum]
Length=592

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVG----DPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIW  445
             P  GT+ N+PH  VH WVG    +    H EDMGNFYSA  DP+FY HH+NVDRMW+ W
Sbjct  319  SPGMGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW  378

Query  444  KTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K LGGKR D+  K++LNSEF FYDEN+N  +VK+ D  
Sbjct  379  KALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCL  416



>ref|XP_009408745.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V N PHN+VH W GD   P+ EDMG FYSA +DP+F+ HH+N+DRMW++WK L  
Sbjct  268  PGGGSVENTPHNNVHTWTGDRTRPNFEDMGTFYSAGRDPIFFAHHANIDRMWSLWKKLSR  327

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR-ARYK  310
            K  D  D ++L + FLFYDEN +LV+V ++D F  R  RYK
Sbjct  328  KHRDFNDSDWLKTSFLFYDENADLVRVTVKDCFKTRWLRYK  368



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSN+DRMW IWK++G 
Sbjct  332  PGAGSIETTPHGPVHTWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIWKSIGT  391

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI DK++L++ FLFYDEN  LV+V + D+ 
Sbjct  392  KNXDINDKDWLDTGFLFYDENAELVRVTVRDTL  424



>gb|KHN08552.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=563

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIW-KTL  436
            G  +G++ NVPH +VH W GD   P+ EDMG FYSA++DP+FY HHSN+DR+W+IW KTL
Sbjct  299  GAGAGSLENVPHGTVHLWTGDSNQPNFEDMGTFYSAARDPIFYSHHSNLDRIWSIWKKTL  358

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG+  D  D ++L S FLFYDENKNLV+VK++D  
Sbjct  359  GGR--DFTDSDWLESGFLFYDENKNLVRVKVKDCL  391



>ref|XP_006653782.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Oryza brachyantha]
Length=516

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +G++ +VPHN+VHRW GDPR P+ EDMG FYSA++DPVF+ HH NVDRMW I + L  
Sbjct  253  PGAGSIESVPHNTVHRWTGDPRQPNGEDMGIFYSAARDPVFFAHHGNVDRMWYIRRGLFP  312

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
               D  D ++L++ FLFYDE+  LV+V++ DS 
Sbjct  313  GNTDFTDPDWLDASFLFYDEDARLVRVRVRDSL  345



>ref|XP_008663490.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Zea mays]
 gb|AFW59173.1| putative polyphenol oxidase family protein [Zea mays]
Length=546

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GTV ++PHN VH W GDPR P+ EDMGNFYSA++DP+F+ HH N+DRMW++W  L  
Sbjct  285  PGAGTVESIPHNPVHFWSGDPRQPNGEDMGNFYSAARDPLFFAHHGNIDRMWSVWNGLRP  344

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
               D  D ++L++ FLFYDE   LV+V++ D  
Sbjct  345  GNSDFTDPSWLDASFLFYDEEARLVRVRVRDCL  377



>ref|XP_002990878.1| hypothetical protein SELMODRAFT_429255 [Selaginella moellendorffii]
 gb|EFJ08151.1| hypothetical protein SELMODRAFT_429255 [Selaginella moellendorffii]
Length=560

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -3

Query  600  GTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRM  421
            G V   PHN+VH + G P   +NEDMGNFYSA +DP+FYCHH NVDRMW +W++LG K  
Sbjct  298  GGVERAPHNAVHIFCGSPDEHNNEDMGNFYSAGRDPLFYCHHGNVDRMWDVWRSLGNK--  355

Query  420  DIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            D  D +YLN++FLF+DEN++LV+VK++DS 
Sbjct  356  DFTDPDYLNTKFLFFDENQDLVRVKVKDSL  385



>pdb|2P3X|A Chain A, Crystal Structure Of Grenache (Vitis Vinifera) Polyphenol 
Oxidase
Length=339

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 3/108 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GT+ + PHN VH+W G    P +EDMGNFY+A +DP+F+ HH+NVDRMW IWKT+GG
Sbjct  229  PGAGTLEHAPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGG  287

Query  429  K-RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF-LCRARYKI*ILPM  292
            K R D  D ++L++ F+FYDENK LVKVK+ D     + RY+   +P+
Sbjct  288  KNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPI  335



>gb|AII22009.1| polyphenol oxidase-7 [Gossypium hirsutum]
Length=616

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-G  433
            P  GT+ N  H +VH++VG    P+NEDMGNFYSA +DP+FY HH NVDRMW IWKTL G
Sbjct  344  PRGGTLENGAHLAVHKFVGAKNPPYNEDMGNFYSAGRDPLFYAHHGNVDRMWNIWKTLPG  403

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             KR D  +K++LNS FLFYDEN N+V+VK+ D  
Sbjct  404  KKRRDFDEKDWLNSSFLFYDENANMVRVKVRDCL  437



>ref|XP_010100567.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82810.1| Polyphenol oxidase [Morus notabilis]
Length=604

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDP--RTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
            P +GTV   PH ++H W G    R  + E++GNFYSA +DP+FY HH+NVDRMW++WKT+
Sbjct  330  PGAGTVERTPHTAIHIWGGSEKDREKNGENLGNFYSAGRDPMFYSHHANVDRMWSLWKTI  389

Query  435  GG-KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            GG KR DI+D +YLN+EFLFYDEN  LV+VK+ D  
Sbjct  390  GGRKRKDISDPDYLNAEFLFYDENARLVRVKVRDCL  425



>gb|AAA85122.1| polyphenol oxidase [Solanum tuberosum]
Length=599

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 8/100 (8%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPR--------TPHNEDMGNFYSASKDPVFYCHHSNVDRMWT  451
            A GT+ N+PH  VH W G  R        T + EDMGNFYSA  DPVFYCHH NVDRMW 
Sbjct  323  APGTIENIPHIPVHIWAGTVRGSTFPNGDTSYGEDMGNFYSAGLDPVFYCHHGNVDRMWN  382

Query  450  IWKTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             WK +GGKR D+++K++LNSEF FYDENK   +VK+ D  
Sbjct  383  EWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCL  422



>ref|XP_009407067.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++ NVPH  VH W GD      EDMGN YSA++DPVF+ HHSN+DR+W +WK LG 
Sbjct  312  PGGGSLENVPHGPVHVWTGDRSQSELEDMGNLYSAARDPVFFAHHSNIDRIWNVWKGLGS  371

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            +R D+AD ++L++ F+FYDEN NLVK+++ D  
Sbjct  372  RRKDLADPDWLDASFVFYDENANLVKIRVRDCI  404



>gb|ABI96936.1| putative polyphenol oxidase [Holodiscus microphyllus]
Length=455

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFY-CHHSNVDRMWTIWKT  439
              P  G++ N PH  +H W GD   P+ E+MGNFYSA KDP+FY   HSNVDRMW IWK+
Sbjct  231  ANPGPGSIENSPHGPIHLWAGDKTQPNYENMGNFYSAGKDPLFYYAIHSNVDRMWGIWKS  290

Query  438  LGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            LGGKR+DI+D ++LNS FLFY+EN  +V+V ++D  
Sbjct  291  LGGKRVDISDSDWLNSGFLFYNENAEMVRVTVKDCL  326



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSN+DRMW IWK++G 
Sbjct  264  PGGGSIETTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNIDRMWNIWKSIGT  323

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI DK++L++ FLFYDEN  LV+V + D+ 
Sbjct  324  KNXDINDKDWLDTGFLFYDENAELVRVTVRDTL  356



>ref|XP_008225002.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Prunus mume]
Length=594

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWK-TLG  433
            P +G + ++PHN++H W GDP+  + E+MG FYSA +DP+FY HHSNVDRMW+I+K  LG
Sbjct  329  PGAGNIESLPHNNIHLWTGDPKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDLLG  388

Query  432  GKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCR  322
            G  +D AD  +LN+EFLFYDE KNLV+VK+ DS   R
Sbjct  389  GTDIDKAD--WLNTEFLFYDEKKNLVRVKVRDSLDTR  423



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSN+DRMW IWK++G 
Sbjct  264  PGXGSIETTPHGPVHXWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIWKSIGT  323

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI DK++L++ FLFYDEN  LV+V + D+ 
Sbjct  324  KNXDINDKDWLDTGFLFYDENAELVRVTVRDTL  356



>ref|XP_011098100.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=593

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -3

Query  606  ASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKT-LGG  430
            A GT     HN+VHRW GDPR P  ED+GNFYSA +DP+FY HH+NVDRMWTIW+     
Sbjct  325  APGTSERGSHNAVHRWCGDPRQPAGEDLGNFYSAGRDPIFYGHHANVDRMWTIWRQGRAN  384

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             + D  D +YLN++FLFYDEN  LV+V++ D  
Sbjct  385  NQRDFTDTDYLNTQFLFYDENSRLVRVRVADCL  417



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GT+ +VPHN VH+W G    P +EDMGNFY+A +DP+F+ HH+NVDRMW IWKT+GG
Sbjct  332  PGAGTLEHVPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGG  390

Query  429  K-RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF-LCRARYKI*ILPM  292
            K R D  D ++L++ F+FYDENK LVKVK+ D     + RY+   +P+
Sbjct  391  KNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPI  438



>gb|EYU34162.1| hypothetical protein MIMGU_mgv1a005754mg [Erythranthe guttata]
Length=471

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = -3

Query  615  GGPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL  436
              P  G+V +  H  +H WVGDP  P +ED+GNFYSA++DP+FYCHH+NVDRMW +W+ L
Sbjct  181  ANPGEGSVESGSHTVIHSWVGDPEQPTSEDLGNFYSAARDPLFYCHHANVDRMWYLWQRL  240

Query  435  GGKRMD---IADKNYLNSEFLFYDENKNLVKVKIEDSF  331
               ++    I D +YLN+ FLFYDEN  LVKV + D+F
Sbjct  241  PNNKLPNKRITDPDYLNASFLFYDENAQLVKVYVRDTF  278



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P +GT+ +VPHN VH+W G    P +EDMGNFY+A +DP+F+ HH+NVDRMW IWKT+GG
Sbjct  332  PGAGTLEHVPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGG  390

Query  429  K-RMDIADKNYLNSEFLFYDENKNLVKVKIEDSF-LCRARYKI*ILPM  292
            K R D  D ++L++ F+FYDENK LVKVK+ D     + RY+   +P+
Sbjct  391  KNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPI  438



>ref|XP_009588337.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 67/101 (66%), Gaps = 8/101 (8%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPR--------TPHNEDMGNFYSASKDPVFYCHHSNVDRMW  454
            P  GT+ N+PH  VH W G  R          + EDMGNFYSA  DPVFYCHH+NVDRMW
Sbjct  317  PGQGTIENIPHTPVHIWTGTVRDTDLGNGVKSYGEDMGNFYSAGLDPVFYCHHANVDRMW  376

Query  453  TIWKTLGGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              WK LGGKR D+ D ++LNSEF FYDEN++  +VK+ D  
Sbjct  377  NEWKALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCL  417



>gb|EYU34163.1| hypothetical protein MIMGU_mgv1a003224mg [Erythranthe guttata]
Length=598

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G+V    H S+H WVGDP  P  ED+GNFYSA +DP+FYCHH+NVDRMW +W+ L  
Sbjct  316  PGEGSVERGSHTSIHAWVGDPEQPSGEDLGNFYSAGRDPLFYCHHANVDRMWYLWQRLPN  375

Query  429  KRMD---IADKNYLNSEFLFYDENKNLVKVKIEDSF  331
             ++    I D +YLN+ FLFYDEN  LVKV + D+F
Sbjct  376  NKLPDKRITDPDYLNASFLFYDENAQLVKVYVRDTF  411



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  PASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGG  430
            P  G++   PH  VH W GD   P+ EDMGNFYSA +DP+F+ HHSNVDRMW IWK+LG 
Sbjct  332  PGQGSIETAPHGPVHLWTGDNTQPNIEDMGNFYSAGRDPIFFAHHSNVDRMWNIWKSLGT  391

Query  429  KRMDIADKNYLNSEFLFYDENKNLVKVKIEDSF  331
            K  DI D ++L++ FLFYDEN  LV+V++ D  
Sbjct  392  KNKDINDPDWLDAGFLFYDENAELVRVRVRDCL  424



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = -3

Query  612  GPASGTVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTL-  436
             P  G V    H ++HRW GDPR  ++EDMGNFYSA +DP+FY HHSNVDRMW+IWK L 
Sbjct  326  SPGGGVVELGSHTAIHRWCGDPRQTYSEDMGNFYSAGRDPLFYAHHSNVDRMWSIWKGLP  385

Query  435  GGKRMDIADKNYLNSEFLFYDENKNLVKVKIEDSFLCRA  319
            G KR D  D ++L++ F+FYDEN NLV+ ++ D    R 
Sbjct  386  GKKRNDFTDTDWLDASFVFYDENANLVRARVRDCLDTRT  424



>ref|XP_009773174.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=621

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -3

Query  597  TVVNVPHNSVHRWVGDPRTPHNEDMGNFYSASKDPVFYCHHSNVDRMWTIWKTLGGKRMD  418
            ++ N+PH  VH W GD   P+ E+MG+FYSA++DP+FY HHSN+DR+W++WKTLGG+R D
Sbjct  350  SLENIPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLGGRRQD  409

Query  417  IADKNYLNSEFLFYDENKNLVKVKIEDSF  331
              D ++LN+ FLFYDE   +V++++ D  
Sbjct  410  FTDPDFLNASFLFYDEKAQMVRIRVRDCL  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 789084978192