BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86099_g1_i1 len=340 path=[318:0-339]

Length=340
                                                                      Score     E

gb|AFR60862.1|  sporamin B                                            88.6    5e-19   
gb|AFR60864.1|  sporamin B                                            88.6    5e-19   
gb|ABB90968.1|  sporamin B precursor                                  88.6    5e-19   Ipomoea batatas [batate]
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor   88.6    6e-19   Ipomoea batatas [batate]
gb|AFR60867.1|  sporamin B                                            88.6    6e-19   
gb|AFR60859.1|  sporamin B                                            88.6    6e-19   
gb|AAA33390.1|  sporamin B                                            88.6    6e-19   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                            88.6    6e-19   
gb|AFR60865.1|  sporamin B                                            88.2    6e-19   
gb|AFR60860.1|  sporamin B                                            88.2    6e-19   
gb|AFR60863.1|  sporamin B                                            88.2    6e-19   
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...  86.3    3e-18   Ipomoea batatas [batate]
gb|ABG26235.1|  sporamin A                                            79.7    9e-16   Ipomoea trifida
gb|ABB97543.1|  sporamin A precursor                                  79.3    1e-15   Ipomoea batatas [batate]
gb|ABB97549.1|  sporamin A precursor                                  79.3    1e-15   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                  79.3    1e-15   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                    79.3    1e-15   Ipomoea batatas [batate]
gb|AAA33391.1|  sporamin A precursor                                  79.3    1e-15   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                            79.3    1e-15   Ipomoea trifida
gb|ABG26222.1|  sporamin A                                            79.3    1e-15   Ipomoea leucantha
gb|ABG26224.1|  sporamin A                                            79.0    2e-15   Ipomoea leucantha
gb|ABG26227.1|  sporamin A                                            79.0    2e-15   Ipomoea leucantha
gb|AAL55800.1|AF289060_1  sporamin                                    79.0    2e-15   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                            78.6    3e-15   Ipomoea trifida
gb|ABG26232.1|  sporamin A                                            77.8    5e-15   Ipomoea trifida
gb|AAB52549.1|  sporamin                                              75.9    6e-15   Ipomoea batatas [batate]
gb|ABG26236.1|  sporamin A                                            77.4    6e-15   Ipomoea trifida
gb|ABG26238.1|  sporamin A                                            77.4    7e-15   Ipomoea trifida
gb|AAA86670.1|  preprosporamin                                        76.6    1e-14   Ipomoea batatas [batate]
gb|ABG26229.1|  sporamin A                                            76.6    1e-14   Ipomoea trifida
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...  76.6    1e-14   Ipomoea batatas [batate]
gb|AAB52547.1|  sporamin precursor                                    76.6    1e-14   Ipomoea batatas [batate]
gb|ABB97547.1|  sporamin A precursor                                  76.3    2e-14   Ipomoea batatas [batate]
gb|ABB97542.1|  sporamin A precursor                                  75.9    2e-14   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                  75.9    2e-14   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                  75.5    3e-14   Ipomoea batatas [batate]
gb|AFR60855.1|  sporamin A                                            75.5    4e-14   
gb|AAB52550.1|  sporamin                                              68.2    9e-12   Ipomoea batatas [batate]
gb|AAD05567.1|  sporamin A                                            66.6    4e-11   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                              66.6    4e-11   
gb|AFR60856.1|  sporamin A                                            66.2    5e-11   
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor   66.2    5e-11   Ipomoea batatas [batate]
gb|AAD40288.1|  sporamin A precursor                                  65.5    1e-10   Ipomoea batatas [batate]
emb|CCK82547.1|  sporamin A precursor                                 63.5    1e-10   
emb|CAA43267.1|  sporamin                                             61.6    3e-09   Ipomoea batatas [batate]



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSNTPFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFVIKPT-DM  216



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPSGDM  143
            AYKI+YCQFGTEKCFNVGRYYDP  RATRLALSN PFVFVIKP+ DM
Sbjct  171  AYKISYCQFGTEKCFNVGRYYDPLTRATRLALSNIPFVFVIKPT-DM  216



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDPMMRTTRLALSNSPFVFVIKPT  217



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  155  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  197



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPLMRTTRLALSNSPFVFVIKPT  217



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCHNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALS++PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSDSPFVFVIKPT  217



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++D   R TRLALSN+PFVFVIKP+
Sbjct  77   YKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVIKPT  119



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALS++PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSDSPFVFVIKPT  217



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC+FG++KC+NVGR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCRFGSDKCYNVGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+N GR++DP  R TRLALSN+PFVFVIKP+
Sbjct  175  YKLTYCQFGSDKCYNCGRFHDPMLRTTRLALSNSPFVFVIKPT  217



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYCQFG++KC+NVGR++DP  R TRLALSN+PF FVI+P+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDPMLRTTRLALSNSPFAFVIRPT  217



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++D   R TRLALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVIKPT  217



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++D   R TRLALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVIKPT  217



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++D   R TRLALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVIKPT  217



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG +KC+NVGR++D   R TRLALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGADKCYNVGRFHDHMLRTTRLALSNSPFVFVIKPT  217



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++D   R TR+ALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDHMLRTTRIALSNSPFVFVIKPT  217



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++D   R TR+ALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDHMLRTTRIALSNSPFVFVIKPT  217



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    AYKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            +YK+TYCQFG++KC+NVGR++D   R TRLALSN+PFVFVIKP+
Sbjct  174  SYKLTYCQFGSDKCYNVGRFHDHMSRTTRLALSNSPFVFVIKPT  217



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC FG++KC+NVGR+ DP  R TRLALS+ PF FVIKP+
Sbjct  127  YKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSSYPFFFVIKPT  169



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC FG++KC+NVGR+ DP  R TRLALS  PF FVIKP+
Sbjct  175  YKLTYCLFGSDKCYNVGRFNDPMLRTTRLALSYYPFFFVIKPT  217



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC FG++KC+NVGR+ DP  R TRLALS  PF FVIKP+
Sbjct  175  YKLTYCLFGSDKCYNVGRFNDPMLRTTRLALSYYPFFFVIKPT  217



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC FG++KC+NVGR+ DP  R TRLALS  PF FVIKP+
Sbjct  175  YKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSYYPFFFVIKPT  217



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC FG++KC+NVGR+ DP  R TRLALS  PF FVIKP+
Sbjct  175  YKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSYYPFFFVIKPT  217



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    YKITYCQFGTEKCFNVGRYYDPSFRATRLALSNTPFVFVIKPS  134
            YK+TYC FG++KC+NVGR+ DP  R TRLA+S  PF FVIKP+
Sbjct  175  YKLTYCLFGSDKCYNVGRFNDPMLRTTRLAISYYPFFFVIKPT  217



>emb|CCK82547.1| sporamin A precursor, partial [Ipomoea batatas]
Length=78

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  185  TYHAYNLN*HRCSLHITTRFDHKHEGSITESQTRSPKRRVIVSANVEAFLGAELTISDFV  6
            +YHA +      +LHI  RFD K+EG I ESQTR P+  V+ SA++ AF+GAELT+S+FV
Sbjct  13   SYHATSPALFSVTLHIG-RFDDKNEGRIGESQTRGPQHVVVESADIVAFIGAELTVSEFV  71

Query  5    S  3
             
Sbjct  72   G  72



>emb|CAA43267.1| sporamin [Ipomoea batatas]
Length=236

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -3

Query  245  LFLHVRTTLSKLQRYLFSIATYHAYNLN*HRCS-LHITT-RFDHKHEGSITESQTRSPKR  72
            +F+  RTTLSK QR    IAT   +N    R S LH T+     K +G I ESQTR P+ 
Sbjct  1    MFILTRTTLSKWQR---CIATMQPHN---RRFSVLHYTSVGLMTKTQGRIGESQTRGPQH  54

Query  71   RVIVSANVEAFLGAELTISDFV  6
             V+ SAN+ AF+GAELT+S+FV
Sbjct  55   GVMESANIVAFVGAELTVSEFV  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 526398857312