BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c86071_g1_i1 len=1552 path=[1530:0-1551]

Length=1552
                                                                      Score     E

ref|XP_006340610.1|  PREDICTED: scarecrow-like protein 4-like           549   0.0      
ref|XP_009605592.1|  PREDICTED: scarecrow-like protein 4                549   0.0      
ref|XP_004232402.1|  PREDICTED: scarecrow-like protein 4                548   0.0      
ref|XP_011099604.1|  PREDICTED: scarecrow-like protein 4                546   0.0      
ref|XP_009794663.1|  PREDICTED: scarecrow-like protein 4                542   0.0      
ref|XP_007046954.1|  Chitin-inducible gibberellin-responsive prot...    539   0.0      
emb|CDP02028.1|  unnamed protein product                                536   0.0      
ref|XP_002521601.1|  Chitin-inducible gibberellin-responsive prot...    530   3e-179   Ricinus communis
ref|XP_002267140.1|  PREDICTED: scarecrow-like protein 4                527   4e-178   Vitis vinifera
gb|KDP34745.1|  hypothetical protein JCGZ_11271                         522   3e-176   
ref|XP_007204097.1|  hypothetical protein PRUPE_ppa003124mg             513   5e-173   
ref|XP_004287903.1|  PREDICTED: scarecrow-like protein 4-like           514   7e-173   
gb|ADL36819.1|  SCL domain class transcription factor                   508   9e-173   
gb|KHG05100.1|  Scarecrow-like protein 4                                511   5e-172   
ref|XP_008241668.1|  PREDICTED: scarecrow-like protein 4                508   8e-171   
ref|XP_011025772.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    503   5e-169   
ref|XP_009350005.1|  PREDICTED: scarecrow-like protein 4                503   1e-168   
ref|XP_006383208.1|  scarecrow-like transcription factor 7 family...    502   1e-168   
ref|XP_002310226.2|  hypothetical protein POPTR_0007s12760g             501   2e-168   Populus trichocarpa [western balsam poplar]
ref|XP_011015972.1|  PREDICTED: scarecrow-like protein 4                500   4e-168   
ref|XP_009371590.1|  PREDICTED: scarecrow-like protein 4                501   5e-168   
ref|XP_010254864.1|  PREDICTED: scarecrow-like protein 4                501   5e-168   
ref|XP_010113493.1|  hypothetical protein L484_026828                   501   8e-168   
gb|EYU40156.1|  hypothetical protein MIMGU_mgv1a018392mg                498   2e-167   
gb|AHZ13509.1|  GRAS/SCL transcription factor                           498   3e-167   
ref|XP_008338096.1|  PREDICTED: scarecrow-like protein 4                498   4e-167   
ref|XP_008338470.1|  PREDICTED: scarecrow-like protein 4                493   4e-165   
ref|XP_010484588.1|  PREDICTED: scarecrow-like protein 4 isoform X1     489   1e-163   
ref|XP_010679714.1|  PREDICTED: scarecrow-like protein 4                490   1e-163   
ref|XP_006393872.1|  hypothetical protein EUTSA_v10003860mg             489   3e-163   
gb|AAL32616.1|  SCARECROW gene regulator                                487   5e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550390.1|  PREDICTED: scarecrow-like protein 4                488   8e-163   
ref|NP_201478.1|  GRAS family transcription factor                      487   9e-163   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28360.1|  gras family transcription factor                        486   1e-162   
ref|XP_010444734.1|  PREDICTED: scarecrow-like protein 4 isoform X3     485   2e-162   
ref|XP_010444732.1|  PREDICTED: scarecrow-like protein 4 isoform X1     483   2e-161   
gb|KCW56779.1|  hypothetical protein EUGRSUZ_I024512                    478   3e-160   
ref|XP_010263679.1|  PREDICTED: scarecrow-like protein 4                479   1e-159   
ref|XP_010464893.1|  PREDICTED: scarecrow-like protein 4                478   2e-159   
ref|XP_010029812.1|  PREDICTED: scarecrow-like protein 4                478   3e-159   
emb|CBI17529.3|  unnamed protein product                                477   4e-159   
ref|XP_010558259.1|  PREDICTED: scarecrow-like protein 4 isoform X1     474   1e-157   
ref|XP_008440702.1|  PREDICTED: scarecrow-like protein 4                473   5e-157   
ref|XP_004143507.1|  PREDICTED: scarecrow-like protein 4-like           472   1e-156   
ref|XP_003540145.1|  PREDICTED: scarecrow-like protein 4-like           466   3e-156   
emb|CAN74537.1|  hypothetical protein VITISV_023717                     477   6e-155   Vitis vinifera
ref|XP_008453739.1|  PREDICTED: scarecrow-like protein 4                465   3e-154   
ref|XP_006404015.1|  hypothetical protein EUTSA_v10011122mg             461   3e-153   
ref|XP_002866739.1|  hypothetical protein ARALYDRAFT_496923             461   5e-153   
emb|CDY72338.1|  BnaCnng77180D                                          461   8e-153   
ref|XP_002877757.1|  hypothetical protein ARALYDRAFT_485412             450   3e-150   
ref|NP_190634.1|  scarecrow-like protein 7                              452   5e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53846.1|  BnaA07g37410D                                          454   6e-150   
ref|XP_004505608.1|  PREDICTED: scarecrow-like protein 4-like           450   5e-149   
ref|XP_009103487.1|  PREDICTED: scarecrow-like protein 4                451   7e-149   
ref|XP_010426606.1|  PREDICTED: scarecrow-like protein 7                449   7e-149   
ref|XP_007131529.1|  hypothetical protein PHAVU_011G020600g             449   1e-148   
ref|XP_006425686.1|  hypothetical protein CICLE_v10025169mg             450   6e-148   
emb|CDL93467.1|  lateral suppressor' /functional='GRAS-family tra...    448   7e-148   
ref|XP_006290864.1|  hypothetical protein CARUB_v10016973mg             446   2e-147   
gb|KDO79532.1|  hypothetical protein CISIN_1g006986mg                   445   4e-146   
ref|XP_004149153.1|  PREDICTED: scarecrow-like protein 4-like           444   6e-146   
ref|XP_004166315.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    444   6e-146   
ref|XP_006290913.1|  hypothetical protein CARUB_v10017026mg             439   3e-145   
dbj|BAG16269.1|  lateral suppressor                                     439   2e-144   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003607414.1|  GAI-like protein                                   432   4e-142   
gb|AES89611.2|  GRAS family transcription factor                        432   5e-142   
ref|XP_008790358.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    433   3e-141   
ref|XP_010939277.1|  PREDICTED: scarecrow-like protein 4                427   6e-139   
ref|XP_010936276.1|  PREDICTED: scarecrow-like protein 4                427   9e-139   
ref|XP_009387926.1|  PREDICTED: scarecrow-like protein 4                425   3e-138   
ref|XP_006650515.1|  PREDICTED: scarecrow-like protein 4-like           418   4e-137   
ref|XP_008785667.1|  PREDICTED: scarecrow-like protein 7                420   5e-136   
gb|EEE59833.1|  hypothetical protein OsJ_12398                          417   5e-136   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051115.1|  Os03g0723000                                       417   6e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009395642.1|  PREDICTED: scarecrow-like protein 4                415   2e-134   
ref|XP_009394305.1|  PREDICTED: scarecrow-like protein 4                414   1e-133   
ref|XP_003607413.1|  GRAS family transcription factor                   402   1e-133   
gb|KHN46452.1|  Scarecrow-like protein 4                                397   8e-132   
ref|XP_002466548.1|  hypothetical protein SORBIDRAFT_01g009740          405   1e-131   Sorghum bicolor [broomcorn]
ref|XP_008665334.1|  PREDICTED: scarecrow-like protein 4                404   6e-131   
ref|XP_004981941.1|  PREDICTED: scarecrow-like protein 4-like           404   9e-131   
ref|XP_008644549.1|  PREDICTED: scarecrow-like protein 4                400   2e-129   
gb|AIB04509.1|  GRAS transcription factor                               399   8e-129   
gb|EPS61944.1|  hypothetical protein M569_12848                         396   1e-127   
ref|XP_003560467.1|  PREDICTED: scarecrow-like protein 4                393   7e-127   
ref|XP_006591548.1|  PREDICTED: scarecrow-like protein 4-like           389   2e-126   
dbj|BAJ84873.1|  predicted protein                                      392   2e-126   
gb|AJC52490.1|  SCL2                                                    384   3e-121   
ref|XP_006856020.1|  hypothetical protein AMTR_s00059p00051820          374   1e-118   
gb|EMS59859.1|  Scarecrow-like protein 4                                279   2e-84    
ref|XP_001783367.1|  predicted protein                                  264   4e-78    
ref|XP_002985548.1|  GRAS family protein                                266   3e-77    
ref|XP_001773672.1|  predicted protein                                  204   9e-57    
ref|XP_001763823.1|  predicted protein                                  204   3e-56    
ref|XP_008806184.1|  PREDICTED: scarecrow-like protein 18               204   4e-56    
ref|XP_001785259.1|  PAL1B encoding AtPAT1-like protein                 201   1e-55    
ref|XP_009411905.1|  PREDICTED: protein MONOCULM 1-like                 205   1e-55    
ref|XP_008811155.1|  PREDICTED: scarecrow-like protein 18               201   5e-55    
ref|XP_002992412.1|  hypothetical protein SELMODRAFT_135151             199   8e-55    
ref|XP_010928164.1|  PREDICTED: scarecrow-like protein 18               200   1e-54    
ref|XP_010913242.1|  PREDICTED: scarecrow-like protein 18               199   3e-54    
ref|XP_001778507.1|  predicted protein                                  199   3e-54    
ref|XP_006338809.1|  PREDICTED: protein SCARECROW-like                  204   6e-54    
ref|XP_001782213.1|  predicted protein                                  197   8e-54    
ref|NP_001060115.1|  Os07g0583600                                       201   1e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010928897.1|  PREDICTED: protein MONOCULM 1-like                 197   1e-53    
gb|EMT07028.1|  Chitin-inducible gibberellin-responsive protein 2       206   2e-53    
ref|XP_001782936.1|  PAL1A AtPAT1-like protein                          195   2e-53    
ref|XP_001763820.1|  predicted protein                                  196   2e-53    
ref|XP_002971092.1|  hypothetical protein SELMODRAFT_95139              195   5e-53    
ref|XP_002968015.1|  GRAS family protein                                198   6e-53    
ref|XP_003562815.1|  PREDICTED: chitin-inducible gibberellin-resp...    199   6e-53    
ref|XP_010315907.1|  PREDICTED: DELLA protein RGL1-like                 201   8e-53    
ref|XP_002512896.1|  DELLA protein GAI1, putative                       200   1e-52    Ricinus communis
ref|XP_010913983.1|  PREDICTED: protein MONOCULM 1-like                 195   2e-52    
ref|XP_009613034.1|  PREDICTED: DELLA protein RGL1-like                 199   2e-52    
ref|XP_007020290.1|  GRAS family transcription factor                   194   2e-52    
gb|KDO63869.1|  hypothetical protein CISIN_1g045762mg                   192   4e-52    
ref|XP_009803754.1|  PREDICTED: DELLA protein RGL2-like                 199   4e-52    
gb|ABD84026.1|  putative chitin-inducible gibberellin-responsive ...    196   4e-52    Bambusa ventricosa [Buddha bamboo]
ref|XP_008798776.1|  PREDICTED: scarecrow-like protein 18               193   5e-52    
ref|XP_009765072.1|  PREDICTED: scarecrow-like protein 18               193   5e-52    
gb|AEE69131.1|  GRAS family transcription factor                        193   5e-52    
ref|XP_004958142.1|  PREDICTED: chitin-inducible gibberellin-resp...    196   6e-52    
gb|ACH47034.1|  lateral suppressor protein                              192   7e-52    Nicotiana tabacum [American tobacco]
ref|XP_004171790.1|  PREDICTED: DELLA protein GAI1-like                 198   7e-52    
ref|XP_006657889.1|  PREDICTED: chitin-inducible gibberellin-resp...    196   8e-52    
ref|XP_008441631.1|  PREDICTED: DELLA protein RGL1-like                 197   8e-52    
ref|XP_009405522.1|  PREDICTED: DELLA protein GAI-like                  198   9e-52    
ref|XP_002265645.1|  PREDICTED: scarecrow-like protein 18               192   9e-52    Vitis vinifera
gb|KDP41801.1|  hypothetical protein JCGZ_26819                         197   1e-51    
ref|XP_004138798.1|  PREDICTED: DELLA protein GAI1-like                 197   1e-51    
ref|XP_011045749.1|  PREDICTED: DELLA protein RGL1-like                 197   1e-51    
ref|XP_008784262.1|  PREDICTED: scarecrow-like protein 3                193   1e-51    
ref|XP_011099005.1|  PREDICTED: DELLA protein RGL2-like                 197   1e-51    
ref|XP_002274834.2|  PREDICTED: scarecrow-like protein 21               197   2e-51    Vitis vinifera
ref|XP_002298647.1|  hypothetical protein POPTR_0001s33360g             197   2e-51    Populus trichocarpa [western balsam poplar]
ref|XP_002460928.1|  hypothetical protein SORBIDRAFT_02g037650          195   2e-51    Sorghum bicolor [broomcorn]
ref|XP_001755257.1|  predicted protein                                  192   2e-51    
dbj|BAJ90910.1|  predicted protein                                      195   2e-51    
gb|EMT21860.1|  hypothetical protein F775_28371                         194   2e-51    
ref|XP_007217517.1|  hypothetical protein PRUPE_ppa024399mg             197   2e-51    
dbj|BAJ95382.1|  predicted protein                                      194   3e-51    
ref|XP_007031934.1|  GRAS family transcription factor                   196   3e-51    
ref|XP_009409866.1|  PREDICTED: protein MONOCULM 1-like                 191   4e-51    
ref|XP_001773669.1|  predicted protein                                  188   4e-51    
ref|XP_006836764.1|  hypothetical protein AMTR_s00088p00161000          194   4e-51    
ref|XP_009618056.1|  PREDICTED: scarecrow-like protein 18               190   5e-51    
gb|ACN28625.1|  unknown                                                 193   5e-51    Zea mays [maize]
ref|NP_001170141.1|  hypothetical protein                               193   9e-51    Zea mays [maize]
gb|EYU31843.1|  hypothetical protein MIMGU_mgv1a021983mg                194   1e-50    
ref|XP_002961994.1|  GRAS family protein                                192   1e-50    
ref|XP_010267831.1|  PREDICTED: chitin-inducible gibberellin-resp...    193   1e-50    
ref|XP_008231070.1|  PREDICTED: DELLA protein GAI-like                  194   1e-50    
ref|XP_009594671.1|  PREDICTED: scarecrow-like protein 21               193   1e-50    
ref|XP_009346793.1|  PREDICTED: DELLA protein RGL1-like                 194   1e-50    
gb|EMS52091.1|  hypothetical protein TRIUR3_35245                       194   1e-50    
ref|XP_001770794.1|  predicted protein                                  190   1e-50    
emb|CDP16713.1|  unnamed protein product                                194   2e-50    
ref|XP_008341667.1|  PREDICTED: DELLA protein RGL1-like                 194   2e-50    
ref|XP_010917930.1|  PREDICTED: DELLA protein GAI1-like                 189   2e-50    
emb|CDP09804.1|  unnamed protein product                                194   2e-50    
ref|XP_010907680.1|  PREDICTED: chitin-inducible gibberellin-resp...    191   2e-50    
ref|NP_001147837.1|  LOC100281447                                       191   3e-50    Zea mays [maize]
ref|XP_009788119.1|  PREDICTED: scarecrow-like protein 21               192   3e-50    
ref|XP_004304540.1|  PREDICTED: DELLA protein GAI1-like                 193   3e-50    
ref|XP_010690197.1|  PREDICTED: scarecrow-like protein 18               190   4e-50    
dbj|BAK03376.1|  predicted protein                                      191   4e-50    
ref|XP_008680172.1|  PREDICTED: DELLA protein GAI-like                  193   4e-50    
gb|KDP39239.1|  hypothetical protein JCGZ_00996                         191   4e-50    
gb|KHN27990.1|  Chitin-inducible gibberellin-responsive protein 1       187   5e-50    
gb|ACR48080.1|  scarecrow 2                                             193   6e-50    Lupinus albus
ref|XP_006447014.1|  hypothetical protein CICLE_v10018153mg             192   7e-50    
ref|XP_011097940.1|  PREDICTED: scarecrow-like protein 21               190   1e-49    
ref|XP_009388384.1|  PREDICTED: protein MONOCULM 1                      187   1e-49    
ref|XP_008797426.1|  PREDICTED: chitin-inducible gibberellin-resp...    189   1e-49    
gb|AJC52496.1|  SCL10                                                   191   1e-49    
ref|XP_001769597.1|  predicted protein                                  186   1e-49    
ref|XP_003562960.1|  PREDICTED: chitin-inducible gibberellin-resp...    190   1e-49    
ref|XP_007021111.1|  GRAS family transcription factor isoform 2         187   1e-49    
emb|CDP05816.1|  unnamed protein product                                190   2e-49    
gb|EMT27957.1|  hypothetical protein F775_07373                         191   2e-49    
gb|EYU42066.1|  hypothetical protein MIMGU_mgv1a005350mg                188   2e-49    
ref|XP_009344215.1|  PREDICTED: DELLA protein RGL1-like                 191   2e-49    
ref|XP_009378007.1|  PREDICTED: DELLA protein RGL1-like                 191   2e-49    
ref|XP_010260476.1|  PREDICTED: scarecrow-like protein 1                189   2e-49    
ref|XP_008797425.1|  PREDICTED: chitin-inducible gibberellin-resp...    189   2e-49    
ref|XP_006592888.1|  PREDICTED: chitin-inducible gibberellin-resp...    187   3e-49    
dbj|BAI94488.1|  GRAS family transcription factor                       189   3e-49    
ref|XP_006356310.1|  PREDICTED: scarecrow-like protein 1-like iso...    189   3e-49    
ref|NP_001234315.1|  GRAS6 protein                                      189   3e-49    
ref|XP_008776123.1|  PREDICTED: chitin-inducible gibberellin-resp...    189   3e-49    
ref|XP_008246525.1|  PREDICTED: scarecrow-like protein 18               186   4e-49    
gb|KDO64235.1|  hypothetical protein CISIN_1g014896mg                   185   5e-49    
ref|XP_010912567.1|  PREDICTED: scarecrow-like protein 21               186   5e-49    
ref|XP_002884379.1|  hypothetical protein ARALYDRAFT_477591             188   5e-49    
gb|ACQ84011.1|  scarecrow 1                                             190   5e-49    Lupinus albus
ref|XP_002276880.1|  PREDICTED: scarecrow-like protein 28               189   5e-49    Vitis vinifera
ref|XP_004980521.1|  PREDICTED: DELLA protein GAI-like                  190   5e-49    
ref|XP_008448967.1|  PREDICTED: scarecrow-like protein 18               184   5e-49    
gb|KHG14123.1|  Scarecrow-like protein 5                                187   5e-49    
ref|XP_011072178.1|  PREDICTED: scarecrow-like protein 28               189   6e-49    
ref|XP_011101883.1|  PREDICTED: scarecrow-like protein 1                188   6e-49    
ref|XP_010252869.1|  PREDICTED: scarecrow-like protein 18               187   7e-49    
ref|XP_003543283.1|  PREDICTED: chitin-inducible gibberellin-resp...    188   7e-49    
ref|XP_011014635.1|  PREDICTED: scarecrow-like transcription fact...    187   8e-49    
gb|ACJ65328.1|  scarecrow-like protein                                  188   8e-49    Capsicum annuum
ref|XP_008379744.1|  PREDICTED: DELLA protein RGL1-like                 189   9e-49    
gb|EPS64600.1|  lateral suppressor protein                              184   9e-49    
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg             187   1e-48    
ref|XP_004957943.1|  PREDICTED: chitin-inducible gibberellin-resp...    187   1e-48    
ref|XP_007206810.1|  hypothetical protein PRUPE_ppa025834mg             183   1e-48    
ref|XP_011000401.1|  PREDICTED: scarecrow-like protein 18               184   1e-48    
ref|XP_007021110.1|  GRAS family transcription factor isoform 1         187   2e-48    
ref|XP_001766594.1|  predicted protein                                  182   2e-48    
ref|XP_010694285.1|  PREDICTED: scarecrow-like protein 21               187   2e-48    
gb|EPS59520.1|  hypothetical protein M569_15285                         186   2e-48    
ref|XP_003540429.1|  PREDICTED: chitin-inducible gibberellin-resp...    187   2e-48    
ref|XP_002300358.2|  hypothetical protein POPTR_0001s37270g             186   2e-48    Populus trichocarpa [western balsam poplar]
ref|XP_006346062.1|  PREDICTED: scarecrow-like protein 18-like          184   2e-48    
ref|XP_008791129.1|  PREDICTED: DELLA protein RGL3-like                 188   2e-48    
ref|XP_010923996.1|  PREDICTED: chitin-inducible gibberellin-resp...    186   2e-48    
ref|XP_008386036.1|  PREDICTED: scarecrow-like protein 21               186   2e-48    
ref|XP_007021113.1|  GRAS family transcription factor isoform 4         187   2e-48    
ref|XP_006857885.1|  hypothetical protein AMTR_s00069p00112440          187   2e-48    
ref|XP_008366473.1|  PREDICTED: scarecrow-like protein 21               186   2e-48    
gb|KDP21811.1|  hypothetical protein JCGZ_00598                         189   2e-48    
ref|XP_004506678.1|  PREDICTED: scarecrow-like protein 5-like iso...    186   2e-48    
ref|XP_009355562.1|  PREDICTED: scarecrow-like protein 21               186   3e-48    
ref|XP_008781654.1|  PREDICTED: DELLA protein RGL2-like                 184   3e-48    
gb|KHN29457.1|  Protein SCARECROW                                       187   3e-48    
ref|XP_010319995.1|  PREDICTED: GRAS6 protein isoform X1                186   3e-48    
ref|XP_009628410.1|  PREDICTED: scarecrow-like protein 1                186   3e-48    
ref|XP_006381294.1|  hypothetical protein POPTR_0006s11500g             188   3e-48    
ref|NP_001234179.1|  lateral suppressor protein                         183   4e-48    
gb|KHN40575.1|  Protein SCARECROW                                       186   4e-48    
ref|XP_002994174.1|  hypothetical protein SELMODRAFT_432115             187   4e-48    
ref|XP_006657807.1|  PREDICTED: chitin-inducible gibberellin-resp...    186   4e-48    
ref|NP_001234168.1|  GRAS2 protein                                      186   4e-48    
ref|XP_011030905.1|  PREDICTED: scarecrow-like protein 21 isoform X2    185   4e-48    
gb|AHA85560.1|  lateral                                                 183   5e-48    
ref|XP_001780523.1|  predicted protein                                  181   5e-48    
ref|XP_011018909.1|  PREDICTED: protein SCARECROW-like                  187   6e-48    
ref|XP_009766061.1|  PREDICTED: scarecrow-like protein 1                185   6e-48    
gb|ABD72963.1|  GRAS7                                                   181   6e-48    Solanum lycopersicum
ref|XP_011030903.1|  PREDICTED: scarecrow-like protein 21 isoform X1    185   6e-48    
ref|XP_008804655.1|  PREDICTED: protein SCARECROW 2-like                186   6e-48    
ref|XP_009401608.1|  PREDICTED: protein SCARECROW 2-like                187   6e-48    
ref|XP_003596568.1|  GRAS family transcription factor                   185   6e-48    
ref|XP_010278894.1|  PREDICTED: protein SCARECROW                       187   7e-48    
dbj|BAJ91036.1|  predicted protein                                      186   7e-48    
ref|XP_008780980.1|  PREDICTED: scarecrow-like protein 21               185   7e-48    
ref|XP_003553957.1|  PREDICTED: protein SCARECROW-like                  186   7e-48    
gb|KCW47573.1|  hypothetical protein EUGRSUZ_K01320                     187   7e-48    
ref|XP_006452128.1|  hypothetical protein CICLE_v10007843mg             185   7e-48    
ref|XP_009417256.1|  PREDICTED: chitin-inducible gibberellin-resp...    185   7e-48    
ref|XP_010036052.1|  PREDICTED: protein SCARECROW                       187   8e-48    
ref|XP_004147990.1|  PREDICTED: scarecrow-like protein 18-like          181   8e-48    
gb|AJC52489.1|  SCR                                                     187   8e-48    
emb|CDM83536.1|  unnamed protein product                                184   9e-48    
ref|XP_002317558.1|  hypothetical protein POPTR_0011s13460g             185   9e-48    Populus trichocarpa [western balsam poplar]
ref|XP_003533642.1|  PREDICTED: protein SCARECROW-like                  187   9e-48    
ref|XP_011101980.1|  PREDICTED: protein SCARECROW                       186   9e-48    
gb|ABH85406.1|  SCARECROW                                               187   9e-48    Pinus sylvestris [Scotch pine]
emb|CDY38434.1|  BnaA10g17240D                                          184   1e-47    
ref|XP_009412448.1|  PREDICTED: chitin-inducible gibberellin-resp...    184   1e-47    
gb|KHG02698.1|  Protein SCARECROW                                       185   1e-47    
ref|XP_007020613.1|  Scarecrow-like transcription factor PAT1 iso...    184   1e-47    
ref|XP_004305056.1|  PREDICTED: protein SCARECROW-like                  186   1e-47    
ref|XP_002450783.1|  hypothetical protein SORBIDRAFT_05g018070          186   1e-47    Sorghum bicolor [broomcorn]
ref|XP_003541840.1|  PREDICTED: scarecrow-like protein 1-like           184   1e-47    
ref|XP_002318447.1|  LATERAL SUPPRESSOR family protein                  182   1e-47    Populus trichocarpa [western balsam poplar]
gb|EYU32461.1|  hypothetical protein MIMGU_mgv1a023543mg                182   1e-47    
gb|EAZ04240.1|  hypothetical protein OsI_26385                          184   1e-47    Oryza sativa Indica Group [Indian rice]
ref|XP_007149678.1|  hypothetical protein PHAVU_005G089900g             184   1e-47    
ref|XP_008800637.1|  PREDICTED: LOW QUALITY PROTEIN: chitin-induc...    184   1e-47    
ref|XP_006851157.1|  hypothetical protein AMTR_s00043p00136400          184   1e-47    
ref|XP_006360106.1|  PREDICTED: chitin-inducible gibberellin-resp...    184   1e-47    
sp|Q9AVK4.1|SCR_PEA  RecName: Full=Protein SCARECROW; AltName: Fu...    186   1e-47    
gb|EPS68254.1|  hypothetical protein M569_06515                         183   2e-47    
ref|XP_009609251.1|  PREDICTED: scarecrow-like protein 28               185   2e-47    
ref|XP_009384356.1|  PREDICTED: protein SCARECROW 2-like                186   2e-47    
ref|XP_006280361.1|  hypothetical protein CARUB_v10026289mg             182   2e-47    
ref|XP_002282942.1|  PREDICTED: chitin-inducible gibberellin-resp...    184   2e-47    
ref|XP_010493620.1|  PREDICTED: scarecrow-like transcription fact...    182   2e-47    
ref|XP_010442232.1|  PREDICTED: scarecrow-like transcription fact...    182   2e-47    
ref|XP_011097794.1|  PREDICTED: scarecrow-like transcription fact...    181   2e-47    
ref|XP_009387556.1|  PREDICTED: scarecrow-like transcription fact...    183   2e-47    
ref|XP_009396052.1|  PREDICTED: chitin-inducible gibberellin-resp...    183   2e-47    
dbj|BAC42642.1|  putative RGA1                                          183   2e-47    
emb|CDY16915.1|  BnaC09g40420D                                          183   2e-47    
ref|XP_002971659.1|  hypothetical protein SELMODRAFT_95651              182   2e-47    
ref|XP_010482060.1|  PREDICTED: scarecrow-like transcription fact...    182   2e-47    
ref|XP_009149055.1|  PREDICTED: scarecrow-like protein 5                179   2e-47    
ref|XP_002460825.1|  hypothetical protein SORBIDRAFT_02g035680          184   2e-47    
ref|XP_007161385.1|  hypothetical protein PHAVU_001G064500g             184   2e-47    
ref|NP_186995.1|  DELLA protein RGL2                                    183   2e-47    
ref|XP_010905298.1|  PREDICTED: scarecrow-like protein 21               183   2e-47    
emb|CAN65092.1|  hypothetical protein VITISV_040971                     179   3e-47    
gb|ACD13207.1|  GRAS protein                                            180   3e-47    
ref|XP_009346474.1|  PREDICTED: chitin-inducible gibberellin-resp...    183   3e-47    
ref|XP_003551631.1|  PREDICTED: protein SCARECROW-like                  185   3e-47    
ref|XP_009334053.1|  PREDICTED: chitin-inducible gibberellin-resp...    183   3e-47    
ref|XP_006363022.1|  PREDICTED: scarecrow-like transcription fact...    182   3e-47    
ref|XP_003526667.1|  PREDICTED: scarecrow-like protein 1-like iso...    183   4e-47    
ref|XP_002323112.2|  hypothetical protein POPTR_0016s15060g             185   4e-47    
ref|NP_001059917.1|  Os07g0545800                                       183   4e-47    
emb|CBI31126.3|  unnamed protein product                                184   4e-47    
ref|XP_004294325.1|  PREDICTED: chitin-inducible gibberellin-resp...    183   4e-47    
ref|XP_002300599.1|  hypothetical protein POPTR_0001s47720g             180   4e-47    
ref|NP_001266225.1|  Hop-interacting protein THI039                     182   5e-47    
ref|XP_002519983.1|  transcription factor, putative                     185   5e-47    
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    182   5e-47    
ref|XP_004970541.1|  PREDICTED: scarecrow-like protein 14-like          184   5e-47    
ref|XP_010061376.1|  PREDICTED: scarecrow-like protein 18               181   6e-47    
ref|NP_001141745.1|  uncharacterized protein LOC100273879               182   6e-47    
ref|XP_009780114.1|  PREDICTED: protein SCARECROW-like                  184   6e-47    
ref|XP_006481279.1|  PREDICTED: protein SCARECROW-like                  184   6e-47    
ref|XP_006429683.1|  hypothetical protein CICLE_v10011085mg             184   7e-47    
ref|XP_004166288.1|  PREDICTED: scarecrow-like transcription fact...    179   7e-47    
ref|XP_007146593.1|  hypothetical protein PHAVU_006G053400g             182   7e-47    
ref|XP_004243547.1|  PREDICTED: scarecrow-like transcription fact...    182   7e-47    
ref|XP_009615228.1|  PREDICTED: protein SCARECROW-like                  184   8e-47    
gb|KDO73932.1|  hypothetical protein CISIN_1g048299mg                   180   8e-47    
ref|XP_003622095.1|  Protein SCARECROW                                  183   8e-47    
ref|XP_002321384.1|  hypothetical protein POPTR_0015s01070g             179   8e-47    
gb|EAZ17249.1|  hypothetical protein OsJ_32770                          182   9e-47    
ref|XP_008788032.1|  PREDICTED: protein SCARECROW 2-like isoform X2     183   1e-46    
ref|XP_002264349.1|  PREDICTED: protein SCARECROW                       183   1e-46    
emb|CDP16025.1|  unnamed protein product                                181   1e-46    
ref|XP_010504220.1|  PREDICTED: protein SCARECROW isoform X2            181   1e-46    
ref|XP_004492611.1|  PREDICTED: protein SCARECROW-like                  183   1e-46    
ref|XP_007140014.1|  hypothetical protein PHAVU_008G077000g             184   1e-46    
gb|KEH35404.1|  GRAS family transcription factor                        182   1e-46    
ref|XP_011027392.1|  PREDICTED: scarecrow-like protein 1                182   1e-46    
ref|XP_003600261.1|  Scarecrow-like transcription factor PAT1           181   1e-46    
ref|XP_006363507.1|  PREDICTED: chitin-inducible gibberellin-resp...    181   1e-46    
ref|NP_001065617.1|  Os11g0124300                                       182   1e-46    
gb|KEH35403.1|  GRAS family transcription factor                        181   1e-46    
dbj|BAD22576.1|  SCARECROW                                              182   1e-46    
ref|XP_008788030.1|  PREDICTED: protein SCARECROW 2-like isoform X1     183   1e-46    
ref|XP_010529957.1|  PREDICTED: protein SCARECROW-like                  181   1e-46    
gb|KDP42245.1|  hypothetical protein JCGZ_02975                         178   1e-46    
emb|CBI26738.3|  unnamed protein product                                181   1e-46    
gb|KHN23438.1|  Scarecrow-like protein 1                                182   1e-46    
ref|XP_010270381.1|  PREDICTED: scarecrow-like protein 1                181   1e-46    
ref|XP_009107522.1|  PREDICTED: DELLA protein RGL3                      181   1e-46    
gb|KDO58435.1|  hypothetical protein CISIN_1g009376mg                   181   1e-46    
gb|KFK34677.1|  hypothetical protein AALP_AA5G176900                    182   1e-46    
ref|XP_006843049.1|  hypothetical protein AMTR_s00186p00018500          182   2e-46    
ref|XP_009116109.1|  PREDICTED: protein SCARECROW                       182   2e-46    
ref|NP_001044771.1|  Os01g0842200                                       183   2e-46    
ref|XP_011043671.1|  PREDICTED: scarecrow-like protein 18               179   2e-46    
gb|EEC71776.1|  hypothetical protein OsI_04388                          183   2e-46    
gb|EEE55654.1|  hypothetical protein OsJ_04038                          183   2e-46    
emb|CDX78219.1|  BnaA09g34140D                                          182   2e-46    
ref|XP_006299072.1|  hypothetical protein CARUB_v10015212mg             181   2e-46    
ref|XP_011097791.1|  PREDICTED: scarecrow-like protein 21 isoform X1    181   2e-46    
ref|XP_009794690.1|  PREDICTED: scarecrow-like protein 21               181   2e-46    
ref|XP_004502571.1|  PREDICTED: scarecrow-like protein 1-like iso...    181   2e-46    
ref|XP_006403603.1|  hypothetical protein EUTSA_v10010179mg             182   2e-46    
ref|XP_009800214.1|  PREDICTED: scarecrow-like protein 14               179   2e-46    
ref|XP_002274103.1|  PREDICTED: scarecrow-like protein 21               181   2e-46    
ref|XP_002266415.1|  PREDICTED: scarecrow-like protein 1                181   2e-46    
ref|XP_007214671.1|  hypothetical protein PRUPE_ppa003323mg             181   2e-46    
ref|XP_009616343.1|  PREDICTED: scarecrow-like protein 21               181   2e-46    
ref|XP_010922842.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    182   2e-46    
ref|XP_010928462.1|  PREDICTED: chitin-inducible gibberellin-resp...    181   2e-46    
ref|XP_006346161.1|  PREDICTED: scarecrow-like transcription fact...    180   2e-46    
emb|CDX73496.1|  BnaC08g25070D                                          181   2e-46    
ref|XP_008342206.1|  PREDICTED: scarecrow-like protein 21               180   2e-46    
ref|XP_010931426.1|  PREDICTED: protein SCARECROW 2-like                182   3e-46    
gb|AAF87875.1|AC012561_8  Putative transcription factor                 180   3e-46    
ref|XP_006393131.1|  hypothetical protein EUTSA_v10011379mg             180   3e-46    
ref|NP_190990.1|  protein SCARECROW                                     181   3e-46    
ref|XP_009395940.1|  PREDICTED: protein MONOCULM 1-like                 178   3e-46    
ref|XP_004159489.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    177   3e-46    
ref|XP_006477403.1|  PREDICTED: scarecrow-like protein 28-like          181   3e-46    
ref|XP_002894262.1|  hypothetical protein ARALYDRAFT_474191             179   3e-46    
ref|XP_004244053.1|  PREDICTED: scarecrow-like protein 21               180   3e-46    
ref|XP_009626207.1|  PREDICTED: scarecrow-like transcription fact...    180   3e-46    
ref|XP_008244327.1|  PREDICTED: scarecrow-like protein 21               181   3e-46    
ref|XP_010504218.1|  PREDICTED: protein SCARECROW-like                  181   3e-46    
emb|CAN78295.1|  hypothetical protein VITISV_004660                     178   3e-46    
gb|KDO63554.1|  hypothetical protein CISIN_1g005954mg                   181   3e-46    
ref|XP_010427091.1|  PREDICTED: protein SCARECROW-like                  181   3e-46    
ref|XP_010252695.1|  PREDICTED: scarecrow-like protein 21               181   3e-46    
sp|Q2Z2E9.1|SCR_IPONI  RecName: Full=Protein SCARECROW; Short=PnSCR     182   4e-46    
ref|XP_002876247.1|  hypothetical protein ARALYDRAFT_485819             181   4e-46    
ref|XP_007161687.1|  hypothetical protein PHAVU_001G089900g             181   4e-46    
ref|XP_011012975.1|  PREDICTED: protein SCARECROW-like                  182   4e-46    
ref|XP_002306674.2|  SCARECROW-LIKE 1 family protein                    180   4e-46    
ref|XP_001758181.1|  predicted protein                                  177   4e-46    
ref|XP_009418762.1|  PREDICTED: chitin-inducible gibberellin-resp...    178   4e-46    
ref|XP_007132993.1|  hypothetical protein PHAVU_011G142300g             180   4e-46    
ref|XP_003549053.1|  PREDICTED: protein SCARECROW-like                  181   4e-46    
ref|XP_011015033.1|  PREDICTED: protein SCARECROW-like                  182   4e-46    
ref|XP_007206431.1|  hypothetical protein PRUPE_ppa001546mg             182   4e-46    
gb|KHN43091.1|  Chitin-inducible gibberellin-responsive protein 1       176   4e-46    
dbj|BAJ93346.1|  predicted protein                                      179   4e-46    
ref|XP_006290705.1|  hypothetical protein CARUB_v10016802mg             181   4e-46    
ref|XP_008783096.1|  PREDICTED: protein MONOCULM 1-like                 177   4e-46    
ref|XP_010113028.1|  hypothetical protein L484_022753                   182   4e-46    
ref|XP_008449075.1|  PREDICTED: scarecrow-like transcription fact...    179   5e-46    
gb|AAK59436.2|  putative scarecrow protein                              180   5e-46    
ref|XP_003523408.1|  PREDICTED: scarecrow-like protein 1-like iso...    180   5e-46    
ref|XP_003623699.1|  Scarecrow                                          182   5e-46    
ref|XP_004140012.1|  PREDICTED: scarecrow-like transcription fact...    179   5e-46    
ref|NP_175475.2|  scarecrow-like protein 5                              180   5e-46    
ref|XP_009370922.1|  PREDICTED: protein SCARECROW 1-like                182   5e-46    
ref|XP_002303565.1|  scarecrow transcription factor family protein      181   5e-46    
ref|XP_009147822.1|  PREDICTED: scarecrow-like protein 5                179   6e-46    
ref|XP_007013315.1|  GAI/RGA-like protein                               179   6e-46    
ref|XP_004147549.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    182   7e-46    
ref|XP_009337846.1|  PREDICTED: protein SCARECROW 2-like                181   7e-46    
ref|XP_003526176.1|  PREDICTED: chitin-inducible gibberellin-resp...    179   7e-46    
ref|XP_011095306.1|  PREDICTED: scarecrow-like protein 21               179   8e-46    
ref|XP_008370319.1|  PREDICTED: protein SCARECROW-like                  181   8e-46    
ref|XP_009804325.1|  PREDICTED: scarecrow-like transcription fact...    179   8e-46    
ref|XP_002873832.1|  hypothetical protein ARALYDRAFT_488615             178   8e-46    
ref|XP_008365835.1|  PREDICTED: chitin-inducible gibberellin-resp...    179   8e-46    
ref|XP_008463324.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    181   8e-46    
gb|EYU19196.1|  hypothetical protein MIMGU_mgv1a003912mg                179   8e-46    
ref|XP_004163982.1|  PREDICTED: uncharacterized protein LOC101230653    181   8e-46    
ref|XP_008244193.1|  PREDICTED: protein SCARECROW-like                  181   8e-46    
gb|AAK62666.1|  F17J6.12/F17J6.12                                       178   9e-46    
ref|XP_002529051.1|  Chitin-inducible gibberellin-responsive prot...    179   9e-46    
emb|CAI30892.1|  SCARECROW                                              181   9e-46    
ref|XP_002302201.1|  SCARECROW-LIKE 1 family protein                    179   9e-46    
gb|KGN53965.1|  hypothetical protein Csa_4G196810                       181   9e-46    
ref|XP_010461911.1|  PREDICTED: scarecrow-like protein 5                179   9e-46    
ref|XP_010500634.1|  PREDICTED: scarecrow-like protein 5                179   9e-46    
gb|KHN43816.1|  Scarecrow-like protein 5                                179   1e-45    
ref|XP_010515939.1|  PREDICTED: protein SCARECROW-like                  180   1e-45    
gb|EYU19915.1|  hypothetical protein MIMGU_mgv1a002248mg                180   1e-45    
ref|XP_010504216.1|  PREDICTED: protein SCARECROW-like                  180   1e-45    
gb|AAB06318.1|  SCARECROW                                               180   1e-45    
ref|XP_007032248.1|  GRAS family transcription factor isoform 2         180   1e-45    
ref|XP_006365320.1|  PREDICTED: protein SCARECROW-like                  181   1e-45    
ref|XP_002982342.1|  hypothetical protein SELMODRAFT_116328             178   1e-45    
ref|XP_004139646.1|  PREDICTED: scarecrow-like protein 1-like           179   1e-45    
ref|XP_008388412.1|  PREDICTED: protein SCARECROW-like                  181   1e-45    
gb|KDP25501.1|  hypothetical protein JCGZ_20657                         180   1e-45    
ref|XP_007201724.1|  hypothetical protein PRUPE_ppa003310mg             179   1e-45    
ref|XP_004149575.1|  PREDICTED: scarecrow-like transcription fact...    178   1e-45    
gb|KEH40473.1|  GRAS family transcription factor                        179   1e-45    
ref|XP_009127484.1|  PREDICTED: DELLA protein RGL1                      177   1e-45    
ref|XP_004290577.1|  PREDICTED: scarecrow-like protein 1-like           179   1e-45    
ref|XP_011007026.1|  PREDICTED: scarecrow-like protein 18               176   1e-45    
ref|XP_006475101.1|  PREDICTED: scarecrow-like protein 18-like          176   1e-45    
ref|XP_006440546.1|  hypothetical protein CICLE_v10019186mg             179   1e-45    
gb|KCW70105.1|  hypothetical protein EUGRSUZ_F03414                     176   1e-45    
ref|XP_003519619.1|  PREDICTED: scarecrow-like protein 5-like           178   1e-45    
ref|XP_007032247.1|  GRAS family transcription factor isoform 1         180   1e-45    
ref|XP_003551507.1|  PREDICTED: scarecrow-like protein 5-like iso...    178   1e-45    
ref|XP_009395599.1|  PREDICTED: scarecrow-like protein 21               178   1e-45    
ref|XP_004162380.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    178   1e-45    
ref|XP_004154460.1|  PREDICTED: scarecrow-like protein 1-like           178   2e-45    
emb|CDY55037.1|  BnaCnng28010D                                          177   2e-45    
gb|AHW42470.1|  RGA                                                     179   2e-45    
gb|KHG10483.1|  Protein SCARECROW -like protein                         180   2e-45    
ref|XP_003544730.1|  PREDICTED: scarecrow-like protein 1-like           179   2e-45    
ref|XP_010255275.1|  PREDICTED: scarecrow-like protein 8                179   2e-45    
ref|XP_010278558.1|  PREDICTED: scarecrow-like protein 28               179   2e-45    
ref|XP_006452790.1|  hypothetical protein CICLE_v10008226mg             176   2e-45    
ref|XP_011033794.1|  PREDICTED: scarecrow-like protein 28               179   2e-45    
ref|XP_003532162.1|  PREDICTED: scarecrow-like protein 5-like           178   2e-45    
ref|XP_002299559.1|  hypothetical protein POPTR_0001s08850g             179   2e-45    
ref|XP_008461488.1|  PREDICTED: scarecrow-like protein 1                178   2e-45    
ref|XP_010479522.1|  PREDICTED: scarecrow-like protein 5                179   2e-45    
ref|XP_010691407.1|  PREDICTED: protein SCARECROW                       180   2e-45    
ref|XP_009360698.1|  PREDICTED: scarecrow-like protein 1 isoform X2     177   2e-45    
ref|XP_009782602.1|  PREDICTED: scarecrow-like protein 28               179   2e-45    
gb|EPS73728.1|  hypothetical protein M569_01030                         174   2e-45    
ref|XP_009346772.1|  PREDICTED: scarecrow-like protein 21               177   3e-45    
ref|XP_002966500.1|  GRAS family protein                                179   3e-45    
ref|XP_008344606.1|  PREDICTED: scarecrow-like protein 1 isoform X2     177   3e-45    
ref|XP_010030721.1|  PREDICTED: scarecrow-like protein 21               178   3e-45    
ref|XP_009344268.1|  PREDICTED: scarecrow-like protein 28               179   3e-45    
emb|CDY70426.1|  BnaCnng68300D                                          177   3e-45    
gb|EYU30084.1|  hypothetical protein MIMGU_mgv1a027121mg                178   3e-45    
ref|XP_009374432.1|  PREDICTED: scarecrow-like protein 18               176   3e-45    
ref|XP_010063084.1|  PREDICTED: scarecrow-like protein 21               177   3e-45    
ref|XP_006303962.1|  hypothetical protein CARUB_v10008830mg             177   3e-45    
ref|XP_010067413.1|  PREDICTED: scarecrow-like protein 30               179   3e-45    
ref|XP_010237707.1|  PREDICTED: DELLA protein GAI-like                  179   3e-45    
ref|XP_010519282.1|  PREDICTED: chitin-inducible gibberellin-resp...    174   4e-45    
ref|XP_010112792.1|  hypothetical protein L484_020023                   177   4e-45    
ref|XP_003556343.1|  PREDICTED: DELLA protein GAI1-like                 175   4e-45    
ref|XP_011097798.1|  PREDICTED: scarecrow-like protein 18               174   4e-45    
ref|XP_006452519.1|  hypothetical protein CICLE_v10007927mg             177   4e-45    
ref|XP_008464182.1|  PREDICTED: scarecrow-like transcription fact...    177   4e-45    
gb|KCW55804.1|  hypothetical protein EUGRSUZ_I01625                     178   4e-45    
ref|XP_006452520.1|  hypothetical protein CICLE_v10007927mg             177   4e-45    
ref|XP_009360694.1|  PREDICTED: scarecrow-like protein 1 isoform X1     177   4e-45    
ref|XP_010675881.1|  PREDICTED: scarecrow-like transcription fact...    174   4e-45    
emb|CDX86324.1|  BnaA06g30410D                                          176   4e-45    
gb|AAY56753.1|  DELLA protein                                           177   4e-45    
gb|ABA93922.1|  GRAS family transcription factor containing protein     179   4e-45    



>ref|XP_006340610.1| PREDICTED: scarecrow-like protein 4-like [Solanum tuberosum]
Length=611

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 314/371 (85%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS-PEKRPANFD  260
             V+CARLA S+PEN VKSLIR+R+SVSQ GDP ERV +YF EALYN LS+   E+ P+ F 
Sbjct  247   VECARLAESEPENVVKSLIRLRESVSQQGDPMERVGFYFLEALYNGLSSCQAERTPSIFG  306

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              + EELTLSYKA NDACPYSKFAHLTANQAILEATEKA++IHI+DFGIV GIQWAA LQA
Sbjct  307   TTPEELTLSYKAFNDACPYSKFAHLTANQAILEATEKATRIHIVDFGIVHGIQWAAFLQA  366

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATRS GKP S+RISGIPS VLGNSPAASLLATGNRLRDFAK+LDLNFEFEP+L P+  L
Sbjct  367   LATRSAGKPVSVRISGIPSVVLGNSPAASLLATGNRLRDFAKLLDLNFEFEPILTPVQEL  426

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             NGSSFR+DPDEILAVNFMLQLYNLLDET   V TAL LA SLNPSIVTLGEYE++ N VG
Sbjct  427   NGSSFRIDPDEILAVNFMLQLYNLLDETNVGVETALSLAKSLNPSIVTLGEYEVNLNDVG  486

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             FL+RFKNALKYYS +FESLDP++TRDSPERV+VE L+LGRRIA  +  ++   + EC   
Sbjct  487   FLQRFKNALKYYSTVFESLDPSLTRDSPERVQVERLILGRRIAGAVGLDDGGTRREC---  543

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+HWR LME AGFK V +SHYA SQAKILLWNYNYSSS+ LIDS PGFLSLAW 
Sbjct  544   ---MEDKEHWRELMEGAGFKPVTLSHYAMSQAKILLWNYNYSSSFGLIDSAPGFLSLAWK  600

Query  1161  DEPLLTVSSWH  1193
             D PLLTVSSWH
Sbjct  601   DNPLLTVSSWH  611



>ref|XP_009605592.1| PREDICTED: scarecrow-like protein 4 [Nicotiana tomentosiformis]
Length=602

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 316/371 (85%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CARLA S+PENAVKSLIR+ + VSQ GDPTERV +YF EALY+RLS   E+ P+ F  
Sbjct  238   LECARLADSEPENAVKSLIRLEELVSQQGDPTERVGFYFLEALYSRLSCQTERSPSIFST  297

Query  264   -SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              + EELTLSYKA NDACPYSKFAHLTANQAILEATEKA++IHI+DFGIV GIQWAA LQA
Sbjct  298   YTPEELTLSYKAFNDACPYSKFAHLTANQAILEATEKATRIHIVDFGIVHGIQWAAFLQA  357

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATRS GKP SIRISGIPS VLGNSPAASLLATGNRLRDFAK+LDLNFEFEP+L P+  L
Sbjct  358   LATRSAGKPVSIRISGIPSVVLGNSPAASLLATGNRLRDFAKLLDLNFEFEPILTPVQEL  417

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             N SSFR+DPDE L+VNFMLQLYNLLDET+ +V TAL LA SLNPSIVTLGEYE++ N VG
Sbjct  418   NESSFRIDPDETLSVNFMLQLYNLLDETSVSVKTALNLAKSLNPSIVTLGEYEVNLNNVG  477

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             FL+RFKNAL YYS +FESLDP++TRDSPERV+VE L+LGRRIA  +  EE   + EC   
Sbjct  478   FLQRFKNALNYYSTVFESLDPSLTRDSPERVEVERLILGRRIAGAVGTEEAGTRREC---  534

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+HW+ LME AGFK V +SHYA SQAKILLWNYNYSSSY LIDSPPGFLSLAWN
Sbjct  535   ---MEDKEHWKELMEGAGFKEVTLSHYAMSQAKILLWNYNYSSSYGLIDSPPGFLSLAWN  591

Query  1161  DEPLLTVSSWH  1193
             D+PLLTVSSWH
Sbjct  592   DKPLLTVSSWH  602



>ref|XP_004232402.1| PREDICTED: scarecrow-like protein 4 [Solanum lycopersicum]
Length=609

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 314/371 (85%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS-PEKRPANFD  260
             V+CARLA S+PEN VKSLIR+R+SVSQ GDP ERV +YF EALYNRLS+   E+ P+ F 
Sbjct  245   VECARLAESEPENVVKSLIRLRESVSQQGDPMERVGFYFLEALYNRLSSCQAERTPSIFG  304

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              + EELTLSYKA NDACPYSKFAHLTANQAILEATEKA++IHI+DFGIV GIQWAA LQA
Sbjct  305   TAPEELTLSYKAFNDACPYSKFAHLTANQAILEATEKATRIHIVDFGIVHGIQWAAFLQA  364

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATRS GKP S+RISGIPS VLGNSP+ASLLATGNRLRDFAK+LDLNFEFEP+L P+  L
Sbjct  365   LATRSAGKPVSVRISGIPSVVLGNSPSASLLATGNRLRDFAKLLDLNFEFEPILTPVQEL  424

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             NGSSFRVDPDEILAVNFMLQLYNLLDET   V TAL LA SLNPSIVTLGEYE++ N VG
Sbjct  425   NGSSFRVDPDEILAVNFMLQLYNLLDETNVGVKTALSLAKSLNPSIVTLGEYEVNLNDVG  484

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             FL+RFKNALKYYS IFESLDP++TRDS ERV+VE L+LGRRIA  +  ++   + EC   
Sbjct  485   FLQRFKNALKYYSTIFESLDPSLTRDSAERVQVERLILGRRIAGAVGLDDGGTRREC---  541

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+HW+ LME AGFK V +SHYA SQAKILLWNYNYSSS+ LIDS PGFLSLAW 
Sbjct  542   ---MEDKEHWKELMEGAGFKPVTLSHYAMSQAKILLWNYNYSSSFGLIDSAPGFLSLAWK  598

Query  1161  DEPLLTVSSWH  1193
             D PLLTVSSWH
Sbjct  599   DNPLLTVSSWH  609



>ref|XP_011099604.1| PREDICTED: scarecrow-like protein 4 [Sesamum indicum]
Length=598

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/371 (75%), Positives = 312/371 (84%), Gaps = 11/371 (3%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CARL+ S PENAVKSLIR+R+SVSQ GDP ERV+YYFSEALY+R+S+  EK    +D 
Sbjct  236   IECARLSESDPENAVKSLIRLRESVSQNGDPLERVSYYFSEALYSRVSHQAEKTATIYDT  295

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +SEE TLSYKALNDACPYSKFAHLTANQAILEATEKA KIHI+DFGIVQGIQWAA LQAL
Sbjct  296   TSEEFTLSYKALNDACPYSKFAHLTANQAILEATEKAKKIHILDFGIVQGIQWAAFLQAL  355

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATR+ GKP+ +RISGIP+P LGNSPAASLLATGNRLRDFAK+LDLNFEFEPVL P+  L 
Sbjct  356   ATRASGKPERVRISGIPAPALGNSPAASLLATGNRLRDFAKLLDLNFEFEPVLTPVQELK  415

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
             GSSFRV PDE+LAVNFMLQLYNLLDE+   V  ALKLA SLNP +VTLGEYE+S NRVGF
Sbjct  416   GSSFRVHPDEVLAVNFMLQLYNLLDESNEGVEAALKLAKSLNPCVVTLGEYEVSLNRVGF  475

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE-QRAKTECvev  980
             L RFKNALKYY+A+FESLDPN+ RDSPER++ E LLLGRRIA L+ PEE +R + E    
Sbjct  476   LHRFKNALKYYTAVFESLDPNLARDSPERLQAERLLLGRRIAGLVGPEELKRERME----  531

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLID-SPPGFLSLAW  1157
                  DK+ WR LME AGF+ +  SHYA SQAKILLWNY+YSS Y L+D SPPGFLSLAW
Sbjct  532   -----DKESWRFLMEGAGFQPLVFSHYALSQAKILLWNYSYSSMYKLVDSSPPGFLSLAW  586

Query  1158  NDEPLLTVSSW  1190
             ND PLLTVSSW
Sbjct  587   NDVPLLTVSSW  597



>ref|XP_009794663.1| PREDICTED: scarecrow-like protein 4 [Nicotiana sylvestris]
Length=602

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/371 (75%), Positives = 313/371 (84%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CARLA S+PENAVKSLIR+++SVSQ GDPTERV +YF EALY+RLS   +  P+ F  
Sbjct  238   LECARLADSEPENAVKSLIRLKESVSQQGDPTERVGFYFFEALYSRLSFQTDNIPSIFGT  297

Query  264   SS-EELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              + EELTLSYKA NDACPYSKFAHLTANQAILEATEKA +IHI+DFGIV GIQWAA LQA
Sbjct  298   CTPEELTLSYKAFNDACPYSKFAHLTANQAILEATEKAMRIHIVDFGIVHGIQWAAFLQA  357

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATRS GKP SIRISGIPS VLGNSPAASLLATGNRLRDFAK+LDL FEFEP+L P+  L
Sbjct  358   LATRSAGKPVSIRISGIPSVVLGNSPAASLLATGNRLRDFAKLLDLKFEFEPILTPVQEL  417

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             N SSFR+DPDE LAVNFMLQLYNLLDET+  V TAL LA SLNPSIVTLGEYE+S N VG
Sbjct  418   NESSFRIDPDETLAVNFMLQLYNLLDETSVGVKTALNLAKSLNPSIVTLGEYEVSLNNVG  477

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             FL+RF NAL YYS IFESLDP++T+DSPERV+VE L+LGRRIA  +  +E   + EC   
Sbjct  478   FLQRFSNALNYYSTIFESLDPSLTQDSPERVQVERLILGRRIAGAVGTDEAGIRREC---  534

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+HW+ LME AGFK V +SHYA SQAKILLWNYNYSSSY LIDSPPGFLSLAWN
Sbjct  535   ---MEDKEHWKELMEGAGFKEVTLSHYAMSQAKILLWNYNYSSSYGLIDSPPGFLSLAWN  591

Query  1161  DEPLLTVSSWH  1193
             D+PLLTVSSWH
Sbjct  592   DKPLLTVSSWH  602



>ref|XP_007046954.1| Chitin-inducible gibberellin-responsive protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007046955.1| Chitin-inducible gibberellin-responsive protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007046956.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91111.1| Chitin-inducible gibberellin-responsive protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX91112.1| Chitin-inducible gibberellin-responsive protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX91113.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
Length=608

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 329/397 (83%), Gaps = 7/397 (2%)
 Frame = +3

Query  6     TPQRNDVVaegsspeslsskp-llkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTE  182
             TP  NDVV   S+     S P LLKAL+DCARLA S+PE A+KSLIR+R+S+S+ GDPTE
Sbjct  218   TPSINDVVGVSSASPEAESAPPLLKALLDCARLAESEPERAIKSLIRLRESISECGDPTE  277

Query  183   RVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEA  362
             RVA+YF+EALY+R+S   EKR    D +SEE TLSYKALNDACPYSKFAHLTANQAILEA
Sbjct  278   RVAFYFTEALYSRVSRQAEKRLTILDTTSEEFTLSYKALNDACPYSKFAHLTANQAILEA  337

Query  363   TEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATG  542
             TE+ASKIHI+DFGIVQG+QWAALLQALATRS GKP  IRISGIP+PVLG SPA+SL ATG
Sbjct  338   TERASKIHIVDFGIVQGVQWAALLQALATRSAGKPTQIRISGIPAPVLGKSPASSLYATG  397

Query  543   NRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGT  722
             NRLRDFAK+LDLNFEFEP+L PI  LN  SFRVD DE+LAVNFMLQLYNLLDE   TV T
Sbjct  398   NRLRDFAKLLDLNFEFEPILTPIEELNELSFRVDQDEVLAVNFMLQLYNLLDEAPVTVET  457

Query  723   ALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVE  902
             AL LA SLNP IVTLGEYE S NRVGF  RFKNAL+YYSA+FESL+PN+ RDSPER++VE
Sbjct  458   ALLLAKSLNPKIVTLGEYEASLNRVGFENRFKNALRYYSAVFESLEPNLPRDSPERIQVE  517

Query  903   SLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKI  1082
              LLLGRRIA ++ PEE   + E       +EDK+ W+ L+ESAGF+ VA+SHYA SQA+I
Sbjct  518   RLLLGRRIAGVIGPEEVEKRRE------RMEDKEQWKNLLESAGFETVALSHYARSQARI  571

Query  1083  LLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             LLWNYNYSSSYSLI+S PGFLSLAWN+ PLLTVSSW 
Sbjct  572   LLWNYNYSSSYSLIESQPGFLSLAWNEVPLLTVSSWR  608



>emb|CDP02028.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 308/370 (83%), Gaps = 5/370 (1%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++ ARLA S P+NAVKSLIR+R+SVSQ GDPTERVA+YF EALY R+S  PEK P  FD 
Sbjct  266   IESARLAGSDPDNAVKSLIRLRESVSQHGDPTERVAFYFLEALYGRVSRQPEKSPTIFDT  325

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             + EELTL YKALNDACPYSKFAHLTANQAILEATE  +KIHIIDFGI+QG+QWAALLQAL
Sbjct  326   TPEELTLCYKALNDACPYSKFAHLTANQAILEATENGTKIHIIDFGILQGVQWAALLQAL  385

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATR  GKP+ IRISGIP+P+LG SP A+LLATG RL DFA++LDLNFEFEPVL PI  L 
Sbjct  386   ATRPAGKPERIRISGIPAPLLGKSPEAALLATGKRLSDFAELLDLNFEFEPVLTPIEELT  445

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
             G+SF+VDPDEILAVNFMLQLYNLLD+       ALKLA SL+PS+VTLGEYE+S NRVGF
Sbjct  446   GASFQVDPDEILAVNFMLQLYNLLDDDNCGAEAALKLAKSLSPSVVTLGEYEVSLNRVGF  505

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFKNALKYYSA+FESLDPN+TRDS ER++VESLL GRRIA ++ PEE     E     
Sbjct  506   LARFKNALKYYSALFESLDPNLTRDSDERLRVESLLFGRRIAGVVGPEE-----ETGTRR  560

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK+ WRILMESAGF+ V +SHYA SQA ILLW+YNYS SY L+DSPPGFLSLAWND
Sbjct  561   DRMEDKEQWRILMESAGFEPVTLSHYAMSQAGILLWSYNYSQSYKLVDSPPGFLSLAWND  620

Query  1164  EPLLTVSSWH  1193
              PLLTVSSW 
Sbjct  621   LPLLTVSSWR  630



>ref|XP_002521601.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
 gb|EEF40872.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
Length=608

 Score =   530 bits (1364),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 274/371 (74%), Positives = 314/371 (85%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CARLA S+PE AVKSLI++R+SV + GDPTERVA+YF+EALY+RL    EK  A F+ 
Sbjct  244   LECARLAESEPERAVKSLIKLRESVCEHGDPTERVAFYFTEALYSRLCLQAEKSLAMFET  303

Query  264   SSEE-LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
             SSEE  TLSYKALNDACPYSKFAHLTANQAILEATE ASKIHI+DFGIVQG+QWAALLQA
Sbjct  304   SSEEDFTLSYKALNDACPYSKFAHLTANQAILEATEGASKIHIVDFGIVQGVQWAALLQA  363

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATRS G+P SIRISGIP+PVLG SPAASLLATGNRL DFAK+LDLNFEF P+L PI  L
Sbjct  364   LATRSAGRPLSIRISGIPAPVLGKSPAASLLATGNRLGDFAKLLDLNFEFVPILTPIQEL  423

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             N S+FRVDPDE+LAVNFMLQLYNLLDET   V TALK+A SLNP IVTLGEYE S N++G
Sbjct  424   NESNFRVDPDEVLAVNFMLQLYNLLDETYGAVETALKMAKSLNPEIVTLGEYEASLNQIG  483

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             +  RFKNAL+YYSA+FESL+PN++RDS ER++VE LLLGRRIA  + PEE   + E    
Sbjct  484   YENRFKNALRYYSAVFESLEPNLSRDSTERLQVERLLLGRRIAGAVGPEEAGTRRE----  539

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+ WRILMES GF++VA+SHYA SQAKILLWNYNYSS YSL++S PGFLSLAWN
Sbjct  540   --RIEDKEQWRILMESCGFESVALSHYAMSQAKILLWNYNYSSLYSLVESQPGFLSLAWN  597

Query  1161  DEPLLTVSSWH  1193
             + PLLTVSSW 
Sbjct  598   EVPLLTVSSWR  608



>ref|XP_002267140.1| PREDICTED: scarecrow-like protein 4 [Vitis vinifera]
Length=616

 Score =   527 bits (1358),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 311/369 (84%), Gaps = 6/369 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARLA S+P+ AVKSLIR+R+SVS+ GDPTERVA+YFSEALY+R+S+  EKRP  F+ 
Sbjct  253   LDCARLADSEPDRAVKSLIRLRESVSEHGDPTERVAFYFSEALYSRVSHQAEKRPTLFET  312

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             SSEE TLSYKALNDACPYSKFAHLTANQAILEATE+A KIHI+DFGIVQG+QWAALLQAL
Sbjct  313   SSEEFTLSYKALNDACPYSKFAHLTANQAILEATERARKIHIVDFGIVQGVQWAALLQAL  372

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P LG SPA+SL ATGNRLRDFA++LDLNFEFEP+L PI  LN
Sbjct  373   ATRSAGKPARIRISGIPAPALGKSPASSLFATGNRLRDFARLLDLNFEFEPILTPIQELN  432

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              S+FRVDPDE+LAVNFMLQLYNLLDET  +V  AL+LA SLNP I+TLGEYE   N V F
Sbjct  433   ESTFRVDPDEVLAVNFMLQLYNLLDETPVSVNAALRLAKSLNPKIMTLGEYEACLNEVDF  492

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             + RFKNAL+YY AIF+SL+PN+ RDS +R++VE LLLGRRIA ++ PEE   + E     
Sbjct  493   INRFKNALRYYRAIFDSLEPNLARDSSDRLQVERLLLGRRIAGVIGPEEPGTRRE-----  547

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK+ W+ L+ES GF++V +SHYA SQAKILLWNYNYSS Y++I+S PGFLSLAWN 
Sbjct  548   -RMEDKEKWKFLVESCGFESVPLSHYAVSQAKILLWNYNYSSLYAIIESAPGFLSLAWNK  606

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  607   VPLLTVSSW  615



>gb|KDP34745.1| hypothetical protein JCGZ_11271 [Jatropha curcas]
Length=604

 Score =   522 bits (1344),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 266/370 (72%), Positives = 311/370 (84%), Gaps = 6/370 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CA+LA S+PE AVKSLI+IR+SVS+ GDPTERVA+YF+EALY+R+S   EK    F+ 
Sbjct  241   LECAQLAESEPEKAVKSLIKIRESVSEHGDPTERVAFYFTEALYSRVSLQAEKSLTMFET  300

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             + E+ TLSYKALNDACPYSKFAHLTANQAILEAT+ ASKIHI+DFGIVQG+QWAALLQAL
Sbjct  301   TCEDFTLSYKALNDACPYSKFAHLTANQAILEATDGASKIHIVDFGIVQGVQWAALLQAL  360

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+PV+G SP ASLLATGNRLRDF+K+LDLNFEFEP+L PI  L+
Sbjct  361   ATRSTGKPARIRISGIPAPVVGKSPGASLLATGNRLRDFSKLLDLNFEFEPILTPIQELD  420

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSF VDPDE+LAVNFMLQLYNLLDET   V TAL++A SLNP IVTLGEYE S N++G+
Sbjct  421   ESSFGVDPDEVLAVNFMLQLYNLLDETPVAVETALRMAKSLNPKIVTLGEYEASLNQIGY  480

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFKNAL+YYSA+FESL+PN+ RDS ER++VE LLLGRRIA ++ PEE   + E     
Sbjct  481   LDRFKNALRYYSAVFESLEPNLNRDSTERLQVERLLLGRRIAGVIGPEEAGTRRE-----  535

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK+ W+ILME  GF++VA+SHYA SQAKILLWNYNYSS YSLI+S PGFL LAWN 
Sbjct  536   -RMEDKEQWKILMERCGFESVALSHYAMSQAKILLWNYNYSSLYSLIESQPGFLCLAWNH  594

Query  1164  EPLLTVSSWH  1193
              PLLTVSSW 
Sbjct  595   VPLLTVSSWR  604



>ref|XP_007204097.1| hypothetical protein PRUPE_ppa003124mg [Prunus persica]
 gb|EMJ05296.1| hypothetical protein PRUPE_ppa003124mg [Prunus persica]
Length=601

 Score =   513 bits (1322),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 264/373 (71%), Positives = 305/373 (82%), Gaps = 11/373 (3%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSN-SPEKRPA---  251
             +DCARLA S P+ AVKSLIR+R+SVS  GDPTERV +YF+EAL +R+S+   EK  A   
Sbjct  235   LDCARLAESDPDRAVKSLIRLRESVSDRGDPTERVGFYFTEALQSRVSSLQSEKSLAATT  294

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
              +D + E+ TLSYKALNDACPYSKFAHLTANQAILEATE+A+KIHI+DFGIVQG+QWAAL
Sbjct  295   TYDTACEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKIHIVDFGIVQGVQWAAL  354

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALATRS GKP  IRISGIP+P LG SPAASL ATGNRLRDFAK+L+LNFEFEP+L P+
Sbjct  355   LQALATRSTGKPSRIRISGIPAPSLGTSPAASLFATGNRLRDFAKLLELNFEFEPILTPV  414

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPN  791
             H L+ S FRV+PDE LAVN MLQLYNLLDET   V +ALKLA SLNP IVTLGEYE + +
Sbjct  415   HELDESCFRVEPDEALAVNLMLQLYNLLDETPTAVQSALKLAKSLNPKIVTLGEYEANLS  474

Query  792   RVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTEC  971
             RVGF  RFKNALKYY+A+FESL+PNMTRDSPER+KVE LLLGRRI  ++ PE+   K E 
Sbjct  475   RVGFTSRFKNALKYYTALFESLEPNMTRDSPERLKVEKLLLGRRIGGVVGPEQPGTKRE-  533

Query  972   veveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSL  1151
                    EDK+ W+ LMES+GF+ VA+SHYA SQAKILLW    +S YSLI+SPPGFLSL
Sbjct  534   -----RFEDKEQWKYLMESSGFEPVALSHYAVSQAKILLW-NYNNSLYSLIESPPGFLSL  587

Query  1152  AWNDEPLLTVSSW  1190
             AWN+ PL TVSSW
Sbjct  588   AWNEVPLFTVSSW  600



>ref|XP_004287903.1| PREDICTED: scarecrow-like protein 4-like [Fragaria vesca subsp. 
vesca]
Length=619

 Score =   514 bits (1323),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 262/371 (71%), Positives = 304/371 (82%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCAR+  S+PE A+KSL+R+R+SVS+ GDPTERV + F+EALY+R+S  P+K  A +D 
Sbjct  255   LDCARVIESEPERAIKSLVRLRESVSERGDPTERVTFRFTEALYSRVSPPPDKTSAAYDG  314

Query  264   SSEE-LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
             S EE  TLSYKALNDACPYSKFAHLTANQAILEATE+A+KIHI+DFGIVQG+QWAALLQA
Sbjct  315   SCEEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKIHIVDFGIVQGVQWAALLQA  374

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATRS GKP  IRISGIP+P LGNSPAASL ATGNRL +FAK+L+LNFEFEPVL PI  L
Sbjct  375   LATRSTGKPSKIRISGIPAPSLGNSPAASLFATGNRLCEFAKLLELNFEFEPVLTPIQEL  434

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             N S FRVDPDE LAVN MLQL+NLLDE+T  V  AL LA  LNP IVTLGEYE   NRVG
Sbjct  435   NESCFRVDPDEFLAVNLMLQLHNLLDESTTGVEAALTLAKLLNPKIVTLGEYEAKLNRVG  494

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+ RFK ALKYY A+FESL+PNM RDSPER++VE LLLGRRIA ++  EE   K +    
Sbjct  495   FMSRFKTALKYYKAMFESLEPNMARDSPERLQVERLLLGRRIASVVGAEESGTKRQ----  550

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+ W+ LMESAGF+ V +SHYA SQAKILLWNY+Y++SYSLI+SPPGFLSLAW 
Sbjct  551   --RLEDKEQWKFLMESAGFEPVTLSHYAVSQAKILLWNYSYNASYSLIESPPGFLSLAWK  608

Query  1161  DEPLLTVSSWH  1193
             + PL TVSSW 
Sbjct  609   EVPLFTVSSWR  619



>gb|ADL36819.1| SCL domain class transcription factor [Malus domestica]
Length=485

 Score =   508 bits (1309),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 262/371 (71%), Positives = 304/371 (82%), Gaps = 8/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPANF  257
             +DCARLA S P+ AVKSL+R+R+S+S  GDPT+RVA+YF+EAL NR+S   S +      
Sbjct  120   LDCARLAESDPDGAVKSLVRLRESISDHGDPTQRVAFYFAEALQNRVSFLQSEKSFTTAH  179

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             D   E+ TLSYKALNDACPYSKFAHLTANQAILEATE+A+K+HI+DFGIVQG+QWAALLQ
Sbjct  180   DTPCEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKLHIVDFGIVQGVQWAALLQ  239

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALATRS GKP SIRISGIP+P LG+SPAASL+ATGNRLR+FAK+L+LNFEFEP+L P+H 
Sbjct  240   ALATRSTGKPVSIRISGIPAPSLGDSPAASLIATGNRLREFAKLLELNFEFEPILTPVHQ  299

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+ S  RVDPDE LAVN +LQLYNLLDE    V +ALKLA SLNP IVTLGEYE + NRV
Sbjct  300   LDESCVRVDPDEALAVNLVLQLYNLLDEKPTAVQSALKLAKSLNPQIVTLGEYEANLNRV  359

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
             GF  RFKNALKYYSA+FESL+PNM RDSPER+KVE LLLGRRI  L+ PE+   K E   
Sbjct  360   GFASRFKNALKYYSALFESLEPNMIRDSPERLKVERLLLGRRIGSLVGPEQPGTKRE---  416

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                  EDK+ W+ LME AGF+ VA+SHY+ SQAKILLWNYNYSS YSL +SPPGFLSL+W
Sbjct  417   ---RFEDKEQWKYLMECAGFEPVALSHYSVSQAKILLWNYNYSSLYSLRESPPGFLSLSW  473

Query  1158  NDEPLLTVSSW  1190
             N+ PL TVSSW
Sbjct  474   NEVPLFTVSSW  484



>gb|KHG05100.1| Scarecrow-like protein 4 [Gossypium arboreum]
Length=614

 Score =   511 bits (1317),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 262/369 (71%), Positives = 308/369 (83%), Gaps = 6/369 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARL+ S+PE A+KSL+ +R+SVS+ GDPTERVA+YF++ALY+++S   EKR    + 
Sbjct  251   LDCARLSDSEPERAIKSLVELRESVSERGDPTERVAFYFTQALYSKVSLPAEKRLNLLET  310

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +SE+ TLSYK LNDACPYSKFAHLTANQAILEATE+A+KIHI+DFGIVQG+QWAALLQAL
Sbjct  311   TSEDFTLSYKVLNDACPYSKFAHLTANQAILEATERATKIHIVDFGIVQGVQWAALLQAL  370

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+PVLG+SPA SL ATGNRLRDFAK+LDLNFEFEP+L PI  L 
Sbjct  371   ATRSAGKPTRIRISGIPAPVLGSSPAPSLYATGNRLRDFAKLLDLNFEFEPILTPIKELK  430

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              S FRVD DE+LAVNFMLQLYNLLD T  TV  AL+LA SLNP IVTLGEYE S NRVGF
Sbjct  431   ESCFRVDDDEVLAVNFMLQLYNLLDATPVTVEAALRLAKSLNPKIVTLGEYEASLNRVGF  490

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             + RFKNAL+YYSA+FESL+PN+ RDSPERV+VE  LLG +I  ++  EE   + E     
Sbjct  491   VNRFKNALRYYSAVFESLEPNLPRDSPERVEVERQLLGGKIGAIIGAEEAEKRRE-----  545

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK+ W++LMESAGF+ V++SHYA SQAKILLWNYNYSSSYSLI+S PGFLSLAW +
Sbjct  546   -RMEDKEQWKVLMESAGFETVSLSHYAISQAKILLWNYNYSSSYSLIESKPGFLSLAWKE  604

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  605   VPLLTVSSW  613



>ref|XP_008241668.1| PREDICTED: scarecrow-like protein 4 [Prunus mume]
Length=601

 Score =   508 bits (1308),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 262/373 (70%), Positives = 303/373 (81%), Gaps = 11/373 (3%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSN-SPEKRPA---  251
             +DCARLA S P+ AVKSLIR+R+SVS  GDPTERV +YF+EAL +R+S+   EK  A   
Sbjct  235   LDCARLAESDPDRAVKSLIRLRESVSDRGDPTERVGFYFTEALQSRVSSLQSEKSLAATT  294

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
              +D + E+ TLSYKALNDACPYSKFAHLTANQAILEA E+A+KIHI+DFGIVQG+QWAAL
Sbjct  295   TYDTACEDFTLSYKALNDACPYSKFAHLTANQAILEAMERATKIHIVDFGIVQGVQWAAL  354

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALATRS GKP  IRISGIP+P LG SPAASL ATGNRLRDFAK+L+LNFEFEP+L P+
Sbjct  355   LQALATRSTGKPSRIRISGIPAPSLGTSPAASLFATGNRLRDFAKLLELNFEFEPILTPV  414

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPN  791
             H L+ S FRV+ DE LAVN MLQLYNLLDET   V +ALKLA SLNP IVTLGEYE + +
Sbjct  415   HELDESCFRVEQDEALAVNLMLQLYNLLDETPTAVQSALKLAKSLNPKIVTLGEYEANLS  474

Query  792   RVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTEC  971
             RVGF  RFKNALKYY+A+FESL+PNMTRDSPER+KVE LLLGRRI  ++ PE+   K E 
Sbjct  475   RVGFTSRFKNALKYYTALFESLEPNMTRDSPERLKVEKLLLGRRIGGVVGPEQPGTKRE-  533

Query  972   veveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSL  1151
                    EDK+ W+ LMES+GF+ VA+SHYA SQAKILLW    +S YSLI+SPPGFLSL
Sbjct  534   -----RFEDKEQWKYLMESSGFEPVALSHYAVSQAKILLW-NYNNSLYSLIESPPGFLSL  587

Query  1152  AWNDEPLLTVSSW  1190
             AWN+ PL TVSSW
Sbjct  588   AWNEVPLFTVSSW  600



>ref|XP_011025772.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 4 [Populus 
euphratica]
Length=595

 Score =   503 bits (1295),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 255/370 (69%), Positives = 305/370 (82%), Gaps = 6/370 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             V+CA+L  S+ + AVKSL++ +D VS+ G+P ER  +YF+E L  R++        NFD 
Sbjct  232   VECAQLVESKADQAVKSLVKFKDLVSENGNPVERAGFYFAEGLRRRVAVGELDVFKNFDQ  291

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             ++EE TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHI+DFGIV G+QWAALLQAL
Sbjct  292   TTEEFTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIVDFGIVHGVQWAALLQAL  351

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+PVLG +PAASLLATGNRL DFAK+LDLNFEFEP+L PI  LN
Sbjct  352   ATRSAGKPVRIRISGIPAPVLGKNPAASLLATGNRLLDFAKLLDLNFEFEPILTPIQELN  411

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              S FRV+PDE+LAVNFMLQLYNLLDE+   V TALK+A SLNP IVTLGEYE+S NRVG+
Sbjct  412   ESCFRVEPDEVLAVNFMLQLYNLLDESPVAVETALKMAKSLNPKIVTLGEYEVSLNRVGY  471

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFKNAL+YY+A+FESL+PN++RDSPER++VE LLLG+RI+ ++ PEE   + E     
Sbjct  472   LTRFKNALRYYTAVFESLEPNLSRDSPERLQVERLLLGQRISSVVGPEEPGMRRE-----  526

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK  W +LMES+GF++V++SHYA SQAKILLWNYNYS+ YSL DS PGFL+LAWN+
Sbjct  527   -RMEDKVQWGVLMESSGFESVSLSHYAMSQAKILLWNYNYSTLYSLDDSQPGFLTLAWNE  585

Query  1164  EPLLTVSSWH  1193
              PLLTVSSW 
Sbjct  586   VPLLTVSSWR  595



>ref|XP_009350005.1| PREDICTED: scarecrow-like protein 4 [Pyrus x bretschneideri]
Length=604

 Score =   503 bits (1294),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 259/371 (70%), Positives = 304/371 (82%), Gaps = 8/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPANF  257
             ++CAR+A S P+ AVKSL+R+R+SVS  GDPTERVA+YF+EAL NR+S     +     +
Sbjct  239   LECARIAESDPDGAVKSLVRLRESVSDHGDPTERVAFYFAEALQNRVSFLQLEKSFTTAY  298

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             D   E+ TLSYKALNDACPYSKFAHLTANQAILEATE+A+KIHI+DFGIVQG+QWAALLQ
Sbjct  299   DTPCEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKIHIVDFGIVQGVQWAALLQ  358

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALATRS GKP SIRISGIP+P LG+SPAASL+ATGNRLR+FAK+L+LNFEFEP+L P+H 
Sbjct  359   ALATRSTGKPVSIRISGIPAPSLGDSPAASLIATGNRLREFAKLLELNFEFEPILTPVHQ  418

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+ S  RVDPDE LAVN +LQLYNLLDE    V +ALKLA SLNP +VTLGEYE + NRV
Sbjct  419   LDESCVRVDPDEALAVNLVLQLYNLLDEKPTAVQSALKLAKSLNPQVVTLGEYEANLNRV  478

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
             GF  RFKNALKYY+A+FESL+PNM RDSPER+KVE LLLGRRI  L+ PE+   K E   
Sbjct  479   GFASRFKNALKYYAALFESLEPNMIRDSPERLKVERLLLGRRIGSLVGPEQPGTKRE---  535

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                  EDK+ W+ LME +GF+ VA+SHY+ SQAKILLWNYNYSS YSL +SPPGFLSL+W
Sbjct  536   ---RFEDKEQWKYLMECSGFEPVALSHYSVSQAKILLWNYNYSSLYSLRESPPGFLSLSW  592

Query  1158  NDEPLLTVSSW  1190
             N+ PL TVSSW
Sbjct  593   NEVPLFTVSSW  603



>ref|XP_006383208.1| scarecrow-like transcription factor 7 family protein [Populus 
trichocarpa]
 gb|ERP61005.1| scarecrow-like transcription factor 7 family protein [Populus 
trichocarpa]
Length=589

 Score =   502 bits (1292),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 317/395 (80%), Gaps = 11/395 (3%)
 Frame = +3

Query  15    RNDVVaegsspeslsskpllkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAY  194
             +N+VV        LSS P+LKALV+CA+L  S+ + AVKSLIR ++SVS+ GDP ERV +
Sbjct  204   KNEVVVGSKEIVELSSSPVLKALVECAQLVESKADQAVKSLIRFKESVSENGDPGERVGF  263

Query  195   YFSEALYNRLSNSPEKRPANF-DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEK  371
             YF + L  R++        NF   +SEE TL YKALNDACPYSKFAHLTANQAILEATEK
Sbjct  264   YFVKGLCRRVAVGELDDLKNFHQTTSEEFTLCYKALNDACPYSKFAHLTANQAILEATEK  323

Query  372   ASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRL  551
             ASKIHI+DFGIVQGIQWAALLQALATRS GKP  IRISGIP+PVLG +PAASLLATGNRL
Sbjct  324   ASKIHIVDFGIVQGIQWAALLQALATRSAGKPVRIRISGIPAPVLGKNPAASLLATGNRL  383

Query  552   RDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALK  731
              DFAK+LDLNFEFEP+L PI  LN S FRV+PDE+LAVNFMLQLYNLL ET   V TALK
Sbjct  384   LDFAKLLDLNFEFEPILTPIQELNESCFRVEPDEVLAVNFMLQLYNLLGETPGAVETALK  443

Query  732   LANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLL  911
             +A SLNP IVTLGEYE+S NRVG+L RFKNAL+YY+A+FESLDPNM+RDS ER++VE LL
Sbjct  444   MAKSLNPRIVTLGEYEVSLNRVGYLTRFKNALRYYTAVFESLDPNMSRDSQERLQVERLL  503

Query  912   LGRRIAELMRPEE-QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL  1088
             LGRRI+ ++ P+  +R + E         DK+ WR+LMES+GF++V++SHYA SQAKILL
Sbjct  504   LGRRISGVVGPDGIRRERME---------DKEQWRVLMESSGFESVSLSHYAMSQAKILL  554

Query  1089  WnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             WNYN S+ YSL DS PGFL+LAWN+ PLLTVSSW 
Sbjct  555   WNYNSSTMYSLDDSQPGFLTLAWNEVPLLTVSSWR  589



>ref|XP_002310226.2| hypothetical protein POPTR_0007s12760g [Populus trichocarpa]
 gb|EEE90676.2| hypothetical protein POPTR_0007s12760g [Populus trichocarpa]
Length=594

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/370 (68%), Positives = 300/370 (81%), Gaps = 6/370 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             V+CA+L  S+ + AVKSL++ +D VS+ GDP ER  +YF+E L  R++        NFD 
Sbjct  231   VECAQLVESKADQAVKSLVKCKDLVSENGDPVERAGFYFAEGLCRRVAVGELDVLKNFDQ  290

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +SEE TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHI+DFGIV G+QWAALLQAL
Sbjct  291   TSEEFTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIVDFGIVHGVQWAALLQAL  350

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+PVLG +PAASLLATGNRL D+AK+L LNFEFEP+L PI  LN
Sbjct  351   ATRSAGKPVRIRISGIPAPVLGKNPAASLLATGNRLLDYAKLLGLNFEFEPILTPIQELN  410

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              S FR +PDE+LAVNFMLQLYNLLDE+   V TALK+A SLNP IVTLGEYE S NRVG+
Sbjct  411   ESCFRAEPDEVLAVNFMLQLYNLLDESPVAVETALKMAKSLNPIIVTLGEYEASLNRVGY  470

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFKNAL+YY+A+FESL+PN++RDSPER++VE LLLG+RI+ ++ PEE   + E     
Sbjct  471   LTRFKNALRYYTAVFESLEPNLSRDSPERLQVERLLLGQRISSVVGPEEPGMRRE-----  525

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDKD W +LMES+GF++V++SHYA SQAKILLW  NYS  YSL DS PGFL+LAWN+
Sbjct  526   -RMEDKDQWGVLMESSGFESVSLSHYAMSQAKILLWYCNYSDLYSLDDSQPGFLTLAWNE  584

Query  1164  EPLLTVSSWH  1193
              PLLTVSSW 
Sbjct  585   VPLLTVSSWR  594



>ref|XP_011015972.1| PREDICTED: scarecrow-like protein 4 [Populus euphratica]
Length=588

 Score =   500 bits (1288),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 269/395 (68%), Positives = 319/395 (81%), Gaps = 11/395 (3%)
 Frame = +3

Query  15    RNDVVaegsspeslsskpllkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAY  194
             +N+VV        LSS P+LKALV+CA+L  S+ + AVKSLI++++SVS+ GDP ERV +
Sbjct  203   KNEVVVGSKEVVELSSSPVLKALVECAQLVESKVDQAVKSLIKLKESVSENGDPGERVGF  262

Query  195   YFSEALYNRLSNSPEKRPANF-DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEK  371
             YF + L  R++        NF   +SEE TLSYKALNDACPYSKFAHLTANQAILEATEK
Sbjct  263   YFVQGLCRRVAVGELDDLKNFHQTTSEEFTLSYKALNDACPYSKFAHLTANQAILEATEK  322

Query  372   ASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRL  551
             ASKIHI+DFGIV G+QWAALLQALATRS GKP  IRISGIP+PVLG +PAASLLATGNRL
Sbjct  323   ASKIHIVDFGIVHGVQWAALLQALATRSAGKPVRIRISGIPAPVLGKNPAASLLATGNRL  382

Query  552   RDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALK  731
              DFAK+LDLNFEFEP+L PI  LN S FRV+PDE+LAVNFMLQLYNLL ET   V TALK
Sbjct  383   LDFAKLLDLNFEFEPILTPIQELNESCFRVEPDEVLAVNFMLQLYNLLGETPGAVETALK  442

Query  732   LANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLL  911
             +A SLNP IVTLGEYE+S NRVG+L RFKNAL+YY+A+FESLDPNM+RDS ER++VE LL
Sbjct  443   MAKSLNPRIVTLGEYEVSLNRVGYLTRFKNALRYYTAVFESLDPNMSRDSQERLQVERLL  502

Query  912   LGRRIAELMRPEE-QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL  1088
             LGRRI+ ++ P+  +R + E         DK+ WR+LMES+GF++V++SHYA SQAKILL
Sbjct  503   LGRRISGVLGPDGIRRERME---------DKEQWRVLMESSGFESVSLSHYAMSQAKILL  553

Query  1089  WnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             WNYNYS+ YSL DS PGFL+LAWN+ PLLTVSSW 
Sbjct  554   WNYNYSTLYSLDDSQPGFLTLAWNEVPLLTVSSWR  588



>ref|XP_009371590.1| PREDICTED: scarecrow-like protein 4 [Pyrus x bretschneideri]
 ref|XP_009371591.1| PREDICTED: scarecrow-like protein 4 [Pyrus x bretschneideri]
Length=603

 Score =   501 bits (1289),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 259/371 (70%), Positives = 305/371 (82%), Gaps = 8/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPANF  257
             +DCARL  S  + AVKSLIR+R+S+S  GDPTERVA+YF+EAL++R+S   S +     +
Sbjct  238   LDCARLTESDTDRAVKSLIRLRESISDHGDPTERVAFYFAEALHSRVSVLQSEKNFTTAY  297

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             D   E+ TLSYKALNDACPYSKFAHLTANQAILEATE+A+KIHI+DFGIVQG+QWAALLQ
Sbjct  298   DTPCEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKIHIVDFGIVQGVQWAALLQ  357

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALATRS GKP SIRISGIP+P LG+SPAASL ATGNRLR+FAK+L+LNFEFEP+L P++ 
Sbjct  358   ALATRSTGKPVSIRISGIPAPSLGDSPAASLFATGNRLREFAKLLELNFEFEPILTPVNE  417

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+ S FR +PDE LA+NFMLQLYNLLDE    V +ALKLA SLNP IVTLGEYE + NRV
Sbjct  418   LDESCFRFEPDEALAMNFMLQLYNLLDEKPTAVHSALKLAKSLNPQIVTLGEYEANLNRV  477

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
              F  RFKNALKYY+A+FESL+PNMTRDSPER+KVE LLLGRRI  L+ PE+   K E   
Sbjct  478   EFASRFKNALKYYTALFESLEPNMTRDSPERLKVERLLLGRRIGGLVGPEQSGTKRE---  534

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                  EDK+ W+ LMES+GF+ VA+SHY+ SQAKILLWNYNYSS YSL +SPPGFLSL+W
Sbjct  535   ---RFEDKEQWKYLMESSGFEPVALSHYSVSQAKILLWNYNYSSLYSLKESPPGFLSLSW  591

Query  1158  NDEPLLTVSSW  1190
             ++ PL TVSSW
Sbjct  592   SEVPLFTVSSW  602



>ref|XP_010254864.1| PREDICTED: scarecrow-like protein 4 [Nelumbo nucifera]
Length=611

 Score =   501 bits (1290),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 257/369 (70%), Positives = 302/369 (82%), Gaps = 6/369 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARLA   PE AVK LIR+R+SVS+ GDPTERV +YF+EALY+R+S    +    F+ 
Sbjct  248   LDCARLADFAPERAVKPLIRLRESVSERGDPTERVVFYFAEALYSRVSTKTARTAPTFET  307

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             SSE+ TL YKALNDACPYSKFAHLTANQAILEATE A++IHI+DFGIV+G+QWAALLQAL
Sbjct  308   SSEDFTLPYKALNDACPYSKFAHLTANQAILEATETANRIHIVDFGIVKGVQWAALLQAL  367

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IR+SGIP+P LG SPA SL ATGNRLRDFAK+LDLNFEFEP+L PI  LN
Sbjct  368   ATRSTGKPSRIRLSGIPAPALGGSPAESLSATGNRLRDFAKLLDLNFEFEPILTPIQELN  427

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSFR+  DE+LAVNFMLQLYNLLDETT  V  AL+LA SL P +VTLGEYE   NRV F
Sbjct  428   ESSFRIVTDEVLAVNFMLQLYNLLDETTVAVERALRLAKSLKPKVVTLGEYEAGLNRVDF  487

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFK AL+YYSA+FESL+P++TRDS ER+++ESLLLG RI+ ++  EE   + E     
Sbjct  488   LNRFKTALRYYSAVFESLEPSLTRDSTERLRIESLLLGSRISGVVGREEGPMRRE-----  542

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +E+K+ WR+LME  GF++VA+SHYA SQAKILLWNYNYSSSYSL++SPPGFLSLAWN 
Sbjct  543   -RMEEKEQWRVLMEGCGFESVALSHYAMSQAKILLWNYNYSSSYSLVESPPGFLSLAWNS  601

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  602   VPLLTVSSW  610



>ref|XP_010113493.1| hypothetical protein L484_026828 [Morus notabilis]
 gb|EXC35520.1| hypothetical protein L484_026828 [Morus notabilis]
Length=615

 Score =   501 bits (1289),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 259/371 (70%), Positives = 306/371 (82%), Gaps = 7/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP-ANFD  260
             +DCARL  S+P+ AVK LIR+ +SVS+ GDP ERV ++F+EALYNR+S   EK+  A +D
Sbjct  251   IDCARLTESEPDRAVKQLIRLSESVSEQGDPIERVTFHFTEALYNRVSLQSEKKSLAVYD  310

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
               SE+ TL YKALNDACPYSKFAHLTANQAILEATE+ASKIHI+DFGIVQGIQWAALLQA
Sbjct  311   GVSEDFTLPYKALNDACPYSKFAHLTANQAILEATERASKIHIVDFGIVQGIQWAALLQA  370

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATR  GKP+ IRISGIP+  LG SPAASL ATGNRL +FAK+L+LNFEFEPVL PI  L
Sbjct  371   LATRPTGKPNKIRISGIPALALGRSPAASLFATGNRLCEFAKLLELNFEFEPVLIPIGEL  430

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             N SSFRV+ DE+LAVNFMLQLYNLLDET   V TAL+LA SLNP I+TLGEYE S N +G
Sbjct  431   NESSFRVEEDEVLAVNFMLQLYNLLDETPIAVQTALRLAKSLNPKIITLGEYEASLNELG  490

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+KRFKNAL+YY+A+FESL+PN++RDSPER++VE LL GRRI+ ++ PEE   K E    
Sbjct  491   FMKRFKNALRYYTAVFESLEPNLSRDSPERLQVERLLFGRRISGVVGPEEPGIKRE----  546

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +E ++ W+ILME++ F+ V +SHYA SQAKILLWNYNYSS YSL++S PGFLSLAWN
Sbjct  547   --RMEGRERWKILMENSDFQPVGLSHYAVSQAKILLWNYNYSSLYSLVESAPGFLSLAWN  604

Query  1161  DEPLLTVSSWH  1193
             D PLLTVSSW 
Sbjct  605   DVPLLTVSSWR  615



>gb|EYU40156.1| hypothetical protein MIMGU_mgv1a018392mg [Erythranthe guttata]
Length=563

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 287/350 (82%), Gaps = 10/350 (3%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARL+ S PENA+ SLI+++DSVS++GDP ERV+YYFSEAL +R+S   EK    +D 
Sbjct  223   IDCARLSESDPENAMASLIQLQDSVSRVGDPVERVSYYFSEALCSRVSTRAEKTSTIYDT  282

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +SEE TLSYKALNDACPYSKFAHLTANQAILEATEKA+KIHI+DFGIVQGIQWAA LQAL
Sbjct  283   TSEEFTLSYKALNDACPYSKFAHLTANQAILEATEKANKIHIVDFGIVQGIQWAAFLQAL  342

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATR  GKPD IRISGIP+P LGNSPAASL ATGNRLRDFAK+LDL FEF+P+L P+H L 
Sbjct  343   ATRPSGKPDRIRISGIPAPSLGNSPAASLFATGNRLRDFAKLLDLRFEFDPILTPVHELE  402

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
             GSSFRVDPDE+LAVNFMLQLYNLLDE+   V  ALKLA SLNP +VTLGEYE+S NRVGF
Sbjct  403   GSSFRVDPDEVLAVNFMLQLYNLLDESNDGVEDALKLAKSLNPCVVTLGEYEVSLNRVGF  462

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE-QRAKTECvev  980
             L RFKN LKYY+AIFESL+P + RDSPER++ E LLLGRRIA ++ PEE +R + E    
Sbjct  463   LHRFKNGLKYYTAIFESLEPGLARDSPERLQAERLLLGRRIAGVVGPEERKRERME----  518

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
                  DK+ WR LME AGF+ +  SHYA SQAKILLWNY  SS Y L+DS
Sbjct  519   -----DKERWRFLMEGAGFQPLVFSHYAQSQAKILLWNYTNSSFYKLLDS  563



>gb|AHZ13509.1| GRAS/SCL transcription factor [Populus euphratica]
Length=588

 Score =   498 bits (1283),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 268/395 (68%), Positives = 318/395 (81%), Gaps = 11/395 (3%)
 Frame = +3

Query  15    RNDVVaegsspeslsskpllkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAY  194
             +N+VV        LSS P+LKA V+CA+L  S+ + AVKSLI++++SVS+ GDP ERV +
Sbjct  203   KNEVVVGSKEVVELSSSPVLKAFVECAQLVESKVDQAVKSLIKLKESVSENGDPGERVGF  262

Query  195   YFSEALYNRLSNSPEKRPANF-DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEK  371
             YF + L  R++        NF   +SEE TLSYKALNDACPYSKFAHLTANQAILEATEK
Sbjct  263   YFVQGLCRRVAVGELDDLKNFHQTTSEEFTLSYKALNDACPYSKFAHLTANQAILEATEK  322

Query  372   ASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRL  551
             ASKIHI+DFGIVQGIQWAALLQALATRS GKP  IRISGIP+PVLG +PAASLLATGNRL
Sbjct  323   ASKIHIVDFGIVQGIQWAALLQALATRSAGKPVRIRISGIPAPVLGKNPAASLLATGNRL  382

Query  552   RDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALK  731
              DFAK+LDLNFEFEP+L PI  LN S FRV+PDE+LAVNFMLQLYNLL ET   V TALK
Sbjct  383   LDFAKLLDLNFEFEPILTPIQELNESCFRVEPDEVLAVNFMLQLYNLLGETPGAVETALK  442

Query  732   LANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLL  911
             +A SLNP IVTLGEYE+S NRVG+L RFKNAL+YY+A+FESLDPNM+RDS ER++VE LL
Sbjct  443   MAKSLNPRIVTLGEYEVSLNRVGYLTRFKNALRYYTAVFESLDPNMSRDSQERLQVERLL  502

Query  912   LGRRIAELMRPEE-QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL  1088
             LGRRI+ ++ P+  +R + E         +K+ WR+LMES+GF++V++SHYA SQAKILL
Sbjct  503   LGRRISGVLGPDGIRRERME---------NKEQWRVLMESSGFESVSLSHYAMSQAKILL  553

Query  1089  WnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             WNYNYS+ YSL DS P FL+LAWN+ PLLTVSSW 
Sbjct  554   WNYNYSTLYSLDDSQPAFLTLAWNEVPLLTVSSWR  588



>ref|XP_008338096.1| PREDICTED: scarecrow-like protein 4 [Malus domestica]
 ref|XP_008338097.1| PREDICTED: scarecrow-like protein 4 [Malus domestica]
Length=602

 Score =   498 bits (1283),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 258/371 (70%), Positives = 306/371 (82%), Gaps = 8/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPANF  257
             +DCARL  S  + AVKSLIR+R+S+S  GDPTERVA+YF+EAL+NR+S   S +     +
Sbjct  237   LDCARLTESDTDRAVKSLIRLRESISDHGDPTERVAFYFAEALHNRVSVLQSEKTFTTAY  296

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             D   E+ TLSYKALNDACPYSKFAHLTANQAILEATE+A+KIHI+DFGIVQG+QWAALLQ
Sbjct  297   DTPCEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKIHIVDFGIVQGVQWAALLQ  356

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALATRS GKP SIRISGIP+P LG+SPAASL ATGNRLR+FAK+L+LNFEFEP+L  ++ 
Sbjct  357   ALATRSTGKPVSIRISGIPAPSLGDSPAASLFATGNRLREFAKLLELNFEFEPILTSVNE  416

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+ S FR +P+E LAVNFMLQLYNLLD+  A V +ALKLA SLNP IVTLGEYE + NRV
Sbjct  417   LDESCFRFEPEEALAVNFMLQLYNLLDDKPAAVHSALKLAKSLNPQIVTLGEYEANLNRV  476

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
              F  RFKNALKYY+A+FESL+PN+TRDSPER+KVE LLLGRRI  L+ PE+   K E   
Sbjct  477   EFASRFKNALKYYTALFESLEPNLTRDSPERLKVERLLLGRRIGGLVGPEQSGTKRE---  533

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                  EDK+ W+ LMES+GF++VA+SHY+ SQAKILLWNYNYSS YSL +SPPGFLSL+W
Sbjct  534   ---RFEDKEQWKYLMESSGFESVALSHYSVSQAKILLWNYNYSSLYSLKESPPGFLSLSW  590

Query  1158  NDEPLLTVSSW  1190
             ++ PL TVSSW
Sbjct  591   SEVPLFTVSSW  601



>ref|XP_008338470.1| PREDICTED: scarecrow-like protein 4 [Malus domestica]
Length=604

 Score =   493 bits (1270),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 258/371 (70%), Positives = 302/371 (81%), Gaps = 8/371 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPANF  257
             +DCARLA S P+ AVKSL+R+R+S+S  GDPT+RVA+YF+EAL NR+S   S +      
Sbjct  239   LDCARLAESDPDGAVKSLVRLRESISDHGDPTQRVAFYFAEALQNRVSFLQSEKSFTTAH  298

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             D   E+ TLSYKALNDACPYSKFAHLTANQAILEATE+A+K+HI+DFGIVQG+QWAALLQ
Sbjct  299   DTPCEDFTLSYKALNDACPYSKFAHLTANQAILEATERATKLHIVDFGIVQGVQWAALLQ  358

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALATRS GKP SIRISGIP+P LG+SPAASL+ATGNRLR+FA +L+LNFEFEP+L P+H 
Sbjct  359   ALATRSTGKPVSIRISGIPAPSLGDSPAASLIATGNRLREFAXLLELNFEFEPILTPVHQ  418

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+ S  RVDPDE LAVN +LQLYNLLDE    V +ALKLA SLNP IVTLGEYE + NRV
Sbjct  419   LDESCVRVDPDEALAVNLVLQLYNLLDEKPTAVQSALKLAKSLNPQIVTLGEYEANLNRV  478

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
             GF  RFKNALKYY+A+FESL+PNM RDSPER+KVE LLLGRRI  L+ PE+   K E   
Sbjct  479   GFASRFKNALKYYAALFESLEPNMIRDSPERLKVERLLLGRRIGSLVGPEQPGTKRE---  535

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                  EDK+ W+ LME +GF+ VA+S Y+ SQAKILLWNYNYSS YSL +SPPGFLSL+W
Sbjct  536   ---RFEDKEQWKYLMECSGFEPVALSXYSVSQAKILLWNYNYSSLYSLSESPPGFLSLSW  592

Query  1158  NDEPLLTVSSW  1190
             N+ PL TVSSW
Sbjct  593   NEVPLFTVSSW  603



>ref|XP_010484588.1| PREDICTED: scarecrow-like protein 4 isoform X1 [Camelina sativa]
 ref|XP_010484589.1| PREDICTED: scarecrow-like protein 4 isoform X2 [Camelina sativa]
Length=581

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 299/368 (81%), Gaps = 8/368 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR++ S P  A KSL++IR+SVS+LGDPTERV +YF+EAL NRLS  P+       + 
Sbjct  221   DCARISDSDPNEASKSLVQIRESVSELGDPTERVGFYFAEALSNRLS--PDYSTTTSSSE  278

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              E+L +SYK LNDACPYSKFAHLTANQAILEATE ++KIHI+DFGIVQGIQW ALLQALA
Sbjct  279   EEDLIISYKTLNDACPYSKFAHLTANQAILEATEDSNKIHIVDFGIVQGIQWPALLQALA  338

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TRS GKP  IR+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNFEF P+L PIH LNG
Sbjct  339   TRSSGKPTQIRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFEFVPILTPIHLLNG  398

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE LAVNFMLQLY LL+ET   V TAL+LA SLNP +VTLGEYE+S NRVGF 
Sbjct  399   SSFRVDPDEALAVNFMLQLYKLLEETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFA  458

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
             KR KNA+ +YSA+FESL+PN+ RDS ERV+VE +L GRRI+ L+ PE+     E      
Sbjct  459   KRVKNAILFYSAVFESLEPNLGRDSEERVRVERVLFGRRISGLIGPEKTGIHRE------  512

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +E K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYSS YS+++S PGF+SLAWND 
Sbjct  513   RMEQKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSSLYSIVESKPGFVSLAWNDL  572

Query  1167  PLLTVSSW  1190
             PLLT+SSW
Sbjct  573   PLLTISSW  580



>ref|XP_010679714.1| PREDICTED: scarecrow-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=611

 Score =   490 bits (1261),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 253/373 (68%), Positives = 297/373 (80%), Gaps = 14/373 (4%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CARLA S PE AVKS++R+RDSVSQ GDPT+R+A+YF+EAL  RLS  P         
Sbjct  250   LECARLAESDPERAVKSVVRLRDSVSQHGDPTQRLAFYFTEALSCRLS--PPLSSTIETT  307

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +SEE TLSYKALNDACP+SKFAHLTANQAILEATE A KIHI+DFGIVQG+QWAALLQAL
Sbjct  308   ASEECTLSYKALNDACPFSKFAHLTANQAILEATEGAEKIHIVDFGIVQGVQWAALLQAL  367

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATR  GKP  IRISGIP+P LG SP  +L ATGNRLRDFAKVL+LNFEFEP+L P+H L 
Sbjct  368   ATRPTGKPIKIRISGIPAPALGESPTTALFATGNRLRDFAKVLELNFEFEPILTPVHELT  427

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSFRVD +E+LAVNFMLQLYNLLDET   V  ALKLA SLNP IVTLGEYE+  NRVG+
Sbjct  428   QSSFRVDSEEVLAVNFMLQLYNLLDETNVEVEAALKLAKSLNPKIVTLGEYEVGLNRVGY  487

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE---EQRAKTECv  974
             L RFK A+ YYSA+F+SLDPN+ R+S +RV+VE L+ GRRI   + PE    +R + +C 
Sbjct  488   LTRFKTAVNYYSAVFDSLDPNLDRESMDRVQVERLIFGRRIMGCVGPELPGTRRERMQC-  546

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                     K+ W+ +ME+AGF+ V +S+YA+SQAKILLWNYNYSSSY L+DSPPGFLSL+
Sbjct  547   --------KEEWKGMMENAGFEPVTLSNYANSQAKILLWNYNYSSSYKLVDSPPGFLSLS  598

Query  1155  WNDEPLLTVSSWH  1193
             WN  PLLTVSSWH
Sbjct  599   WNGVPLLTVSSWH  611



>ref|XP_006393872.1| hypothetical protein EUTSA_v10003860mg [Eutrema salsugineum]
 dbj|BAJ33698.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31158.1| hypothetical protein EUTSA_v10003860mg [Eutrema salsugineum]
Length=601

 Score =   489 bits (1258),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 250/372 (67%), Positives = 301/372 (81%), Gaps = 15/372 (4%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR+  S+ + A ++L+RIRDSVS+LGDPTER+ +YF+EAL +RLS  P+  P     S
Sbjct  242   DCARILESESDVAAEALVRIRDSVSELGDPTERLGFYFTEALCDRLS--PDSVPKE-SPS  298

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              EE+ LSYK LNDACPYSKFAHLTANQAILEATE ++KIHI+DFGIVQG+QW ALLQALA
Sbjct  299   VEEMILSYKTLNDACPYSKFAHLTANQAILEATENSNKIHIVDFGIVQGLQWPALLQALA  358

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TRS GKP  +R+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNF+F P+L PIHSLNG
Sbjct  359   TRSSGKPIQVRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFDFIPILTPIHSLNG  418

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             S+FRVDPDE+LAVNFMLQLY LLDET   V TAL+LA SLNP +VTLGEYE+S NRV F 
Sbjct  419   STFRVDPDEVLAVNFMLQLYKLLDETPTIVDTALRLARSLNPIVVTLGEYEVSLNRVAFA  478

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE---QRAKTECve  977
              R +NALK+YSA+FESL+PN+ RDS ERV+VE +L GRRI+ L+ PE+   QR + E   
Sbjct  479   NRMRNALKFYSAVFESLEPNLGRDSEERVRVERVLFGRRISGLIGPEKTGNQRERME---  535

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                   +K+ WR+LMESAGF++V +S+YA SQAKILLW YNYS  Y++++S PGF+SLAW
Sbjct  536   ------EKEQWRVLMESAGFESVKLSNYAVSQAKILLWYYNYSDLYTIVESMPGFISLAW  589

Query  1158  NDEPLLTVSSWH  1193
             ND PLLTVSSW 
Sbjct  590   NDLPLLTVSSWR  601



>gb|AAL32616.1| SCARECROW gene regulator [Arabidopsis thaliana]
 gb|AAO00940.1| SCARECROW gene regulator [Arabidopsis thaliana]
Length=573

 Score =   487 bits (1253),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 305/368 (83%), Gaps = 7/368 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR++ S P  A K+L++IR+SVS+LGDPTERVA+YF+EAL NRLS +     ++  +S
Sbjct  212   DCARISDSDPNEASKTLLQIRESVSELGDPTERVAFYFTEALSNRLSPNSPAT-SSSSSS  270

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
             +E+L LSYK LNDACPYSKFAHLTANQAILEATEK++KIHI+DFGIVQGIQW ALLQALA
Sbjct  271   TEDLILSYKTLNDACPYSKFAHLTANQAILEATEKSNKIHIVDFGIVQGIQWPALLQALA  330

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP  IR+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNF+F P+L PIH LNG
Sbjct  331   TRTSGKPTQIRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFDFIPILTPIHLLNG  390

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE+LAVNFMLQLY LLDET   V TAL+LA SLNP +VTLGEYE+S NRVGF 
Sbjct  391   SSFRVDPDEVLAVNFMLQLYKLLDETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFA  450

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNAL++YSA+FESL+PN+ RDS ERV+VE  L GRRI+ L+ PE+     E      
Sbjct  451   NRVKNALQFYSAVFESLEPNLGRDSEERVRVERELFGRRISGLIGPEKTGIHRE------  504

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +E+K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYS+ YS+++S PGF+SLAWND 
Sbjct  505   RMEEKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSNLYSIVESKPGFISLAWNDL  564

Query  1167  PLLTVSSW  1190
             PLLT+SSW
Sbjct  565   PLLTLSSW  572



>ref|XP_010550390.1| PREDICTED: scarecrow-like protein 4 [Tarenaya hassleriana]
Length=605

 Score =   488 bits (1255),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 299/368 (81%), Gaps = 4/368 (1%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR A S+P+ A ++L++IR+SVS+LGDPTERV +YFSEAL  RLS           AS
Sbjct  241   DCARAADSEPDRAAEALVQIRESVSELGDPTERVGFYFSEALRGRLSQESAATARESPAS  300

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              E+   SY  LNDACPY KFAHLTANQAILEAT++ASKIHI+DFGIVQGIQW+ALLQALA
Sbjct  301   LEDFIHSYNTLNDACPYLKFAHLTANQAILEATDQASKIHIVDFGIVQGIQWSALLQALA  360

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP  IRISGIP+P LG SP  SL+ATGNRLRDFA++LDLNFEF+P+L PIH LNG
Sbjct  361   TRASGKPARIRISGIPAPSLGESPGPSLVATGNRLRDFARLLDLNFEFDPILTPIHLLNG  420

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVD DE L VNFMLQLYNLLDET + V TAL+LA SL P IVTLGEYE+S NRVGF 
Sbjct  421   SSFRVDQDEALTVNFMLQLYNLLDETPSAVETALRLAKSLGPRIVTLGEYEVSLNRVGFS  480

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNAL++YSA+FESL+PN++RDS +R+++E +LLGRRI+ L+ PE    +T       
Sbjct  481   NRVKNALRFYSAVFESLEPNLSRDSQDRLRIERVLLGRRISSLIGPENPGTRT----GRE  536

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +EDK+ WRILME +GF++VA+S+YA SQAKILLWNYNYS+ YSLI+S PGF+SLAWND 
Sbjct  537   RMEDKEQWRILMEKSGFESVALSNYAVSQAKILLWNYNYSTLYSLIESEPGFISLAWNDV  596

Query  1167  PLLTVSSW  1190
             PLLTVSSW
Sbjct  597   PLLTVSSW  604



>ref|NP_201478.1| GRAS family transcription factor [Arabidopsis thaliana]
 sp|Q9FL03.1|SCL4_ARATH RecName: Full=Scarecrow-like protein 4; Short=AtSCL4; AltName: 
Full=GRAS family protein 32; Short=AtGRAS-32 [Arabidopsis 
thaliana]
 dbj|BAB08619.1| SCARECROW gene regulator [Arabidopsis thaliana]
 gb|AED98261.1| GRAS family transcription factor [Arabidopsis thaliana]
Length=584

 Score =   487 bits (1253),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 305/368 (83%), Gaps = 7/368 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR++ S P  A K+L++IR+SVS+LGDPTERVA+YF+EAL NRLS +     ++  +S
Sbjct  223   DCARISDSDPNEASKTLLQIRESVSELGDPTERVAFYFTEALSNRLSPNSPAT-SSSSSS  281

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
             +E+L LSYK LNDACPYSKFAHLTANQAILEATEK++KIHI+DFGIVQGIQW ALLQALA
Sbjct  282   TEDLILSYKTLNDACPYSKFAHLTANQAILEATEKSNKIHIVDFGIVQGIQWPALLQALA  341

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP  IR+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNF+F P+L PIH LNG
Sbjct  342   TRTSGKPTQIRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFDFIPILTPIHLLNG  401

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE+LAVNFMLQLY LLDET   V TAL+LA SLNP +VTLGEYE+S NRVGF 
Sbjct  402   SSFRVDPDEVLAVNFMLQLYKLLDETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFA  461

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNAL++YSA+FESL+PN+ RDS ERV+VE  L GRRI+ L+ PE+     E      
Sbjct  462   NRVKNALQFYSAVFESLEPNLGRDSEERVRVERELFGRRISGLIGPEKTGIHRE------  515

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +E+K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYS+ YS+++S PGF+SLAWND 
Sbjct  516   RMEEKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSNLYSIVESKPGFISLAWNDL  575

Query  1167  PLLTVSSW  1190
             PLLT+SSW
Sbjct  576   PLLTLSSW  583



>gb|KFK28360.1| gras family transcription factor [Arabis alpina]
Length=575

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 252/372 (68%), Positives = 302/372 (81%), Gaps = 17/372 (5%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS-NSPEKRPANFDA  263
             DCAR+  S P++A K++IRIR+SVS+LGDP ERV YYF+EAL+NRLS +S  + P     
Sbjct  216   DCARILESDPDDASKAIIRIRESVSELGDPIERVGYYFTEALHNRLSPDSVSEAPP----  271

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             S EELT++YK LNDA PYSKFAHLTANQAILEATE ++KIHI+DFGIVQGIQW ALLQAL
Sbjct  272   SVEELTVAYKTLNDASPYSKFAHLTANQAILEATENSNKIHIVDFGIVQGIQWPALLQAL  331

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P LG+SP  SL+ATGNRLRDFAKVLDLNF+F P+L PIH LN
Sbjct  332   ATRSSGKPTQIRISGIPAPSLGDSPEPSLIATGNRLRDFAKVLDLNFDFVPILTPIHLLN  391

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
             GSSFRVDPDE+LAVNFMLQLY LLDE+ A V TAL+LA SL+P +VTLGEYE+S NRVGF
Sbjct  392   GSSFRVDPDEVLAVNFMLQLYKLLDESPAIVDTALRLAKSLDPMVVTLGEYEVSLNRVGF  451

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE---QRAKTECv  974
               R KNAL++Y A+FESL+P + RDS ERV+VE +L GRRI+ L+ PE+   QR + E  
Sbjct  452   ANRVKNALRFYFAVFESLEPKLRRDSEERVRVERVLFGRRISGLIGPEKTGNQRERME--  509

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                    +K+ WR+LME+AGF++V +S+YA SQA ILLW+YNY  SYSL++S PGF+SLA
Sbjct  510   -------EKEQWRVLMENAGFESVKLSNYAMSQANILLWSYNYDDSYSLVESKPGFISLA  562

Query  1155  WNDEPLLTVSSW  1190
             W D PLLTVSSW
Sbjct  563   WKDLPLLTVSSW  574



>ref|XP_010444734.1| PREDICTED: scarecrow-like protein 4 isoform X3 [Camelina sativa]
Length=577

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 299/368 (81%), Gaps = 8/368 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR++ S P  A KSL++IR+SVS+LGDPTERV +YF+EAL NRLS  P+       + 
Sbjct  217   DCARISDSDPNEASKSLVQIRESVSELGDPTERVGFYFAEALSNRLS--PDYSTTTSSSE  274

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              E+L +SYK LNDACPYSKFAHLTANQAILEATE ++KIHI+DFGIVQGIQW ALLQALA
Sbjct  275   EEDLIISYKTLNDACPYSKFAHLTANQAILEATEDSNKIHIVDFGIVQGIQWPALLQALA  334

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TRS GKP  IR+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNFEF P+L PIH LNG
Sbjct  335   TRSSGKPTQIRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFEFVPILAPIHLLNG  394

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE LAVNFMLQLY LL+ET   V TAL+LA SLNP +VTLGEYE+S NRVGF 
Sbjct  395   SSFRVDPDEALAVNFMLQLYKLLEETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFA  454

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNA+++YSA+FESL+PN+ R S ERV+VE +L GRRI+ L+ PE+     E      
Sbjct  455   NRVKNAIQFYSAVFESLEPNLGRHSEERVRVERVLFGRRISGLIGPEKTGIHRE------  508

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +E+K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYSS YS+++S PGF+SLAWND 
Sbjct  509   RMEEKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSSLYSIVESKPGFVSLAWNDL  568

Query  1167  PLLTVSSW  1190
             PLLT+SSW
Sbjct  569   PLLTLSSW  576



>ref|XP_010444732.1| PREDICTED: scarecrow-like protein 4 isoform X1 [Camelina sativa]
 ref|XP_010444733.1| PREDICTED: scarecrow-like protein 4 isoform X2 [Camelina sativa]
Length=578

 Score =   483 bits (1243),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 252/369 (68%), Positives = 301/369 (82%), Gaps = 9/369 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-KRPANFDA  263
             +CAR++ S P  A KSL++IR+SVS+LGDPTERV +YF+EAL NRLS  P+        +
Sbjct  217   NCARISDSDPNEASKSLVQIRESVSELGDPTERVGFYFAEALSNRLS--PDYSPSPTTSS  274

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             S+E+L LSYK LNDACPYSKFAHLTANQAILEATE ++KIHI+DFGIVQGIQW ALLQAL
Sbjct  275   STEDLILSYKTLNDACPYSKFAHLTANQAILEATEDSNKIHIVDFGIVQGIQWPALLQAL  334

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IR+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNFEF P+L PIH LN
Sbjct  335   ATRSSGKPTQIRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFEFVPILAPIHLLN  394

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
             GSSFRVDPDE LAVNFMLQLY LL+ET   V TAL+LA SLNP +VTLGEYE+S NRVGF
Sbjct  395   GSSFRVDPDEALAVNFMLQLYKLLEETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGF  454

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
               R KNA+++YSA+FESL+PN+ R S ERV+VE +L GRRI+ L+ PE+     E     
Sbjct  455   ANRVKNAIQFYSAVFESLEPNLGRHSEERVRVERVLFGRRISGLIGPEKTGIHRE-----  509

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +E+K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYSS YS+++S PGF+SLAWND
Sbjct  510   -RMEEKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSSLYSIVESKPGFVSLAWND  568

Query  1164  EPLLTVSSW  1190
              PLLT+SSW
Sbjct  569   LPLLTLSSW  577



>gb|KCW56779.1| hypothetical protein EUGRSUZ_I024512, partial [Eucalyptus grandis]
Length=527

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 254/370 (69%), Positives = 291/370 (79%), Gaps = 6/370 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCAR++ S PE A K+L R+R+S S+ GDP ERVA+YFS+AL++RLS   +  P     
Sbjct  164   LDCARVSESDPELAAKTLARLRESASERGDPAERVAFYFSDALHSRLSL--DGSPIASST  221

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             S EE TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHI+DFGIVQG+QWAALLQAL
Sbjct  222   SPEEFTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIVDFGIVQGVQWAALLQAL  281

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKPD IRISGIP+  LG +PA SLLATGNRLR+FAK+LDLNFEF P+L P  SL+
Sbjct  282   ATRSTGKPDRIRISGIPARALGENPAPSLLATGNRLREFAKLLDLNFEFVPILDPTDSLD  341

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              +SFRVDPDE LAVNFMLQLYNLL ET+A V  AL+L+ SL P IVTLGEYE S NR  +
Sbjct  342   AASFRVDPDEDLAVNFMLQLYNLLGETSAAVDAALRLSKSLGPKIVTLGEYEASLNRAPY  401

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
               RFKNAL YY+A+FESL+P M+RDS +R +VE LLLGRRI   + PE   A        
Sbjct  402   PARFKNALAYYAAVFESLEP-MSRDSLQRREVERLLLGRRIVRSVGPE---APPGTGAER  457

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK+ WR LME AGF+AV +SHYA SQAKILLWNY YS  YSL DSPPGFLSLAWN 
Sbjct  458   ERMEDKEQWRALMERAGFEAVPLSHYAVSQAKILLWNYKYSELYSLQDSPPGFLSLAWNK  517

Query  1164  EPLLTVSSWH  1193
              PLLTVS+W 
Sbjct  518   APLLTVSAWR  527



>ref|XP_010263679.1| PREDICTED: scarecrow-like protein 4 [Nelumbo nucifera]
Length=606

 Score =   479 bits (1234),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/369 (67%), Positives = 292/369 (79%), Gaps = 4/369 (1%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCAR+A S+PE AVK LI +R+S S+ GDPTERVA+YF+EALYNR+S    +  +  + 
Sbjct  241   LDCARVADSEPERAVKPLIGLRESFSEHGDPTERVAFYFAEALYNRISTKAGRTASTVET  300

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
              S++ TLS K LNDACPYSKFAHLTANQAILEATE AS+IHI+DFGIV+G+QWAAL QAL
Sbjct  301   CSQDFTLS-KTLNDACPYSKFAHLTANQAILEATETASRIHIVDFGIVEGVQWAALFQAL  359

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P LG SP  SL+ATGNRLR+FAKVLDLNFEFE +L PI  L 
Sbjct  360   ATRSTGKPSRIRISGIPAPALGKSPGDSLVATGNRLREFAKVLDLNFEFESILTPIEELE  419

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSFRVD DE+LAVNF+LQLYNLLDET A V  AL+LA SL P +VTLGEYE   NRV F
Sbjct  420   ESSFRVDMDEVLAVNFVLQLYNLLDETPAAVERALRLAKSLKPKVVTLGEYEAGLNRVDF  479

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFK AL+YY+A++ESL+P M RDS +R+ VE LLLGRRIA ++ PEE     E     
Sbjct  480   LNRFKVALRYYTAVYESLEPGMARDSAQRLLVERLLLGRRIAGVIGPEEGE---EGSIKR  536

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +E+K  W+  ME  GF++VA+SHYA SQAKILLWNY+YSS YSL++SPPGFLSL WND
Sbjct  537   ERMEEKGQWKAWMEGCGFQSVALSHYAISQAKILLWNYSYSSMYSLMESPPGFLSLLWND  596

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  597   VPLLTVSSW  605



>ref|XP_010464893.1| PREDICTED: scarecrow-like protein 4 [Camelina sativa]
Length=591

 Score =   478 bits (1231),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 298/368 (81%), Gaps = 11/368 (3%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR++ S    A K+L++IR+SVS+LGDPTERV +YF+EAL NRLS +          S
Sbjct  234   DCARISDSDQNEASKALVQIRESVSELGDPTERVGFYFAEALSNRLSPTTSSF-----TS  288

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
             +E+  LSYK LNDACPYSKFAHLTANQAILEATE ++KIHI+DFGIVQGIQW ALLQALA
Sbjct  289   TEDFILSYKTLNDACPYSKFAHLTANQAILEATEDSNKIHIVDFGIVQGIQWPALLQALA  348

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TRS GKP  IR+SGIP+P LG SP  SL+ATGNRLRDFAKVLDLNFEF P+L PIH LNG
Sbjct  349   TRSSGKPTQIRVSGIPAPSLGESPEPSLIATGNRLRDFAKVLDLNFEFVPILTPIHLLNG  408

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE LAVNFMLQLY LL+ET   V TAL+LA SLNP +VTLGEYE+S NRVGF 
Sbjct  409   SSFRVDPDEALAVNFMLQLYKLLEETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFA  468

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNA+++YSA+FESL+PN+ RDS ERV+VE +L GRRI+ L+ PE+     E      
Sbjct  469   NRVKNAIQFYSAVFESLEPNLGRDSEERVRVERVLFGRRISGLIGPEKTGIHRE------  522

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +E+K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYSS YS+++S PGF+SLAWN+ 
Sbjct  523   RMEEKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSSLYSIVESKPGFVSLAWNEL  582

Query  1167  PLLTVSSW  1190
             PLLT+SSW
Sbjct  583   PLLTLSSW  590



>ref|XP_010029812.1| PREDICTED: scarecrow-like protein 4 [Eucalyptus grandis]
Length=597

 Score =   478 bits (1230),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 254/370 (69%), Positives = 291/370 (79%), Gaps = 6/370 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCAR++ S PE A K+L R+R+S S+ GDP ERVA+YFS+AL++RLS   +  P     
Sbjct  234   LDCARVSESDPELAAKTLARLRESASERGDPAERVAFYFSDALHSRLSL--DGSPIASST  291

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             S EE TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHI+DFGIVQG+QWAALLQAL
Sbjct  292   SPEEFTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIVDFGIVQGVQWAALLQAL  351

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKPD IRISGIP+  LG +PA SLLATGNRLR+FAK+LDLNFEF P+L P  SL+
Sbjct  352   ATRSTGKPDRIRISGIPARALGENPAPSLLATGNRLREFAKLLDLNFEFVPILDPTDSLD  411

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              +SFRVDPDE LAVNFMLQLYNLL ET+A V  AL+L+ SL P IVTLGEYE S NR  +
Sbjct  412   AASFRVDPDEDLAVNFMLQLYNLLGETSAAVDAALRLSKSLGPKIVTLGEYEASLNRAPY  471

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
               RFKNAL YY+A+FESL+P M+RDS +R +VE LLLGRRI   + PE   A        
Sbjct  472   PARFKNALAYYAAVFESLEP-MSRDSLQRREVERLLLGRRIVRSVGPE---APPGTGAER  527

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               +EDK+ WR LME AGF+AV +SHYA SQAKILLWNY YS  YSL DSPPGFLSLAWN 
Sbjct  528   ERMEDKEQWRALMERAGFEAVPLSHYAVSQAKILLWNYKYSELYSLQDSPPGFLSLAWNK  587

Query  1164  EPLLTVSSWH  1193
              PLLTVS+W 
Sbjct  588   APLLTVSAWR  597



>emb|CBI17529.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   477 bits (1228),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 232/327 (71%), Positives = 274/327 (84%), Gaps = 6/327 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARLA S+P+ AVKSLIR+R+SVS+ GDPTERVA+YFSEALY+R+S+  EKRP  F+ 
Sbjct  224   LDCARLADSEPDRAVKSLIRLRESVSEHGDPTERVAFYFSEALYSRVSHQAEKRPTLFET  283

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             SSEE TLSYKALNDACPYSKFAHLTANQAILEATE+A KIHI+DFGIVQG+QWAALLQAL
Sbjct  284   SSEEFTLSYKALNDACPYSKFAHLTANQAILEATERARKIHIVDFGIVQGVQWAALLQAL  343

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P LG SPA+SL ATGNRLRDFA++LDLNFEFEP+L PI  LN
Sbjct  344   ATRSAGKPARIRISGIPAPALGKSPASSLFATGNRLRDFARLLDLNFEFEPILTPIQELN  403

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              S+FRVDPDE+LAVNFMLQLYNLLDET  +V  AL+LA SLNP I+TLGEYE   N V F
Sbjct  404   ESTFRVDPDEVLAVNFMLQLYNLLDETPVSVNAALRLAKSLNPKIMTLGEYEACLNEVDF  463

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             + RFKNAL+YY AIF+SL+PN+ RDS +R++VE LLLGRRIA ++ PEE   + E     
Sbjct  464   INRFKNALRYYRAIFDSLEPNLARDSSDRLQVERLLLGRRIAGVIGPEEPGTRRE-----  518

Query  984   veveDKDHWRILMESAGFKAVAISHYA  1064
               +EDK+ W+ L+ES GF++V +SHYA
Sbjct  519   -RMEDKEKWKFLVESCGFESVPLSHYA  544



>ref|XP_010558259.1| PREDICTED: scarecrow-like protein 4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010558267.1| PREDICTED: scarecrow-like protein 4 isoform X2 [Tarenaya hassleriana]
Length=597

 Score =   474 bits (1220),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/368 (65%), Positives = 300/368 (82%), Gaps = 6/368 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCA++  ++P+ A ++L+RIR+SVS+LGDPTERV +YF EAL+ RLS   +       AS
Sbjct  235   DCAQIIETEPDRAAETLVRIRESVSKLGDPTERVGFYFVEALFERLSPEADSAARESPAS  294

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              E+  LSYK LNDACPYSKFAHLTANQAILEAT+KASKIHI+DFGIVQGIQWAALLQA+A
Sbjct  295   LEDYILSYKTLNDACPYSKFAHLTANQAILEATDKASKIHIVDFGIVQGIQWAALLQAMA  354

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP  IRISGIP+  LG+SP  SL ATGNRLRDFA++LDLNFEF+P+L PIH LNG
Sbjct  355   TRASGKPTRIRISGIPASSLGDSPGPSLAATGNRLRDFARLLDLNFEFDPILTPIHLLNG  414

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             S+FR++P E LAVN MLQL  LLDET   V TAL+LA SL+P IVTLGEYE S NRVGF 
Sbjct  415   SNFRIEPGEALAVNCMLQLCTLLDETPVAVETALRLAKSLDPRIVTLGEYEASLNRVGFS  474

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNAL++YSA+FESL+PN+ R+S +R+++E +++GRRI++L+RPE+   + E      
Sbjct  475   NRVKNALRFYSAMFESLEPNLQRESQDRLRIERVIMGRRISDLIRPEKPGTRRE------  528

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +EDK+ WR+L+E +G ++VA+S+YA SQA+ILLWNYNYS+ YSLI++ PGF+SLAWND 
Sbjct  529   RMEDKEQWRVLLEKSGLESVALSNYAVSQARILLWNYNYSTLYSLIETEPGFISLAWNDV  588

Query  1167  PLLTVSSW  1190
             PLLTVSSW
Sbjct  589   PLLTVSSW  596



>ref|XP_008440702.1| PREDICTED: scarecrow-like protein 4 [Cucumis melo]
Length=609

 Score =   473 bits (1217),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 241/369 (65%), Positives = 294/369 (80%), Gaps = 5/369 (1%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CAR++ S+P+ A ++LI++++S S  GDPTERVA+YF +AL  RLS   + R  + ++
Sbjct  245   IECARISESEPDRAAQTLIKLKESSSDHGDPTERVAFYFMDALCRRLSLRSDSRLISCES  304

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +S++ TLSYKALNDACPYSKFAHLTANQAILE+TE ASKIHIIDFGI QG+QWAALLQAL
Sbjct  305   TSDDFTLSYKALNDACPYSKFAHLTANQAILESTENASKIHIIDFGIAQGVQWAALLQAL  364

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P+LGN PA  L ATGNRL +FAK+L+LNFEF+P+L PI  LN
Sbjct  365   ATRSTGKPTGIRISGIPAPMLGNCPATGLFATGNRLAEFAKLLELNFEFDPILTPIEELN  424

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSF++D DE LAVNFMLQLYNLLDET   V   L+LA SLNP IVTLGEYE S NRVGF
Sbjct  425   ESSFQMDTDETLAVNFMLQLYNLLDETPRAVLNVLQLAKSLNPKIVTLGEYEASLNRVGF  484

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
               RFKNAL++YSA+FESLDP + RDS ER+ +E LLLGR+I  L+ PE            
Sbjct  485   FNRFKNALRHYSAVFESLDPKLPRDSNERLHLEKLLLGRQIGGLVGPESSPGS-----KT  539

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
             V +EDK+ W+ LMES+GF +V +SHYA SQAKILLW Y+YSS YSL++S PGFLSLAWN+
Sbjct  540   VRMEDKEEWKKLMESSGFDSVNLSHYAKSQAKILLWKYDYSSEYSLMESSPGFLSLAWNE  599

Query  1164  EPLLTVSSW  1190
              P++TVSSW
Sbjct  600   VPIITVSSW  608



>ref|XP_004143507.1| PREDICTED: scarecrow-like protein 4-like [Cucumis sativus]
 ref|XP_004170737.1| PREDICTED: scarecrow-like protein 4-like [Cucumis sativus]
 gb|KGN48824.1| Chitin-inducible gibberellin-responsive protein [Cucumis sativus]
Length=609

 Score =   472 bits (1214),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 241/370 (65%), Positives = 299/370 (81%), Gaps = 7/370 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++CAR++ S+P+ A ++LI++++S S+ GDPTERVA+YF +AL  RLS   + R  + ++
Sbjct  245   IECARISESEPDRAAQTLIKLKESSSEHGDPTERVAFYFMDALCRRLSLPSDSRLISCES  304

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +S++ TLSYKALNDACPYSKFAHLTANQAILE+TE ASKIHIIDFGI QG+QWAALLQAL
Sbjct  305   TSDDFTLSYKALNDACPYSKFAHLTANQAILESTENASKIHIIDFGIAQGVQWAALLQAL  364

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P+LG+ PA  L ATGNRL +FAK+L+LNFEF+P+L PI  LN
Sbjct  365   ATRSTGKPTGIRISGIPAPMLGSCPATGLFATGNRLAEFAKLLELNFEFDPILTPIEELN  424

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSF++D  E LAVNFMLQLYNLLDET   V   L+LA SLNP IVTLGEYE S NRVGF
Sbjct  425   ESSFQIDTHETLAVNFMLQLYNLLDETPRAVLNVLQLAKSLNPKIVTLGEYEASLNRVGF  484

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ-RAKTECvev  980
             L RFKNAL++YSA+FESLDP + RDS ER+ +E LLLGR+I  L+ PE    +KTE    
Sbjct  485   LNRFKNALRHYSAVFESLDPKLPRDSNERLHLEKLLLGRQIGGLVGPESSPGSKTE----  540

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+ W+ LME++GF++V +SHYA SQAKILLW Y+YSS YSL++S PGFLSLAWN
Sbjct  541   --RMEDKEEWKKLMENSGFESVNLSHYAKSQAKILLWKYDYSSEYSLMESSPGFLSLAWN  598

Query  1161  DEPLLTVSSW  1190
             + P++TVSSW
Sbjct  599   EVPIITVSSW  608



>ref|XP_003540145.1| PREDICTED: scarecrow-like protein 4-like [Glycine max]
Length=481

 Score =   466 bits (1199),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 243/369 (66%), Positives = 289/369 (78%), Gaps = 13/369 (4%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             +CA L+ ++P+ A +SL R+R SVSQ G+PTERV +YF +AL  ++    EK      +S
Sbjct  124   ECASLSETEPDQAAESLSRLRKSVSQHGNPTERVGFYFWQALSRKMWGDKEKMEP---SS  180

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              EELTLSYKALNDACPYSKFAHLTANQAILEATE AS IHI+DFGIVQGIQWAALLQA A
Sbjct  181   WEELTLSYKALNDACPYSKFAHLTANQAILEATENASNIHILDFGIVQGIQWAALLQAFA  240

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP+ I ISGIP+  LG SP  SL ATGNRL DFA++LDLNF F P+L PIH L+ 
Sbjct  241   TRASGKPNKITISGIPAVSLGPSPGPSLSATGNRLSDFARLLDLNFVFTPILTPIHQLDH  300

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             +SF +DP+E+LAVNFMLQLYNLLDE  + V TAL+LA SLNP IVTLGEYE S  RVGF+
Sbjct  301   NSFCIDPNEVLAVNFMLQLYNLLDEPPSAVDTALRLAKSLNPRIVTLGEYEASVTRVGFV  360

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              RF+ A KY+SA+FESL+PN+  DSPER +VESLLLGRRIA ++ P   R   E      
Sbjct  361   NRFRTAFKYFSAVFESLEPNLAADSPERFQVESLLLGRRIAAVIGPGPVRESME------  414

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS-PPGFLSLAWND  1163
                DK+ WR+LME AGF++V++SHYA SQAKILLWNY+YSS +SL++S PPGFLSLAW D
Sbjct  415   ---DKEQWRVLMERAGFESVSLSHYAISQAKILLWNYSYSSLFSLVESKPPGFLSLAWKD  471

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  472   VPLLTVSSW  480



>emb|CAN74537.1| hypothetical protein VITISV_023717 [Vitis vinifera]
Length=893

 Score =   477 bits (1227),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 232/327 (71%), Positives = 274/327 (84%), Gaps = 6/327 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARLA S+P+ AVKSLIR+R+SVS+ GDPTERVA+YFSEALY+R+S+  EKRP  F+ 
Sbjct  286   LDCARLADSEPDRAVKSLIRLRESVSEHGDPTERVAFYFSEALYSRVSHQAEKRPTLFET  345

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             SSEE TLSYKALNDACPYSKFAHLTANQAILEATE+A KIHI+DFGIVQG+QWAALLQAL
Sbjct  346   SSEEFTLSYKALNDACPYSKFAHLTANQAILEATERARKIHIVDFGIVQGVQWAALLQAL  405

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP  IRISGIP+P LG SPA+SL ATGNRLRDFA++LDLNFEFEP+L PI  LN
Sbjct  406   ATRSAGKPARIRISGIPAPALGKSPASSLFATGNRLRDFARLLDLNFEFEPILTPIQELN  465

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              S+FRVDPDE+LAVNFMLQLYNLLDET  +V  AL+LA SLNP I+TLGEYE   N V F
Sbjct  466   ESTFRVDPDEVLAVNFMLQLYNLLDETPVSVNAALRLAKSLNPKIMTLGEYEACLNEVDF  525

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             + RFKNAL+YY AIF+SL+PN+ RDS +R++VE LLLGRRIA ++ PEE   + E     
Sbjct  526   INRFKNALRYYRAIFDSLEPNLARDSSDRLQVERLLLGRRIAGVIGPEEPGTRRE-----  580

Query  984   veveDKDHWRILMESAGFKAVAISHYA  1064
               +EDK+ W+ L+ES GF++V +SHYA
Sbjct  581   -RMEDKEKWKFLVESCGFESVPLSHYA  606



>ref|XP_008453739.1| PREDICTED: scarecrow-like protein 4 [Cucumis melo]
Length=590

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 258/403 (64%), Positives = 306/403 (76%), Gaps = 18/403 (4%)
 Frame = +3

Query  9     PQRNDVVaegsspeslsskp-llkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTER  185
             P +NDVV   SS   + S   +LK L+DCARL  S+P  A K+L RI  S+ + GDP ER
Sbjct  196   PLKNDVVEGSSSALEVESSSPVLKVLLDCARLCDSEPNRAAKTLNRISKSLREDGDPIER  255

Query  186   VAYYFSEALYNRLSNSPEKR---PANFDASSEELTLSYKALNDACPYSKFAHLTANQAIL  356
             V +YF EAL  RLS +  K        DA+SE+  LSYKALNDACPYSKFAHLTANQAIL
Sbjct  256   VGFYFGEALRKRLSLTAMKNCLDSTESDANSEDFLLSYKALNDACPYSKFAHLTANQAIL  315

Query  357   EATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLA  536
             E T++ASKIHI+DFGIVQG+QWAALLQALATR+ GKP  +RISGIP+P LG+SPAASL A
Sbjct  316   EVTQRASKIHIVDFGIVQGVQWAALLQALATRATGKPVRVRISGIPAPSLGDSPAASLYA  375

Query  537   TGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATV  716
             TGNRL +FAK+L+LNFEF+P+L PI +L  SSF V  DE+LAVNFMLQLYNLLDE +  V
Sbjct  376   TGNRLSEFAKILELNFEFQPILTPIENLKESSFSVQSDEVLAVNFMLQLYNLLDENSTGV  435

Query  717   GTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVK  896
               AL+LA SL+P IVTLGEYE S NR GF  RFKNALK+YS+IFESL+PN+ RDSPER++
Sbjct  436   HNALRLAKSLSPQIVTLGEYEASLNRNGFYSRFKNALKFYSSIFESLEPNLPRDSPERLQ  495

Query  897   VESLLLGRRIAELMRP-----EEQRAKTECveveveveDKDHWRILMESAGFKAVAISHY  1061
             +E LLLGRRIA ++        E+R + E         DK+ W+ LME+ GF+ VA+SHY
Sbjct  496   LEKLLLGRRIAGVVGTVEDSRRERRVRME---------DKEQWKNLMENTGFEPVALSHY  546

Query  1062  AHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             A SQAKILLWNYNYSS Y+LI+S P FLSLAWND PLLTVSSW
Sbjct  547   AISQAKILLWNYNYSSLYTLIESAPEFLSLAWNDVPLLTVSSW  589



>ref|XP_006404015.1| hypothetical protein EUTSA_v10011122mg [Eutrema salsugineum]
 gb|ESQ45468.1| hypothetical protein EUTSA_v10011122mg [Eutrema salsugineum]
Length=547

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 290/368 (79%), Gaps = 6/368 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR    +P+ A ++L+RIR+SVS  GDPTERV +YF+EAL  RLS++ +K   +   S
Sbjct  185   DCARNLEIKPDVAAETLVRIRESVSDSGDPTERVGFYFTEALSKRLSSTAKKETES--PS  242

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              ++  LSYK LNDACP+SKFAHLTANQAILEAT  +S IHI+DFGI QG+QWAALLQALA
Sbjct  243   LKDFILSYKTLNDACPFSKFAHLTANQAILEATHNSSNIHIVDFGIFQGVQWAALLQALA  302

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP  IRISGIP+P LG+SP  SL+ATGNRLRDFA VLDLNFEF P+L PIH LN 
Sbjct  303   TRASGKPARIRISGIPAPSLGDSPGMSLIATGNRLRDFAAVLDLNFEFYPILTPIHLLNV  362

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRV+PD+ LAVNFML+LY LLDET   V  AL+LA SLNP IVTLGEYE+S NRV F+
Sbjct  363   SSFRVEPDDFLAVNFMLELYKLLDETATIVDNALRLARSLNPRIVTLGEYEVSLNRVEFV  422

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNAL++YSA+FESL+PN+ RDS ER++VE +L GRRIA+L+RP   +          
Sbjct  423   NRVKNALRFYSAVFESLEPNLERDSKERLRVERVLFGRRIADLVRPGNNKPGNRS----G  478

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
              +E+K+ WR+LME AGF+ V  S+YA SQA +LLW+YNYS+ YSL++S PGF+SLAW++ 
Sbjct  479   RMEEKEQWRVLMEKAGFEPVKPSNYAVSQASLLLWSYNYSTLYSLVESEPGFISLAWDNV  538

Query  1167  PLLTVSSW  1190
             PLLTVSSW
Sbjct  539   PLLTVSSW  546



>ref|XP_002866739.1| hypothetical protein ARALYDRAFT_496923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42998.1| hypothetical protein ARALYDRAFT_496923 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 241/356 (68%), Positives = 290/356 (81%), Gaps = 8/356 (2%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             DCAR++ S P  A K+L++IR+SVS+LGDPTERV +YF+EAL NRLS       ++  +S
Sbjct  217   DCARISESDPNEASKTLVQIRESVSELGDPTERVGFYFTEALSNRLSPDSPATSSS--SS  274

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
             +E+L LSYK LNDACPYSKFAHLTANQAILEATE ++KIHI+DFGIVQGIQW ALLQALA
Sbjct  275   TEDLILSYKTLNDACPYSKFAHLTANQAILEATENSNKIHIVDFGIVQGIQWPALLQALA  334

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TRS GKP  IR+SGIP+P LG+SP  SL+ATGNRLRDFAKVLDLNF+F P+L PIH LNG
Sbjct  335   TRSSGKPTQIRVSGIPAPSLGDSPEPSLIATGNRLRDFAKVLDLNFDFIPILTPIHLLNG  394

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE+LAVNFMLQLY LLDET   V TAL+LA SLNP +VTLGEYE+S NRVGF 
Sbjct  395   SSFRVDPDEVLAVNFMLQLYKLLDETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFA  454

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KNAL++YSA+FESL+ N+ RDS ERV+VE  L GRRI+ L+ PE+     E      
Sbjct  455   NRVKNALQFYSAVFESLEANLGRDSEERVRVERELFGRRISGLIGPEKTGIHRE------  508

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
              +E+K+ WR+LME+AGF++V +S+YA SQAKILLWNYNYS+ YS ++S PGF+SLA
Sbjct  509   RMEEKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSNLYSFVESKPGFISLA  564



>emb|CDY72338.1| BnaCnng77180D [Brassica napus]
Length=585

 Score =   461 bits (1187),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 294/376 (78%), Gaps = 17/376 (5%)
 Frame = +3

Query  87    DCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSN---SPEKRPAN  254
             DC+  L  S+ E+A K+L+RI+ SVS+ GDPTERV Y+F+EAL NRLS    S +   + 
Sbjct  218   DCSLILDSSESEDAAKALVRIKKSVSEHGDPTERVGYHFTEALCNRLSPDSVSNDSSQSQ  277

Query  255   FDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
               A  E L LSYK LNDACPY KFAHLTANQAILEATE +SKIHI+DFGIVQGIQW ALL
Sbjct  278   AAAIVENLILSYKTLNDACPYFKFAHLTANQAILEATEHSSKIHIVDFGIVQGIQWPALL  337

Query  435   QALATRSGGKPDSIRISGIPSPV-LGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             QALATRS GKP  +RISGIP+P  LG SP  SL+ATGNRLRDFAKVLDLNF+F PVL PI
Sbjct  338   QALATRSSGKPAQVRISGIPAPSSLGQSPEPSLIATGNRLRDFAKVLDLNFDFIPVLTPI  397

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPN  791
             H LNGSSFRVDPDE LAVNFMLQLY LLDET A   TAL+LA SLNP +VTLGEY++S N
Sbjct  398   HLLNGSSFRVDPDEALAVNFMLQLYKLLDETPAVFDTALRLARSLNPMVVTLGEYDVSLN  457

Query  792   RVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE---EQRAK  962
             RVGF  R KNAL +YSA+FESL+P++ RDS ER++VE ++ GR I+ L+ PE    QR +
Sbjct  458   RVGFANRVKNALHFYSAVFESLEPSLGRDSEERLRVERVMFGRTISGLIGPEITGNQRLR  517

Query  963   TECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF  1142
              E          K+ WR+LME+AGF++V +S+YA SQA+ILLWNYNYSS YS+++S PGF
Sbjct  518   ME---------GKEQWRVLMENAGFESVKLSNYAVSQAEILLWNYNYSSLYSIVESKPGF  568

Query  1143  LSLAWNDEPLLTVSSW  1190
             +SLAWND PLLTVSSW
Sbjct  569   VSLAWNDLPLLTVSSW  584



>ref|XP_002877757.1| hypothetical protein ARALYDRAFT_485412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54016.1| hypothetical protein ARALYDRAFT_485412 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   450 bits (1158),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/355 (65%), Positives = 282/355 (79%), Gaps = 3/355 (1%)
 Frame = +3

Query  129   KSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSYKALNDA  308
             ++LIRI++SVS+ GDP ERV YYF EAL ++         ++  +S E+  LSYK LNDA
Sbjct  109   ETLIRIKESVSEFGDPIERVGYYFLEALSHK-ETESPSSSSSSSSSLEDFILSYKTLNDA  167

Query  309   CPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISG  488
             CPYSKFAHLTANQAILEAT +++ IHI+DFGI QGIQW+ALLQALATR  GKP  IRISG
Sbjct  168   CPYSKFAHLTANQAILEATNQSNNIHIVDFGIFQGIQWSALLQALATRPSGKPTRIRISG  227

Query  489   IPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVN  668
             IP+P LG+SP  SL+ATGNRLRDFA +LDLNFEF P+L PI  LNGSSFRVDPDE+L VN
Sbjct  228   IPAPSLGDSPGPSLIATGNRLRDFAAILDLNFEFYPILTPIQLLNGSSFRVDPDEVLVVN  287

Query  669   FMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIF  848
             FML+LY LLDET  TVGTAL+LA SLNP IVTLGEYE+S NRVGF  R KN+L++YSA+F
Sbjct  288   FMLELYKLLDETATTVGTALRLARSLNPRIVTLGEYEVSLNRVGFANRVKNSLRFYSAVF  347

Query  849   ESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMES  1028
             ESL+PN+ RDS ER++VE +L GRRI +L+R ++   K         +E+K+ WR+LME 
Sbjct  348   ESLEPNLERDSKERLRVERVLFGRRIFDLVRSDDDNNKPGT--RFGLMEEKEQWRVLMEK  405

Query  1029  AGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             AGF+ V  S+YA SQAK+LLWNYNYS+ YSL++S PGF+SLAWN+ PLLTVSSW 
Sbjct  406   AGFEPVTPSNYAVSQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSSWR  460



>ref|NP_190634.1| scarecrow-like protein 7 [Arabidopsis thaliana]
 sp|Q9SCR0.1|SCL7_ARATH RecName: Full=Scarecrow-like protein 7; Short=AtSCL7; AltName: 
Full=GRAS family protein 19; Short=AtGRAS-19 [Arabidopsis 
thaliana]
 emb|CAB62434.1| scarecrow-like 7 (SCL7) [Arabidopsis thaliana]
 dbj|BAF01117.1| scarecrow-like 7 [Arabidopsis thaliana]
 dbj|BAH30481.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78689.1| scarecrow-like protein 7 [Arabidopsis thaliana]
Length=542

 Score =   452 bits (1164),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 287/360 (80%), Gaps = 5/360 (1%)
 Frame = +3

Query  111   QPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSY  290
             +PE    +LIRI++SVS+ GDP +RV YYF+EAL ++ +   E   ++  +S E+  LSY
Sbjct  187   KPETKPDTLIRIKESVSESGDPIQRVGYYFAEALSHKET---ESPSSSSSSSLEDFILSY  243

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             K LNDACPYSKFAHLTANQAILEAT +++ IHI+DFGI QGIQW+ALLQALATRS GKP 
Sbjct  244   KTLNDACPYSKFAHLTANQAILEATNQSNNIHIVDFGIFQGIQWSALLQALATRSSGKPT  303

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
              IRISGIP+P LG+SP  SL+ATGNRLRDFA +LDLNFEF PVL PI  LNGSSFRVDPD
Sbjct  304   RIRISGIPAPSLGDSPGPSLIATGNRLRDFAAILDLNFEFYPVLTPIQLLNGSSFRVDPD  363

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E+L VNFML+LY LLDET  TVGTAL+LA SLNP IVTLGEYE+S NRV F  R KN+L+
Sbjct  364   EVLVVNFMLELYKLLDETATTVGTALRLARSLNPRIVTLGEYEVSLNRVEFANRVKNSLR  423

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHW  1010
             +YSA+FESL+PN+ RDS ER++VE +L GRRI +L+R ++   K         +E+K+ W
Sbjct  424   FYSAVFESLEPNLDRDSKERLRVERVLFGRRIMDLVRSDDDNNKPGT--RFGLMEEKEQW  481

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             R+LME AGF+ V  S+YA SQAK+LLWNYNYS+ YSL++S PGF+SLAWN+ PLLTVSSW
Sbjct  482   RVLMEKAGFEPVKPSNYAVSQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSSW  541



>emb|CDY53846.1| BnaA07g37410D [Brassica napus]
Length=583

 Score =   454 bits (1167),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 241/361 (67%), Positives = 284/361 (79%), Gaps = 14/361 (4%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS-NSPEKRPANFDASSEELTLSYKAL  299
             A  +L+RI+ SVS+ GDPTERV YYF+EAL NRLS +S     +   A  E L LSYK L
Sbjct  231   AKAALVRIKKSVSEHGDPTERVGYYFTEALCNRLSPDSVSNDSSQAAAIVENLILSYKTL  290

Query  300   NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIR  479
             NDACPY KFAHLTANQAILEATE +SKIHI+DFGIVQGIQW ALLQALATRS GKP  +R
Sbjct  291   NDACPYFKFAHLTANQAILEATEHSSKIHIVDFGIVQGIQWPALLQALATRSSGKPAQVR  350

Query  480   ISGIPSP-VLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEI  656
             ISGIP+P  LG SP  SL+ATGNRLRDFAKVLDLNF+F PVL P+H LNGSSFRVDPDE 
Sbjct  351   ISGIPAPSCLGQSPEPSLIATGNRLRDFAKVLDLNFDFIPVLTPVHLLNGSSFRVDPDEA  410

Query  657   LAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             LAVNFMLQLY LLDET     TAL+LA SLNP +VTLGEY++S NRVGF  R KNA+ +Y
Sbjct  411   LAVNFMLQLYKLLDETPVVFDTALRLARSLNPMVVTLGEYDVSLNRVGFANRVKNAIHFY  470

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE---EQRAKTECveveveveDKDH  1007
             SA+FESL+P++ RDS ER++VE ++ GR I+ L+ PE    QR + E          K+ 
Sbjct  471   SAVFESLEPSLGRDSEERLRVERVMFGRTISGLVGPEITGNQRLRME---------GKEQ  521

Query  1008  WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             WR+LME+AGF++V +S+YA SQA+ILLWNYNYSS YS+++S PGF+SLAWND PLLTVSS
Sbjct  522   WRVLMENAGFESVKLSNYAVSQAEILLWNYNYSSLYSIVESKPGFVSLAWNDLPLLTVSS  581

Query  1188  W  1190
             W
Sbjct  582   W  582



>ref|XP_004505608.1| PREDICTED: scarecrow-like protein 4-like [Cicer arietinum]
Length=539

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 233/370 (63%), Positives = 286/370 (77%), Gaps = 14/370 (4%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
              +CA L  ++P  A+++L  +++S+SQ G P +RV++YFS+AL N+++   E   ++   
Sbjct  182   TECATLIETEPNRAIETLTNLKNSISQNGTPIQRVSFYFSQALTNKVTAQGEST-SSIST  240

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             + EELTLSYKALNDACPYSKFAHLTANQAILEATE  + IHI+DFGIVQGIQWAALLQA 
Sbjct  241   TWEELTLSYKALNDACPYSKFAHLTANQAILEATEGFTNIHIVDFGIVQGIQWAALLQAF  300

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATRS GKP+S+RISGIP+  LG SP +SL ATGNRL +FAK+L LNFEF P+L PI  LN
Sbjct  301   ATRSSGKPNSVRISGIPAMALGISPVSSLTATGNRLSEFAKLLGLNFEFTPILTPIQLLN  360

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS-PNRVG  800
              +SF + P+E LAVNFMLQLYNLLDET   V TAL+LA SLNP IVTLGEYE S  +RVG
Sbjct  361   ETSFCIQPNEALAVNFMLQLYNLLDETMDAVETALRLAKSLNPKIVTLGEYEASLTSRVG  420

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+KRF  A  Y++A FESL+PNM  DSPER +VESLLLGRRI  ++   E+         
Sbjct  421   FVKRFNTAFNYFAAFFESLEPNMAFDSPERFQVESLLLGRRIDGVIGVRER---------  471

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +EDK+ W++LMES GF++V++SHYA SQAKILLWNY+Y S YSL++S PGFLSLAW 
Sbjct  472   ---MEDKERWKVLMESCGFESVSLSHYATSQAKILLWNYSYGSLYSLVESQPGFLSLAWK  528

Query  1161  DEPLLTVSSW  1190
             D PLLTVSSW
Sbjct  529   DVPLLTVSSW  538



>ref|XP_009103487.1| PREDICTED: scarecrow-like protein 4 [Brassica rapa]
Length=597

 Score =   451 bits (1161),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 241/361 (67%), Positives = 283/361 (78%), Gaps = 14/361 (4%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS-NSPEKRPANFDASSEELTLSYKAL  299
             A  +L+RI+ SVS+ GDPTERV YYF+EAL NRLS +S     +   A  E L LSYK L
Sbjct  245   AKAALVRIKKSVSEHGDPTERVGYYFTEALCNRLSPDSVSNDSSQAAAIVENLILSYKTL  304

Query  300   NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIR  479
             NDACPY KFAHLTANQAILEATE +SKIHI+DFGIVQGIQW ALLQALATRS GKP  +R
Sbjct  305   NDACPYFKFAHLTANQAILEATEHSSKIHIVDFGIVQGIQWPALLQALATRSSGKPAQVR  364

Query  480   ISGIPSP-VLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEI  656
             ISGIP+P  LG SP  SL+ATGNRLRDFAKVLDLNF+F PVL P+  LNGSSFRVDPDE 
Sbjct  365   ISGIPAPSCLGQSPEPSLIATGNRLRDFAKVLDLNFDFIPVLTPVQLLNGSSFRVDPDEA  424

Query  657   LAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             LAVNFMLQLY LLDET A   TAL+LA SLNP +VTLGEY++S NRVGF  R KNAL +Y
Sbjct  425   LAVNFMLQLYKLLDETPAVFDTALRLARSLNPMVVTLGEYDVSLNRVGFANRVKNALHFY  484

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE---EQRAKTECveveveveDKDH  1007
             SA+FESL+P++ RDS ER++VE ++ GR I+ L+ PE    QR + E          K+ 
Sbjct  485   SAVFESLEPSLGRDSEERLRVERVMFGRTISGLIGPEITGNQRLRME---------GKEQ  535

Query  1008  WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             WR+LME+AGF++V +S+YA SQA+ILLWNYNYSS YS+++S PGF+SLAWND PLL VSS
Sbjct  536   WRVLMENAGFESVKLSNYAVSQAEILLWNYNYSSLYSIVESKPGFVSLAWNDLPLLAVSS  595

Query  1188  W  1190
             W
Sbjct  596   W  596



>ref|XP_010426606.1| PREDICTED: scarecrow-like protein 7 [Camelina sativa]
Length=543

 Score =   449 bits (1156),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 283/360 (79%), Gaps = 8/360 (2%)
 Frame = +3

Query  111   QPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSY  290
             +PE   ++LI+IR+SVS+LG+P ERV +YF EAL ++ + SP        +S E+  LSY
Sbjct  191   KPETKPETLIQIRESVSELGNPVERVGFYFLEALSHKETESPPS------SSLEDFILSY  244

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             K LNDACPYSKFAHLTANQAILEAT ++  IHI+DFGI QGIQW+ALLQALATR  GKP 
Sbjct  245   KTLNDACPYSKFAHLTANQAILEATNQSQNIHIVDFGIFQGIQWSALLQALATRPSGKPT  304

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
              IR+SGIP+P LG+SP  SL+ATGNRLRDFA +LDLNFEF PVL PI  L GSSFRV+PD
Sbjct  305   RIRVSGIPAPSLGDSPEMSLIATGNRLRDFAAILDLNFEFNPVLTPIQFLTGSSFRVEPD  364

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E+L VNFML+LY LLDET  +VGTAL+LA SLNP IVTLGEYE+S NRV F  R KN+L+
Sbjct  365   EVLVVNFMLELYKLLDETATSVGTALRLARSLNPRIVTLGEYEVSLNRVEFANRVKNSLR  424

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHW  1010
             +YSA+FESL+PN+ RDS ER++VE +L GRRI++L+R      K         +E+K+ W
Sbjct  425   FYSAVFESLEPNLERDSKERLRVERVLFGRRISDLVRTGNDNNKPGT--RFGLMEEKEQW  482

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             R+LME AGF+ V  S+YA SQAK+LLWNYNYS+ YSL++S PGF+SLAWN+ PLLTVSSW
Sbjct  483   RVLMEKAGFEPVKPSNYAVSQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSSW  542



>ref|XP_007131529.1| hypothetical protein PHAVU_011G020600g [Phaseolus vulgaris]
 gb|ESW03523.1| hypothetical protein PHAVU_011G020600g [Phaseolus vulgaris]
Length=549

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 243/376 (65%), Positives = 285/376 (76%), Gaps = 16/376 (4%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK------R  245
              +CA  A S+P+ A +SL R+R SVSQ G+PT+RV +YF EAL  ++    EK       
Sbjct  182   TECASFAESEPDQAAESLARLRKSVSQHGNPTQRVGFYFCEALSRKIWAEKEKAEPTSTS  241

Query  246   PANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWA  425
                   +SEELTLSYKA+NDACPYSKFAHLTANQAILEAT+ A+ IHI+DFGIVQGIQWA
Sbjct  242   TTTTTTTSEELTLSYKAMNDACPYSKFAHLTANQAILEATDGAANIHILDFGIVQGIQWA  301

Query  426   ALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLG  605
             ALLQA ATRS GKP+ I+ISGIP+  LG SP  SL ATGNRL +FAK+LDLNFEF P+L 
Sbjct  302   ALLQAFATRSSGKPNKIKISGIPAIALGASPGPSLSATGNRLSEFAKLLDLNFEFTPILT  361

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS  785
             PIH L+ +SF +DPDE LAVNFMLQLYNLLDE    V TAL+LA SLNP IVTLGEYE S
Sbjct  362   PIHHLDHNSFCIDPDEALAVNFMLQLYNLLDEPPTAVDTALRLAKSLNPKIVTLGEYEAS  421

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKT  965
               RVGFL RFK A  Y+SA+FESLDPN+  DSPER +VESLLLGRRI  ++ P   R   
Sbjct  422   LTRVGFLNRFKTAFNYFSAVFESLDPNLPADSPERFQVESLLLGRRIDAVIGPGPARESM  481

Query  966   ECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS-PPGF  1142
             E         D++ WR+LME AGF++V++SHYA SQAKILLWNY YSS +SL++S PPGF
Sbjct  482   E---------DREQWRVLMERAGFESVSLSHYAVSQAKILLWNYGYSSLFSLLESTPPGF  532

Query  1143  LSLAWNDEPLLTVSSW  1190
             LSLAW D PLLT+SSW
Sbjct  533   LSLAWKDVPLLTLSSW  548



>ref|XP_006425686.1| hypothetical protein CICLE_v10025169mg [Citrus clementina]
 ref|XP_006466785.1| PREDICTED: scarecrow-like protein 4-like isoform X1 [Citrus sinensis]
 ref|XP_006466786.1| PREDICTED: scarecrow-like protein 4-like isoform X2 [Citrus sinensis]
 gb|ESR38926.1| hypothetical protein CICLE_v10025169mg [Citrus clementina]
Length=622

 Score =   450 bits (1157),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 234/369 (63%), Positives = 280/369 (76%), Gaps = 6/369 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCARL  S+P+ AVKSL+R+R SV   G+PTERVAYYF+EALY RL+   EK     +A
Sbjct  259   IDCARLVESEPDKAVKSLVRLRGSVCAHGNPTERVAYYFTEALYKRLTQRAEKSITTLEA  318

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             + E+  LS+K LNDACPYSKFA+LTANQAILEATE AS IHI+DFGIVQGIQW+ LLQAL
Sbjct  319   NCEDCILSFKTLNDACPYSKFAYLTANQAILEATENASHIHIVDFGIVQGIQWSFLLQAL  378

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             A R  GKP  +RISGIP+P LG SPAASLLATG+RLR+FA  L LN EFEP+L PI  L 
Sbjct  379   ANRPTGKPVKVRISGIPAPALGKSPAASLLATGDRLREFAGSLSLNLEFEPILIPIRKLR  438

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSFRVDP+E L VNFMLQL +LLD+    V  AL++A SLNP++VTL EYE + NR GF
Sbjct  439   ASSFRVDPNEALVVNFMLQLNSLLDDNRLAVENALQMAKSLNPNVVTLAEYEANLNRTGF  498

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFKNALKYY+A+FESL+PNMT DS ER +VE  +LG RIA L+ PE+Q AK E     
Sbjct  499   LARFKNALKYYTAVFESLEPNMTTDSDERFQVERQILGPRIANLLAPEKQGAKRE-----  553

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               VED ++WRI ME++ F+ +  SHYA SQA+ILLWNYNYS  ++L  S    L+L+W  
Sbjct  554   -RVEDIENWRIFMENSDFEGIPFSHYALSQAEILLWNYNYSPLFTLNQSHDNLLTLSWKK  612

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  613   VPLLTVSSW  621



>emb|CDL93467.1| lateral suppressor' /functional='GRAS-family transcriptional 
regulator [Helianthus annuus]
Length=580

 Score =   448 bits (1153),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 241/373 (65%), Positives = 292/373 (78%), Gaps = 12/373 (3%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVS-QLGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
              DCAR+A ++PE AV  L R+R+S+S + GDPTERVA+YF+EAL+NR++  P  R  +  
Sbjct  215   TDCARIADTEPEKAVTPLNRLRESLSGEHGDPTERVAFYFAEALHNRVTRKP--RSISDV  272

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              S+ E TL+YKALNDACPY KFAHLTANQ+ILEATE A KIHIIDFGIVQG+QWAALLQA
Sbjct  273   TSATEFTLTYKALNDACPYFKFAHLTANQSILEATETADKIHIIDFGIVQGVQWAALLQA  332

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATR  GKP SIRISGIP+ +LG+SPA  LLATGNRLR+FAK+LDL FEFEP+L PI +L
Sbjct  333   LATRPAGKPTSIRISGIPALILGSSPAPELLATGNRLREFAKLLDLKFEFEPILTPIENL  392

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
               SSF ++ +E +AVNFMLQLYNLLDE +  V  ALKLA SLNPSIVTLGEYE S N + 
Sbjct  393   TVSSFWINDNEFVAVNFMLQLYNLLDEDSKAVTKALKLAKSLNPSIVTLGEYEASLNGLP  452

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM-RPEEQRAKTECve  977
             F++RF NAL +YSA+F+S++PNM+RDS ER++VE LL GRRIA  +    E+ ++ E   
Sbjct  453   FVQRFDNALSFYSALFDSIEPNMSRDSVERLQVERLLFGRRIAAAVGNGNEEGSERE---  509

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI--DSPPGFLSL  1151
                 +EDK+ WRI+ME AGF+ V  S+YA SQAKILLW+YNYS  Y LI  DS  GFLSL
Sbjct  510   ---RMEDKERWRIMMEDAGFEKVKFSNYAVSQAKILLWSYNYSDMYELIDDDSQLGFLSL  566

Query  1152  AWNDEPLLTVSSW  1190
             AWN  P+LTVSSW
Sbjct  567   AWNGVPVLTVSSW  579



>ref|XP_006290864.1| hypothetical protein CARUB_v10016973mg [Capsella rubella]
 gb|EOA23762.1| hypothetical protein CARUB_v10016973mg [Capsella rubella]
Length=540

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/360 (65%), Positives = 281/360 (78%), Gaps = 6/360 (2%)
 Frame = +3

Query  111   QPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSY  290
             +P    ++L +IR+SVS+LG+P ERV +YF EAL ++ +   E  PA   +S EE  LSY
Sbjct  186   KPGTIPETLTQIRESVSELGNPIERVGFYFVEALSHKET---EPSPAA-SSSLEEFILSY  241

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             K LNDACPYSKFAHLTANQAILEAT ++  IHI+DFGI QGIQW+ALLQALATR+ GKP 
Sbjct  242   KTLNDACPYSKFAHLTANQAILEATSQSQNIHIVDFGIFQGIQWSALLQALATRASGKPT  301

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
              IRISGIP+P LG+SP  SL+ATGNRLRDFA +LDLNFEF PVL PI  L GSSFRVDPD
Sbjct  302   RIRISGIPAPSLGDSPEPSLIATGNRLRDFAAILDLNFEFNPVLTPIQLLTGSSFRVDPD  361

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E+L VNFML+LY LLDET   VGTAL+LA SLNP IVTLGEYE+S NRV F  R KN+L+
Sbjct  362   EVLVVNFMLELYKLLDETATGVGTALRLARSLNPRIVTLGEYEVSLNRVEFANRVKNSLR  421

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHW  1010
             +YSA+FESL+PN+ RDS ER +VE +L GRRI+EL+R      K         +E+K+ W
Sbjct  422   FYSAVFESLEPNLERDSKERQRVERVLFGRRISELVRTGNVNIKPGT--RLGLMEEKEQW  479

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             R+LME AGF+ V  S+YA SQAK+LLWNYNYS+ YSL++S PGF+SLAWN+ PLLTVSSW
Sbjct  480   RVLMEKAGFEPVKPSNYAVSQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSSW  539



>gb|KDO79532.1| hypothetical protein CISIN_1g006986mg [Citrus sinensis]
Length=622

 Score =   445 bits (1145),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 233/369 (63%), Positives = 278/369 (75%), Gaps = 6/369 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCA L  S+P+ AVKSL+R+R SV   G+PTERVAYYF+EALY RL+   EK     +A
Sbjct  259   IDCACLVESEPDKAVKSLVRLRGSVCAHGNPTERVAYYFTEALYKRLTQRAEKSITTLEA  318

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             + E+  LS+K LNDACPYSKFA+LTANQAILEATE AS IHI+DFGIVQGIQW+ LLQAL
Sbjct  319   NCEDCILSFKTLNDACPYSKFAYLTANQAILEATENASHIHIVDFGIVQGIQWSFLLQAL  378

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             A R  GKP  +RISGIP+P LG SPAASLLATG+RLR+FA  L LN EFEP+L PI  L 
Sbjct  379   ANRPTGKPVKVRISGIPAPALGKSPAASLLATGDRLREFAGSLSLNLEFEPILIPIRKLR  438

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              SSFRVDP+E L VNFMLQL +LLD+    V  AL++A SLNP +VTL EYE + NR GF
Sbjct  439   ASSFRVDPNEALVVNFMLQLNSLLDDNRLAVENALQMAKSLNPIVVTLAEYEANLNRTGF  498

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RFKNALKYY+A+FESL+PNMT DS ER +VE  +LG RIA L+ PE+Q AK E     
Sbjct  499   LARFKNALKYYTAVFESLEPNMTTDSDERFQVERQILGPRIANLLAPEKQGAKRE-----  553

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
               VED ++WRI ME++ F+ +  SHYA SQA+ILLWNYNYS  ++L  S    L+L+W  
Sbjct  554   -RVEDIENWRIFMENSDFEGIPFSHYALSQAEILLWNYNYSPLFTLNQSHDNLLTLSWKK  612

Query  1164  EPLLTVSSW  1190
              PLLTVSSW
Sbjct  613   VPLLTVSSW  621



>ref|XP_004149153.1| PREDICTED: scarecrow-like protein 4-like [Cucumis sativus]
 gb|KGN53252.1| hypothetical protein Csa_4G038690 [Cucumis sativus]
Length=589

 Score =   444 bits (1141),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 259/404 (64%), Positives = 308/404 (76%), Gaps = 18/404 (4%)
 Frame = +3

Query  6     TPQRNDVVaegsspeslsskp-llkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTE  182
             +P +NDVV   SS   + S   +LK L+DCARL  S+P  A K+L RI  S+ + GDP E
Sbjct  194   SPLKNDVVEGSSSALEVESSSPVLKVLLDCARLCDSEPNRAAKTLNRISKSLREDGDPIE  253

Query  183   RVAYYFSEALYNRLSNSPEKR---PANFDASSEELTLSYKALNDACPYSKFAHLTANQAI  353
             RV +YF +AL  RLS++P K        DA+SE+  LSYKALNDACPYSKFAHLTANQAI
Sbjct  254   RVGFYFGDALRKRLSSTPMKNCLDSTESDANSEDFLLSYKALNDACPYSKFAHLTANQAI  313

Query  354   LEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLL  533
             LE TE+ASKIHI+DFGIVQG+QWAALLQALATR+ GKP  +RISGIP+P LG+SPAASL 
Sbjct  314   LEVTERASKIHIVDFGIVQGVQWAALLQALATRATGKPVRVRISGIPAPSLGDSPAASLY  373

Query  534   ATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTAT  713
             ATGNRL +FAK+L+LNFEF+P+L PI +L  SSF V  DE+LAVNFMLQLYNLLDE    
Sbjct  374   ATGNRLSEFAKLLELNFEFQPILTPIENLKESSFSVQSDEVLAVNFMLQLYNLLDENPTG  433

Query  714   VGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERV  893
             V  AL+LA SL+P IVTLGEYE S NR GF  RFKNALK+YSAIFESL+PN+ R+SPER+
Sbjct  434   VHNALRLAKSLSPHIVTLGEYEASLNRNGFYNRFKNALKFYSAIFESLEPNLPRNSPERL  493

Query  894   KVESLLLGRRIAELMRP-----EEQRAKTECveveveveDKDHWRILMESAGFKAVAISH  1058
             ++E LLLGRRIA ++        E+R + E         DK+ W+ LME+ GF+ VA+SH
Sbjct  494   QLERLLLGRRIAGVVGTVEDSRRERRVRME---------DKEQWKNLMENTGFEPVALSH  544

Query  1059  YAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             YA SQAKILLWNYNYSS Y+LI+S P FLSLAWND PLLTVSSW
Sbjct  545   YAISQAKILLWNYNYSSLYTLIESAPEFLSLAWNDVPLLTVSSW  588



>ref|XP_004166315.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 4-like 
[Cucumis sativus]
Length=589

 Score =   444 bits (1141),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 259/404 (64%), Positives = 308/404 (76%), Gaps = 18/404 (4%)
 Frame = +3

Query  6     TPQRNDVVaegsspeslsskp-llkalVDCARLAVSQPENAVKSLIRIRDSVSQLGDPTE  182
             +P +NDVV   SS   + S   +LK L+DCARL  S+P  A K+L RI  S+ + GDP E
Sbjct  194   SPLKNDVVEGSSSALEVESSSPVLKVLLDCARLCDSEPNRAAKTLNRISKSLREDGDPIE  253

Query  183   RVAYYFSEALYNRLSNSPEKR---PANFDASSEELTLSYKALNDACPYSKFAHLTANQAI  353
             RV +YF +AL  RLS++P K        DA+SE+  LSYKALNDACPYSKFAHLTANQAI
Sbjct  254   RVGFYFGDALRKRLSSTPMKNCLDSTESDANSEDFLLSYKALNDACPYSKFAHLTANQAI  313

Query  354   LEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLL  533
             LE TE+ASKIHI+DFGIVQG+QWAALLQALATR+ GKP  +RISGIP+P LG+SPAASL 
Sbjct  314   LEVTERASKIHIVDFGIVQGVQWAALLQALATRATGKPVRVRISGIPAPSLGDSPAASLY  373

Query  534   ATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTAT  713
             ATGNRL +FAK+L+LNFEF+P+L PI +L  SSF V  DE+LAVNFMLQLYNLLDE    
Sbjct  374   ATGNRLSEFAKLLELNFEFQPILTPIENLKESSFSVQSDEVLAVNFMLQLYNLLDENPTG  433

Query  714   VGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERV  893
             V  AL+LA SL+P IVTLGEYE S NR GF  RFKNALK+YSAIFESL+PN+ R+SPER+
Sbjct  434   VHNALRLAKSLSPHIVTLGEYEASLNRNGFYNRFKNALKFYSAIFESLEPNLPRNSPERL  493

Query  894   KVESLLLGRRIAELMRP-----EEQRAKTECveveveveDKDHWRILMESAGFKAVAISH  1058
             ++E LLLGRRIA ++        E+R + E         DK+ W+ LME+ GF+ VA+SH
Sbjct  494   QLERLLLGRRIAGVVGTVEDSRRERRVRME---------DKEQWKNLMENTGFEPVALSH  544

Query  1059  YAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             YA SQAKILLWNYNYSS Y+LI+S P FLSLAWND PLLTVSSW
Sbjct  545   YAISQAKILLWNYNYSSLYTLIESAPEFLSLAWNDVPLLTVSSW  588



>ref|XP_006290913.1| hypothetical protein CARUB_v10017026mg [Capsella rubella]
 gb|EOA23811.1| hypothetical protein CARUB_v10017026mg [Capsella rubella]
Length=518

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 235/368 (64%), Positives = 285/368 (77%), Gaps = 18/368 (5%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             D AR   ++PE    +LI+IR+SVS+LG+P ERV +YF+EAL ++ +   E  PA   +S
Sbjct  168   DYARKPGTKPE----ALIQIRESVSELGNPIERVGFYFAEALSHKET---EPSPAASSSS  220

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
              EE  LSYK L+DACPYSKFAHLTANQAILEAT ++  IHI+DFGI QGIQW+ALLQALA
Sbjct  221   LEEFILSYKTLSDACPYSKFAHLTANQAILEATSQSQNIHIVDFGIFQGIQWSALLQALA  280

Query  447   TRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNG  626
             TR+ GKP  IRISGIP+P LG+SP  SL+ATGNRLRDFA +LDLNFEF PVL PI  L  
Sbjct  281   TRASGKPIRIRISGIPAPSLGDSPEPSLIATGNRLRDFAAILDLNFEFNPVLTPIQLLTE  340

Query  627   SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFL  806
             SSFRVDPDE+L VNFML+LY LLDET   VGTAL+LA SLNP IVTLGEYE+S NRV F 
Sbjct  341   SSFRVDPDEVLVVNFMLELYKLLDETATGVGTALRLARSLNPRIVTLGEYEVSLNRVEFS  400

Query  807   KRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevev  986
              R KN+L++YSA+FESL+PN+ RDS ER +VE +L GRRI+EL+R +    +        
Sbjct  401   NRVKNSLRFYSAVFESLEPNLERDSKERSRVERVLFGRRISELVRMDNGLME--------  452

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
                +K+ WR+LME AGF+ V  S+YA SQAK+LLWNYNYS+ YSL++S PGF+SLAWN+ 
Sbjct  453   ---EKEQWRVLMEKAGFEPVKPSNYAVSQAKLLLWNYNYSTLYSLVESEPGFISLAWNNV  509

Query  1167  PLLTVSSW  1190
             PLLTVSSW
Sbjct  510   PLLTVSSW  517



>dbj|BAG16269.1| lateral suppressor [Chrysanthemum x morifolium]
Length=561

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 229/374 (61%), Positives = 282/374 (75%), Gaps = 13/374 (3%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSV---SQLGDPTERVAYYFSEALYNRLSNSPEKRPAN  254
              +CA++  S P  +++SL R+RDS+   S  GDPTERV +YF++AL  R++  P ++  +
Sbjct  195   TECAKVMESDPAKSLQSLTRLRDSLTLSSTAGDPTERVTFYFADALNRRVT--PTRQTVD  252

Query  255   FDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
                S EE TL YKALNDACPY KFAHLTANQAILEATE   KIHI+DFGIVQG+QWAALL
Sbjct  253   EVTSPEEFTLIYKALNDACPYFKFAHLTANQAILEATENVDKIHIVDFGIVQGVQWAALL  312

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR  GKP  IRISGIP+ +LG+ P + LLATGNRLR+FAKVLDLNFEF+P+L PI 
Sbjct  313   QALATRPAGKPSMIRISGIPAVILGSKPGSDLLATGNRLREFAKVLDLNFEFQPILTPIE  372

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDET--TATVGTALKLANSLNPSIVTLGEYEMSP  788
              LN SSF +   E LAVNFMLQLYNLLD++     V  ALK+A SLNPS+VTLGEYE S 
Sbjct  373   DLNESSFWIKDGEFLAVNFMLQLYNLLDDSANCNAVEKALKMAKSLNPSLVTLGEYEASL  432

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTE  968
             N+VGF +RF  AL YYSA+F+SL+PNM+RDS ER++VE LL GRRIA+++  EE   + E
Sbjct  433   NKVGFFQRFSTALSYYSALFDSLEPNMSRDSSERIQVEKLLFGRRIADVIGYEEVGRRRE  492

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
                    +E K+ W I+M+ +GF  V  S+YA SQA+ILLW+YNYS  Y+LID   GFLS
Sbjct  493   ------RMEGKEQWWIMMQGSGFGTVKFSNYAVSQARILLWSYNYSEMYNLIDDDRGFLS  546

Query  1149  LAWNDEPLLTVSSW  1190
             LAWND PL++VSSW
Sbjct  547   LAWNDVPLISVSSW  560



>ref|XP_003607414.1| GAI-like protein [Medicago truncatula]
Length=544

 Score =   432 bits (1112),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 227/366 (62%), Positives = 282/366 (77%), Gaps = 14/366 (4%)
 Frame = +3

Query  99    LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASS-EE  275
             +   +P  A+++L  +  S+SQ G+P +RV++YFS+AL N+++       +N  +++ EE
Sbjct  190   IETQKPNQAIETLTHLNKSISQNGNPNQRVSFYFSQALTNKITAQSSIASSNSSSTTWEE  249

Query  276   LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRS  455
             LTLSYKALNDACPYSKFAHLTANQAILEATE ++ IHI+DFGIVQGIQWAALLQA ATRS
Sbjct  250   LTLSYKALNDACPYSKFAHLTANQAILEATEGSNNIHIVDFGIVQGIQWAALLQAFATRS  309

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
              GKP+S+RISGIP+  LG SP +S+ ATGNRL +FAK+L LNFEF P+L PI  L+ SSF
Sbjct  310   SGKPNSVRISGIPAMALGTSPVSSISATGNRLSEFAKLLGLNFEFTPILTPIELLDESSF  369

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS-PNRVGFLKR  812
              + PDE LAVNFMLQLYNLLDE T +V  AL+LA SLNP IVTLGEYE S   RVGF++R
Sbjct  370   CIQPDEALAVNFMLQLYNLLDENTNSVEKALRLAKSLNPKIVTLGEYEASLTTRVGFVER  429

Query  813   FKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevevev  992
             F+ A  Y++A FESL+PNM  DSPER +VESLLLGRRI  ++   E+            +
Sbjct  430   FETAFNYFAAFFESLEPNMALDSPERFQVESLLLGRRIDGVIGVRER------------M  477

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
             EDK+ W++LME+ GF++V +SHYA SQAKILLWNY+YSS YSL++S P FLSLAW D PL
Sbjct  478   EDKEQWKVLMENCGFESVGLSHYAISQAKILLWNYSYSSLYSLVESQPAFLSLAWKDVPL  537

Query  1173  LTVSSW  1190
             LTVSSW
Sbjct  538   LTVSSW  543



>gb|AES89611.2| GRAS family transcription factor [Medicago truncatula]
Length=555

 Score =   432 bits (1112),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 227/366 (62%), Positives = 282/366 (77%), Gaps = 14/366 (4%)
 Frame = +3

Query  99    LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASS-EE  275
             +   +P  A+++L  +  S+SQ G+P +RV++YFS+AL N+++       +N  +++ EE
Sbjct  201   IETQKPNQAIETLTHLNKSISQNGNPNQRVSFYFSQALTNKITAQSSIASSNSSSTTWEE  260

Query  276   LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRS  455
             LTLSYKALNDACPYSKFAHLTANQAILEATE ++ IHI+DFGIVQGIQWAALLQA ATRS
Sbjct  261   LTLSYKALNDACPYSKFAHLTANQAILEATEGSNNIHIVDFGIVQGIQWAALLQAFATRS  320

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
              GKP+S+RISGIP+  LG SP +S+ ATGNRL +FAK+L LNFEF P+L PI  L+ SSF
Sbjct  321   SGKPNSVRISGIPAMALGTSPVSSISATGNRLSEFAKLLGLNFEFTPILTPIELLDESSF  380

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS-PNRVGFLKR  812
              + PDE LAVNFMLQLYNLLDE T +V  AL+LA SLNP IVTLGEYE S   RVGF++R
Sbjct  381   CIQPDEALAVNFMLQLYNLLDENTNSVEKALRLAKSLNPKIVTLGEYEASLTTRVGFVER  440

Query  813   FKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevevev  992
             F+ A  Y++A FESL+PNM  DSPER +VESLLLGRRI  ++   E+            +
Sbjct  441   FETAFNYFAAFFESLEPNMALDSPERFQVESLLLGRRIDGVIGVRER------------M  488

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
             EDK+ W++LME+ GF++V +SHYA SQAKILLWNY+YSS YSL++S P FLSLAW D PL
Sbjct  489   EDKEQWKVLMENCGFESVGLSHYAISQAKILLWNYSYSSLYSLVESQPAFLSLAWKDVPL  548

Query  1173  LTVSSW  1190
             LTVSSW
Sbjct  549   LTVSSW  554



>ref|XP_008790358.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 4 [Phoenix 
dactylifera]
Length=629

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 233/381 (61%), Positives = 282/381 (74%), Gaps = 18/381 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFD-  260
             ++CAR+A S+P+ A KSL++IR+S S LGDPTERVA+YF+EAL +RL+ +     A+   
Sbjct  254   LECARIADSEPDLAAKSLVKIRESASDLGDPTERVAFYFAEALCSRLAAAAAAGGAHLKD  313

Query  261   -----------ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIV  407
                        +S E+ TL YKALNDACPYSKFAHLTANQAILEATE AS+IHIIDFGIV
Sbjct  314   RSSPPPSSSYDSSPEDFTLCYKALNDACPYSKFAHLTANQAILEATESASRIHIIDFGIV  373

Query  408   QGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFE  587
             QG+QWAALLQALATR  GKP  IRISGIP+  LG+SPAASL+ATGNRLR FA +LDL+FE
Sbjct  374   QGVQWAALLQALATRPAGKPAKIRISGIPALALGDSPAASLVATGNRLRHFAALLDLDFE  433

Query  588   FEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTL  767
             FE VL PI  L  S+FR++P E +AVNFMLQLY LL E+T  V   L+LA SL P++VTL
Sbjct  434   FEAVLTPIPELTESTFRIEPGESVAVNFMLQLYTLLGESTEPVERVLRLAKSLGPAVVTL  493

Query  768   GEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE  947
             GEYE S NR GF +RF  AL YY+A+FESL+P + R+SPERV+VE LLLGRRI   + P 
Sbjct  494   GEYEASLNRSGFAERFGTALAYYAAVFESLEPALDRESPERVRVERLLLGRRIRAAVGPG  553

Query  948   EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLID  1127
             E   + +       +E  + W  +M   G     +S+YA SQAK+LLWNY+YSS Y L+D
Sbjct  554   EGAKRRD------RMEGMEEWTAMMGRCGLGPKVLSNYAVSQAKLLLWNYDYSSQYRLLD  607

Query  1128  SPPGFLSLAWNDEPLLTVSSW  1190
             SPPGFLSLAW D PLLTVSSW
Sbjct  608   SPPGFLSLAWEDRPLLTVSSW  628



>ref|XP_010939277.1| PREDICTED: scarecrow-like protein 4 [Elaeis guineensis]
Length=645

 Score =   427 bits (1099),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 280/380 (74%), Gaps = 17/380 (4%)
 Frame = +3

Query  87    DCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS---NSPEKR----  245
             DCAR+A S P+ A KSL +IR+S S LGDPTERVA+YF+EALY+R+S     P ++    
Sbjct  272   DCARIADSNPDLAAKSLDKIRESASDLGDPTERVAFYFAEALYSRISVADGDPYRKDPSS  331

Query  246   ----PANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
                   ++D+S+E+ TL YKA NDACPYSKFAHLTANQAILEATE AS+IHIIDFGI+QG
Sbjct  332   PPPSATSYDSSTEDFTLCYKAFNDACPYSKFAHLTANQAILEATESASRIHIIDFGIIQG  391

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
             +QWAALLQALATR  GKP  IRISGIP+P LG+SPAASL  TGNRLR+FA +LDL+F+FE
Sbjct  392   VQWAALLQALATRPAGKPAKIRISGIPAPALGDSPAASLAVTGNRLRNFAALLDLDFDFE  451

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGE  773
             PVL P+  L  S+FRV+P E +AVN MLQL  LL + T  V   L+LA SL P++VTLGE
Sbjct  452   PVLTPLAELTASTFRVEPGESVAVNSMLQLNTLLGDATDLVEPVLRLAKSLGPAVVTLGE  511

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ  953
             YE + NR GF++RF  AL  Y+A+FESL+P M R S ER++VE LLLG RI   + P + 
Sbjct  512   YEANLNRFGFVERFGAALACYAAVFESLEPGMDRGSAERLRVERLLLGHRIRAAVGPGKV  571

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
               + +       +E ++ W  LM   G   +A+S+YA SQAK+LLWNY+YSS Y + + P
Sbjct  572   PNRQD------GMEGREGWTALMGRCGLGPLAVSNYAVSQAKLLLWNYDYSSKYRVFEFP  625

Query  1134  PGFLSLAWNDEPLLTVSSWH  1193
             PGF+SLAW D PLLTVSSWH
Sbjct  626   PGFISLAWKDRPLLTVSSWH  645



>ref|XP_010936276.1| PREDICTED: scarecrow-like protein 4 [Elaeis guineensis]
Length=629

 Score =   427 bits (1097),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 236/382 (62%), Positives = 283/382 (74%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS----------NS  233
             +DCAR+A S+P+ A KSL++IR+S S  GDPTERVA+YF+EAL +RLS          +S
Sbjct  256   LDCARIADSEPDLAAKSLVKIRESASDFGDPTERVAFYFAEALCSRLSAAAGGAHQKDHS  315

Query  234   PEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
             P    +++D+S E+ TL YKALNDACPYSKFAHLTANQAILEATE AS+IHIIDFGIVQG
Sbjct  316   PPPPSSSYDSSPEDFTLCYKALNDACPYSKFAHLTANQAILEATESASRIHIIDFGIVQG  375

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
             +QWAALLQALATR  GKP  IR+SGIP+  LG+SPAASL ATGNRLR FA +LDL+FEFE
Sbjct  376   VQWAALLQALATRPAGKPAKIRVSGIPALALGDSPAASLAATGNRLRHFASLLDLDFEFE  435

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGE  773
              VL PI  L  S+FRV+P E +AVNFMLQLY LL E+T  V   L+LA SL P++VTLGE
Sbjct  436   AVLTPIPELTESTFRVEPGESVAVNFMLQLYTLLGESTEPVERVLRLAKSLGPAVVTLGE  495

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRI---AELMRP  944
             YE S NR GF  RF  AL YY+A+F+SL+P M R+S ERV+VE LLLGRRI     L   
Sbjct  496   YEASLNRSGFADRFGTALAYYAAVFDSLEPAMNRESVERVRVERLLLGRRIRAAVGLGEG  555

Query  945   EEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              ++R + E          K+ W  +M   G   VA+S+YA SQA++LLWNYNYSS Y+L+
Sbjct  556   AKRRDRME---------GKEEWTAMMGRCGLVPVALSNYAVSQAELLLWNYNYSSKYTLL  606

Query  1125  DSPPGFLSLAWNDEPLLTVSSW  1190
              SPPG LSLAW D PLLTVSSW
Sbjct  607   HSPPGILSLAWADRPLLTVSSW  628



>ref|XP_009387926.1| PREDICTED: scarecrow-like protein 4 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   425 bits (1093),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 278/381 (73%), Gaps = 18/381 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS----------  233
             +DCARLA   P+ A KSLI +R+S S LGDPTERVA+YF+EAL  RL             
Sbjct  246   LDCARLADGDPDLAAKSLIHVRESASVLGDPTERVAFYFAEALNRRLLGDQKDHSHPSTV  305

Query  234   --PEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIV  407
               P    + FD+S E+ TL YK  NDACPYSKFAHLTANQAI+EATE A++IHI+DFGI+
Sbjct  306   AVPLCSTSAFDSSPEDFTLCYKVFNDACPYSKFAHLTANQAIVEATESAARIHIVDFGII  365

Query  408   QGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFE  587
             QGIQWAALLQALATR  GKP  +R+SGIP+P+LG +PAASL ATGNRLRDFA +LDL+FE
Sbjct  366   QGIQWAALLQALATRPRGKPSRVRVSGIPAPMLGAAPAASLTATGNRLRDFAAILDLDFE  425

Query  588   FEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTL  767
             F+P+L PI  L  S FR+D DE++ VNFMLQLY+LL ++  +V   L +A SL P +VTL
Sbjct  426   FDPILTPIAELTVSCFRIDSDEVVVVNFMLQLYHLLADSPESVERVLGIAKSLVPRVVTL  485

Query  768   GEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE  947
             GEYE S NR  F++RFK AL YY+A+F+SLDP + RDS ER ++E +LLG RI   +   
Sbjct  486   GEYEASVNRGRFVERFKAALAYYAAVFDSLDPAIRRDSAERAQMERVLLGPRILGAVGAG  545

Query  948   EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLID  1127
             +   + E       +E K+ WR +ME  GF+ V +S++A SQAK+LLWNY+YS  Y+++D
Sbjct  546   DGPNRRE------RMEAKEEWRAVMERCGFEPVPVSNFAVSQAKLLLWNYDYSYKYAVLD  599

Query  1128  SPPGFLSLAWNDEPLLTVSSW  1190
             S PGFL+LAW D PLLTVSSW
Sbjct  600   SAPGFLTLAWGDRPLLTVSSW  620



>ref|XP_006650515.1| PREDICTED: scarecrow-like protein 4-like [Oryza brachyantha]
Length=500

 Score =   418 bits (1074),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 268/373 (72%), Gaps = 9/373 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPAN  254
             + C+R A + P  A   L  +R + +  GDP+ER+A+YF++AL  RL   + +P    A+
Sbjct  134   LSCSRAAATDPGLAAAELASVRAAATDAGDPSERLAFYFADALTRRLECGTGAPPSVAAD  193

Query  255   FDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
                +S+ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALL
Sbjct  194   ARFASDELTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVQGIQWAALL  253

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR  GKP  IRI+GIPSP LG  PAASL AT  RLRDFAK+L ++FEF P+L P+H
Sbjct  254   QALATRPEGKPTRIRITGIPSPFLGPQPAASLAATSTRLRDFAKLLGVDFEFVPLLQPVH  313

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              L+ S F V+PDE +AVNFMLQLY+LL ++   V   L+LA SL+P++VTLGEYE+S NR
Sbjct  314   ELDQSDFLVEPDEAVAVNFMLQLYHLLGDSDELVRRVLRLAKSLSPAVVTLGEYEVSLNR  373

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECv  974
              GF+ RF NAL YY ++FESLD  MTRDSPERV+VE  + G RI   + PEE   +TE  
Sbjct  374   AGFVDRFANALSYYRSLFESLDVAMTRDSPERVRVERWMFGERIQRAVGPEEGADRTE--  431

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                  +     W+ LME +GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLA
Sbjct  432   ----RMAGSCEWQTLMEWSGFEPVRLSNYARSQADLLLWNYDSKYKYSLVELPPAFLSLA  487

Query  1155  WNDEPLLTVSSWH  1193
             W   PLLTVS+W 
Sbjct  488   WEKRPLLTVSAWR  500



>ref|XP_008785667.1| PREDICTED: scarecrow-like protein 7 [Phoenix dactylifera]
Length=654

 Score =   420 bits (1080),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 224/380 (59%), Positives = 279/380 (73%), Gaps = 17/380 (4%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS---NSPEKR---  245
             +DCAR+A S P+ A KSL +IR+S S LGDPTERVA+YF+EALY+RLS     P ++   
Sbjct  280   LDCARIADSDPDLAAKSLDKIRESASDLGDPTERVAFYFAEALYSRLSAASGDPYRKDPS  339

Query  246   -----PANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQ  410
                    ++ ++ E+ T  YKA NDACPYSKFAHLTANQAILEATE AS+IHIIDFGI+Q
Sbjct  340   SPPPSATSYSSTPEDFTFCYKAFNDACPYSKFAHLTANQAILEATESASQIHIIDFGIIQ  399

Query  411   GIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEF  590
             G+QWAALLQALATR GGKP  IRISGIP+P LG+SPA+SL  TGNRLR+FA +LDL+F+F
Sbjct  400   GVQWAALLQALATRPGGKPAKIRISGIPAPALGDSPASSLAVTGNRLRNFAALLDLDFDF  459

Query  591   EPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLG  770
             EPVL P+  L  S+FRV+P E +AVNF+LQLY LL ++T  V   L+LA SL P+++TL 
Sbjct  460   EPVLTPLPELTASTFRVEPGESVAVNFVLQLYTLLGDSTELVERVLRLAKSLGPAVLTLC  519

Query  771   EYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE  950
             EYE S NR GF++RF  A+  Y+A+FESL+P M R S ER++VE LLLG RI   + P +
Sbjct  520   EYEASLNRSGFVERFGAAVACYAAVFESLEPEMDRGSAERLRVERLLLGHRIRAAVGPGK  579

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
                + E       +E ++ W  LM   G   VA+S+YA SQA +LLWNYNYSS Y ++D 
Sbjct  580   AANRPE------TMEGREEWTALMGRCGLCPVAVSNYAVSQANLLLWNYNYSSKYRILDF  633

Query  1131  PPGFLSLAWNDEPLLTVSSW  1190
             PPGFLSLAW D PLLTV SW
Sbjct  634   PPGFLSLAWEDRPLLTVYSW  653



>gb|EEE59833.1| hypothetical protein OsJ_12398 [Oryza sativa Japonica Group]
Length=560

 Score =   417 bits (1072),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 217/373 (58%), Positives = 268/373 (72%), Gaps = 9/373 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP-ANFD  260
             + C+R A + P  A   L  +R + +  GDP+ER+A+YF++AL  RL+      P A  D
Sbjct  194   LSCSRAAATDPGLAAAELASVRAAATDAGDPSERLAFYFADALSRRLACGTGAPPSAEPD  253

Query  261   A--SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
             A  +S+ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALL
Sbjct  254   ARFASDELTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVQGIQWAALL  313

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR  GKP  IRI+G+PSP+LG  PAASL AT  RLRDFAK+L ++FEF P+L P+H
Sbjct  314   QALATRPEGKPTRIRITGVPSPLLGPQPAASLAATNTRLRDFAKLLGVDFEFVPLLRPVH  373

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              LN S F V+PDE +AVNFMLQLY+LL ++   V   L+LA SL+P++VTLGEYE+S NR
Sbjct  374   ELNKSDFLVEPDEAVAVNFMLQLYHLLGDSDELVRRVLRLAKSLSPAVVTLGEYEVSLNR  433

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECv  974
              GF+ RF NAL YY ++FESLD  MTRDSPERV+VE  + G RI   + PEE   +TE  
Sbjct  434   AGFVDRFANALSYYRSLFESLDVAMTRDSPERVRVERWMFGERIQRAVGPEEGADRTE--  491

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                  +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLA
Sbjct  492   ----RMAGSSEWQTLMEWCGFEPVPLSNYARSQADLLLWNYDSKYKYSLVELPPAFLSLA  547

Query  1155  WNDEPLLTVSSWH  1193
             W   PLLTVS+W 
Sbjct  548   WEKRPLLTVSAWR  560



>ref|NP_001051115.1| Os03g0723000 [Oryza sativa Japonica Group]
 gb|AAX95685.1| GRAS family transcription factor, putative [Oryza sativa Japonica 
Group]
 gb|ABF98609.1| GRAS family transcription factor containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13029.1| Os03g0723000 [Oryza sativa Japonica Group]
 gb|EAY91699.1| hypothetical protein OsI_13340 [Oryza sativa Indica Group]
 dbj|BAG95146.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88969.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95752.1| unnamed protein product [Oryza sativa Japonica Group]
Length=578

 Score =   417 bits (1073),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 217/373 (58%), Positives = 268/373 (72%), Gaps = 9/373 (2%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP-ANFD  260
             + C+R A + P  A   L  +R + +  GDP+ER+A+YF++AL  RL+      P A  D
Sbjct  212   LSCSRAAATDPGLAAAELASVRAAATDAGDPSERLAFYFADALSRRLACGTGAPPSAEPD  271

Query  261   A--SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
             A  +S+ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALL
Sbjct  272   ARFASDELTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVQGIQWAALL  331

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR  GKP  IRI+G+PSP+LG  PAASL AT  RLRDFAK+L ++FEF P+L P+H
Sbjct  332   QALATRPEGKPTRIRITGVPSPLLGPQPAASLAATNTRLRDFAKLLGVDFEFVPLLRPVH  391

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              LN S F V+PDE +AVNFMLQLY+LL ++   V   L+LA SL+P++VTLGEYE+S NR
Sbjct  392   ELNKSDFLVEPDEAVAVNFMLQLYHLLGDSDELVRRVLRLAKSLSPAVVTLGEYEVSLNR  451

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECv  974
              GF+ RF NAL YY ++FESLD  MTRDSPERV+VE  + G RI   + PEE   +TE  
Sbjct  452   AGFVDRFANALSYYRSLFESLDVAMTRDSPERVRVERWMFGERIQRAVGPEEGADRTE--  509

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                  +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLA
Sbjct  510   ----RMAGSSEWQTLMEWCGFEPVPLSNYARSQADLLLWNYDSKYKYSLVELPPAFLSLA  565

Query  1155  WNDEPLLTVSSWH  1193
             W   PLLTVS+W 
Sbjct  566   WEKRPLLTVSAWR  578



>ref|XP_009395642.1| PREDICTED: scarecrow-like protein 4 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   415 bits (1067),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 219/378 (58%), Positives = 273/378 (72%), Gaps = 15/378 (4%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK-------  242
             + CARLA S P  A KSLI +R+S S+LGDPTERVA+YF+EAL+ RL  +  K       
Sbjct  249   LQCARLADSDPHLATKSLIHVRESASELGDPTERVAFYFAEALHRRLLGAQRKHPLPTSA  308

Query  243   -RPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
              +P + D+S EE TL YK LNDACPY KFA LTANQAI+EATE A +IHI+DFGIVQG+Q
Sbjct  309   PQPPSLDSSPEEFTLCYKVLNDACPYFKFAQLTANQAIIEATESAGRIHIVDFGIVQGVQ  368

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSP-AASLLATGNRLRDFAKVLDLNFEFEP  596
             W +LLQALATR  GKP  +RISGIP+P LG +  A SL ATGNRLRDFA +LDL+FEF+ 
Sbjct  369   WPSLLQALATRPSGKPSKVRISGIPAPALGGAAIATSLAATGNRLRDFAALLDLDFEFDC  428

Query  597   VLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEY  776
             +L PI  +  S+FRVDPDE++ VNFMLQL  LL ++   V   L++A SL P I+TL EY
Sbjct  429   ILTPIPEIAASTFRVDPDELVVVNFMLQLSQLLGDSPEPVERVLRVAKSLGPRILTLAEY  488

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQR  956
             E S N  GF+ RF  AL +Y+A+FESLDP M RD+ ER ++E +L+G RI E + P E +
Sbjct  489   EASLNHAGFVDRFGAALGHYAAVFESLDPAMGRDAVERARMERVLIGHRILEAVGPFEGQ  548

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
              +       V +  K+ WR +ME  GF +V +S+YA SQAK+LLWNYNYSS Y+L+DSPP
Sbjct  549   NR------RVRMAPKEEWRAVMERCGFSSVPLSNYAVSQAKLLLWNYNYSSRYTLLDSPP  602

Query  1137  GFLSLAWNDEPLLTVSSW  1190
               L+LAW D PLLTVSSW
Sbjct  603   PCLTLAWGDRPLLTVSSW  620



>ref|XP_009394305.1| PREDICTED: scarecrow-like protein 4 [Musa acuminata subsp. malaccensis]
Length=634

 Score =   414 bits (1063),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 232/383 (61%), Positives = 285/383 (74%), Gaps = 20/383 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPA----  251
             +DCAR+A S P+ A KSLI +R+S S+ GDPTERVA+YF+EALY RL  +  K  +    
Sbjct  257   LDCARIADSDPDLAAKSLIHVRESASESGDPTERVAFYFAEALYRRLHGAQRKHHSYPST  316

Query  252   ----------NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFG  401
                       +FD+S E+ TL YKALNDACPYSKFAHLTANQAILEATE A++IHI+DFG
Sbjct  317   AAAPPSCSSSSFDSSPEDFTLCYKALNDACPYSKFAHLTANQAILEATESAARIHIVDFG  376

Query  402   IVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLN  581
             I+QG+QWAALLQALATR  GKP  +RISGIP+P LG + AASL ATGNRLRDFA +LDL+
Sbjct  377   IMQGVQWAALLQALATRPSGKPSRVRISGIPAPALGAAAAASLAATGNRLRDFAALLDLD  436

Query  582   FEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIV  761
             FEF+P+L PI  L+ S+FRVDP+E LAVNFMLQL +LL ++   V   L++A SL P +V
Sbjct  437   FEFDPILTPISELSASTFRVDPEETLAVNFMLQLCHLLGDSPEPVERVLRVAKSLGPRVV  496

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             TLGEYE S NR  FL+RF+ AL YY+A+F+SLDP M RDS ER +VE LL GRRI  ++ 
Sbjct  497   TLGEYEASLNRAAFLERFRTALAYYAAVFDSLDPAMQRDSAERARVERLLFGRRILGVVG  556

Query  942   PEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysL  1121
             P +++ + E       +E    WR +ME  GF+ V +S+YA SQAK+LLWNYNYSS Y+L
Sbjct  557   PGDEQIRRE------RMEANAEWRAVMEQCGFETVPLSNYAVSQAKLLLWNYNYSSKYTL  610

Query  1122  IDSPPGFLSLAWNDEPLLTVSSW  1190
              DS P FLSLAW D PLLTVSSW
Sbjct  611   SDSAPVFLSLAWGDRPLLTVSSW  633



>ref|XP_003607413.1| GRAS family transcription factor [Medicago truncatula]
Length=306

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 244/307 (79%), Gaps = 13/307 (4%)
 Frame = +3

Query  276   LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRS  455
             LTLSYKALNDACPYSKFAHLTANQAILEATE ++ IHI+DFGIVQGIQWAALLQA ATRS
Sbjct  12    LTLSYKALNDACPYSKFAHLTANQAILEATEGSNNIHIVDFGIVQGIQWAALLQAFATRS  71

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
              GKP+S+RISGIP+  LG SP +S+ ATGNRL +FAK+L LNFEF P+L PI  L+ SSF
Sbjct  72    SGKPNSVRISGIPAMALGTSPVSSISATGNRLSEFAKLLGLNFEFTPILTPIELLDESSF  131

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS-PNRVGFLKR  812
              + PDE LAVNFMLQLYNLLDE T +V  AL+LA SLNP IVTLGEYE S   RVGF++R
Sbjct  132   CIQPDEALAVNFMLQLYNLLDENTNSVEKALRLAKSLNPKIVTLGEYEASLTTRVGFVER  191

Query  813   FKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevevev  992
             F+ A  Y++A FESL+PNM  DSPER +VESLLLGRRI  ++   E+            +
Sbjct  192   FETAFNYFAAFFESLEPNMALDSPERFQVESLLLGRRIDGVIGVRER------------M  239

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
             EDK+ W++LME+ GF++V +SHYA SQAKILLWNY+YSS YSL++S P FLSLAW D PL
Sbjct  240   EDKEQWKVLMENCGFESVGLSHYAISQAKILLWNYSYSSLYSLVESQPAFLSLAWKDVPL  299

Query  1173  LTVSSWH  1193
             LTVSSW 
Sbjct  300   LTVSSWR  306



>gb|KHN46452.1| Scarecrow-like protein 4 [Glycine soja]
Length=297

 Score =   397 bits (1019),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 208/310 (67%), Positives = 240/310 (77%), Gaps = 26/310 (8%)
 Frame = +3

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             S EELTLSYKALNDACPYSKFAHLTANQAILEATE AS IHI+DFGIVQGIQWAALLQA 
Sbjct  12    SWEELTLSYKALNDACPYSKFAHLTANQAILEATENASNIHILDFGIVQGIQWAALLQAF  71

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATR+ GKP+ I ISGIP+                RL DFA++LDLNF F P+L PIH L+
Sbjct  72    ATRASGKPNKITISGIPA----------------RLSDFARLLDLNFVFTPILTPIHQLD  115

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
              +SF +DP+E+LAVNFMLQLYNLLDE    V TAL+LA SLNP IVTLGEYE S  RVGF
Sbjct  116   HNSFCIDPNEVLAVNFMLQLYNLLDEPPTAVDTALRLAKSLNPRIVTLGEYEASVTRVGF  175

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             + RF+ A KY+SA+FESL+PN+  DSPER +VESLLLGRRIA ++ P   R   E     
Sbjct  176   VNRFRTAFKYFSAVFESLEPNLAADSPERFQVESLLLGRRIAAVIGPGPVRESME-----  230

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS-PPGFLSLAWN  1160
                 DK+ WR+LME AGF++V++SHYA SQAKILLWNY+YSS +SL++S PPGFLSLAW 
Sbjct  231   ----DKEQWRVLMERAGFESVSLSHYAISQAKILLWNYSYSSLFSLVESKPPGFLSLAWK  286

Query  1161  DEPLLTVSSW  1190
             D PLLTVSSW
Sbjct  287   DVPLLTVSSW  296



>ref|XP_002466548.1| hypothetical protein SORBIDRAFT_01g009740 [Sorghum bicolor]
 gb|EER93546.1| hypothetical protein SORBIDRAFT_01g009740 [Sorghum bicolor]
Length=547

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 214/371 (58%), Positives = 263/371 (71%), Gaps = 9/371 (2%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPA-NFDA-  263
             C+R A + P  A   L+++R + S  GDP ERVA+YF++AL  RL+     +P    DA 
Sbjct  183   CSRTAAADPGLAAAELVQVRAAASDDGDPAERVAFYFADALARRLACGGGAQPTMAVDAR  242

Query  264   -SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              +S+ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALLQA
Sbjct  243   FASDELTLCYKTLNDACPYSKFAHLTANQAILEATGTATKIHIVDFGIVQGIQWAALLQA  302

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATR G KP  +RISG+PSP LG  PA SL AT  RLRDFAK+L ++FEF P+L P+H L
Sbjct  303   LATRPGEKPSRVRISGVPSPYLGPKPATSLAATSARLRDFAKLLGVDFEFVPLLRPVHEL  362

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             + S F V+PDE +AVNFMLQLY+LL ++   V   L+L  SL+PS+VTLGEYE+S NR G
Sbjct  363   DRSDFSVEPDETVAVNFMLQLYHLLGDSDEPVRRVLQLVKSLDPSVVTLGEYEVSLNRAG  422

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+ RF NAL YY  +FESLD  M RDSPERV+VE  + G RI   + PEE   +T+    
Sbjct  423   FVDRFANALLYYKPVFESLDVAMPRDSPERVRVERCMFGERIRRAIGPEEGEERTD----  478

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLAW 
Sbjct  479   --RMAASREWQTLMEWCGFEPVKLSNYAMSQADLLLWNYDSKYKYSLVELPPAFLSLAWE  536

Query  1161  DEPLLTVSSWH  1193
               PLLTVS+W 
Sbjct  537   KRPLLTVSAWR  547



>ref|XP_008665334.1| PREDICTED: scarecrow-like protein 4 [Zea mays]
 tpg|DAA51088.1| TPA: hypothetical protein ZEAMMB73_431874 [Zea mays]
 gb|AIB04513.1| GRAS transcription factor, partial [Zea mays]
Length=551

 Score =   404 bits (1038),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 212/373 (57%), Positives = 262/373 (70%), Gaps = 11/373 (3%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPAN-FD  260
             C+R A + P  A   L+++R + S+ GDP ERVA+YF +AL  RL+     + +P    D
Sbjct  185   CSRTAAADPGLAAVELVKVRAAASEDGDPAERVAFYFGDALARRLACGGGAQAQPLTAVD  244

Query  261   A--SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
             A  +++ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALL
Sbjct  245   ARFATDELTLCYKTLNDACPYSKFAHLTANQAILEATGTATKIHIVDFGIVQGIQWAALL  304

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR G KP  +RISG+PSP LG  PA SL AT  RLRDFAK+L + FEF P+L  +H
Sbjct  305   QALATRPGEKPSRVRISGLPSPYLGPKPATSLAATSARLRDFAKLLGVEFEFVPLLRSVH  364

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              L+ S F V+PDE +AVNFMLQLY+LL ++   V   L+L  SL+PS+VTLGEYE+S NR
Sbjct  365   ELDRSDFLVEPDETVAVNFMLQLYHLLGDSDEPVRRVLRLVKSLDPSVVTLGEYEVSLNR  424

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECv  974
              GF+ RF NAL YY  +FESLD  M RDSPERV+VE  + G RI   + PEE   +T+  
Sbjct  425   AGFVDRFSNALLYYKPVFESLDVAMPRDSPERVRVERCMFGERIRRAIGPEEGAERTD--  482

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                  +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLA
Sbjct  483   ----RMAASREWQTLMEWCGFEPVKLSNYAMSQADLLLWNYDSKYKYSLVELPPAFLSLA  538

Query  1155  WNDEPLLTVSSWH  1193
             W   PLLTVS+W 
Sbjct  539   WEKRPLLTVSAWR  551



>ref|XP_004981941.1| PREDICTED: scarecrow-like protein 4-like [Setaria italica]
Length=562

 Score =   404 bits (1037),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 263/370 (71%), Gaps = 9/370 (2%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPA---NFD  260
             C+R A + P  A   L+++R + S  GDP ERVA+YF++AL  RL+     +P+   +  
Sbjct  198   CSRTAAADPALAAVELVKVRAAASDDGDPAERVAFYFADALARRLACGGGAQPSTAPDTR  257

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              +S+ELTL YK LNDACPYSKFAHLTA+QAILEAT  A+KIHI+DFGIVQGIQWAALLQA
Sbjct  258   FASDELTLCYKTLNDACPYSKFAHLTASQAILEATGAATKIHIVDFGIVQGIQWAALLQA  317

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATR  GKP  +RISG+PSP LG  PAASL AT  RLRDFAK+L ++FEF P+L P+H L
Sbjct  318   LATRPEGKPSRVRISGVPSPYLGPKPAASLAATSARLRDFAKLLGVDFEFVPLLRPVHEL  377

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             + S F V+ DE +AVNFMLQLY+LL ++   V   L+LA SL+PS+VTLGEYE+S NR G
Sbjct  378   DRSDFLVESDEAVAVNFMLQLYHLLGDSDEPVRRVLRLAKSLSPSVVTLGEYEVSLNRAG  437

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+ RF NAL YY  +FESLD  M RDSPERV+VE  + G RI   + PEE   +T+    
Sbjct  438   FVDRFANALCYYKPVFESLDVAMARDSPERVRVERCMFGERIRRAVGPEEGAERTD----  493

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +     W+ LME  GF+ V +S+YA SQA  LLWNY+    YSL++ PP FLSLAW 
Sbjct  494   --RMAASREWQTLMECCGFEPVKLSNYAMSQADFLLWNYDAKYKYSLVELPPAFLSLAWE  551

Query  1161  DEPLLTVSSW  1190
               PLLTVS+W
Sbjct  552   KRPLLTVSAW  561



>ref|XP_008644549.1| PREDICTED: scarecrow-like protein 4 [Zea mays]
 gb|AFW67772.1| hypothetical protein ZEAMMB73_621918 [Zea mays]
Length=569

 Score =   400 bits (1029),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 262/373 (70%), Gaps = 11/373 (3%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPA---N  254
             C+R A +    A   L  +R + S  GDP ERVA+YF++AL  RL+     + +P+   +
Sbjct  203   CSRTAAAGTGLAAAELAEVRAAASDDGDPAERVAFYFADALARRLACGGGAQAQPSLAVD  262

Query  255   FDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
                + +ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALL
Sbjct  263   SRFAPDELTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVQGIQWAALL  322

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR G KP  +RISG+PSP LG  PAASL AT  RLRDFAK+L ++FEF P+L P+H
Sbjct  323   QALATRPGEKPSRVRISGVPSPYLGPKPAASLAATSARLRDFAKLLGVDFEFVPLLRPVH  382

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              L+ S F V+PDE +AVNFMLQLY+LL ++   V   L+L  SL+PS+VTLGEYE+S NR
Sbjct  383   ELDRSDFLVEPDETVAVNFMLQLYHLLGDSDEPVRRVLRLVKSLDPSVVTLGEYEVSLNR  442

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECv  974
              GF+ RF NAL YY  +FESLD  M RDSPERV+VE  + G RI   + PEE   +T+  
Sbjct  443   AGFVDRFANALLYYKPVFESLDVAMPRDSPERVRVERCMFGERIRRAIGPEEGAERTD--  500

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                  +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLA
Sbjct  501   ----RMAASREWQTLMEWCGFEPVKLSNYAMSQADLLLWNYDSKYKYSLVELPPAFLSLA  556

Query  1155  WNDEPLLTVSSWH  1193
             W  +PLLTVS+W 
Sbjct  557   WEKQPLLTVSAWR  569



>gb|AIB04509.1| GRAS transcription factor, partial [Zea mays]
Length=569

 Score =   399 bits (1025),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 210/373 (56%), Positives = 261/373 (70%), Gaps = 11/373 (3%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPA---N  254
             C+R A +    A   L  +R + S  GDP ERVA+YF++AL  RL+     + +P+   +
Sbjct  203   CSRTAAAGTGLAAAELAEVRAAASDDGDPAERVAFYFADALARRLACGGGAQAQPSLAVD  262

Query  255   FDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
                + +ELTL YK LNDACPYSKFAHLTANQ ILEAT  A+KIHI+DFGIVQGIQWAALL
Sbjct  263   SRFAPDELTLCYKTLNDACPYSKFAHLTANQVILEATGAATKIHIVDFGIVQGIQWAALL  322

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QALATR G KP  +RISG+PSP LG  PAASL AT  RLRDFAK+L ++FEF P+L P+H
Sbjct  323   QALATRPGEKPSRVRISGVPSPYLGPKPAASLAATSARLRDFAKLLGVDFEFVPLLRPVH  382

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              L+ S F V+PDE +AVNFMLQLY+LL ++   V   L+L  SL+PS+VTLGEYE+S NR
Sbjct  383   ELDRSDFLVEPDETVAVNFMLQLYHLLGDSDEPVRRVLRLVKSLDPSVVTLGEYEVSLNR  442

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECv  974
              GF+ RF NAL YY  +FESLD  M RDSPERV+VE  + G RI   + PEE   +T+  
Sbjct  443   AGFVDRFANALLYYKPVFESLDVAMPRDSPERVRVERCMFGERIRRAIGPEEGAERTD--  500

Query  975   eveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                  +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++ PP FLSLA
Sbjct  501   ----RMAASREWQTLMEWCGFEPVKLSNYAMSQADLLLWNYDSKYKYSLVELPPAFLSLA  556

Query  1155  WNDEPLLTVSSWH  1193
             W  +PLLTVS+W 
Sbjct  557   WEKQPLLTVSAWR  569



>gb|EPS61944.1| hypothetical protein M569_12848 [Genlisea aurea]
Length=572

 Score =   396 bits (1018),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 268/371 (72%), Gaps = 20/371 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             ++C RL  +QP+ A KSL  IR + S  GDP+ERV++YFSEA++NR+S  P+ RPA+ D 
Sbjct  219   IECLRLCDAQPDAAAKSLSAIRSAASPDGDPSERVSFYFSEAIFNRISKQPQ-RPASVDG  277

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
               E+  L YKALNDACPYSKF HLTANQAILEAT +A KIHI+DFGIV+GIQW A LQA+
Sbjct  278   E-EDFILPYKALNDACPYSKFIHLTANQAILEATHRAHKIHILDFGIVRGIQWPAFLQAI  336

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             ATR  GKP S+RI+GIP+  LG SP  +L ATGNRLR+FA+ LDLNFEFE +    H+ N
Sbjct  337   ATRPAGKPHSVRITGIPAASLGRSPETALSATGNRLREFAEALDLNFEFESIPELQHTTN  396

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS-PNRVG  800
               + R+ PDE LAVNFMLQL+ LLD+    +   L L  SLNP IVTLGEYE++  + +G
Sbjct  397   --NLRISPDESLAVNFMLQLHTLLDD---GITNTLNLVRSLNPCIVTLGEYEVNLRHGLG  451

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
                R +NAL++Y+A+FESL+P M R+SPER  VE ++LGRRIA ++       +      
Sbjct  452   HRARMENALRHYAAVFESLEPAMARESPERAMVERVVLGRRIAGIVGGGGDNLQ------  505

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI-DSPPGFLSLAW  1157
                  DK+ WR  ME AGF+ + +SHYA SQAKILLWNY+YS  Y L+  SPPGFLSLAW
Sbjct  506   -----DKERWRSYMEKAGFETMGLSHYAVSQAKILLWNYSYSECYRLVHSSPPGFLSLAW  560

Query  1158  NDEPLLTVSSW  1190
             +D P+LTVSSW
Sbjct  561   DDVPILTVSSW  571



>ref|XP_003560467.1| PREDICTED: scarecrow-like protein 4 [Brachypodium distachyon]
Length=541

 Score =   393 bits (1009),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 207/371 (56%), Positives = 257/371 (69%), Gaps = 9/371 (2%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP---ANFD  260
             C+R A +    A   L ++R   +  GDP ERVA+YFS+AL  RL+      P   A+  
Sbjct  177   CSRAAAANSGLAATELAKVRAVATDSGDPAERVAFYFSDALARRLACGGAASPVTAADAR  236

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              +++ELTL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIVQGIQWAALLQA
Sbjct  237   FAADELTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVQGIQWAALLQA  296

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATR  GKP  IRISG+PSP LG  PAASL AT  RLRDFAK+L ++FEF P+L P+  L
Sbjct  297   LATRPEGKPSRIRISGVPSPFLGPEPAASLAATSARLRDFAKLLGVDFEFVPLLRPVDEL  356

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             + S F ++PDE++AVNFMLQLY+LL ++   V   L+LA SL+P++VTLGEYE+S NR G
Sbjct  357   DQSDFLIEPDEVVAVNFMLQLYHLLGDSDEPVRRVLRLAKSLHPAVVTLGEYEVSLNRAG  416

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+ RF NAL YY  +FESLD  M RDS ERV +E  + G RI   + P E   +T+    
Sbjct  417   FVDRFANALSYYRLVFESLDVAMARDSQERVMMERCMFGERIRRAVGPGEGADRTD----  472

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                +     W+ LME  GF+ V +S+YA SQA +LLWNY+    YSL++  P FLSLAW 
Sbjct  473   --RMAGSSEWQTLMEWCGFEPVRLSNYAMSQADLLLWNYDSKYKYSLVELQPAFLSLAWE  530

Query  1161  DEPLLTVSSWH  1193
               PLLTVS+W 
Sbjct  531   KRPLLTVSAWR  541



>ref|XP_006591548.1| PREDICTED: scarecrow-like protein 4-like [Glycine max]
Length=459

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 209/322 (65%), Positives = 247/322 (77%), Gaps = 11/322 (3%)
 Frame = +3

Query  234   PEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
             P +R   +    EE TLS+KA  + CPYSKF  LTANQAILEAT+ AS IHI+DFGIVQG
Sbjct  145   PPRRQGPYSTWEEESTLSFKARTETCPYSKFDQLTANQAILEATQTASNIHIVDFGIVQG  204

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
             IQWAALLQA ATR  GKP+ IRISGIP+  LG+SP  SL AT +RL DFAK+LDLNF F 
Sbjct  205   IQWAALLQAFATRPSGKPNKIRISGIPALSLGSSPGPSLSATAHRLSDFAKLLDLNFHFT  264

Query  594   PVLGPIHSLNGSSFRV-DPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLG  770
             P+L PIH L+ +SF + D +E LAVNFMLQLYNLLDE    V TAL+LA SLNP IVTLG
Sbjct  265   PILTPIHQLDRNSFCIDDTNEALAVNFMLQLYNLLDEPPTAVDTALRLAKSLNPKIVTLG  324

Query  771   EYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM-RPE  947
             EYE S  R GF+ RFK A KY+SA+FESL+PN+  DSPER +VESLLLGRRIA ++  P 
Sbjct  325   EYEASVTRFGFVNRFKTAFKYFSAVFESLEPNLAADSPERFQVESLLLGRRIAAVIGGPG  384

Query  948   EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLID  1127
               R ++        +EDK+ WR+LME AGF++V++SHYA SQAKILLWNY+YSS +SL++
Sbjct  385   SVRRES--------MEDKEQWRVLMERAGFESVSLSHYAISQAKILLWNYSYSSLFSLVE  436

Query  1128  S-PPGFLSLAWNDEPLLTVSSW  1190
             S PPGFLSLAW D PLLTVSSW
Sbjct  437   STPPGFLSLAWKDVPLLTVSSW  458



>dbj|BAJ84873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/374 (55%), Positives = 262/374 (70%), Gaps = 12/374 (3%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP----ANF  257
             C+R A +    A   L ++R + ++ GDP ERVA+YFS+AL  RL+     R     A+ 
Sbjct  183   CSRAAAAGSGLAAAELAKVRAAATESGDPAERVAFYFSDALARRLACRGAARAPLDTASS  242

Query  258   DA--SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
             DA  +S+E+TL YK LNDACPYSKFAHLTANQAILEAT  A+KIHI+DFGIV GIQWAAL
Sbjct  243   DARLASDEVTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVHGIQWAAL  302

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALATR  GKP  IRISG+PSP LG  PAASL AT  RLRDFA++L ++FEF P+L P+
Sbjct  303   LQALATRPEGKPSRIRISGVPSPYLGPQPAASLAATSARLRDFAQLLGVDFEFVPLLRPV  362

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPN  791
             H L+ S F V+PDE++AVNFMLQLY+LL ++   V   L+LA SL P++VTLGEYE+S N
Sbjct  363   HELDLSDFSVEPDEVVAVNFMLQLYHLLGDSDEPVRRVLRLAKSLGPAVVTLGEYEVSLN  422

Query  792   RVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTEC  971
             R GF+ RF +AL YY  +FESLD  M RDS +R+ +E  + G RI   + P E   + + 
Sbjct  423   RAGFVDRFASALSYYRCVFESLDVAMARDSEDRLTLERCMFGERIRRAVGPPEGADRKD-  481

Query  972   veveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSL  1151
                   +     W+ LME  GF+ V +S+YA SQA++LLW+Y+    YSL++ PP FLSL
Sbjct  482   -----RMAGSGEWQALMEWCGFEPVRLSNYAESQAELLLWDYDSKYKYSLVELPPAFLSL  536

Query  1152  AWNDEPLLTVSSWH  1193
             AW+  PLLTVS+W 
Sbjct  537   AWDKRPLLTVSAWR  550



>gb|AJC52490.1| SCL2, partial [Pinus radiata]
Length=722

 Score =   384 bits (987),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 264/377 (70%), Gaps = 21/377 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
             +DCA++  ++PE A +S+  ++   S  GDPT+R+A +F++AL  RLS   E++P  F +
Sbjct  356   LDCAKIVDTEPERAGQSVAYLQRIASHHGDPTQRIASHFADALAKRLSKGIEQKP-QFQS  414

Query  264   SSE------ELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWA  425
             S E      +LTL+YKALNDACPYSKFA LT NQAILEA +KA KIHI+DFGIVQG+QWA
Sbjct  415   SDECSKSFEDLTLAYKALNDACPYSKFAQLTGNQAILEAMDKAEKIHIVDFGIVQGVQWA  474

Query  426   ALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLG  605
             ALL A ATR GGKP  I+I+GIP+P LG +P +SLLATG RL +FAK+LDL FEF PV  
Sbjct  475   ALLHAFATRPGGKPHKIKITGIPAPTLGQNPTSSLLATGKRLTEFAKLLDLEFEFCPVSK  534

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS  785
              +  +  S+ +++ DE +AVNFMLQLYNLL ++   +   LKLA++L+P +VTLGEYE  
Sbjct  535   HMSEVELSTLKIEQDECIAVNFMLQLYNLLGDSPEPLVKILKLAHALSPKVVTLGEYEAH  594

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRA  959
              N   F  RF+NAL+Y+SA FES++PNM RDS ER+ VE      +I  ++  E  E++ 
Sbjct  595   LNACQFQVRFRNALEYFSAFFESMEPNMARDSAERLNVEKHFFAEKIMGIVAFEGAERKI  654

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             + E          +D WRI+MESAGFK   +SHYA SQA+ILL+NY  + S   +D   G
Sbjct  655   RLE---------GRDQWRIVMESAGFKFTNLSHYARSQARILLYNYCEAYS---LDESSG  702

Query  1140  FLSLAWNDEPLLTVSSW  1190
             FLSLAW + PLLTVS+W
Sbjct  703   FLSLAWQNRPLLTVSAW  719



>ref|XP_006856020.1| hypothetical protein AMTR_s00059p00051820 [Amborella trichopoda]
 gb|ERN17487.1| hypothetical protein AMTR_s00059p00051820 [Amborella trichopoda]
Length=626

 Score =   374 bits (961),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 254/370 (69%), Gaps = 17/370 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP-ANFD  260
             VD AR   S P +A  SL  +R S    G PTER+  YF+EAL  RL   P   P A F 
Sbjct  272   VDAARTVHSDPGHAAASLAELRRSAPDSGSPTERLVSYFAEALIERLD--PTGHPVAQF-  328

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              S+EE TL YKALNDACP+SKFAHLTANQAILEA E A  IHI+DFGIVQG+QWAALLQA
Sbjct  329   -SAEESTLCYKALNDACPFSKFAHLTANQAILEAMETADSIHIVDFGIVQGVQWAALLQA  387

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LATR  GKP  IRISGIP+P LG++PA SL ATGNRL DFAK+L+LNFEF PV   I  +
Sbjct  388   LATRPAGKPAKIRISGIPAPSLGSNPAPSLAATGNRLCDFAKLLELNFEFSPVPCSIEDV  447

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
                  R    E +AVNFMLQL+ L+DE    V  AL++A +L P +VTLGEYE+  NR  
Sbjct  448   MEGDLRRADGEFVAVNFMLQLHRLVDEKMEKVARALRVAKALKPKVVTLGEYELGLNRGD  507

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             F+ R   AL+YY A+FE L+  M R   ER +VE +++GRRIA  ++  E R +  C+  
Sbjct  508   FMGRLSRALRYYGAMFECLEAGMGRACKERERVERVVIGRRIAGAVKNTE-RMEERCI--  564

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                      WR  +E AGF  + +SHYA SQA++LLWNY+YSSSYSLI++ PGFL+LAW 
Sbjct  565   ---------WREEIERAGFVGLGLSHYAVSQARMLLWNYDYSSSYSLIEAGPGFLTLAWK  615

Query  1161  DEPLLTVSSW  1190
             D+PLLTVS+W
Sbjct  616   DQPLLTVSAW  625



>gb|EMS59859.1| Scarecrow-like protein 4 [Triticum urartu]
Length=421

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 183/262 (70%), Gaps = 6/262 (2%)
 Frame = +3

Query  405   VQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNF  584
             V GIQWAALLQALATR  GKP  IRISG+PSP LG  PAASL AT  RLRDFA++L ++F
Sbjct  165   VPGIQWAALLQALATRPEGKPSRIRISGVPSPYLGPHPAASLAATSARLRDFAQLLGVDF  224

Query  585   EFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVT  764
             EF P+L P+H+L+ S F VDPDE++AVNFMLQLY+LL ++       L+LA SL P++VT
Sbjct  225   EFVPLLRPVHALDRSDFSVDPDEVVAVNFMLQLYHLLGDSDEPGRRLLRLAKSLGPAVVT  284

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             LGEYE+S NR GF+ RF +AL YY A+FESLD  M RDS +R  +E  + G RI   + P
Sbjct  285   LGEYEVSLNRAGFVDRFASALSYYRAVFESLDVAMARDSEDRATLERSMFGERIRRAVGP  344

Query  945   EEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E   +T+       +     W+ LME  GF+ V +S+YA SQA++LLW+Y+    YSL+
Sbjct  345   PEGADRTD------RMAGSAEWQALMEWCGFQPVRLSNYAESQAELLLWDYDAKYKYSLV  398

Query  1125  DSPPGFLSLAWNDEPLLTVSSW  1190
               PP FLSLAW   PLLTVS+W
Sbjct  399   QLPPAFLSLAWEKRPLLTVSAW  420



>ref|XP_001783367.1| predicted protein [Physcomitrella patens]
 gb|EDQ51812.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 225/380 (59%), Gaps = 28/380 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSP-EKRPANFD  260
             ++CA         AV +L R+RD  S LGDP +RVA YF +AL  R++    E  P   +
Sbjct  84    LECATQIEKNQHLAVSTLCRLRDLSSPLGDPMQRVAAYFCDALTKRIARGKGEADPGVLE  143

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
             A       + + LN+ACPY KFAHLTANQAILEA +    +HI+DFGI  GIQWAALLQA
Sbjct  144   APHNS-PKACQVLNEACPYMKFAHLTANQAILEAVKGCESVHILDFGITHGIQWAALLQA  202

Query  441   LATRSGGK-PDSIRISGIPSPVLGNSPAA-----SLLATGNRLRDFAKVLDLNFEFEPV-  599
              A+    + P  +RI+GI      N+PA+     S+LATG RL+ FA+ L++ FEF PV 
Sbjct  203   FASLPKKQPPPKVRITGISV----NNPASESASLSVLATGKRLQSFAEHLNVEFEFCPVI  258

Query  600   LGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDET-TATVGTALKLANSLNPSIVTLGEY  776
             L  +      S +++PDE    NFMLQL+ +LDE  + ++   L+   SL+P++VTL E+
Sbjct  259   LVSMEDFTPESIQLNPDEKTVANFMLQLHEMLDEEGSPSILRLLRSVISLSPALVTLTEH  318

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             + + NR  F  RF +AL +Y A+F+SLD  M RD  +R+ VE+    ++I  ++  E  +
Sbjct  319   DAALNRPEFRPRFMDALHFYCALFDSLDSTMPRDCHDRLNVENNYFAKQIENIVANEGVD  378

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + EC          + W  +ME+ GF  V +SHYA+SQA+ LLW +  S     +  
Sbjct  379   RTERYECT---------ETWIRIMETVGFTLVPLSHYAYSQAQQLLWQFCDSFR---LQR  426

Query  1131  PPGFLSLAWNDEPLLTVSSW  1190
             P G ++LAW D  L+TVS+W
Sbjct  427   PSGCIALAWQDRSLITVSAW  446



>ref|XP_002985548.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ13422.1| GRAS family protein [Selaginella moellendorffii]
Length=624

 Score =   266 bits (680),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 220/380 (58%), Gaps = 37/380 (10%)
 Frame = +3

Query  111   QPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA---------  263
             Q  +A+  L  ++   S  G+  E+ A+YFS  L  RL     +R  N  +         
Sbjct  262   QASSAMDKLATLKAMASSSGNAVEKCAWYFSSGLEARL----HRRGGNDHSDGDDDEEEE  317

Query  264   -------SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQW  422
                     +E + ++YK L DACPY KFAHLTANQA+LEAT+ A KIHI+D+G +QG+QW
Sbjct  318   SPSSSPNKAEAIAMAYKTLTDACPYLKFAHLTANQALLEATDGAPKIHIVDYGTMQGVQW  377

Query  423   AALLQALATRSGGKPD--SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEP  596
             AA LQA AT     P   S+RI+GIPSP LG++PA ++LAT  RL DFAK+L ++F+F P
Sbjct  378   AAFLQAFATWPAKNPSPRSLRITGIPSPHLGSNPAPAMLATQRRLTDFAKLLGVDFQFCP  437

Query  597   VLGPIHSLNGS-SFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGE  773
             +L PI     S S R DPDE++AVNF+LQL  L       +  A  L   LNP IVT+ E
Sbjct  438   ILEPIRDFQPSQSLRTDPDEVVAVNFVLQLAQL---PAPALKRAFSLVQRLNPRIVTVAE  494

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ  953
             YE + N      +  +  ++YS++FESLD  +  D  +R+  E L  GR I + +    +
Sbjct  495   YEAN-NGASLRDQLASNARFYSSVFESLDVALPGDDAQRITAERLFFGREITKSLV---E  550

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
                 EC E       +  W+  ++ AG  + A+SHY  SQA++LLW YN S +++L+   
Sbjct  551   GTNCECPEK------QREWQRCIDGAGLWSAALSHYTVSQARLLLWLYNKSENFTLLQG-  603

Query  1134  PGFLSLAWNDEPLLTVSSWH  1193
             PG LSL W    ++TVS+WH
Sbjct  604   PGSLSLGWLGTSIVTVSAWH  623



>ref|XP_001773672.1| predicted protein [Physcomitrella patens]
 gb|EDQ61560.1| predicted protein [Physcomitrella patens]
Length=367

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 130/374 (35%), Positives = 197/374 (53%), Gaps = 21/374 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSN----SPEKRP  248
             + CA    +Q  + V  L+ ++ +  S  G   +RVA YF+E L  R+++      +  P
Sbjct  9     IACAEAVSTQSLSLVNHLLPKLGELASPQGTAMQRVAAYFTEGLACRVAHLWPHIYQPLP  68

Query  249   ANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAA  428
                  + EEL  ++  LN   PY+KFAH TAN  IL+  E A ++H+IDF + QG+QW A
Sbjct  69    IESSLNEEELQTAFHLLNHVVPYTKFAHFTANDIILQGFEGADRVHVIDFDVKQGLQWPA  128

Query  429   LLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP  608
             L Q+LA R  G P  IRI+GI            LL TG+RL +FA+  ++ F F  V+  
Sbjct  129   LFQSLAVRECGPPSHIRITGI------GECKEDLLETGDRLAEFAEEFNIPFTFHAVIDR  182

Query  609   IHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSP  788
             +  +      V  +E +AVN + QL+ LL ++  T+   L L  S  P +V + E E S 
Sbjct  183   LEDVRLWMLHVKENEAVAVNCISQLHRLLYDSGETIEGFLNLIGSTKPKVVAVVEQEGSH  242

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTE  968
             N   F  RF  +L+YYSA+F+SL+ N++R+S  RV+VE  L  R I  ++         E
Sbjct  243   NSPQFEGRFLESLQYYSAVFDSLEANISRESSARVQVEQ-LFAREIRNIL-------SCE  294

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
               +     E+   WR +M  +GF  V +   A++QA ILL    + S    +    G ++
Sbjct  295   GTDRMERHENISRWRSIMSRSGFVKVPLEDSAYTQALILL--RMFDSDGYTLAEENGAVT  352

Query  1149  LAWNDEPLLTVSSW  1190
             L W ++PLLT S+W
Sbjct  353   LGWMEQPLLTASAW  366



>ref|XP_001763823.1| predicted protein [Physcomitrella patens]
 gb|EDQ71465.1| predicted protein [Physcomitrella patens]
Length=390

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/376 (35%), Positives = 200/376 (53%), Gaps = 25/376 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSN----SPEKRP  248
             + CA    +Q  + V  L+ ++ +  S  G   +RVA YF+E L  R+++      +  P
Sbjct  11    IACAEAVSTQSLSLVNHLLQKLGEHASPQGTAMQRVAAYFTEGLACRVAHLWPHVYQPLP  70

Query  249   ANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAA  428
              + + + E+L  ++  LN   PY+KFAH T N  IL+A   A ++H+IDF I QG+QW A
Sbjct  71    THSNLNDEQLQTAFHLLNHVVPYTKFAHFTVNDIILQAFNGADRVHVIDFDIKQGLQWPA  130

Query  429   LLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP  608
             L Q+LA R  G P  IRI+GI            LL TG+RL +FA+  ++ F F  V+  
Sbjct  131   LFQSLAERECGPPSHIRITGI------GECKDDLLETGDRLAEFAEEFNIPFSFHAVIDR  184

Query  609   IHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSP  788
             +  +      V  +E +AVN + Q + LL ++  T+   L L  S  P +V + E E S 
Sbjct  185   LEDVRLWMLHVKENEAVAVNCISQFHRLLYDSGETIKDFLNLIGSTKPRVVAIVEQEGSH  244

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAK  962
             N   F  RF  +LKYYSAIF+SL+ N++R+S  RV+VE  L    I  ++  E  E+  +
Sbjct  245   NSPHFEGRFLESLKYYSAIFDSLEANLSRESCVRVQVEQ-LFALEIRNILSCEGAERVER  303

Query  963   TECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF  1142
              E         D   W +L+  + F  V +   A++QA+ILL    + S    + +  G 
Sbjct  304   HE---------DTARWSVLLSQSDFVNVPLEDSANTQAQILL--RMFDSDGYTLTAENGS  352

Query  1143  LSLAWNDEPLLTVSSW  1190
             L+L W ++PLLTVS+W
Sbjct  353   LTLGWVEQPLLTVSAW  368



>ref|XP_008806184.1| PREDICTED: scarecrow-like protein 18 [Phoenix dactylifera]
Length=420

 Score =   204 bits (520),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 141/383 (37%), Positives = 207/383 (54%), Gaps = 27/383 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             + CA L      +A + +I +  ++S   GD T+R+ + F+ AL   + +     P +F 
Sbjct  43    IGCAELIHRADYSAARRIISLLSTISSPHGDSTDRLVHQFTRALSLHIDSLTHLLPPSFF  102

Query  261   ASS-EELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             +S+ + L  SY +LN   P+ +FAHLTANQAILEA +    IHI+DF    G+QW  LLQ
Sbjct  103   SSNGDTLQSSYLSLNKVTPFLRFAHLTANQAILEAVDGRQSIHILDFDTSHGVQWPPLLQ  162

Query  438   ALATRS--GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPV----  599
             A+A RS    +P S+RI+G  + +        L  TG+RL+ FA  L L F+F P+    
Sbjct  163   AIAERSEPSNRP-SVRITGTGTDL------DVLHRTGDRLKAFASSLGLRFQFHPLHLPT  215

Query  600   LGPIHSLNGSSFRVDPDEILAVNFMLQLYNLL-----DETTATVGTALKLANSLNPSIVT  764
               P  S + SSF+  P E LAVN  L L+ LL     D+    +   L+    +NP++VT
Sbjct  216   TNPDTSASFSSFQPHPGETLAVNCTLFLHKLLRDRGSDDPACKLMGFLRAVKEMNPAVVT  275

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             + E E + N   FL+RF  AL +Y+A+FESL+  +   S ER +VE + LGR I +++  
Sbjct  276   VAEREANHNSPVFLQRFMEALDHYAAVFESLEATLPPKSRERQEVEEMWLGREIEDIVGK  335

Query  945   EEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
             E +  +      E        W  LM   GF ++ +S +A +QAK+LL  +  S  Y LI
Sbjct  336   EGEERRERHERFEW-------WEALMRGRGFSSLQLSPFALTQAKLLLRLHYPSEGYQLI  388

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
                   L LAW  +PL +VSSWH
Sbjct  389   QMSKNCLFLAWQHKPLFSVSSWH  411



>ref|XP_001785259.1| PAL1B encoding AtPAT1-like protein [Physcomitrella patens]
 gb|EDQ49911.1| PAL1B encoding AtPAT1-like protein [Physcomitrella patens]
Length=355

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 180/359 (50%), Gaps = 17/359 (5%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS---SEELTLSYKALND  305
             + ++   VS  GDP +R+A Y  E L  R++ S +    +       + +L  + + L +
Sbjct  8     IAQLNQEVSIHGDPMQRLAAYMVEGLVARVAASGKSIYTSLKCKEPPTRDLLSAMQILYE  67

Query  306   ACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRIS  485
              CPY KF ++ AN AI EA +  S++HIIDF I QG QW  L++ALA R GG P  +RI+
Sbjct  68    VCPYFKFGYMAANGAIAEAFQNESRVHIIDFQIAQGTQWTTLIRALAARPGGPPH-VRIT  126

Query  486   GIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAV  665
             GI  P+ G +P   +   G RL + A+ + + F F PV      +          E LAV
Sbjct  127   GIDDPMPGPTPNVGVEMVGKRLANLAEAVGVPFVFHPVAKKGTEIEAWMLERQQGEALAV  186

Query  666   NFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             NF LQL+++ DE+  T       L +   LNP ++TL E E + N   F  RF  AL YY
Sbjct  187   NFALQLHHMPDESVCTSNPRDRMLHMIKGLNPKVMTLVEQESNTNTAPFFPRFLEALSYY  246

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRI  1016
             SAIFESLD  + R+S ERV VE   L R I  ++         E ++     E    WR 
Sbjct  247   SAIFESLDITLARESKERVNVEQQCLARDIVNII-------ACEGIDRVERHEMMGKWRA  299

Query  1017  LMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
              +  AGF+   +S   ++  K LL      S    +    G L L W + PL+  S+WH
Sbjct  300   RLTMAGFRPYPLSQTVNNTIKTLL---ESYSDKYRLKEEGGALFLGWKNRPLIVSSAWH  355



>ref|XP_009411905.1| PREDICTED: protein MONOCULM 1-like [Musa acuminata subsp. malaccensis]
Length=489

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 142/366 (39%), Positives = 201/366 (55%), Gaps = 38/366 (10%)
 Frame = +3

Query  153   SVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASS-EELTLSYKALNDACPYSKFA  329
             + S  GD T+R+ + F+ AL  R+       P   DA+S E L  SY + N   P+ +FA
Sbjct  143   TASPYGDSTDRLVHQFARALSLRVER---LLPPVVDAASPEALQSSYLSFNQITPFLRFA  199

Query  330   HLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK-PDSIRISGIPSPVL  506
             HLTANQAILEA +   ++HI+DF    G+QW  LLQA+A RS  K P SIR++G  S + 
Sbjct  200   HLTANQAILEAVDGRRQVHILDFDTSHGLQWPPLLQAIAERSDPKDPPSIRVTGTGSNL-  258

Query  507   GNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS----------LNGSSFRVDPDEI  656
                    L  TG+RL+ FA  L+L+F+F P+L P  S          L  SSF++ P EI
Sbjct  259   -----EVLRRTGDRLQTFADSLNLHFQFHPLLLPSTSSNPLSSTSADLTSSSFQIHPGEI  313

Query  657   LAVNFMLQLYNLLDETTATVGTA-----LKLANSLNPSIVTLGEYEMSPNRVGFLKRFKN  821
             LAVN +L L+ LL +   + G+      L+   ++NP++VT+ E E S N   FL+RF  
Sbjct  314   LAVNCVLFLHKLLKDGGGSDGSHDLRAFLQAVRAMNPAVVTVAEREASHNSPIFLQRFTE  373

Query  822   ALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveve  995
             AL YY+A+FESL+  +   S ERV VE + L + I +++  E   +R + E         
Sbjct  374   ALDYYTAVFESLEATLPPTSRERVAVEQVWLSKEIEDVVSREGDGRRERHERF-------  426

Query  996   DKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLL  1175
               + W  LM  AGF  + +S +A SQA++LL  +  S  Y L      F  L W  + L 
Sbjct  427   --EWWEALMRRAGFTNLPLSPFALSQARLLLRLHYPSEGYQLQMVRDSFF-LGWQKKSLF  483

Query  1176  TVSSWH  1193
             +VSSWH
Sbjct  484   SVSSWH  489



>ref|XP_008811155.1| PREDICTED: scarecrow-like protein 18 [Phoenix dactylifera]
Length=410

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 142/384 (37%), Positives = 204/384 (53%), Gaps = 29/384 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEK-RPANF  257
             + CA L      +A + ++ +  ++S   GD T+R+ + F+ +L  R+        P+ F
Sbjct  42    ISCAELIHRADYSAARRILSLLSNISSPHGDSTDRLVHQFARSLSLRIDRLTHLISPSLF  101

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
               + + L  SY +LN   P+ +FAHLTANQAILEA +    IHI+DF    G+QW   LQ
Sbjct  102   SDNEDTLQSSYLSLNKVTPFLRFAHLTANQAILEAIDGHRSIHILDFDTSHGVQWPPFLQ  161

Query  438   ALATRSG-GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI-  611
             A+A RS      SIRI+G  + +        L  TG RL+ FA  L L F+F P+  P  
Sbjct  162   AIAERSDPSSLPSIRITGTGTGL------DVLRRTGERLQAFANSLGLRFQFHPLYLPTA  215

Query  612   -----HSLNGSSFRVDPDEILAVNFMLQLYNLL-----DETTATVGTALKLANSLNPSIV  761
                   SLN SSF++ P E LAVN ML L+ LL     D+    +   L    ++NP +V
Sbjct  216   DPDASASLN-SSFQLHPGETLAVNCMLFLHKLLKDGSSDDPACKLVAFLHAVKAMNPVVV  274

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             T+ E E + N   FL+RF  AL +Y+A+FESL+  +   SPER++VE + LGR I +++ 
Sbjct  275   TVAEREANHNSPIFLRRFMEALDHYTAVFESLEATLPPKSPERLEVEQVWLGREIEDIVG  334

Query  942   PEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysL  1121
              E +  K             + W  LM   GF ++ +S +A SQAK+LL  +  S  Y L
Sbjct  335   REGEGRKERHERF-------EWWEGLMRGRGFSSLPLSPFALSQAKLLLRLHYPSEGYQL  387

Query  1122  IDSPPGFLSLAWNDEPLLTVSSWH  1193
               S    L L W  +PL +VSSWH
Sbjct  388   PMSKNS-LFLGWQHKPLFSVSSWH  410



>ref|XP_002992412.1| hypothetical protein SELMODRAFT_135151, partial [Selaginella 
moellendorffii]
 gb|EFJ06562.1| hypothetical protein SELMODRAFT_135151, partial [Selaginella 
moellendorffii]
Length=371

 Score =   199 bits (507),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 185/359 (52%), Gaps = 23/359 (6%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN---FD-ASSEELTLSYKALN  302
             L +++   S  GD   RVA +F++ALY RL+ +  +       +D AS EE+  +Y  L 
Sbjct  27    LHQLKQLASPTGDSIHRVATHFTDALYARLNGTGYRSYTALRAYDPASLEEILGAYHILY  86

Query  303   DACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRI  482
               CPY KFAH T+NQAI EA E    +HIID  I+QG QW A +QALA R GG P  +RI
Sbjct  87    QVCPYIKFAHFTSNQAIFEAFEGEQSVHIIDLEILQGYQWPAFMQALAARQGGAP-HLRI  145

Query  483   SGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILA  662
             +G+  P+       ++  TG RL D A  L + FE+  V   +  L          E LA
Sbjct  146   TGVGMPL------EAVQETGKRLADLAATLRVPFEYHAVGERLEDLQSHMLHRRHGEALA  199

Query  663   VNFMLQLYNLLDETTATVGTALKLANSLN---PSIVTLGEYEMSPNRVGFLKRFKNALKY  833
             VN + + + L  +    V   +++ + +    P IVTL E E S N   FLKRF  A+ Y
Sbjct  200   VNCIDRFHRLFTDDHLVVNPVVRILSMIREQAPRIVTLVEQEASHNTNSFLKRFLEAMHY  259

Query  834   YSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWR  1013
             YSAIF+SL+  + + SPER KVE ++    I  ++         E  +  V  E  D W 
Sbjct  260   YSAIFDSLEATLPQVSPERAKVEQVVFSSEIMNIV-------ACEGSQRIVRHEKVDKWC  312

Query  1014  ILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
              +MES GF  VA+S  A  Q+K+LL  Y       + D   G L L W D  ++  S+W
Sbjct  313   KIMESIGFYNVALSPSAVHQSKLLLRLYQTDGYTLVEDK--GCLLLGWQDRAIIGASAW  369



>ref|XP_010928164.1| PREDICTED: scarecrow-like protein 18 [Elaeis guineensis]
Length=412

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 143/387 (37%), Positives = 206/387 (53%), Gaps = 32/387 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSV-SQLGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             + CA L      +A + ++ +  ++ S  GD T+R+ + F+ AL  R+        ++  
Sbjct  41    ISCAELIHRADYSAARRILSLLSTICSPHGDSTDRLVHQFARALSLRIDRVLTHLISSSM  100

Query  261   ASSEELTL---SYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
              SS E T+   SY +LN   P+ +FAHLTANQAILEA +    IHI+DF    G+QW   
Sbjct  101   FSSNEDTIQSSSYLSLNKVTPFLRFAHLTANQAILEAIDGRRSIHILDFDTSHGVQWPPF  160

Query  432   LQALATRSG-GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP  608
             LQA+A RS      SIRI+G  + +        L  TG+RL+ FA  L L F+F P+  P
Sbjct  161   LQAMAERSDPSSLQSIRITGTGTDL------DVLHRTGDRLQAFANSLGLRFQFHPLYLP  214

Query  609   -------IHSLNGSSFRVDPDEILAVNFMLQLYNLL-----DETTATVGTALKLANSLNP  752
                      SLN SSF++ P E LAVN +L L+ LL     D+    +   L    ++NP
Sbjct  215   TTNPDATTTSLN-SSFQLHPGETLAVNCILFLHKLLRDRTGDDPACKLVAFLHAVKAMNP  273

Query  753   SIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAE  932
              +VT+ E E + N   FL+RF  AL +Y+A+FESL+  +   SPER++VE + LGR I +
Sbjct  274   VVVTVAEREATHNSPVFLRRFMEALDHYTAVFESLEATLPPKSPERLEVEQVWLGREIED  333

Query  933   LMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysss  1112
             ++  E +  K             + W  LM   GF ++ +S +A SQAK+LL  +  S  
Sbjct  334   IVGREGEGRKERHERF-------EWWEGLMRDRGFSSLPLSPFALSQAKLLLRLHYPSEG  386

Query  1113  ysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             Y L  S    L L W  +PL +VSSWH
Sbjct  387   YQLQMSKNS-LFLGWQHKPLFSVSSWH  412



>ref|XP_010913242.1| PREDICTED: scarecrow-like protein 18 [Elaeis guineensis]
Length=409

 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 142/388 (37%), Positives = 208/388 (54%), Gaps = 38/388 (10%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEK-RPANF  257
             + CA+L      +  + +I    ++S   GD T+R+ + F+ AL  R+ N      P+ F
Sbjct  40    ISCAKLIHRADYSDARRIISFLSTISSPHGDSTDRLIHQFTRALSLRIDNLTHLLSPSLF  99

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
              ++ + L  SY +LN   P+ +FAHLTANQAILEA +    IHI+DF  + G+QW  LLQ
Sbjct  100   SSNGDTLQSSYLSLNKVTPFLRFAHLTANQAILEAIDGRQSIHILDFNTLHGVQWPPLLQ  159

Query  438   ALATRSGGKPD--SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPV-LGP  608
             A+A RS    +  SIRI+G  + +        L  TG+RL  FA  L L F+F P+ L  
Sbjct  160   AIAERSDDPSNRPSIRITGTGADL------DVLHRTGDRLEAFANSLGLRFQFHPLYLST  213

Query  609   IHSLNGS---SFRVDPDEILAVNFMLQLYNLLDETTAT------VGTALKLANSLNPSIV  761
              +   G+   SF++ P E LAVN +L L+ LL + ++T      +   L+   ++ P +V
Sbjct  214   TNVDTGAGLRSFQLHPGETLAVNCVLFLHKLLKDGSSTDDPPCELMAFLRAVKAMKPVVV  273

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             T+ E E + N   FL+RF  AL +Y+A+FESL+  +   S ER +VE L LGR I +++ 
Sbjct  274   TVAEREANHNSPVFLQRFMEALDHYTAVFESLEATLPPKSQERREVEELWLGREIEDIVS  333

Query  942   PE-----EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynys  1106
              E     E+ A+ E             W  LM   GF +V +S +A SQAK+LL  +  S
Sbjct  334   REGEGRRERHARFEW------------WEGLMRDRGFSSVQLSPFAFSQAKLLLRLHYPS  381

Query  1107  ssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
               Y L  S    L L W  +PL +VSSW
Sbjct  382   EGYQLQMS-KNCLFLGWQHKPLFSVSSW  408



>ref|XP_001778507.1| predicted protein [Physcomitrella patens]
 gb|EDQ56680.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 141/399 (35%), Positives = 193/399 (48%), Gaps = 58/399 (15%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS-----------------------  227
             E A   L  +R  VS  GD +ERVA  F EAL  R S                       
Sbjct  20    ERARPLLQVLRRQVSSTGDSSERVASCFFEALATRFSRVSGTEVILAFCGFVGNLFSRTT  79

Query  228   -------------NSPEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATE  368
                          +SP + P     SSEE+  ++ ALN   P+ +FAHLTANQA+LEA  
Sbjct  80    NICFRFAVINELLSSPTQEP-----SSEEILSAFLALNQVTPFMRFAHLTANQALLEALT  134

Query  369   KASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI---RISGIPSPVLGNSPAASLLAT  539
                 +HI+D  I  G+QW   +QALA   G +  +I   RI+G+            L  T
Sbjct  135   GEDFVHIVDLDIGHGVQWPPFMQALADIRGEEGHTIQHLRITGV------GKDREMLDRT  188

Query  540   GNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG  719
             G RL +FA+ + L FEF P++    +L  S F +   E +A N MLQL+ LL + +  + 
Sbjct  189   GTRLAEFAQSIQLPFEFTPLVQAPENLIPSMFGLRIGEAVAFNCMLQLHQLLAKGSEKLT  248

Query  720   TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKV  899
             + L +  SL P +VTL E E S N+  FL RF  AL +YS +F+SLD  +   SPER++V
Sbjct  249   SFLYMLESLTPRVVTLAELEASHNQPHFLDRFAEALNHYSTLFDSLDATLPPTSPERIRV  308

Query  900   ESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAK  1079
             E       I  ++         +  E  V  +  + WR   E AGF+ +  S +A SQA+
Sbjct  309   EQTWYKMEIINIV-------ACDGTERTVRHQRCEQWRRFFERAGFQLLPTSRFATSQAR  361

Query  1080  ILLWnynysssysLI-DSPPGFLSLAWNDEPLLTVSSWH  1193
             +LL  +     Y L+ D   G L L W D PL  VSSWH
Sbjct  362   LLLRLHYPCDGYRLVEDVEDGCLLLGWQDRPLFCVSSWH  400



>ref|XP_006338809.1| PREDICTED: protein SCARECROW-like [Solanum tuberosum]
Length=689

 Score =   204 bits (518),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 192/366 (52%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V+ +GD  +RVA  F+EAL  RL+ +   +P+         F  +S E+
Sbjct  343   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLAATLATKPSTSVPKPFNPFPPNSLEI  402

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  403   LKIYQILYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPG  462

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+     G+SP A +  TG  L + A+ L + FEF PV   +  L    F 
Sbjct  463   GAP-FLRITGV-----GSSPEA-VRETGRCLTELAQSLHVPFEFHPVGEQLEDLKAHMFN  515

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF 
Sbjct  516   RRIGEALAVNSVNRLHRV---PGNCIGNLLGMIRDQAPNIVTIVEQEASHNGPYFLGRFL  572

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R K+E  + G  I  ++  E  E+  + E        
Sbjct  573   EALHYYSAIFDSLDATFPGDSSQRAKLEQYIFGPEIMNIVSCEGMERMVRHE--------  624

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR +ME  GFK VA+S  A +Q+KILL  Y+        D+  G L L W D  +
Sbjct  625   -RLEKWRRVMEGKGFKGVALSANAVTQSKILLGLYSCDGYKLTEDN--GCLLLGWQDRAI  681

Query  1173  LTVSSW  1190
             L  S+W
Sbjct  682   LAASAW  687



>ref|XP_001782213.1| predicted protein [Physcomitrella patens]
 gb|EDQ52964.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 139/379 (37%), Positives = 203/379 (54%), Gaps = 35/379 (9%)
 Frame = +3

Query  84    VDCARLAVSQPEN--AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS--------  233
             + CA  A+S  +N  A   L ++ +  +  G   +RV  YF+E++ +RL  S        
Sbjct  40    LQCAE-AISADDNNQATAILPQLSELATPFGTSVQRVVAYFAESMGSRLVTSSLGICRPL  98

Query  234   PEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
             P K+PA    S++ +  + +  N+ CP+ KF+H TANQAI EA E    +HIID  I+QG
Sbjct  99    PCKQPA----SNQSIVSAMQVFNEICPFVKFSHFTANQAIAEAFEGKFNVHIIDVDIMQG  154

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
             +QW +L Q LA+R+GG P  + I+G     LG S A SL ATG RL+DFA    ++FEF 
Sbjct  155   LQWPSLFQVLASRAGGPP-HVHITG-----LGTS-AESLDATGKRLKDFAGSFGISFEFT  207

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGE  773
              +   + +++ S+ +V   + LAV++M   ++L D T + + T L L   LNP ++TL E
Sbjct  208   AIADKMSNVDISTLKVAFSDALAVHWM--HHSLYDVTGSDLDT-LSLIQKLNPKVITLVE  264

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ  953
              +   +   FL RF  AL YYSA+F+SL      DSPER  VE  LL   I  ++  +  
Sbjct  265   QDFRHSGT-FLSRFLEALHYYSAMFDSLGATCKDDSPERYMVEQQLLSCEIKNIVAFDGP  323

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
               K             D WR  +  AGFK V++S  A  QA +LL +      Y+L++  
Sbjct  324   GRKIN--------HKFDQWRDELSKAGFKPVSLSGKASHQAALLLQSLFPCDGYTLLEH-  374

Query  1134  PGFLSLAWNDEPLLTVSSW  1190
              G L L W D  L T S+W
Sbjct  375   SGSLKLGWKDLYLFTASAW  393



>ref|NP_001060115.1| Os07g0583600 [Oryza sativa Japonica Group]
 sp|Q8GVE1.1|CIGR2_ORYSJ RecName: Full=Chitin-inducible gibberellin-responsive protein 
2 [Oryza sativa Japonica Group]
 gb|AAL61821.1| chitin-inducible gibberellin-responsive protein [Oryza sativa 
Japonica Group]
 dbj|BAC55608.1| chitin-inducible gibberellin-responsive protein [Oryza sativa 
Japonica Group]
 dbj|BAF22029.1| Os07g0583600 [Oryza sativa Japonica Group]
 gb|EAZ04489.1| hypothetical protein OsI_26640 [Oryza sativa Indica Group]
 gb|EAZ40446.1| hypothetical protein OsJ_24900 [Oryza sativa Japonica Group]
 dbj|BAG93797.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93469.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00810.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 135/378 (36%), Positives = 196/378 (52%), Gaps = 20/378 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSP---EKRPA  251
             + CAR    +   A+  +I  +R  VS  G+P ER+  Y  E L  RL++S     K   
Sbjct  179   IACARAVEEKNSFAIDMMIPELRKIVSVSGEPLERLGAYMVEGLVARLASSGISIYKALK  238

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +   +IHIIDF I QG QW +L
Sbjct  239   CKEPKSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHISQGAQWISL  298

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P ++RI+GI   V   +    L   G RL   A +  + FEF P+    
Sbjct  299   LQALAARPGGPP-TVRITGIDDSVSAYARGGGLELVGRRLSHIASLCKVPFEFHPLAISG  357

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEM  782
               +  +   V P E LAVNF L+L+++ DE+ +T       L++  SL+P ++TL E E 
Sbjct  358   SKVEAAHLGVIPGEALAVNFTLELHHIPDESVSTANHRDRLLRMVKSLSPKVLTLVEMES  417

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQRA  959
             + N   F +RF   L YY+AIFES+D  + RD  ER+ +E   L R I  L+  E E+RA
Sbjct  418   NTNTAPFPQRFAETLDYYTAIFESIDLTLPRDDRERINMEQHCLAREIVNLIACEGEERA  477

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             +          E    W+  +  AGF+   +S   ++  + LL +Y+ +   +  D   G
Sbjct  478   E--------RYEPFGKWKARLTMAGFRPSPLSSLVNATIRTLLQSYSDNYKLAERD---G  526

Query  1140  FLSLAWNDEPLLTVSSWH  1193
              L L W   PL+  S+WH
Sbjct  527   ALYLGWKSRPLVVSSAWH  544



>ref|XP_010928897.1| PREDICTED: protein MONOCULM 1-like [Elaeis guineensis]
Length=430

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 143/405 (35%), Positives = 204/405 (50%), Gaps = 55/405 (14%)
 Frame = +3

Query  84    VDCARL-AVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             + CA L        A ++   +  + S  GD  +R+ + F+ AL  RL +      A+  
Sbjct  44    ISCAELIHCGDLPTARRTASLLSTAASPYGDSADRLTHQFARALSLRLDSLARLSLASPS  103

Query  261   A----SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAA  428
             A    SSE L  SY +LN   P+ +FAHLTANQAILEA + + +IHI+DF    G+QW  
Sbjct  104   APSLTSSEALQSSYLSLNQVTPFLRFAHLTANQAILEALDASPRIHILDFDTSHGVQWPP  163

Query  429   LLQALATRSGGK-PDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLG  605
             LLQA+A RS    P SIRI+G  + +        L  TG+RL+ FA  L L F+F P+L 
Sbjct  164   LLQAIAERSNAHGPPSIRITGTGTDL------GVLRRTGDRLQTFAHSLGLQFQFHPLLL  217

Query  606   PIHSLN-------------------GSSFRVDPDEILAVNFMLQLYNLL------DETTA  710
             PI   N                    SSF++ P E LAVN +L L+ L       D+ + 
Sbjct  218   PITGTNTTSPSTSILSTSTATTNLTSSSFQLHPGETLAVNCVLFLHKLFQDGRNEDDGSR  277

Query  711   TVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPER  890
              +   L+   ++NP +VT+ E E S N   FL+RF  AL YY+ +FESL+  +   S ER
Sbjct  278   ELRAFLEAVKAMNPGVVTVAEMEASHNSPIFLQRFMEALDYYTVVFESLEATLPPRSQER  337

Query  891   VKVESLLLGRRIAELM--RPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYA  1064
             + VE + LGR I +++    E +R + E             W  LM  AGF  + +S +A
Sbjct  338   LAVEQVWLGREIEDIIAHEGEGRRERHERFA---------RWEGLMRGAGFSNLPLSPFA  388

Query  1065  HSQAKILL---WnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
              SQAK+LL   +         + DS    + L W ++ L +VSSW
Sbjct  389   LSQAKLLLRLHYPSEGYQLQMVGDS----IFLGWQNKALFSVSSW  429



>gb|EMT07028.1| Chitin-inducible gibberellin-responsive protein 2 [Aegilops tauschii]
Length=1334

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/379 (36%), Positives = 196/379 (52%), Gaps = 22/379 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             + CAR   ++  +AV  ++  +R  VS  GDP +R+  Y  E L  RL++S     K   
Sbjct  969   ISCARAVEAKDMSAVDMMVPELRKMVSVSGDPHQRLGAYIVEGLVARLASSGHSIYKALK  1028

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +    IHIIDFGI QG QW  L
Sbjct  1029  CKEPRSSDLMSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDMIHIIDFGISQGAQWVPL  1088

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALATR GG P ++RI+GI   +   +    L   G RL   A +  + FEF  V    
Sbjct  1089  LQALATRPGGPP-TVRITGIDDSLSAYARGGGLDLVGRRLSHIAGLCKVPFEFHSVAVAG  1147

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               +      V P E LAVNF L+L+++ DE  +T       L+L  SL+P +VTL E E+
Sbjct  1148  DEVKEGHLMVIPGEALAVNFTLELHHIPDEAVSTANHRDRILRLVKSLSPKVVTLVEQEL  1207

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQR  956
             + N V F +RF   L YY+AIFES+D  + RD  ER+ +E   L R I  ++  E  E+ 
Sbjct  1208  NTNTVPFKQRFAETLDYYTAIFESIDLTLPRDDRERINMEQHCLAREIVNIVACEGAERV  1267

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
              + E             W+  +   GF+   +S   ++  + LL +Y+ +   +  D   
Sbjct  1268  ERHEVF---------GKWKGRLMMVGFRPCPLSSLVNATIRTLLQSYSANYQLAERD---  1315

Query  1137  GFLSLAWNDEPLLTVSSWH  1193
             G L L W ++PL+  S+WH
Sbjct  1316  GVLYLGWKNKPLVVSSAWH  1334



>ref|XP_001782936.1| PAL1A AtPAT1-like protein [Physcomitrella patens]
 gb|EDQ52234.1| PAL1A AtPAT1-like protein [Physcomitrella patens]
Length=355

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/359 (35%), Positives = 180/359 (50%), Gaps = 17/359 (5%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANF---DASSEELTLSYKALND  305
             + ++   VS  GDP +R+A Y  E L  R++ S +    +    D  + +L  + + L +
Sbjct  8     IAQLNQVVSIYGDPMQRLAAYMVEGLVARVAASGKGIYRSLKCKDPPTRDLLSAMQILYE  67

Query  306   ACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRIS  485
              CPY KF ++ AN +I EA +  S++HIIDF I QG QW  L+QALA R GG P  +RI+
Sbjct  68    VCPYFKFGYMAANGSIAEAFQNESRVHIIDFQIAQGTQWTTLIQALAARPGGPP-HLRIT  126

Query  486   GIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAV  665
             GI  P+ G +  A +   G RL   A+ + + F+F PV      +        P E LAV
Sbjct  127   GIDDPMPGPNSNAGVEMVGKRLAKLAEAVGVPFDFHPVAKKGPEVEAWMLERQPGEALAV  186

Query  666   NFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             NF L L+++ DE+  T       L +  +LNP +VTL E E + N   F  RF  A+ YY
Sbjct  187   NFALHLHHMPDESVCTSNPRDRILHMVKALNPKVVTLVEQESNTNTAPFFPRFLEAMNYY  246

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRI  1016
             +AIFESLD  + R+S ERV VE   L R I  ++         E ++     E    WR 
Sbjct  247   AAIFESLDITLARESKERVNVEQQCLARDIVNII-------ACEGIDRVERHEMMGKWRA  299

Query  1017  LMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
              +  AGF+   +S   ++  K LL      S    +    G L L W +  L+  S+W 
Sbjct  300   RLTMAGFRPYPLSQTVNNTIKTLL---ESYSDKYRLKDEGGALYLGWKNRSLIVSSAWQ  355



>ref|XP_001763820.1| predicted protein [Physcomitrella patens]
 gb|EDQ71462.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/364 (34%), Positives = 193/364 (53%), Gaps = 26/364 (7%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL--SNSPEKRPANFDASSEELTLSY  290
             E A + L  +    S  GD  +R+A +F+EAL  R+   ++P  +     +  ++   ++
Sbjct  25    EIATQKLEELYSHASLFGDSMQRIAAFFTEALAARIVGKDNPAYKNLMLQSHLDDYLSAF  84

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
               L   CPY +F H TANQAILEA E  S +HIID  ++QG QW   +Q+L+ R GG P 
Sbjct  85    TTLYKICPYFQFGHFTANQAILEAVEGYSVVHIIDMDLMQGFQWPGFIQSLSEREGGPP-  143

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
              ++I+G+       +   SL  TG RL  FA+   + FEF  V+G +  L+       P 
Sbjct  144   KLKITGV------GTSCTSLQDTGRRLAAFAETYGVPFEFHAVVGELEDLSPMELGAKPG  197

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E +AVN ++QL+ LL+     +   +    S++P ++TL E E + N   F+ RF  AL 
Sbjct  198   EAVAVNCVMQLHRLLNNGD-KLQNFISGLRSIHPVMLTLVEQEANHNTSSFMGRFVEALH  256

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE----QRAKTECveveveveD  998
             YY+A+F+SLD ++   S ER K+E L   ++I  ++  E     +R +T           
Sbjct  257   YYAAVFDSLDSSLPLASEERAKIEQLYFAQQIKNIVACEGADRIERHET-----------  305

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + W+  M+ AGF+   +S ++ +QAK+LL + +    Y L   P G +SL W D  LLT
Sbjct  306   LELWQKRMKLAGFRQWPLSSHSVTQAKLLL-SLSPCDGYCLSQQPGGSISLNWQDRSLLT  364

Query  1179  VSSW  1190
              S+W
Sbjct  365   ASTW  368



>ref|XP_002971092.1| hypothetical protein SELMODRAFT_95139 [Selaginella moellendorffii]
 gb|EFJ27690.1| hypothetical protein SELMODRAFT_95139 [Selaginella moellendorffii]
Length=375

 Score =   195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 129/361 (36%), Positives = 181/361 (50%), Gaps = 24/361 (7%)
 Frame = +3

Query  141   RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS---SEELTLSYKALNDAC  311
             R+   V   G P ER+A Y  E L  R+ +S                E+  + + + + C
Sbjct  29    RLNQVVCIYGQPMERLAAYMVEGLVARIQSSGTGLCRALRCKEPVGNEILSAMQVMYEVC  88

Query  312   PYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGI  491
             PY KF ++ AN AI EA +   ++HIIDF I QG Q+ AL+QALA R GG P ++RI+G+
Sbjct  89    PYIKFGYMAANGAIAEALKDEPRVHIIDFEIAQGTQYIALIQALARRPGGPP-TVRITGV  147

Query  492   PSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLGPIHSLNGSSFRVDPDEILAV  665
               P  G +    + A G RL   A    + FEF   PV G     + ++ +  P E LAV
Sbjct  148   GDPAAGVAAPGGVAAVGRRLAALAADHGVPFEFHAVPVSGA-GVTDAAALQRRPGEALAV  206

Query  666   NFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             NF +QL+++ DE+ +        L++A SL P IVTL E E + N   FL RFK +L YY
Sbjct  207   NFAMQLHHMPDESVSVSNPRDRLLRMAKSLGPKIVTLVEQEANTNTAPFLARFKESLSYY  266

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKDHW  1010
              A+FESLD  + R S ER+ VE   L R +  L+  E  E+  + E +           W
Sbjct  267   GAVFESLDVTLPRQSKERISVEQHCLARDLVNLIACEGAERIERHEVM---------GKW  317

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             R  M  AGFK   +S Y +     LL  Y      S  D   G + L W D  L++ S+W
Sbjct  318   RARMSMAGFKQYPLSRYVNQTISCLLKTYCDKYKLSEED---GVIYLGWLDRSLVSASAW  374

Query  1191  H  1193
             +
Sbjct  375   N  375



>ref|XP_002968015.1| GRAS family protein, partial [Selaginella moellendorffii]
 gb|EFJ31362.1| GRAS family protein, partial [Selaginella moellendorffii]
Length=504

 Score =   198 bits (503),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 132/359 (37%), Positives = 185/359 (52%), Gaps = 23/359 (6%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN---FD-ASSEELTLSYKALN  302
             L +++   S  GD   RVA +F++ALY RL+ +  +       +D AS EE+  +Y  L 
Sbjct  160   LHQLKQLASPTGDSIHRVATHFTDALYARLNGTGYRSYTALRAYDPASLEEILGAYHILY  219

Query  303   DACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRI  482
               CPY KFAH T+NQAI EA E    +HIID  I+QG QW A +QALA R GG P  +RI
Sbjct  220   QVCPYIKFAHFTSNQAIFEAFEGEQSVHIIDLEILQGYQWPAFMQALAARQGGAPH-LRI  278

Query  483   SGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILA  662
             +G+  P+       ++  TG RL D A  L + FE+  V   +  L          E LA
Sbjct  279   TGVGMPL------EAVQETGKRLADLAATLRVPFEYHAVGERLEDLQSHMLHRRHGEALA  332

Query  663   VNFMLQLYNLLDETTATVGTALKLANSLN---PSIVTLGEYEMSPNRVGFLKRFKNALKY  833
             VN + + + L  +    V   +++ + +    P IVTL E E + N   FLKRF  A+ Y
Sbjct  333   VNCIDRFHRLFTDDHLVVNPVVRILSMIREQAPRIVTLVEQEANHNTNSFLKRFLEAMHY  392

Query  834   YSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWR  1013
             YSAIF+SL+  + + SPER KVE ++    I  ++         E  +  V  E  D W 
Sbjct  393   YSAIFDSLEATLPQVSPERAKVEQVVFSSEIMNIV-------ACEGSQRIVRHEKVDKWC  445

Query  1014  ILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
              +MES GF  VA+S  A  Q+K+LL  Y       + D   G L L W D  ++  S+W
Sbjct  446   KIMESIGFYNVALSPSAVHQSKLLLRLYQTDGYTLVEDK--GCLLLGWQDRAIIGASAW  502



>ref|XP_003562815.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2 
[Brachypodium distachyon]
Length=549

 Score =   199 bits (505),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 134/379 (35%), Positives = 194/379 (51%), Gaps = 22/379 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             V CAR    +   A+  +I  +R  VS  G+P +R+  Y  E L  RL++S     K   
Sbjct  184   VACARAVEEKNGYAIDMMIPELRKMVSVSGEPLQRLGAYMVEGLVARLASSGHSIYKALK  243

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +   +IHIIDF I QG QW +L
Sbjct  244   CKEPKSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHISQGAQWISL  303

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P +++I+GI   V   +    L   G RL   A +  + FEF  V    
Sbjct  304   LQALAARPGGPP-TVKITGIDDSVSAYARDGGLDIVGRRLSHIAGLCKVPFEFHAVAISG  362

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               +      V P E LAVNF L+L+++ DET +T       L+L  SL+P+++TL E E 
Sbjct  363   DEVEERHLGVIPGEALAVNFTLELHHISDETVSTANHRDRILRLVKSLSPNVLTLVEQES  422

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQR  956
             + N   F++RF   L YY+AIFES+D  + RD  ER+ +E   L R I  L+  E  E+ 
Sbjct  423   NTNTAPFVQRFAETLDYYTAIFESIDLTLPRDDKERINMEQHCLAREIVNLVACEGSERV  482

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
              + E             W+  +  AGF+   +S   +   + LL +Y+ +   +  D   
Sbjct  483   ERHEVFGK---------WKARLMMAGFRPSPLSSLVNDTIRTLLQSYSVNYQLAERD---  530

Query  1137  GFLSLAWNDEPLLTVSSWH  1193
             G L L W + PL+  S+WH
Sbjct  531   GVLYLGWKNRPLVVSSAWH  549



>ref|XP_010315907.1| PREDICTED: DELLA protein RGL1-like [Solanum lycopersicum]
Length=680

 Score =   201 bits (510),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 139/366 (38%), Positives = 191/366 (52%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V+ +GD  +RVA  F+EAL  RL+ +   +P+         F  +S E+
Sbjct  334   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLAATLATKPSTSVPKPFNPFPPNSLEI  393

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  394   LKIYQILYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPG  453

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+     G+ P A +  TG  L + A+ L + FEF PV   +  L    F 
Sbjct  454   GAP-FLRITGV-----GSYPEA-VRETGRCLTELAQSLHVPFEFHPVGEQLEDLKPHMFN  506

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF 
Sbjct  507   RRIGEALAVNSVNRLHRV---PGNCIGNLLGMIRDQAPNIVTIVEQEASHNGPYFLGRFL  563

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R K+E  + G  I  ++  E  E+  + E        
Sbjct  564   EALHYYSAIFDSLDATFPGDSSQRAKLEQYIFGPEIMNIVSCEGMERMVRHE--------  615

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR +ME  GFK VA+S  A +Q+KILL  Y+        D+  G L L W D  +
Sbjct  616   -RLEKWRRVMEGKGFKGVALSANAVTQSKILLGLYSCDGYKLTEDN--GCLLLGWQDRAI  672

Query  1173  LTVSSW  1190
             L  S+W
Sbjct  673   LAASAW  678



>ref|XP_002512896.1| DELLA protein GAI1, putative [Ricinus communis]
 gb|EEF49399.1| DELLA protein GAI1, putative [Ricinus communis]
Length=686

 Score =   200 bits (508),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 140/369 (38%), Positives = 187/369 (51%), Gaps = 37/369 (10%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A K L  +   V+ LGD  +RVA  F+EAL  RL+ +   +P+N        + ++S E+
Sbjct  340   ARKYLHHLNRVVTPLGDSMQRVASCFTEALSARLAATLTTQPSNTAPKPYSSYPSNSMEI  399

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  400   LKIYQIVYQACPYIKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPG  459

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+ S +       S+  TG  L + A  L + FEF PV   +  L    F 
Sbjct  460   GAP-FLRITGVGSCI------ESVRETGRCLTELAHSLHVPFEFHPVAEELEDLKPHMFN  512

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+++       +   L +     P+IVT+ E E S N   FL RF 
Sbjct  513   RRVGEALAVNSVNRLHHVPGNCLPNL---LAMIRDQAPNIVTIVEKEASHNGPYFLGRFL  569

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLG---RRIAELMRPE--EQRAKTECveve  983
              AL YYSAIF+SLD     DS +R KVE  +     R I     PE  E+  + E     
Sbjct  570   EALHYYSAIFDSLDATFPPDSTQRAKVEQYIFAPEIRNIVACEGPERTERHERLE-----  624

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
                     WR LME  GFK V +S  A +Q+KILL  Y+        D   G L L W D
Sbjct  625   -------KWRKLMEGKGFKGVPLSANAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQD  675

Query  1164  EPLLTVSSW  1190
               +L  S+W
Sbjct  676   RAILAASAW  684



>ref|XP_010913983.1| PREDICTED: protein MONOCULM 1-like [Elaeis guineensis]
Length=433

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/377 (36%), Positives = 194/377 (51%), Gaps = 54/377 (14%)
 Frame = +3

Query  168   GDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQ  347
             GD  +R+A+ F+ AL  RL++     P  FD SSE L  SY +LN   P+ +FAHLTANQ
Sbjct  76    GDSADRLAHQFARALSLRLASPSPSVP--FDTSSEALQSSYLSLNQVTPFLRFAHLTANQ  133

Query  348   AILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK-PDSIRISGIPSPVLGNSPAA  524
             AIL+A     +IHI+D     G+QW  LLQA+A RS  + P SIRI+G  + +       
Sbjct  134   AILDALHGCRRIHILDLDTSHGVQWPPLLQAIADRSYAEGPPSIRITGTGTDL------D  187

Query  525   SLLATGNRLRDFAKVLDLNFEFEPVLGPIH-------------------------SLNGS  629
              L  TG+RL+ FA  L L F+F P+L PI                          +L  S
Sbjct  188   VLRRTGDRLQTFAHSLGLQFQFHPLLLPISSTSPGSSTSTSIPLITTAAGGGGSSNLTSS  247

Query  630   SFRVDPDEILAVNFMLQLYNLL------DETTATVGTALKLANSLNPSIVTLGEYEMSPN  791
             SF++ P E LAVN +L L+ LL      D+ +  +   L+   ++NP +VT+ E E S N
Sbjct  248   SFQLHPGETLAVNCVLFLHKLLKDSRHEDDGSRELRAFLQAVKAMNPVVVTVAEREASHN  307

Query  792   RVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTEC  971
                FL+R   AL YY+ +FESL+  +   S ER+ VE + LGR I +++  E +  +   
Sbjct  308   SPNFLQRLMEALDYYTVVFESLEATLPPKSQERLAVEQVWLGREIEDIVAREGEGRRERH  367

Query  972   veveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL---WnynysssysLIDSPPGF  1142
                E           LM  AGF  + +S +A SQAK+LL   +         + DS    
Sbjct  368   ERFERWEG-------LMRDAGFSNLPLSPFALSQAKLLLRLHYPSEGYQLEMVRDS----  416

Query  1143  LSLAWNDEPLLTVSSWH  1193
             + L W ++ L +VSSWH
Sbjct  417   IFLGWQNKALFSVSSWH  433



>ref|XP_009613034.1| PREDICTED: DELLA protein RGL1-like [Nicotiana tomentosiformis]
Length=707

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 187/367 (51%), Gaps = 32/367 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS---------SEE  275
             A + L  +   V+ +GD  +RVA  F+EAL  RL+ +   +P    A          S E
Sbjct  360   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLTATLATKPNTSSAPKPFNPFPPNSLE  419

Query  276   LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRS  455
             +   Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R 
Sbjct  420   ILKIYQILYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARP  479

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
             GG P  +RI+G+     G SP A +  TG  L + A  L + FEF PV   +  L    F
Sbjct  480   GGAP-FLRITGV-----GPSPEA-VKETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMF  532

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRF  815
                  E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF
Sbjct  533   NRRIGEALAVNSVNRLHRV---PVNCIGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRF  589

Query  816   KNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveve  989
               AL YYSAIF+SLD     DS +R K+E  +    I  ++  E  E+  + E       
Sbjct  590   LEALHYYSAIFDSLDATFPADSSQRAKLEQYIFAPEIMNIVSCEGAERVVRHE-------  642

Query  990   veDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEP  1169
                 + WR LME  GFK VA+S  A +Q+KILL  Y+        D+  G L L W D  
Sbjct  643   --RLEKWRRLMEGKGFKGVALSANAVTQSKILLGLYSCDGYKLTEDN--GCLLLGWQDRA  698

Query  1170  LLTVSSW  1190
             +L  S+W
Sbjct  699   ILAASAW  705



>ref|XP_007020290.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY11815.1| GRAS family transcription factor [Theobroma cacao]
Length=438

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 146/402 (36%), Positives = 206/402 (51%), Gaps = 47/402 (12%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQL-GDPTERVAYYFSEAL---YNRLS--------  227
             + CA L       A   L+ I  S S L GD TER+ + F++AL    NRL         
Sbjct  52    ISCAELVSQSDFPAANRLLSILSSNSCLYGDSTERLVHQFTKALSLRINRLHGPGSLLMM  111

Query  228   ---NSPEKRPA-------NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKAS  377
                N P            N+D     L   Y +LN   P+ +FAHLTANQAILEA +   
Sbjct  112   MNINYPIAAATATATAIANYDIDPS-LQSCYLSLNQITPFIRFAHLTANQAILEAIQVGQ  170

Query  378   K-IHIIDFGIVQGIQWAALLQALATRSGGK---PDSIRISGIPSPVLGNSPAASLLATGN  545
             + IHI+DF I+ G+QW  L+QALA RS      P  +RI+G    +        L  TG+
Sbjct  171   QSIHILDFDIMHGVQWPPLMQALAERSANTLHPPPMLRITGTGHDL------NILQRTGD  224

Query  546   RLRDFAKVLDLNFEFEPVL----GPIH-SLN-GSSFRVDPDEILAVNFMLQLYNLLDETT  707
             RL  FA+ L L F+F P+L     P   +LN  S+  + PDE LAVN M  L+ LL + +
Sbjct  225   RLFKFAQSLGLRFQFHPLLVLNNDPTSVALNLPSTLTILPDEALAVNCMFYLHRLLKDDS  284

Query  708   ATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPE  887
               +   L    ++NP++VT+ E E + N   FL+RF  AL YY+AIF+SL+  +  +S E
Sbjct  285   RDLRLFLHNIKAMNPAVVTIAEREANHNHPLFLQRFIEALDYYTAIFDSLEATLPPNSRE  344

Query  888   RVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAH  1067
             R+ VE +  GR I +++  E +  +     +       + W +++ S GF  V +S +AH
Sbjct  345   RLAVEQIWFGREIVDIVAAEGENRRERHERL-------ETWEVILRSTGFSNVPLSPFAH  397

Query  1068  SQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             SQAK+LL  +  S  Y L      F  L W +  L +VSSWH
Sbjct  398   SQAKLLLRLHYPSDGYRLQILNNSFF-LGWQNRALFSVSSWH  438



>gb|KDO63869.1| hypothetical protein CISIN_1g045762mg, partial [Citrus sinensis]
Length=373

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 186/366 (51%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS--------PEKRPANFDASSEEL  278
             A + L  +   VS LGD  +RVA  F+EAL  RL+ +             + F  +S E+
Sbjct  27    ARRYLHHLNRVVSPLGDSMQRVASCFTEALSARLAATLTTKPSTSTPTPFSPFPPNSLEV  86

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  87    LKIYQIVYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPG  146

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+ + +       S   TG  L + A  L + FEF PV   +  L    F 
Sbjct  147   GAP-FLRITGVGATI------ESAKETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMFN  199

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +    +  +G  L +     P+IVT+ E E S N   FL RF 
Sbjct  200   RRVGEALAVNAVNRLHRV---PSNCLGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFL  256

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E  E+ A+ E        
Sbjct  257   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGGERTARHE--------  308

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR +ME  GF+ V +S  A +Q+KILL  Y+        D+  G L L W D  L
Sbjct  309   -RLEKWRKIMEGKGFRGVPLSANAVTQSKILLGLYSCDGYRLTEDN--GCLLLGWQDRAL  365

Query  1173  LTVSSW  1190
             L  S+W
Sbjct  366   LAASAW  371



>ref|XP_009803754.1| PREDICTED: DELLA protein RGL2-like [Nicotiana sylvestris]
Length=713

 Score =   199 bits (505),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 187/367 (51%), Gaps = 32/367 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS---------SEE  275
             A + L  +   V+ +GD  +RVA  F+EAL  RL+ +   +P+   A          S E
Sbjct  366   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLAATLATKPSTSSAPKPFNPFPPNSLE  425

Query  276   LTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRS  455
             +   Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R 
Sbjct  426   ILKIYQILYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARP  485

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
             GG P  +RI+G+     G SP A +  TG  L + A  L + FEF PV   +  L    F
Sbjct  486   GGAP-FLRITGV-----GPSPEA-VRETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMF  538

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRF  815
                  E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF
Sbjct  539   NRRIGEALAVNSVNRLHRV---PVNCIGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRF  595

Query  816   KNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveve  989
               AL YYSAIF+SLD     DS +R K+E  +    I  ++  E  E+  + E       
Sbjct  596   LEALHYYSAIFDSLDATFPADSSQRAKLEQYIFAPEIMNIVSCEGAERVVRHE-------  648

Query  990   veDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEP  1169
                 + WR LME  GFK V +S  A +Q+KILL  Y+        D+  G L L W D  
Sbjct  649   --RLEKWRRLMEGKGFKGVPLSANAVTQSKILLGLYSCDGYKLTEDN--GCLLLGWQDRA  704

Query  1170  LLTVSSW  1190
             +L  S+W
Sbjct  705   ILAASAW  711



>gb|ABD84026.1| putative chitin-inducible gibberellin-responsive protein [Bambusa 
ventricosa]
Length=545

 Score =   196 bits (499),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 131/379 (35%), Positives = 192/379 (51%), Gaps = 22/379 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLS---NSPEKRPA  251
             + CAR        A+  +I  +R  VS  G+P ER+  Y  E L  RL+   NS  K   
Sbjct  180   IACARAVEENNSFAIDLIIPELRKMVSVSGEPVERLGAYMVEGLVARLASSGNSIYKALK  239

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACP+ KF +++AN AI+EA +   +IHIIDF I QG QW +L
Sbjct  240   CKEPRSSDLLSYMHFLYEACPFFKFGYMSANGAIVEAVKGEDRIHIIDFHISQGTQWISL  299

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P ++RI+GI   V   +    L   G RL   A +  + FEF  V    
Sbjct  300   LQALAARPGGPP-TVRITGIDDSVSAYARGGGLELVGRRLSHIAGLCKVPFEFHAVAISG  358

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               +      V P E +AVNF L+L+++ DET +T       L+L   ++P +VTL E E 
Sbjct  359   SEVEEGHLGVIPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGMSPKVVTLVEQES  418

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQR  956
             + N   F++RF   L YY+A+FES+D  + R+  ER+ +E   L R I  L+  E  E+ 
Sbjct  419   NTNTAPFVQRFAKTLDYYTAVFESIDLTLPREDKERINMEQHCLAREIVNLVACEGAERV  478

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
              + E             W+  +  AGF    +S   ++  + LL +Y+ +   +  D   
Sbjct  479   ERHELFGK---------WKARLTMAGFSPSPLSSLVNATIRTLLQSYSMNYQLAERD---  526

Query  1137  GFLSLAWNDEPLLTVSSWH  1193
             G L L W + PL+  S+WH
Sbjct  527   GVLYLGWKNRPLVVSSAWH  545



>ref|XP_008798776.1| PREDICTED: scarecrow-like protein 18 [Phoenix dactylifera]
Length=418

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 197/364 (54%), Gaps = 33/364 (9%)
 Frame = +3

Query  153   SVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANF--DASSEELTLSYKALNDACPYSKF  326
             + S  GD  +R+A+ F+ AL  RL+        +   D SSE L  SY +LN   P+ +F
Sbjct  71    AASPYGDSADRLAHQFARALSLRLARLARLASPSVPSDTSSEALQSSYLSLNQVTPFLRF  130

Query  327   AHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK-PDSIRISGIPSPV  503
             AHLTANQAIL+A     +IHI+D     G+QW  LLQA+A RSG   P SIRI+G  + +
Sbjct  131   AHLTANQAILDALHGCRRIHILDLDTSHGVQWPPLLQAIADRSGADVPPSIRITGTGTDL  190

Query  504   LGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS------LNGSSFRVDPDEILAV  665
                     L  TG+RL+ FA+ L L F+F P+L P  S       +G+S  + P E LAV
Sbjct  191   ------DVLRRTGDRLQTFARSLGLQFQFHPLLLPPSSTIGTSLCSGNSTSILPGETLAV  244

Query  666   NFMLQLYNLL------DETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNAL  827
             N +L L+ LL      D+ +  +   L+   ++NP++VT+ E E S N   FL+RF  AL
Sbjct  245   NCVLFLHKLLKDSRHEDDGSRELRAFLQAVKAMNPAVVTVAEREASHNSPIFLQRFMEAL  304

Query  828   KYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM--RPEEQRAKTECveveveveDK  1001
              YY+ +FESL+  +   S ER+ VE + LGR I +++    E +R + E           
Sbjct  305   DYYTVVFESLEATLPPKSQERLAVEQVWLGREIEDIVAWEGEGRRERHERFA--------  356

Query  1002  DHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTV  1181
               W  LM  AGF  + +S +A SQAK+LL  +  S  Y L       + L W ++ L +V
Sbjct  357   -RWEGLMRDAGFSNLPLSPFALSQAKLLLRLHYPSEGYQL-QMVRDCIFLGWQNKALFSV  414

Query  1182  SSWH  1193
             SSWH
Sbjct  415   SSWH  418



>ref|XP_009765072.1| PREDICTED: scarecrow-like protein 18 [Nicotiana sylvestris]
Length=407

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 141/386 (37%), Positives = 202/386 (52%), Gaps = 33/386 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRL-----SNSPEKR  245
             + CA L      +A   L+ I  + S   GD TER+ + F+ AL  RL     S +    
Sbjct  37    ISCAELISRSDFSAANRLLTILSTNSSPFGDSTERLVHQFTRALSLRLNRYISSATNFLT  96

Query  246   PANFDASSEELTL---SYKALNDACPYSKFAHLTANQAILEA-TEKASKIHIIDFGIVQG  413
             P+N   SS +  L   SY +LN   P+ +F+ LTANQAILEA  +    IHI+DF I  G
Sbjct  97    PSNVVESSNDSALLQSSYLSLNQVTPFIRFSQLTANQAILEAINDNQQAIHIVDFDINHG  156

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
             +QW  L+QALA R    P ++RI+G      GN    +L  TG+RL  FA  L L F+F 
Sbjct  157   VQWPPLMQALADRY--PPPTLRITGT-----GND-LDTLRRTGDRLAKFAHSLGLRFQFH  208

Query  594   PVLGPIHSLNG------SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPS  755
             P+L   ++ N       SS  + PDE LA+N +  L+ LL +    +   L    S+NP 
Sbjct  209   PLLITNNNDNDHDPSIISSIVLLPDETLAINCVFYLHRLLKDR-EKLRIFLHRIKSMNPK  267

Query  756   IVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAEL  935
             +VTL E E + N   FL+RF  AL YY+A+F+SL+  +   S ER+ VE +  GR I ++
Sbjct  268   VVTLAEREANHNHPLFLQRFVEALDYYAAVFDSLEATLPPSSRERMTVEQVWFGREIIDI  327

Query  936   MRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssy  1115
             +  E  + +               W +++ S GF  VA+S +A SQAK+LL  +  S  Y
Sbjct  328   VAAEGDKRRERHERFRS-------WEVMLRSCGFSNVALSPFALSQAKLLLRLHYPSEGY  380

Query  1116  sL-IDSPPGFLSLAWNDEPLLTVSSW  1190
              L + S      L W ++PL ++SSW
Sbjct  381   QLSVSSTSNSFFLGWQNQPLFSISSW  406



>gb|AEE69131.1| GRAS family transcription factor [Citrus medica var. sarcodactylis]
Length=411

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 141/377 (37%), Positives = 190/377 (50%), Gaps = 22/377 (6%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPANFD  260
             CA+   +    A +SL+   R  VS  GDP +R+  Y  E L  RL++S     +     
Sbjct  48    CAKAIENNDMYAAESLMAESRQMVSVSGDPIQRLGAYMLEGLIARLASSGSSIYKALRCK  107

Query  261   ASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
               +    LSY   L + CPY KF +++AN AI EA +  +KIHIIDF I QG QW  L+ 
Sbjct  108   EPASAALLSYMHLLYEICPYFKFGYMSANGAIAEAMKDENKIHIIDFLIAQGSQWIILIM  167

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLGPI  611
             ALA+R GG P  IRI+GI  PV   +    L A G RL   ++  ++  EF   PV  P 
Sbjct  168   ALASRPGGPP-HIRITGIDDPVSKYARGDGLEAVGRRLAAISQKFNILVEFNPIPVFAPD  226

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
              +L     R  P E LAVNF LQL++  DE+          L++  SLNP +VTL E E 
Sbjct  227   VTLEMLGVR--PGEALAVNFPLQLHHTPDESVDLNNPRDGLLRMIKSLNPKVVTLVEQES  284

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAK  962
             + N   FL RF   L YY A+FES+D  M RD  ER+ VE   L R I  ++   E R +
Sbjct  285   NTNTAAFLPRFVETLNYYLAMFESIDVTMPRDQKERINVEQHCLARDIVNVIAC-EGRER  343

Query  963   TECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF  1142
              E  E+         WR     AGF+   +S Y +S  + LL  Y+   +    D   G 
Sbjct  344   VERHELL------GKWRSRFTMAGFRQCTLSSYVNSVIRNLLRCYSDHYTLVETD---GA  394

Query  1143  LSLAWNDEPLLTVSSWH  1193
             + L W D  L++ S+WH
Sbjct  395   MLLGWKDRALVSASAWH  411



>ref|XP_004958142.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Setaria italica]
Length=547

 Score =   196 bits (498),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 193/378 (51%), Gaps = 20/378 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLS---NSPEKRPA  251
             + CAR        A+  +I  +R  VS  G+P ER+  Y  E L  RL+   NS  K   
Sbjct  182   IACARAVEQNNSFAIDLMIPELRKMVSVSGEPLERLGAYMVEGLVARLASSGNSIYKALK  241

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +   +IHIIDF I QG QW +L
Sbjct  242   CKEPKSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQWISL  301

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P  +RI+GI   V   +    L   G RL   A +  + F+F  V    
Sbjct  302   LQALAARPGGPP-FVRITGIDDSVSAYARGGGLELVGRRLSHIAGLYKVPFQFNAVAISG  360

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
             + +      + P E +AVNF L+L+++ DET +T       L+L  SL+P ++TL E E 
Sbjct  361   NEMEEGHLGIVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKSLSPKVLTLVEQES  420

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQRA  959
             + N   F +RF   L YY+AIFES+D  + R+  ER+ +E   L R I  L+  E E+R 
Sbjct  421   NTNTAPFAQRFAETLDYYTAIFESIDLALPREDRERINMEQHCLAREIVNLVACEGEERV  480

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             +   V  +        W+  +  AGF+   +S   ++  K LL +Y+     +  D   G
Sbjct  481   ERHEVFGK--------WKARLMMAGFRPSPLSALVNATIKTLLQSYSPDYKLAERD---G  529

Query  1140  FLSLAWNDEPLLTVSSWH  1193
              L L W + PL+  S+WH
Sbjct  530   VLYLGWKNRPLIVSSAWH  547



>gb|ACH47034.1| lateral suppressor protein [Nicotiana tabacum]
Length=407

 Score =   192 bits (489),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 141/386 (37%), Positives = 202/386 (52%), Gaps = 33/386 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRL-----SNSPEKR  245
             + CA L      +A   L+ I  + S   GD TER+ + F+ AL  RL     S +    
Sbjct  37    ISCAELISRSDFSAANRLLTILSTNSSPFGDSTERLVHQFTRALSLRLNRYISSATNFLT  96

Query  246   PANFDASSEELTL---SYKALNDACPYSKFAHLTANQAILEA-TEKASKIHIIDFGIVQG  413
             P+N   SS +  L   SY +LN   P+ +F+ LTANQAILEA  +    IHI+DF I  G
Sbjct  97    PSNVVESSNDSALLQSSYLSLNQVTPFIRFSQLTANQAILEAINDNQQAIHIVDFDINHG  156

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
             +QW  L+QALA R    P ++RI+G      GN    +L  TG+RL  FA  L L F+F 
Sbjct  157   VQWPPLMQALADRY--PPLTLRITGT-----GND-LDTLRRTGDRLAKFAHSLGLRFQFH  208

Query  594   PVLGPIHSLNG------SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPS  755
             P+L   ++ N       SS  + PDE LA+N +  L+ LL +    +   L    S+NP 
Sbjct  209   PLLITNNNDNDHDPSIISSIVLLPDETLAINCVFYLHRLLKDR-EKLRIFLHRIKSMNPK  267

Query  756   IVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAEL  935
             +VTL E E + N   FL+RF  AL YY+A+F+SL+  +   S ER+ VE +  GR I ++
Sbjct  268   VVTLAEREANHNHPLFLQRFVEALDYYAAVFDSLEATLPPSSRERMTVEQVWFGREIIDI  327

Query  936   MRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssy  1115
             +  E  + +               W +++ S GF  VA+S +A SQAK+LL  +  S  Y
Sbjct  328   VAAEGDKRRERHERFRS-------WEVMLRSCGFSNVALSPFALSQAKLLLRLHYPSEGY  380

Query  1116  sL-IDSPPGFLSLAWNDEPLLTVSSW  1190
              L + S      L W ++PL ++SSW
Sbjct  381   QLSVSSTSNSFFLGWQNQPLFSISSW  406



>ref|XP_004171790.1| PREDICTED: DELLA protein GAI1-like [Cucumis sativus]
Length=688

 Score =   198 bits (503),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 138/366 (38%), Positives = 187/366 (51%), Gaps = 34/366 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL-----SNSPEKRPANFDASSEELTLS  287
             A + L  +   V+ +GD  +RVA  F+EAL  RL     ++ P      F  +S E+   
Sbjct  345   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLAATLTTSKPSSSIPPFPQNSLEILKI  404

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
             Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R GG P
Sbjct  405   YQIVYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGGSP  464

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +RI+G+   +       ++  TG  L + A  L++ FEF  +   + SL  + F    
Sbjct  465   -FLRITGVGPSI------DAVRETGRCLTELAHSLNVPFEFHAIGEQLESLKPNMFNRRV  517

Query  648   DEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNAL  827
              E LAVN + +L+ +      ++G  L +     P+IVTL E E S N   FL RF  AL
Sbjct  518   GEALAVNAVNRLHRV---PGKSLGNLLGMIRDQAPNIVTLVEQEASHNGPYFLGRFLEAL  574

Query  828   KYYSAIFESLDPNMTRDSPERVKVESLLLG---RRIAELMRPE--EQRAKTECvevevev  992
              YYSAIF+SLD     DS +R KVE  +     R I     PE  E+  + E        
Sbjct  575   HYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLE--------  626

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR LME+ GFK VA+S  A +Q+KILL  Y+        D   G L L W D  L
Sbjct  627   ----KWRKLMEAKGFKGVALSSNAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRAL  680

Query  1173  LTVSSW  1190
             +  S+W
Sbjct  681   IAASAW  686



>ref|XP_006657889.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Oryza brachyantha]
Length=545

 Score =   196 bits (497),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 132/378 (35%), Positives = 194/378 (51%), Gaps = 20/378 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             + CAR    +   A+  +I  +R  VS  G+P ER+  Y  E L  RL++S     K   
Sbjct  180   IACARAVEEKNSFAIDLMITELRKMVSVSGEPLERLGAYMVEGLVARLASSGSSIYKALK  239

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +   +IHIIDF I QG QW +L
Sbjct  240   CKEPKSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHISQGAQWISL  299

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P ++RI+GI   V   +    L   G RL   A +  + FEF P+    
Sbjct  300   LQALAARPGGPP-TVRITGIDDSVSAYARGGGLELVGRRLSHIAGLCKVPFEFHPLAISG  358

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEM  782
               +  +   V P E +AVNF L+L+++ DE+ +T       L++   L+P ++TL E E 
Sbjct  359   SQVEEAHLGVLPGEAVAVNFTLELHHVPDESVSTANHRDRLLRMVKGLSPRVLTLVEMES  418

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQRA  959
             + N   F +RF   L YY+AIFES+D  + RD  ER+ +E   L R I  L+  E E+RA
Sbjct  419   NTNTAPFTQRFAETLDYYTAIFESIDLTLPRDDRERINMEQHCLAREIVNLVACEGEERA  478

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             +          E    W+  +  AG +   +S   ++  + LL +Y+     +  D   G
Sbjct  479   E--------RYEPFGKWKARLTMAGLRPSPLSSLVNATIRTLLQSYSDDYKLAERD---G  527

Query  1140  FLSLAWNDEPLLTVSSWH  1193
              L L W + PL+  S+WH
Sbjct  528   ALYLGWKNRPLVVSSAWH  545



>ref|XP_008441631.1| PREDICTED: DELLA protein RGL1-like [Cucumis melo]
Length=685

 Score =   197 bits (502),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 138/366 (38%), Positives = 188/366 (51%), Gaps = 34/366 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL-----SNSPEKRPANFDASSEELTLS  287
             A + L  +   V+ +GD  +RVA  F+EAL  RL     ++ P      F  +S E+   
Sbjct  342   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLAATLTTSKPSSSIPPFPQNSLEILKI  401

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
             Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R GG P
Sbjct  402   YQIVYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGGSP  461

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +RI+G+   +       ++  TG  L + A  L++ FEF  +   + SL  + F    
Sbjct  462   -FLRITGVGPSI------DAVRETGRCLTELAHSLNVPFEFHAIGEQLESLKPNMFNRRV  514

Query  648   DEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNAL  827
              E LAVN + +L+ +  +   ++G  L +     P+IVTL E E S N   FL RF  AL
Sbjct  515   GEALAVNAVNRLHRVPGK---SLGNLLGMIRDQAPNIVTLVEQEASHNGPYFLGRFLEAL  571

Query  828   KYYSAIFESLDPNMTRDSPERVKVESLLLG---RRIAELMRPE--EQRAKTECvevevev  992
              YYSAIF+SLD     DS +R KVE  +     R I     PE  E+  + E        
Sbjct  572   HYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLE--------  623

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR LME+ GFK VA+S  A +Q+KILL  Y+        D   G L L W D  L
Sbjct  624   ----KWRKLMEAKGFKGVALSSNAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRAL  677

Query  1173  LTVSSW  1190
             +  S+W
Sbjct  678   IAASAW  683



>ref|XP_009405522.1| PREDICTED: DELLA protein GAI-like [Musa acuminata subsp. malaccensis]
Length=726

 Score =   198 bits (503),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 184/361 (51%), Gaps = 26/361 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS--NSPEKRPANFDASSEELTLSYKA  296
             A + L  +   VS  GD  +RVA  F++AL  RLS   S  ++ A F   + ++   Y+ 
Sbjct  385   ARRYLHNLNHVVSPFGDSMQRVASCFTDALSARLSPSTSSSRKYARFPPPAPDVLKIYQI  444

Query  297   LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI  476
             +  ACPY KFAH TANQAI EA E    +H+ID  I+QG QW A LQALA R GG P ++
Sbjct  445   IYQACPYIKFAHFTANQAIFEAFESEDCVHVIDLDILQGYQWPAFLQALAARPGGAP-AL  503

Query  477   RISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE-PVLGPIHSLNGSSFRVDPDE  653
             RI+G+        PA S+  TG  L + A  L + FEF    +  +  L  S       E
Sbjct  504   RITGV------GHPADSVRETGRHLAELAHSLRVPFEFHAATVERLEDLRPSMLHRRVGE  557

Query  654   ILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKY  833
              LAVN + +L+ +     A +G  L +     P I TL E E S N   FL RF  AL Y
Sbjct  558   ALAVNSVNRLHRV---PGAHLGPLLAMIRDQAPKIFTLVEQEASHNGPYFLGRFLEALHY  614

Query  834   YSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKDH  1007
             YSAIF+SLD     DS  R KVE  LL   I  ++  E  E+ A+ E           + 
Sbjct  615   YSAIFDSLDATFPSDSAARAKVEQFLLAPEIRNIVACEGSERVARHE---------RLER  665

Query  1008  WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             WR +ME  GF+ VA+S  A +Q+KILL  Y         D   G L L W D P++  S+
Sbjct  666   WRRVMEGRGFEGVALSANAVNQSKILLGLYPCDGYRLTEDK--GCLLLGWQDRPIIAASA  723

Query  1188  W  1190
             W
Sbjct  724   W  724



>ref|XP_002265645.1| PREDICTED: scarecrow-like protein 18 [Vitis vinifera]
 emb|CBI39870.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 133/363 (37%), Positives = 193/363 (53%), Gaps = 38/363 (10%)
 Frame = +3

Query  165   LGDPTERVAYYFSEALYNRLSN--SPEKRPANFDAS-------SEELTLSYKALNDACPY  317
              GD TER+ + FS AL  RLS   +P        AS       SE    +Y +LN   P+
Sbjct  69    FGDSTERLVHQFSAALSLRLSRYATPATSSGAMSASANTAAADSEAFHSTYLSLNQITPF  128

Query  318   SKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGG--KPDSIRISGI  491
              +F+ LTANQAILEA E    IHI+DF I+ G+QW  L+QA+A R G    P  IRI+G 
Sbjct  129   IRFSQLTANQAILEAIEGQRAIHILDFDIMHGVQWPPLMQAIAERCGNLHPPPMIRITGT  188

Query  492   PSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVL-------GPIHSLNGSSFRVDPD  650
                +        L  TG+RL  FA+ L L F+F P+L        P++    S+ ++ PD
Sbjct  189   GEDL------GILQRTGDRLLKFAQSLGLKFQFHPLLLRNDPTSVPLYL--PSALQLLPD  240

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E LAVN +L L+ LL + +  +   L    ++ P +VT+ E E + N   FL+RF  AL 
Sbjct  241   ETLAVNCVLYLHRLLKDDSRDLRLFLHKIKAMEPKVVTIAEREANHNHPLFLQRFVEALD  300

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKD  1004
             +Y+A+F+SL+  +   S ER+ VE +  GR I +++  E   +R + E           +
Sbjct  301   HYTAVFDSLEATLPPTSRERLAVERIWFGREIVDIVSAEGDNRRERHERF---------E  351

Query  1005  HWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVS  1184
              W +++ S+GF  V +S +A SQAK+LL  +  S  Y L      F  L W ++ L +VS
Sbjct  352   SWEVMLRSSGFSNVPLSPFALSQAKLLLRLHYPSEGYRLQIINDSFF-LGWQNQALFSVS  410

Query  1185  SWH  1193
             SWH
Sbjct  411   SWH  413



>gb|KDP41801.1| hypothetical protein JCGZ_26819 [Jatropha curcas]
Length=674

 Score =   197 bits (501),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 139/369 (38%), Positives = 187/369 (51%), Gaps = 32/369 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN-------------FDA  263
             A K L  +   VS LGD  +RVA +F+EAL  RL+ +   +P               +  
Sbjct  323   ARKYLHHLNRVVSPLGDSMQRVASFFTEALSARLAATLTAKPNTNTNSTSSTKPFSPYPP  382

Query  264   SSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQAL  443
             +S E+   Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QAL
Sbjct  383   NSLEILKIYQILYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQAL  442

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLN  623
             A R GG P  +RI+G+ S +       S+  TG  L + A  L + FE+ PV   + +L 
Sbjct  443   AARPGGAP-FLRITGVGSSI------ESVRETGRCLTELAHSLHVPFEYHPVAEELDNLK  495

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
                F     E LAVN + +L+ +       +G  L +     P+IVTL E E S N   F
Sbjct  496   PHMFNRRVGEALAVNSVNRLHRV---PANCLGNLLAMIRDQAPNIVTLVEREASHNGPYF  552

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveve  983
             L RF  AL YYSAIF+SLD     DS +R K+E  +    I  ++  E    +TE     
Sbjct  553   LGRFLEALHYYSAIFDSLDATFPPDSAQRAKLEQYIFAPEIRNIVACEGAE-RTE-----  606

Query  984   veveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWND  1163
                E  + WR LME  GFK V +S  A +Q++ILL  Y+        D   G L L W D
Sbjct  607   -RHERLEKWRKLMEGKGFKGVPLSANAVTQSRILLGLYSCDGYRLTEDK--GCLLLGWQD  663

Query  1164  EPLLTVSSW  1190
               L+  S+W
Sbjct  664   RALVAASAW  672



>ref|XP_004138798.1| PREDICTED: DELLA protein GAI1-like [Cucumis sativus]
 gb|KGN63151.1| hypothetical protein Csa_2G405020 [Cucumis sativus]
Length=685

 Score =   197 bits (501),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 138/366 (38%), Positives = 187/366 (51%), Gaps = 34/366 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL-----SNSPEKRPANFDASSEELTLS  287
             A + L  +   V+ +GD  +RVA  F+EAL  RL     ++ P      F  +S E+   
Sbjct  342   ARRYLHHLNRVVTPIGDSMQRVASCFTEALTARLAATLTTSKPSSSIPPFPQNSLEILKI  401

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
             Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R GG P
Sbjct  402   YQIVYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGGSP  461

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +RI+G+   +       ++  TG  L + A  L++ FEF  +   + SL  + F    
Sbjct  462   -FLRITGVGPSI------DAVRETGRCLTELAHSLNVPFEFHAIGEQLESLKPNMFNRRV  514

Query  648   DEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNAL  827
              E LAVN + +L+ +      ++G  L +     P+IVTL E E S N   FL RF  AL
Sbjct  515   GEALAVNAVNRLHRV---PGKSLGNLLGMIRDQAPNIVTLVEQEASHNGPYFLGRFLEAL  571

Query  828   KYYSAIFESLDPNMTRDSPERVKVESLLLG---RRIAELMRPE--EQRAKTECvevevev  992
              YYSAIF+SLD     DS +R KVE  +     R I     PE  E+  + E        
Sbjct  572   HYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLE--------  623

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR LME+ GFK VA+S  A +Q+KILL  Y+        D   G L L W D  L
Sbjct  624   ----KWRKLMEAKGFKGVALSSNAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRAL  677

Query  1173  LTVSSW  1190
             +  S+W
Sbjct  678   IAASAW  683



>ref|XP_011045749.1| PREDICTED: DELLA protein RGL1-like [Populus euphratica]
Length=679

 Score =   197 bits (501),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 184/366 (50%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   VS LGD  +RVA  F+EAL  RL+ +   +P+         F  +S E+
Sbjct  333   ARRYLHHLNRVVSPLGDSMQRVASCFTEALSARLAATLTTKPSTSSSKAFSPFPPNSMEI  392

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  393   LKIYQILYQACPYVKFAHFTANQAIFEAFETEERVHVIDLDILQGYQWPAFMQALAARPG  452

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+       S   ++  TG  L + A  L + FE+ PV   +  L    F 
Sbjct  453   GAP-FLRITGV------GSSMENVRETGRCLTELAHSLHVPFEYHPVAEELEDLKPHMFN  505

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G    +     P+IVT+ E E S N   FL RF 
Sbjct  506   RRVGEALAVNSVNRLHRVPGN---CLGNLFAMIRDQAPNIVTVVEQEASHNGPYFLGRFL  562

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E  E+  + E        
Sbjct  563   EALHYYSAIFDSLDATFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHE--------  614

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR LME  GFK V +S  A +Q+KILL  Y+        D   G L L W D  +
Sbjct  615   -RLEKWRKLMEGKGFKGVPLSANAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRAI  671

Query  1173  LTVSSW  1190
             L  S+W
Sbjct  672   LAASAW  677



>ref|XP_008784262.1| PREDICTED: scarecrow-like protein 3 [Phoenix dactylifera]
Length=463

 Score =   193 bits (491),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 138/377 (37%), Positives = 196/377 (52%), Gaps = 35/377 (9%)
 Frame = +3

Query  120   NAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL--SNSPEKRPANFDASSEELTLSYK  293
             +AV +L  + D VS  GDP +RVA YF++ L  RL    SP  R      + EE   ++ 
Sbjct  90    SAVDALHELYDRVSLHGDPIQRVAAYFTDGLAARLLTGRSPFYRTIMAHPTPEEEFSAFT  149

Query  294   ALNDACPYSKFAHLTANQAILEATEK-----ASKIHIIDFGIVQGIQWAALLQALATR-S  455
              L  A PY +FAH TANQAI+EA EK       ++H++DF +  G QW +L+Q+L+ + +
Sbjct  150   QLYQASPYYQFAHFTANQAIIEAFEKEEMKNGRRLHVVDFDVSYGFQWPSLIQSLSDKAT  209

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAK-VLDLNFEFEPVLGPIHSLNGSS  632
             G KP S+RI G    +        L  T  RL +F K   +L FEFE +L    S   S 
Sbjct  210   GSKPISLRIMGFGRSI------EELKETETRLANFTKGCRNLIFEFEGLLTGSRS---SD  260

Query  633   FRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKR  812
             F+++ D  L VN +  L NL   +++ V   L   +SLNPS+V L   E S +   FL R
Sbjct  261   FKIEKDATLVVNLVFYLQNL--RSSSEVYDTLMAIHSLNPSVVVLVGKEGSQSPQSFLSR  318

Query  813   FKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevevev  992
             F  +L YY+A+F+SL+  +   S ER+ +E   LGR I   M  EE+  +       +  
Sbjct  319   FTESLHYYAAMFDSLNDCLPSGSVERLSIEKNHLGREIKTAMTNEEKEEEKHLRSERL--  376

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF----------  1142
                D W+  MES GF+ + +S  + SQAK+LL   ++ SS        GF          
Sbjct  377   ---DTWKRKMESFGFEEIKLSSTSVSQAKLLLKIKSHCSSLGHDGGAGGFRISERDEGRA  433

Query  1143  LSLAWNDEPLLTVSSWH  1193
             +SL W D  L TVS+WH
Sbjct  434   ISLGWQDRLLTTVSAWH  450



>ref|XP_011099005.1| PREDICTED: DELLA protein RGL2-like [Sesamum indicum]
Length=708

 Score =   197 bits (501),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 186/367 (51%), Gaps = 33/367 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFD--------ASSEEL  278
             A K L  +   VS LGD  +RVA  F+EAL  RL+ +   +P+  +          + E+
Sbjct  362   ARKYLHHLNRVVSPLGDSMQRVAACFTEALSARLAATLTNKPSTSNLKRFNPIPPDNLEI  421

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++HIID  I+QG QW A +QALA R G
Sbjct  422   LKIYQILYQACPYIKFAHFTANQAIFEAFEAEERVHIIDLDILQGYQWPAFMQALAARPG  481

Query  459   GKPDSIRISGI-PSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
             G P  +RI+G+ PSP        S+  TG  L + A  L + FEF PV   +  L    F
Sbjct  482   GAP-FLRITGVGPSP-------ESVRETGRCLTELAHSLHVPFEFHPVGEELEDLKPHMF  533

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRF  815
                  E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF
Sbjct  534   NRRVGEALAVNSVNRLHRV---PGNCLGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRF  590

Query  816   KNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveve  989
               AL YYSAIF+SLD     DS +R KVE  +    I  ++  E  E+  + E       
Sbjct  591   LEALHYYSAIFDSLDATFPPDSAQRAKVEQHIFAPEIRNIVAQEGPERTMRHE-------  643

Query  990   veDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEP  1169
                 + WR +ME  GF+ V +S  A +Q+KILL  Y+        D   G L L W D  
Sbjct  644   --RLEKWRKVMEGKGFQGVPLSSNAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRS  699

Query  1170  LLTVSSW  1190
             +L  S+W
Sbjct  700   ILAASAW  706



>ref|XP_002274834.2| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
 emb|CBI21318.3| unnamed protein product [Vitis vinifera]
Length=668

 Score =   197 bits (500),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 186/364 (51%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V+ LGD  +RVA  F+EAL  RL+ +   +P+         F  +S E+
Sbjct  322   ARRYLHHLNRVVTPLGDSMQRVASCFTEALSARLAATLTPKPSTSTTKPFNPFPPNSLEI  381

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  382   LKIYQILYQACPYIKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFIQALAARPG  441

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+     G SP  S+  TG  L + A  L + FEF PV   +  L    F 
Sbjct  442   GAP-FLRITGV-----GCSP-ESVRETGRCLTELAHSLHVPFEFHPVGEELEDLKPHMFN  494

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN   +L+ +    T  +G  L +     P+IVT+ E E S N   FL RF 
Sbjct  495   RRVGEALAVNSANRLHRV---PTNFLGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFL  551

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R K+E  +    I  ++         E  E  +  E 
Sbjct  552   EALHYYSAIFDSLDATFPPDSAQRAKLEQYIFAPVIRNIV-------ACEGAERVMRHER  604

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR LME  GF+ V +S  A +Q+KILL  Y+        D   G L L W D  +L 
Sbjct  605   LEKWRKLMEGKGFQGVPLSANAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRAILA  662

Query  1179  VSSW  1190
              S+W
Sbjct  663   ASAW  666



>ref|XP_002298647.1| hypothetical protein POPTR_0001s33360g [Populus trichocarpa]
 gb|EEE83452.1| hypothetical protein POPTR_0001s33360g [Populus trichocarpa]
Length=679

 Score =   197 bits (500),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/366 (38%), Positives = 185/366 (51%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   VS LGD  +RVA  F+EAL  RL+ +   +P+         F  +S E+
Sbjct  333   ARRYLHHLNRVVSPLGDSMQRVASCFTEALSARLAATLTTKPSTSSSKAFSPFPPNSMEI  392

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  393   LKIYQILYQACPYVKFAHFTANQAIFEAFETEERVHVIDLDILQGYQWPAFMQALAARPG  452

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+       S   ++  TG  L + A  L + FE+ PV   +  L    F 
Sbjct  453   GAP-FLRITGV------GSSMENVRETGRCLTELAHSLHVPFEYHPVAEELVDLKPHMFN  505

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF 
Sbjct  506   RRVGEALAVNSVNRLHRVPGN---CLGNLLAMIRDQAPNIVTVVEQEASHNGPYFLGRFL  562

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E  E+  + E        
Sbjct  563   EALHYYSAIFDSLDSTFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHE--------  614

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR LME  GFK V +S  A +Q+KILL  Y+        D   G L L W D  +
Sbjct  615   -RLEKWRKLMEGKGFKGVPLSANAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDRAI  671

Query  1173  LTVSSW  1190
             L  S+W
Sbjct  672   LAASAW  677



>ref|XP_002460928.1| hypothetical protein SORBIDRAFT_02g037650 [Sorghum bicolor]
 gb|EER97449.1| hypothetical protein SORBIDRAFT_02g037650 [Sorghum bicolor]
Length=547

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 191/378 (51%), Gaps = 20/378 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             + CAR        A+  +I  +R  VS  G+P ER+  Y  E L  RL+ S     K   
Sbjct  182   IACARAVEYNNSYAIDLMIPELRKKVSVSGEPLERLGAYMVEGLVARLAASGSSIYKALK  241

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +   +IHIIDF I QG QW +L
Sbjct  242   CKEPRSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQWISL  301

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P  +RI+GI   V   +    L   G RL   A +  + F+F+ V    
Sbjct  302   LQALAARPGGPP-FVRITGIDDSVSAYARGGGLELVGRRLSHIAGLYKVPFQFDAVAISS  360

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               +      + P E +AVNF L+L+++ DET +T       L+L   L+P ++TL E E 
Sbjct  361   SEVEEGHLGIVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGLSPKVLTLVEQES  420

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQRA  959
             + N   F +RF   L YY+AIFES+D  + RD  ER+ +E   L R I  L+  E E+R 
Sbjct  421   NTNTAPFAQRFAETLDYYTAIFESIDLALPRDDRERINIEQHCLAREIVNLVACEGEERV  480

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             +   V  +        W+  +  AGF+   +S   ++  K LL +Y+     +  D   G
Sbjct  481   ERHEVFGK--------WKARLMMAGFRPSPLSALVNATIKTLLQSYSPDYKLAERD---G  529

Query  1140  FLSLAWNDEPLLTVSSWH  1193
              L L W + PL+  S+WH
Sbjct  530   VLYLGWKNRPLIVSSAWH  547



>ref|XP_001755257.1| predicted protein [Physcomitrella patens]
 gb|EDQ79737.1| predicted protein [Physcomitrella patens]
Length=420

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 192/361 (53%), Gaps = 29/361 (8%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRL--------SNSPEKRPANFDASSEELTLSY  290
             L R++   +  GDP +R++ YF++AL +RL        S +P   P   D       L+Y
Sbjct  78    LSRLKAISNPYGDPMQRISLYFADALSDRLTKESETPVSAAPISSPVELDTD-----LAY  132

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             ++  +  P++KF H TANQAI EA    +KIH++D  I QG+QW + LQ LA R GG P 
Sbjct  133   QSFYEVLPFAKFTHFTANQAIFEAVGYHNKIHVVDLDIQQGLQWPSFLQTLALRPGGPP-  191

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
             S++I+ +       + AASL  T  RL +FA+ L++ FE   ++  + +L+   F+++PD
Sbjct  192   SLKITAV------GTNAASLQLTKRRLSEFAQALEVPFELIVLVEDLDNLDKEKFQIEPD  245

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E LAVN   Q+ + L  + A +   L L  SLNP +VTL E E + N    + RF  AL 
Sbjct  246   EALAVNCS-QVLHRLSGSEAVLQKLLLLLRSLNPEVVTLLEVEANHNGANLISRFVEALH  304

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHW  1010
             YY A+F++L+ +++ DSP+R ++E++ L   I  ++         E           + W
Sbjct  305   YYCALFDALEASVSSDSPDRFRIENITLASEIRGIV-------ALEGSGRGARHVKSETW  357

Query  1011  RILMESAGFKAVAISHYAHSQAKILL-WnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             +      GF+   +S YA  QA++LL +     +    +    G L + W D P++ VSS
Sbjct  358   QSHFTKCGFRNRPLSSYAVQQAQLLLGYFVTGETPTYKLSEEFGVLIMGWQDTPVMAVSS  417

Query  1188  W  1190
             W
Sbjct  418   W  418



>dbj|BAJ90910.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   195 bits (496),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 131/377 (35%), Positives = 188/377 (50%), Gaps = 18/377 (5%)
 Frame = +3

Query  84    VDCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             V CA  L+ ++ E  +K +   R +VS  G+P +R+  Y  E L  R  NS     +   
Sbjct  205   VKCAEALSENRTEEFLKLVQEARGTVSINGEPIQRLGAYLLEGLVARHGNSGTNIYRALK  264

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S+EL    K L + CPY KF ++ AN AI EA     KIHIIDF I QG QW  L
Sbjct  265   CREPESKELLSYMKILYNICPYFKFGYMAANGAIAEALRSEDKIHIIDFQIAQGTQWITL  324

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             +QALA R GG P  +RI+GI  PV   +    L   GN L++ ++  ++  EF P+    
Sbjct  325   IQALAARPGGPP-HVRITGIDDPVSEYARGEGLELVGNMLKNMSEEFNIPLEFTPLSVYA  383

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               +      + P E +AVNF LQL++  DE+          L++   L+P + TL E E 
Sbjct  384   TQVTKEMLEIRPGEAVAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQES  443

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAK  962
               N   FL RF   + YYSA+FES+D N+ RDS ER+ VE   L + I  ++   E + +
Sbjct  444   HTNTTPFLMRFVETMDYYSAMFESIDANLPRDSKERISVEQHCLAKDIVNIIAC-EGKDR  502

Query  963   TECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF  1142
              E  E+         W+  +  AGFK   +S Y +S  K LL      S    ++   G 
Sbjct  503   VERHELL------GKWKSRLSMAGFKPYPLSSYVNSVIKKLL---ACYSDKYTLEEKDGA  553

Query  1143  LSLAWNDEPLLTVSSWH  1193
             + L W    L++ S+WH
Sbjct  554   MLLGWKSRKLISASAWH  570



>gb|EMT21860.1| hypothetical protein F775_28371 [Aegilops tauschii]
Length=555

 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/383 (36%), Positives = 190/383 (50%), Gaps = 34/383 (9%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------K  242
             CAR    +   AV  ++  +R  VS  G P ER+  Y  E L  RL++S          K
Sbjct  192   CARAVEEKNMYAVDVMVPELRKMVSVSGTPLERLGAYMVEGLVARLASSGHSIYKALRCK  251

Query  243   RPANFDASSEELTLSYKA-LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
              P + D       LSY   L +ACPY KF +++AN AI EA +   +IHIIDF I QG Q
Sbjct  252   EPKSSD------LLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQ  305

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPV  599
             W +LLQALA R GG P ++RI+GI   V   +    L   G RL   A +  + FEF  V
Sbjct  306   WISLLQALAARPGGPP-TVRITGIDDTVSAYARGGGLDLVGRRLSHIAGLCKVPFEFHSV  364

Query  600   LGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLG  770
                   +      V P E L VNF L+L+++ DET +T       L+L   L P ++TL 
Sbjct  365   AMAGEEVEEGHLGVVPGEALTVNFTLELHHIPDETVSTANHRDRILRLVKGLRPRVLTLV  424

Query  771   EYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-  947
             E E + N   F +RF   L+YY+AIFES+D  + RD  ERV +E   L R +  L+  E 
Sbjct  425   EQESNTNTAPFPQRFAETLEYYTAIFESIDLTLPRDDRERVNMEQHCLAREVVNLIACEG  484

Query  948   -EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E+  + E             W+  +  AGF+   +S   ++    LL +Y+ +   +  
Sbjct  485   AERVERHEVFGK---------WKARLTLAGFRPSPLSSLVNATISTLLQSYSENYKLAER  535

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
             D   G L L W  +PL+  S+WH
Sbjct  536   D---GALYLGWKSKPLVVSSAWH  555



>ref|XP_007217517.1| hypothetical protein PRUPE_ppa024399mg [Prunus persica]
 gb|EMJ18716.1| hypothetical protein PRUPE_ppa024399mg [Prunus persica]
Length=708

 Score =   197 bits (500),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 189/364 (52%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V+ LGD  +RVA  F+EAL  RL+ +    PA         F  +S E+
Sbjct  362   ARRYLHHLNRVVTPLGDSMQRVASCFTEALSARLAATLTTNPAASAPKPFSPFPPNSLEI  421

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R+G
Sbjct  422   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARTG  481

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+  P +      ++  TG  L + A  L + FEF  V   +  L    F 
Sbjct  482   GAP-FLRITGV-GPCI-----EAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  534

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  535   RRIGEALAVNTVNRLHRVPGN---YLGNVLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  591

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +  + I  ++  E    +TE        E 
Sbjct  592   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAQEIRNIVACEGAE-RTE------RHER  644

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +MES GFK+VA+S  A +Q+KILL  Y+        D   G L L W D  ++ 
Sbjct  645   LEKWRKVMESKGFKSVALSANAVTQSKILLGLYSCDGYRMTEDK--GCLLLGWQDRSIMA  702

Query  1179  VSSW  1190
              S+W
Sbjct  703   ASAW  706



>dbj|BAJ95382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   194 bits (494),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 137/383 (36%), Positives = 189/383 (49%), Gaps = 34/383 (9%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------K  242
             CAR    +   AV  ++  +R  VS  G P ER+  Y  E L  RL++S          K
Sbjct  194   CARAVEEKNMYAVDVMVPELRKMVSVSGTPLERLGAYMVEGLVARLASSGHSIYKALRCK  253

Query  243   RPANFDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
              P + D       LSY   L +ACPY KF +++AN AI EA +   +IHIIDF I QG Q
Sbjct  254   EPKSSD------LLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQ  307

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPV  599
             W +LLQALA R GG P ++RI+GI   V   +    L   G RL   A +  + FEF  V
Sbjct  308   WISLLQALAARPGGPP-TVRITGIDDSVSAYARGGGLDLVGRRLSHIAGLCKVPFEFRSV  366

Query  600   LGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLG  770
                   +      V P E LAVNF L+L+++ DET +T       L+L   L P ++TL 
Sbjct  367   AMAGEEVEEGHLGVVPGEALAVNFTLELHHIPDETVSTANHRDRILRLVKGLRPKVLTLV  426

Query  771   EYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-  947
             E E + N   F +RF   L YY+AIFES+D  + RD  ERV +E   L R +  L+  E 
Sbjct  427   EQESNTNTAPFPQRFAETLDYYTAIFESIDLTLPRDDRERVNMEQHCLAREVVNLIACEG  486

Query  948   -EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E+  + E             W+  +  AGF+   +S   ++    LL +Y+ +   +  
Sbjct  487   AERVERHEVFGK---------WKARLTMAGFRPSPLSSLVNATISKLLQSYSDNYKLAER  537

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
             D   G L L W   PL+  S+WH
Sbjct  538   D---GALYLGWKKRPLVVSSAWH  557



>ref|XP_007031934.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY02860.1| GRAS family transcription factor [Theobroma cacao]
Length=654

 Score =   196 bits (497),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 141/368 (38%), Positives = 188/368 (51%), Gaps = 34/368 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL----------SNSPEKRPANFDASSE  272
             A K +  +   V+ LGD  +RVA  F+EAL  RL          SN+P K  A F ++S 
Sbjct  307   ARKYIHHLNRVVTPLGDSMQRVASCFTEALSARLAATITTNPGTSNAP-KPFAPFPSNSL  365

Query  273   ELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATR  452
             E+   Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R
Sbjct  366   EVLKIYQIVYQACPYIKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAAR  425

Query  453   SGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSS  632
               G P  +RI+G+  P L       +  TG  L + A  L + FEF P+   +  +    
Sbjct  426   PNGAP-FLRITGV-GPSL-----EYIKETGRCLTELAHSLHIPFEFHPIGEQLEDIKPHM  478

Query  633   FRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKR  812
             F     E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL R
Sbjct  479   FNRRVGEALAVNAVNRLHRVPGN---CLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGR  535

Query  813   FKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevev  986
             F  AL YYSAIF+SLD   + DS +R KVE  +    I  ++  E  E+ A+ E      
Sbjct  536   FLEALHYYSAIFDSLDATFSPDSAQRAKVEQYIFAPEIRNIVACEGSERTARHE------  589

Query  987   eveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDE  1166
                  + WR LME  GFK V +S  A +Q+KILL  Y+        D   G L L W D 
Sbjct  590   ---RLEKWRKLMEGKGFKGVPLSANAVTQSKILLGLYSCDGYRLTEDK--GCLLLGWQDR  644

Query  1167  PLLTVSSW  1190
              +L  S+W
Sbjct  645   AILAASAW  652



>ref|XP_009409866.1| PREDICTED: protein MONOCULM 1-like [Musa acuminata subsp. malaccensis]
Length=404

 Score =   191 bits (484),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 140/385 (36%), Positives = 194/385 (50%), Gaps = 37/385 (10%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             + CA L       A +  I I  + +   GD  +R+   F  AL  R+      R +   
Sbjct  42    ISCAELVHCGDLPAAERAISILTAAAAPYGDSIDRLIRQFCRALSVRIG-----RVSPSA  96

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
             AS   L  SY   N   P+ +F+HLTANQAILEA +    IHI+DF    G+QW  LLQA
Sbjct  97    ASLGSLQSSYLLFNQMTPFLRFSHLTANQAILEAVDGHRHIHILDFDTYYGLQWPPLLQA  156

Query  441   LATRSG-GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP--I  611
             +A RS  G P  IRISG  S +       +L  TG+RLR+FA  L L F+F P+L P  +
Sbjct  157   IADRSDPGDPPFIRISGTGSSL------ETLQRTGDRLRNFAHSLGLEFQFHPLLLPPSV  210

Query  612   HSLNG------SSFRVDPDEILAVNFMLQLYNLL-----DETTATVGTALKLANSLNPSI  758
             HS N       S  +  P E L VN +L L+ L      D+ +  +   L+    +NPS+
Sbjct  211   HSTNTSYNFTPSCLQFHPSETLVVNCVLFLHKLQREDGNDDGSRKLQAFLRTIRVMNPSV  270

Query  759   VTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM  938
             VT+ E E   +   F++RF  AL YY+A+FE+L+  +   S ER+ VE + LGR I  ++
Sbjct  271   VTVAERETVHSSRSFMQRFVEALDYYTAVFEALEATLPPTSEERMAVEQVWLGREIESIV  330

Query  939   RPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssys  1118
               E    +             + W  LM  AGF ++A S +A SQA++LL  +  S  Y 
Sbjct  331   GGEGDGRRER----------HERWDSLMRDAGFSSLAPSTFAVSQARLLLRLHYPSEGYQ  380

Query  1119  LIDSPPGFLSLAWNDEPLLTVSSWH  1193
             L      FL L W+   L +VSSWH
Sbjct  381   LQLVRDSFL-LGWHSRHLFSVSSWH  404



>ref|XP_001773669.1| predicted protein [Physcomitrella patens]
 gb|EDQ61557.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 181/343 (53%), Gaps = 26/343 (8%)
 Frame = +3

Query  180   ERVAYYFSEALYNRLSNSPEKRPANFDASS--EELTLSYKALNDACPYSKFAHLTANQAI  353
             +RVA +F+E L  R+    +    N    S  ++   ++  L   CPY +F H  ANQAI
Sbjct  2     QRVAAFFTEGLAARMVGKDKPMYKNLMVQSRLDDYLSAFTTLYKVCPYFQFGHFAANQAI  61

Query  354   LEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLL  533
             LEA E  S +HIID  ++QG+QW   +Q+L+ R  G P  ++I+GI       +   SL 
Sbjct  62    LEAVEGRSVVHIIDMDLMQGLQWPGFIQSLSEREDGPP-KLKITGI------GTSCNSLQ  114

Query  534   ATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTAT  713
              TG RL  FA+   + FEF  V+G +  L        P E +AVN ++QL+ LL+     
Sbjct  115   DTGRRLASFAETYGVPFEFHAVVGELEDLTPMELGAKPGEAVAVNCVMQLHRLLNNGDKL  174

Query  714   VGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERV  893
                   L  SL+P ++TL E E + N   FL RF  A+ YY+A+F+SLD ++   S ER 
Sbjct  175   HNFIAGL-RSLHPVMLTLVEQEANHNTSSFLGRFVEAVHYYAAVFDSLDSSLPLASEERA  233

Query  894   KVESLLLGRRIAELMRPEE----QRAKTECveveveveDKDHWRILMESAGFKAVAISHY  1061
             K+E L   ++I  ++  E     +R +T            D W+  M +AGF+ + +S +
Sbjct  234   KIEQLYFAQQIKNIVACEGVDRIERHET-----------LDLWQKRMVTAGFRQLPLSSH  282

Query  1062  AHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             A +QAK+LL + +    Y L   P G +SL W D+ LL+ SSW
Sbjct  283   AVTQAKLLL-SLSPCGGYRLSQQPGGSISLNWQDQCLLSASSW  324



>ref|XP_006836764.1| hypothetical protein AMTR_s00088p00161000 [Amborella trichopoda]
 gb|ERM99617.1| hypothetical protein AMTR_s00088p00161000 [Amborella trichopoda]
Length=558

 Score =   194 bits (492),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 127/364 (35%), Positives = 179/364 (49%), Gaps = 29/364 (8%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------KRPANFDASSEELTLSY  290
             +  +R  VS  G+P +R+  Y  E L  R+++S          K+P   D       LSY
Sbjct  211   ITELRQMVSVSGEPIQRLGAYMVEGLVARIASSGSAIYKSLRCKQPLASD------LLSY  264

Query  291   -KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
                L + CPY KF +L+AN AI EA +   ++HIIDF I QG QW  L+QALA R GG P
Sbjct  265   MHVLYEVCPYFKFGYLSANGAIAEALKGEDRVHIIDFQIAQGTQWVTLIQALAARPGGPP  324

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +RI+G+  PV   +    L   G RL   AK+ ++ FEF         +     +V P
Sbjct  325   -YLRITGVDDPVSAYARGCGLELVGQRLAKLAKLCNVPFEFNAAAICGSQVEVGMLKVRP  383

Query  648   DEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
             ++ LAVNF  QL+++ DE+ +TV      L++  SLNP +VTL E E + N   FL RF 
Sbjct  384   NDALAVNFPFQLHHMPDESVSTVNHRDRLLRMIKSLNPKVVTLVEQESNTNTAPFLHRFV  443

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
               L YYSA+FES+D  + RDS ER+ VE   L R I  ++  E Q        +      
Sbjct  444   EVLSYYSAVFESIDVTLPRDSKERISVEQHCLARDIVNVIACEGQERVERHELL------  497

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
                W++    AGF    +S   +S  K LL           ++   G L L W +  L+ 
Sbjct  498   -GKWKLRFMMAGFSPYPLSSSVNSTIKSLL---EGYCENYRLEEKDGVLYLGWKNRVLVA  553

Query  1179  VSSW  1190
               +W
Sbjct  554   SCAW  557



>ref|XP_009618056.1| PREDICTED: scarecrow-like protein 18 [Nicotiana tomentosiformis]
Length=410

 Score =   190 bits (483),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 202/389 (52%), Gaps = 36/389 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSN---------S  233
             + CA L      +A   L+ I  + S   GD TER+ + F+ AL  RL+          +
Sbjct  37    ISCAELISRSDFSAANRLLTILSTNSSPFGDSTERLVHQFTRALSIRLNRYISSATNFLT  96

Query  234   PEKRPANFDASSEELTL--SYKALNDACPYSKFAHLTANQAILEA-TEKASKIHIIDFGI  404
             P       ++S++   L  SY +LN   P+ +F+ LTANQAILEA  +    IHI+DF I
Sbjct  97    PNASSNVVESSNDSALLQSSYLSLNQVTPFIRFSQLTANQAILEAINDNQQAIHIVDFDI  156

Query  405   VQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNF  584
               G+QW  L+QALA R    P ++RI+G      GN    +L  TG+RL  FA  L L F
Sbjct  157   NHGVQWPPLMQALADRY--PPPTLRITGT-----GND-LDTLRRTGDRLAKFAHSLGLRF  208

Query  585   EFEPVLGPIHSLNG------SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSL  746
             +F P+L   ++ N       SS  + PDE LA+N +  L+ LL +    +   L    S+
Sbjct  209   QFHPLLITNNNDNDHDPSIISSIVLLPDETLAINCVFYLHRLLKDR-EMLRIFLHRIKSM  267

Query  747   NPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRI  926
             NP +VTL E E + N   FL+RF  AL YY+A+F+SL+  +   S ER+ VE +  GR I
Sbjct  268   NPKVVTLAEREANHNHPLFLQRFVEALDYYAAVFDSLEATLPPSSRERMTVEQVWFGREI  327

Query  927   AELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynys  1106
              +++  E  + +               W +++ S GF  VA+S +A SQAK+LL  +  S
Sbjct  328   IDIVAAEGDKRRERHERFRS-------WEVMLRSCGFSNVALSPFALSQAKLLLRLHYPS  380

Query  1107  ssysL-IDSPPGFLSLAWNDEPLLTVSSW  1190
               Y L + S      L W ++PL ++SSW
Sbjct  381   EGYQLSVSSTSNSFFLGWQNQPLFSISSW  409



>gb|ACN28625.1| unknown [Zea mays]
 tpg|DAA41243.1| TPA: chitin-inducible gibberellin-responsive protein 2 [Zea mays]
 gb|AIB04326.1| GRAS transcription factor, partial [Zea mays]
Length=554

 Score =   193 bits (491),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 136/384 (35%), Positives = 192/384 (50%), Gaps = 32/384 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CAR        A+  +I  +R  VS  G+P ER+  Y  E L  RL+ S         
Sbjct  189   IACARAVERNNSYAIDLMITELRKMVSVSGEPLERLGAYMVEGLVARLAASGSSIYKALK  248

Query  240   -KRPANFDASSEELTLSYKA-LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K P + D       LSY   L +ACPY KF +++AN AI EA +   +IHIIDF I QG
Sbjct  249   CKEPRSSD------LLSYMHFLYEACPYFKFGYMSANGAIAEAIKGEDRIHIIDFHIAQG  302

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW +LLQALA R GG P  +R++GI   V   +    L   G RL   A +  + F+F+
Sbjct  303   AQWVSLLQALAARPGGPP-FVRVTGIDDSVSAYARGGGLELVGRRLTHIAGLYKVPFQFD  361

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVT  764
              V      +      V P E +AVNF L+L+++ DET +T       L+L   L+P ++T
Sbjct  362   AVAISGSEVEEEHLGVVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGLSPKVLT  421

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             L E E + N   F +RF   L YY+AIFES+D  + RD  ER+ +E   L R I  L+  
Sbjct  422   LVEQESNTNTAPFAQRFAETLDYYTAIFESIDLALPRDDRERINIEQHCLAREIVNLVAC  481

Query  945   E-EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysL  1121
             E E+R +   V  +        W+  +  AGF    +S   ++  K LL +Y+     + 
Sbjct  482   EGEERVERHEVFGK--------WKARLMMAGFSPSPLSALVNATIKTLLQSYSPDYKLAE  533

Query  1122  IDSPPGFLSLAWNDEPLLTVSSWH  1193
              D   G L L W + PL+  S+WH
Sbjct  534   RD---GVLYLGWKNRPLIVSSAWH  554



>ref|NP_001170141.1| hypothetical protein [Zea mays]
 ref|XP_008651757.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008651758.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN35970.1| unknown [Zea mays]
 gb|AFT82641.1| GRAS38 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA63341.1| TPA: hypothetical protein ZEAMMB73_803613 [Zea mays]
 tpg|DAA63342.1| TPA: hypothetical protein ZEAMMB73_803613 [Zea mays]
Length=558

 Score =   193 bits (490),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 137/385 (36%), Positives = 193/385 (50%), Gaps = 34/385 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI--RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE------  239
             + CAR AV Q       L+   +R  VS  G+P ER+  Y  E L  RL+ S        
Sbjct  193   IACAR-AVEQNNGYSIDLMVPELRKMVSVSGEPLERLGAYMVEGLVARLAASGSSIYKAL  251

Query  240   --KRPANFDASSEELTLSYKA-LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQ  410
               K P + D       LSY   L +ACPY KF +++AN AI EA +   +IHIIDF I Q
Sbjct  252   RCKEPRSSD------LLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQ  305

Query  411   GIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEF  590
             G QW +LLQALA R GG P  +R++GI  PV   +    L   G RL   A +  + F+F
Sbjct  306   GAQWVSLLQALAARPGGPP-FVRVTGIDDPVSAYARGGGLELVGKRLSHIAGLYKVPFQF  364

Query  591   EPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIV  761
             + V      +      V P E +AVNF L+L+++ DET +T       L+L   L+P ++
Sbjct  365   DAVAISGSEVEEGHLGVVPGEAVAVNFTLELHHIPDETVSTANHRDRVLRLVKGLSPRVL  424

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             TL E E + N   F +RF   L YY+AIFES+D  + R   ER+ +E   L R I  L+ 
Sbjct  425   TLVEQESNTNTAPFAQRFAETLDYYAAIFESIDLALPRGDRERINIEQHCLAREIVNLVA  484

Query  942   PE-EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssys  1118
              E E+R +   V  +        W+  +  AGF+   +S   ++  K LL +Y+      
Sbjct  485   CEGEERVERHEVFGK--------WKARLMMAGFRPSPLSALVNATIKTLLQSYSPDYK--  534

Query  1119  LIDSPPGFLSLAWNDEPLLTVSSWH  1193
              +    G L L W + PL+  S+WH
Sbjct  535   -LAEREGVLYLGWKNRPLIVSSAWH  558



>gb|EYU31843.1| hypothetical protein MIMGU_mgv1a021983mg [Erythranthe guttata]
Length=694

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 138/367 (38%), Positives = 185/367 (50%), Gaps = 33/367 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A K L  +   VS  GD  +RVA  F+EAL  RL+ +   +P+         F   + E+
Sbjct  348   ARKYLHHLNRVVSTDGDSMQRVAACFTEALTARLAATLTNKPSTSKLIPFNPFPPDNLEI  407

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  408   LKIYQILYQACPYIKFAHFTANQAIFEAFESEGRVHVIDLDILQGYQWPAFMQALAARPG  467

Query  459   GKPDSIRISGI-PSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSF  635
             G P  +RI+G+ PSP        S+  TG  L + A  L + FEF PV   +  L    F
Sbjct  468   GAP-FLRITGVGPSP-------ESVRETGRCLSELAHSLHVPFEFHPVGEELEDLKPHMF  519

Query  636   RVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRF  815
                  E LAVN + +L+ +       +G  L +     P+IVT+ E E S N   FL RF
Sbjct  520   NRRVGEALAVNSVNRLHRV---PGNALGNLLTMIRDQAPNIVTIVEQEASHNGPYFLGRF  576

Query  816   KNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveve  989
               AL YYSAIF+SLD     +S +R KVE  +    I  ++  E  E+  + E       
Sbjct  577   LEALHYYSAIFDSLDATFPSESEQRTKVEQNIFAPEIKNIVAHEGPERVMRHE-------  629

Query  990   veDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEP  1169
                 + WR +ME  GF+ V +S  A +Q+KILL  Y+        D   G L L W D  
Sbjct  630   --RLEKWRKIMEGKGFQGVPLSSNAVTQSKILLGLYSCDGYRLTEDR--GCLLLGWQDRS  685

Query  1170  LLTVSSW  1190
             +L  S+W
Sbjct  686   ILAASAW  692



>ref|XP_002961994.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ37254.1| GRAS family protein [Selaginella moellendorffii]
Length=554

 Score =   192 bits (489),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 181/365 (50%), Gaps = 32/365 (9%)
 Frame = +3

Query  141   RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------KRPANFDASSEELTLSYKA  296
             R+   V   G P ER+A Y  E L  R+ +S          K P        E+  + + 
Sbjct  208   RLNQVVCIYGQPMERLAAYMVEGLVARIQSSGTGLCRALRCKEPVG-----NEILSAMQV  262

Query  297   LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI  476
             + + CPY KF ++ AN AI EA +   ++HIIDF I QG Q+ AL+QALA R GG P ++
Sbjct  263   MYEVCPYIKFGYMAANGAIAEALKDEPRVHIIDFEIAQGTQYIALIQALARRPGGPP-TV  321

Query  477   RISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPV-LGPIHSLNGSSFRVDPDE  653
             RI+G+  P  G +    + A G RL   A    +  EF  V L      + ++ +  P E
Sbjct  322   RITGVGDPAAGVAAPGGVAAVGRRLAVLAADHGVPLEFHAVPLSGAGVTDAAALQRRPGE  381

Query  654   ILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
              LAVNF +QL+++ DE+ +        L++A SL P IVTL E E + N   FL RFK +
Sbjct  382   ALAVNFAMQLHHMPDESVSVSNPRDRLLRMAKSLGPKIVTLVEQEANTNTAPFLARFKES  441

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveD  998
             L YY A+FESLD  + R S ER+ VE   L R +  L+  E  E+  + E +        
Sbjct  442   LSYYGAVFESLDVTLPRQSKERISVEQHCLARDLVNLIACEGAERIERHEVM--------  493

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
                WR  M  AGFK   +S Y +     LL  Y      S  D   G + L W D  L++
Sbjct  494   -GKWRARMSMAGFKQYPLSRYVNQTISCLLKTYCDKYKLSEED---GVIYLGWLDRSLVS  549

Query  1179  VSSWH  1193
              S+W+
Sbjct  550   ASAWN  554



>ref|XP_010267831.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
[Nelumbo nucifera]
Length=587

 Score =   193 bits (490),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 142/388 (37%), Positives = 197/388 (51%), Gaps = 40/388 (10%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRI----RDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPA  251
             ++CAR A+S  EN     +R+    R +VS  G+P +R+  Y  E L  R     E   A
Sbjct  222   IECAR-ALS--ENRTDDFMRLSEEARAAVSISGEPIQRLGAYILEGLVAR----KEASGA  274

Query  252   NF-------DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQ  410
             N        +  S++L    + L + CPY KF ++ AN AI EA      +HIIDF I Q
Sbjct  275   NIYRALRCREPESKDLLSYMQILYEICPYLKFGYMAANGAIAEAFRSEDHVHIIDFQIAQ  334

Query  411   GIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEF  590
             G QW  L+QALA R GG P+ +RI+GI  PV   +  ASL A G RL   +K  ++  EF
Sbjct  335   GTQWMTLIQALAARPGGPPN-VRITGIDDPVSKYARGASLEAVGRRLDALSKKFNIPVEF  393

Query  591   E--PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPS  755
                PV  P   +      V P E LAVNF LQL++  DE+          L++  SL+P 
Sbjct  394   HAMPVFAP--DVTREMLGVRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKSLSPK  451

Query  756   IVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAEL  935
             +VTL E E + N   FL RF   L++YSA+FES+D  + RD  ER+ VE   L R I  +
Sbjct  452   VVTLVEQESNTNTTPFLTRFVETLEFYSAMFESIDVTLPRDRKERINVEQHCLARDIVNI  511

Query  936   MRPE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynyss  1109
             +  E  E+  + E +           W+     AGF+   +S Y +S  K LL    YS 
Sbjct  512   IACEGKERVERHELLGK---------WKSRFTMAGFRPYPLSSYVNSVIKGLL--RCYSE  560

Query  1110  sysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
              Y+L++     L L W D  L++ S+WH
Sbjct  561   HYTLVEKDEAML-LGWKDRNLISASAWH  587



>ref|XP_008231070.1| PREDICTED: DELLA protein GAI-like [Prunus mume]
Length=712

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 187/364 (51%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V+ LGD  +RVA  F+EAL  RL+ +    PA         F  +S E+
Sbjct  366   ARRYLHHLNRVVTPLGDSMQRVASCFTEALSARLTATLTTNPAASAPKPFSPFPPNSLEI  425

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  426   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPG  485

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+  P +      ++  TG  L + A  L + FEF  V   +  L    F 
Sbjct  486   GAP-FLRITGV-GPCI-----EAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  538

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  539   RRIGEALAVNTVNRLHRVPGN---YLGNVLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  595

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E    +TE        E 
Sbjct  596   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAE-RTE------RHER  648

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +MES GFK+VA+S  A +Q+KILL  Y+        D   G L L W D  ++ 
Sbjct  649   LEKWRKVMESKGFKSVALSANAVTQSKILLGLYSCDGYRMTEDK--GCLLLGWQDRSIMA  706

Query  1179  VSSW  1190
              S+W
Sbjct  707   ASAW  710



>ref|XP_009594671.1| PREDICTED: scarecrow-like protein 21 [Nicotiana tomentosiformis]
Length=583

 Score =   193 bits (490),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 139/387 (36%), Positives = 187/387 (48%), Gaps = 38/387 (10%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CAR       +   SLI + R++VS  GDP +R+  Y  E L  R   S         
Sbjct  218   IACARALAENKLDDFGSLIAKARNAVSITGDPIQRLGAYIVEGLVARKEASGTNIYRALR  277

Query  240   -KRPANFDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K PA  D       LSY + L + CPY KF ++ AN AI EA     +IHIIDF I QG
Sbjct  278   CKEPAGRD------LLSYMQILYEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQG  331

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW  LLQALA R  G P  +RI+GI  PV   +    L   G RL + +K  ++  EF 
Sbjct  332   TQWLTLLQALAARPSGAP-HVRITGIDDPVSKYARGDGLTLVGERLAEVSKKFNIPVEFH  390

Query  594   --PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSI  758
               PV  P   +      V P E LAVNF L L++  DE+          L++  SL+P +
Sbjct  391   AVPVFAP--EVTRDMLDVRPGEALAVNFPLVLHHTPDESVDVTNPRDELLRMVKSLSPKV  448

Query  759   VTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM  938
             VTL E E + N   F  RF  AL YY A+FES+D  + RD  ER+ VE   L R I  ++
Sbjct  449   VTLVEQESNTNTAPFFPRFLEALDYYCAMFESIDVTLERDRKERINVEQHCLARDIVNII  508

Query  939   RPE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysss  1112
               E  E+  + E +           W++    AGF+   +S Y +S  K LL  Y+   +
Sbjct  509   ACEGKERVERHELL---------GKWKLRFTMAGFRQYPLSSYVNSVIKSLLRCYSEHYT  559

Query  1113  ysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
                 D   G + L W D  L++ S+WH
Sbjct  560   LVEKD---GAMLLGWKDRNLISASAWH  583



>ref|XP_009346793.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=704

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 138/364 (38%), Positives = 188/364 (52%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP--------ANFDASSEEL  278
             A + L  +   V+ LGD  +RVA  F++AL  RL+ +    P        + F  +S E+
Sbjct  358   ARRYLHHLNRVVTPLGDSMQRVASCFTDALSARLAATLTTNPRASAPQPFSPFPPNSLEI  417

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  418   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPG  477

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+  P +      ++  TG  L + A  L + FEF  V   +  L    F 
Sbjct  478   GAP-FLRITGV-GPCI-----EAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  530

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  531   RRIGEALAVNTVNRLHRV---PVNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  587

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E    +TE        E 
Sbjct  588   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAE-RTE------RHER  640

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              D WR +MES GFK+VA+S  A +Q+KILL  Y+        D+  G L L W D  ++ 
Sbjct  641   LDKWRKVMESKGFKSVALSANAVTQSKILLGLYSCDGYRMTEDN--GCLLLGWQDRSIMA  698

Query  1179  VSSW  1190
              S+W
Sbjct  699   ASAW  702



>gb|EMS52091.1| hypothetical protein TRIUR3_35245 [Triticum urartu]
Length=646

 Score =   194 bits (492),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 131/375 (35%), Positives = 185/375 (49%), Gaps = 18/375 (5%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANF  257
             CA  L+  + E  +K +   R +VS  G+P +R+  Y  E L  R  NS     +     
Sbjct  283   CAEALSEDRTEEFLKLVQEARGTVSINGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCR  342

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             +  S+EL    K L + CPY KF ++ AN AI EA      IHIIDF I QG QW  L+Q
Sbjct  343   EPESKELLSYMKILYNICPYFKFGYMAANGAIAEALRSEDNIHIIDFQIAQGTQWITLIQ  402

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALA R GG P  +RI+GI  PV   +    L   GN L   +K  ++  EF P+      
Sbjct  403   ALAARPGGPP-HVRITGIDDPVSEYARGEGLEIVGNMLTSMSKEFNIPLEFTPLSVYATQ  461

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSP  788
             +     ++ P E +AVNF LQL++  DE+          L++   L+P + TL E E   
Sbjct  462   VTEEMLKIRPGEAVAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHT  521

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTE  968
             N   FL RF   + YYSA+FES+D N+ RDS ER+ VE   L + I  ++   E + + E
Sbjct  522   NTTPFLMRFLETMDYYSAMFESIDANLPRDSKERISVEQHCLAKDIVNIIAC-EGKDRVE  580

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
               E+         W+  +  AGFK   +S Y +S  K LL      S    ++   G + 
Sbjct  581   RHELL------GKWKSRLSMAGFKPYPLSSYVNSVIKKLL---ACYSDKYTLEEKDGAML  631

Query  1149  LAWNDEPLLTVSSWH  1193
             L WN   L++ S+WH
Sbjct  632   LGWNTRKLISASAWH  646



>ref|XP_001770794.1| predicted protein [Physcomitrella patens]
 gb|EDQ64318.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/348 (34%), Positives = 180/348 (52%), Gaps = 25/348 (7%)
 Frame = +3

Query  168   GDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQ  347
             GDP +R+A YF EAL + L+        +  + S+   L+Y+A     P++KF+H+TANQ
Sbjct  107   GDPMQRIALYFGEALTDHLAGVVSPSETHLLSDSK---LAYQAFYKVLPFAKFSHVTANQ  163

Query  348   AILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAAS  527
              I EA  ++  +H++D  I  G+QW   +Q+LA R GG P  +RIS I       + A +
Sbjct  164   TIYEAVVRSQNVHVVDLDIQLGLQWPCFIQSLAMRPGGAPH-LRISAI------GTNAEN  216

Query  528   LLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETT  707
             L  T  RL +FA+ L + FEF PVL  + +L  +   +  +E LA+N    L+ L  E  
Sbjct  217   LQTTKRRLSEFAEALKVPFEFTPVLSSLENLTAAMLDIRSEEDLAINCSQVLHTLSGE-E  275

Query  708   ATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPE  887
             A +   L + ++L P++VTL E E + N   F+ RF  AL YY A+F+SL+  + RDS +
Sbjct  276   AVLDKLLSMFHNLKPNVVTLLEAEANHNGASFIARFVEALHYYCALFDSLEGALGRDSAD  335

Query  888   RVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAH  1067
             R  +ES  L   I E++  +  R +             + WR L   AGF ++A S Y  
Sbjct  336   RYHIESTALAAEIKEIVAFKGNRRRVR-------HVRSETWRGLFAKAGFLSMAFSSYTV  388

Query  1068  SQAKILLWnynysssysLIDSPPGFLS-------LAWNDEPLLTVSSW  1190
              QA++LL             + P  LS       L W + P++ VS+W
Sbjct  389   QQAQMLLEVLTSKPMQQANATMPYKLSQESTSLILGWQETPVIGVSAW  436



>emb|CDP16713.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   194 bits (493),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 137/364 (38%), Positives = 186/364 (51%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V+ LGD  +RVA  F+EAL  RL+ +   +PA         F  +S E+
Sbjct  361   ARRYLHHLNRVVTPLGDSMQRVASCFAEALGARLAATLTAKPATAASRPFNPFPPNSLEI  420

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ L  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  421   LKIYQILYQACPYIKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPG  480

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+     G  P A +  TG  L + A  L + FEF PV   +  L      
Sbjct  481   GAP-FLRITGV-----GPYPEA-VRETGRCLTELAHSLHIPFEFHPVGEQLEDLKPHMLN  533

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +      ++G  L +     P+IVT+ E E S N   FL RF 
Sbjct  534   RRVGEALAVNSVNRLHWVPGN---SLGNLLGMIRDQAPNIVTIVEQEASHNGPYFLGRFL  590

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     +S +R KVE  +    I  ++  EE R +          E 
Sbjct  591   EALHYYSAIFDSLDATFPAESAQRAKVEQYIFAPEIRNIVA-EEGRERVR------RHER  643

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +ME  G+K V +S  A +Q+KILL  Y+        D   G L L W D  ++ 
Sbjct  644   LEKWRKIMEGKGYKGVGLSTNAVTQSKILLGLYSCEGYRLTEDK--GCLLLGWQDRAIVA  701

Query  1179  VSSW  1190
              S+W
Sbjct  702   ASAW  705



>ref|XP_008341667.1| PREDICTED: DELLA protein RGL1-like [Malus domestica]
Length=705

 Score =   194 bits (493),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 138/366 (38%), Positives = 186/366 (51%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL--------SNSPEKRPANFDASSEEL  278
             A + L  +   V+ LGD  +RVA  F+EAL  RL        S S  K  + F  +S E+
Sbjct  359   ARRYLHHLNRVVTPLGDSMQRVASCFTEALSARLAATLTTTPSXSASKPFSPFPPNSFEI  418

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  419   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPG  478

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+   + G      +  TG  L + A  L + FEF  V   +  L    F 
Sbjct  479   GAP-FLRITGVGPCIEG------VKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  531

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +   +   +G  L +     P+IVTL E E S N   FL RF 
Sbjct  532   RRIGEALAVNTVNRLHRV---SVNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  588

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E  E+  + E        
Sbjct  589   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGVERTERHE--------  640

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR +MES GFK+V +S  A +Q+KILL  Y+        D   G L L W D  +
Sbjct  641   -RLEKWRKVMESKGFKSVPLSANAVTQSKILLGLYSCDGYRMTEDK--GCLLLGWQDRSI  697

Query  1173  LTVSSW  1190
             +  S+W
Sbjct  698   MAASAW  703



>ref|XP_010917930.1| PREDICTED: DELLA protein GAI1-like [Elaeis guineensis]
Length=409

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 191/374 (51%), Gaps = 29/374 (8%)
 Frame = +3

Query  84    VDCARLAVSQPE--NAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANF  257
             ++CA +AV++ +   A   L  +   VS +GD  +RVA  F++AL  RLS  P      +
Sbjct  58    MECA-MAVAKDDYFTARGYLHHLNHLVSPIGDSMQRVASCFADALAARLSPPPAP--KPY  114

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
              A S      Y  L  ACPY KFAH TANQAILEA E   ++H++D  I+QG QW A LQ
Sbjct  115   PAPSLHTFKFYHILYQACPYFKFAHFTANQAILEAFESEDRVHVVDLNILQGHQWPAFLQ  174

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP-IH  614
             ALATR GG P ++RI+G+        PA S+  TG  L + A  L + FEF P +   + 
Sbjct  175   ALATRPGGPP-ALRITGV------GHPAESVHQTGRHLAELAHSLHVPFEFHPAIADRLE  227

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              L  S       E LAVN + +L+ + D     +   L       P IVTL E E S N 
Sbjct  228   DLRPSMLHRRVGEALAVNAVCRLHRVPD---IHLDWLLSTIRDQAPKIVTLVEIEASHND  284

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTE  968
               FL RF  AL Y++A+F+SLD     DS  R KVE  +    I  ++  E  E+ A+ E
Sbjct  285   PHFLGRFLEALPYFAALFDSLDATFPADSAARAKVEQYIFAPEIKNIVAREGAERVARHE  344

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
                        D WR +ME  GFK VA+S  +  Q++ILL  Y         ++  G + 
Sbjct  345   ---------KLDRWRKVMEGRGFKGVALSANSVDQSRILLGLYACDGYRLTEEN--GCMF  393

Query  1149  LAWNDEPLLTVSSW  1190
             L W D+ ++  S+W
Sbjct  394   LGWRDQRMIAASAW  407



>emb|CDP09804.1| unnamed protein product [Coffea canephora]
Length=684

 Score =   194 bits (492),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 132/380 (35%), Positives = 195/380 (51%), Gaps = 29/380 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSN--------SP  236
             V CA    S+   A+   I R+ +  S  G P  R+  YF+EAL  R++         SP
Sbjct  306   VACADAIASKNILAINHFIARLGELASPRGSPISRLTAYFTEALSLRVARFWPHIFHISP  365

Query  237   EKRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGI  416
                P + D   ++   S + LN   P  +F H T+N+ +L A E   ++HIIDF I QG+
Sbjct  366   ---PRDLDRVDDDCGTSLRLLNQVSPIPRFIHFTSNEILLRAFEGKDRVHIIDFDIKQGL  422

Query  417   QWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEP  596
             QW +L Q+LA+R+   P  IRI+GI     G S    L+ TG+RL  FA+ L+L FEF P
Sbjct  423   QWPSLFQSLASRTN-PPSHIRITGI-----GES-KQELIETGDRLAGFAEALNLPFEFHP  475

Query  597   VLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLL-DETTATVGTALKLANSLNPSIVTLGE  773
             V+  +  +      V   E +AVN + QL+ +L D T   +   L L  S NP++V +GE
Sbjct  476   VVDRLEDVRLWMLHVKEKESVAVNCIFQLHKMLYDSTGGVLRDFLGLIRSTNPTVVLMGE  535

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ  953
              E   N  GF  R  N+LKYYSAIF+SL+ ++  DSP R+K+E  +  R I  ++  E Q
Sbjct  536   QEAEHNGPGFETRLTNSLKYYSAIFDSLEESIAADSPIRMKIEE-MFAREIRNIIACEGQ  594

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
                               W+ +ME  GF+++        Q+++LL  Y   +        
Sbjct  595   ERFERHQGFVK-------WQKMMEQGGFRSLNTGERELLQSRMLLKMYGSENYKVEKQGE  647

Query  1134  PG-FLSLAWNDEPLLTVSSW  1190
              G  L+L+W D+PL T+S+W
Sbjct  648   DGAALTLSWLDQPLYTISAW  667



>ref|XP_010907680.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2 
[Elaeis guineensis]
Length=539

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 180/378 (48%), Gaps = 22/378 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             + CAR         +  LI  +R  VS  G+P +RV  Y  E L  RLS+S     K   
Sbjct  174   IACARAVADNDAQVMDWLIPELRQMVSVSGEPIQRVGAYMLEGLIARLSSSGSSIYKALK  233

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               + +S +L      L D CPY KFA+L+AN AI EA +   K+HIIDF I QG QW  L
Sbjct  234   CKEPTSSDLLSYMHILYDVCPYFKFAYLSANGAIAEALKNEDKVHIIDFQIAQGSQWMTL  293

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P  +RI+GI   +   +    L   G RL  FA+   + FEF       
Sbjct  294   LQALAARPGGPP-HVRITGIDDSMSAYARGGGLHIVGQRLFRFAESCSVPFEFHAADVSC  352

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               L      V P E LAVNF  QL+++ DE+ +T       L++  SL+P +VTL E E 
Sbjct  353   CDLEVKDLGVHPGEALAVNFPFQLHHVPDESVSTENHRDRILRMVKSLSPQVVTLVEQES  412

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQR  956
             + N     +RF   L YY+AIFES+D  + RDS ER+ VE   L R I  ++  E  E+ 
Sbjct  413   NTNTAPLFQRFVETLNYYTAIFESIDVTLPRDSKERINVEQHCLARDIVNIIACEGAERV  472

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
              + E             W+     AGF    +S   ++  K LL           ++   
Sbjct  473   ERHELFGK---------WKSRFTMAGFGPYPLSPLVNATIKSLL---AKYCENYTLEERD  520

Query  1137  GFLSLAWNDEPLLTVSSW  1190
             G L L W +  L   S+W
Sbjct  521   GVLYLGWKNRRLSVSSAW  538



>ref|NP_001147837.1| LOC100281447 [Zea mays]
 gb|ACG28850.1| chitin-inducible gibberellin-responsive protein 2 [Zea mays]
Length=554

 Score =   191 bits (486),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 132/378 (35%), Positives = 190/378 (50%), Gaps = 20/378 (5%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             + CAR        A+  +I  +R  VS  G+P ER+  Y  E L  RL+ S     K   
Sbjct  189   IACARAVERYNTYAIDLMITELRKMVSVSGEPLERLGAYMVEGLVARLAASGSSIYKALK  248

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S +L      L +ACPY KF +++AN AI EA +   +IHIIDF I QG QW +L
Sbjct  249   CKEPRSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAIKGEDRIHIIDFHIAQGAQWVSL  308

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P  +R++GI   V   +    L   G RL   A +  + F+F+ +    
Sbjct  309   LQALAARPGGPP-FVRVTGIDDSVSAYARGGGLELVGRRLTHIAGLYKVPFQFDALAISG  367

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEM  782
               +      V P E +AVNF L+L+++ DET +T       L+L   L+P ++TL E E 
Sbjct  368   SEVEEEHLGVVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGLSPKVLTLVEQES  427

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQRA  959
             + N   F +RF   L YY+AIFES+D  + RD  ER+ +E   L R I  L+  E E+R 
Sbjct  428   NTNTAPFAQRFAETLDYYTAIFESIDLALPRDDRERINIEQHCLAREIVNLVACEGEERV  487

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             +   V  +        W+  +  AGF    +S   ++  K LL +Y+     +  D   G
Sbjct  488   ERHEVFGK--------WKARLMMAGFSPSPLSALVNATIKTLLQSYSPDYKLAERD---G  536

Query  1140  FLSLAWNDEPLLTVSSWH  1193
              L L W + PL+  S+WH
Sbjct  537   VLYLGWKNRPLIVSSAWH  554



>ref|XP_009788119.1| PREDICTED: scarecrow-like protein 21 [Nicotiana sylvestris]
 ref|XP_009788120.1| PREDICTED: scarecrow-like protein 21 [Nicotiana sylvestris]
Length=583

 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 138/387 (36%), Positives = 186/387 (48%), Gaps = 38/387 (10%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CAR       +   SLI + R+++S  GDP +R+  Y  E L  R   S         
Sbjct  218   IACARALTENKLDDFGSLIAKARNAISITGDPIQRLGAYIVEGLVARKEASGTNIYRALR  277

Query  240   -KRPANFDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K PA  D       LSY   L + CPY KF ++ AN AI EA     +IHIIDF I QG
Sbjct  278   CKEPAGRD------LLSYMHILYEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQG  331

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW  LLQALA R  G P  +RI+GI  PV   +    L   G RL D ++  ++  EF 
Sbjct  332   TQWMTLLQALAARPSGAPH-VRITGIDDPVSKYARGDGLAFVGKRLTDISEKFNIPVEFH  390

Query  594   --PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSI  758
               PV  P   +      V P E LAVNF L L++  DE+          L++  SL+P +
Sbjct  391   AVPVFAP--EVTRDMLDVRPGEALAVNFPLVLHHTPDESVDVTNPRDELLRMVKSLSPKV  448

Query  759   VTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM  938
             VTL E E + N   F  RF  AL YY A+FES+D  + RD  ER+ VE   L R I  ++
Sbjct  449   VTLVEQESNTNTAPFFPRFLEALDYYCAMFESIDVTLERDRKERINVEQHCLARDIVNVI  508

Query  939   RPE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysss  1112
               E  E+  + E +           W++    AGF+   +S Y +S  K LL  Y+   +
Sbjct  509   ACEGKERVERHELLGK---------WKLRFTMAGFRQYPLSSYVNSVIKSLLRCYSEHYT  559

Query  1113  ysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
                 D   G + L W D  L++ S+WH
Sbjct  560   LVEKD---GAMLLGWKDRNLISASAWH  583



>ref|XP_004304540.1| PREDICTED: DELLA protein GAI1-like [Fragaria vesca subsp. vesca]
Length=709

 Score =   193 bits (491),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 188/364 (52%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL-----SNSPEKRP---ANFDASSEEL  278
             A + L  +   VS LGD  +RVA  F+EAL  RL     +NS    P   + F  +S E+
Sbjct  363   ARRYLHHLNQVVSALGDSMQRVAACFTEALSARLAATLTTNSSALAPKPFSPFPPNSLEI  422

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA RSG
Sbjct  423   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARSG  482

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+  P +      ++  TG  L + A  L + FEF  V   +  L    F 
Sbjct  483   GAP-FLRITGV-GPCI-----EAVKETGRCLMELAISLHVPFEFHAVGEQLEDLKPHMFN  535

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  536   RRIGEALAVNTVNRLHRVPGN---CLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  592

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +    I  ++   E   +TE        E 
Sbjct  593   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVA-FEGAERTE------RHER  645

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +ME  GFK+V +S  A +Q+KILL  Y+      + D   G L L W D  ++ 
Sbjct  646   LEKWRKVMEGKGFKSVPLSANAVTQSKILLGLYSCDGYRMMEDK--GCLLLGWQDRSIMA  703

Query  1179  VSSW  1190
              S+W
Sbjct  704   ASAW  707



>ref|XP_010690197.1| PREDICTED: scarecrow-like protein 18 [Beta vulgaris subsp. vulgaris]
Length=488

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 146/418 (35%), Positives = 205/418 (49%), Gaps = 63/418 (15%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDS--VSQLGDPTERVAYYFSEALYNRLSNS--------  233
             V CA L      ++   L+ +  S   SQ GD TER+ YYF  AL  RL+          
Sbjct  84    VTCAELISRSEFSSANRLLSLVSSELASQSGDSTERLVYYFCRALNERLNRHLSSITTCV  143

Query  234   --------PEKRPANFDA--------------SSEELTLSYKALNDACPYSKFAHLTANQ  347
                     P+    ++                S+     SY +LN   P+++F HLTANQ
Sbjct  144   ISPSMSIPPQSLAQHYPIIPIRPPIMRAMPLESTTSRYSSYLSLNQVTPFTRFTHLTANQ  203

Query  348   AILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG--GKP-DSIRISGIP-SPVLGNS  515
             AILEA E  S IHI+D  I+ G+QW  L+QA+  RS   G+P  +IRI+G    P L   
Sbjct  204   AILEAVEGYSSIHILDMDIMHGVQWPPLMQAIMERSTTLGRPCPTIRITGAAYDPNL---  260

Query  516   PAASLLATGNRLRDFAKVLDLNFEFEPVL-----------GPIHSLNGSSFRVDP-DEIL  659
                 L  TG+RLR FA+ L L F+F  +L             IH+L     R +  +E L
Sbjct  261   ----LEKTGDRLRRFAESLGLEFQFRDLLLHDSEVVDHSEAVIHTLLDHRLRFNQVEEAL  316

Query  660   AVNFMLQLYNLLDE-TTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             A+N    L+ LL E  T ++   L    +LNP ++TLGE E   N   FL+RF  AL +Y
Sbjct  317   AINCGDYLHRLLREYDTRSLRRFLHQVKTLNPRVLTLGEREADHNHPIFLRRFVEALDHY  376

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRI  1016
              AIF+SL+  +   S ERV VE    G  I +++  E +R K             + W +
Sbjct  377   GAIFDSLEATLPPQSRERVAVEEGWFGEEIKDVVGEEGERRKERHQRF-------ESWEV  429

Query  1017  LMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             ++ S+GFK++A+S ++ SQAK+LL  +  S  Y L       L L W + PL +VSSW
Sbjct  430   VLRSSGFKSLALSPFSLSQAKLLLRLHYPSEGYQLQVLNSNCLLLGWKNRPLYSVSSW  487



>dbj|BAK03376.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   191 bits (486),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 136/383 (36%), Positives = 188/383 (49%), Gaps = 34/383 (9%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------K  242
             CAR    +   AV  ++  +R  VS    P ER+  Y  E L  RL++S          K
Sbjct  194   CARAVEEKNMYAVDVMVPELRKMVSVSDTPLERLGAYMVEGLVARLASSGHSIYKALRCK  253

Query  243   RPANFDASSEELTLSYKA-LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
              P + D       LSY   L +ACPY KF +++AN AI EA +   +IHIIDF I QG Q
Sbjct  254   EPKSSD------LLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQ  307

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPV  599
             W +LLQALA R GG P ++RI+GI   V   +    L   G RL   A +  + FEF  V
Sbjct  308   WISLLQALAARPGGPP-TVRITGIDDSVSAYARGGGLDLVGRRLSHIAGLCKVPFEFRSV  366

Query  600   LGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLG  770
                   +      V P E LAVNF L+L+++ DET +T       L+L   L P ++TL 
Sbjct  367   AMAGEEVEEGHLGVVPGEALAVNFTLELHHIPDETVSTANHRDRILRLVKGLRPKVLTLV  426

Query  771   EYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-  947
             E E + N   F +RF   L YY+AIFES+D  + RD  ERV +E   L R +  L+  E 
Sbjct  427   EQESNTNTAPFPQRFAETLDYYTAIFESIDLTLPRDDRERVNMEQHCLAREVVNLIACEG  486

Query  948   -EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E+  + E             W+  +  AGF+   +S   ++    LL +Y+ +   +  
Sbjct  487   AERVERHEVFGK---------WKARLTMAGFRPSPLSSLVNATISKLLQSYSDNYKLAER  537

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
             D   G L L W   PL+  S+WH
Sbjct  538   D---GALYLGWKKRPLVVSSAWH  557



>ref|XP_008680172.1| PREDICTED: DELLA protein GAI-like [Zea mays]
 gb|AFW60842.1| hypothetical protein ZEAMMB73_473687 [Zea mays]
 gb|AIB04575.1| GRAS transcription factor, partial [Zea mays]
Length=771

 Score =   193 bits (491),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 140/374 (37%), Positives = 192/374 (51%), Gaps = 36/374 (10%)
 Frame = +3

Query  111   QPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLS-NSPEKR----------PANF  257
             QP +A++ L  +R   S LGD  +RVA YF++AL  RLS N+P             P  F
Sbjct  418   QP-SALRHLHLLRRVASPLGDSMQRVASYFADALAARLSSNNPSSSAGAGAGAGVAPYTF  476

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
               S + L + Y+ L  ACPY KFAH TANQAI EA     ++H++D  I+QG QW A LQ
Sbjct  477   PPSPDTLKV-YQILYQACPYIKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQ  535

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP-IH  614
             ALA R GG P ++R++G+        PAA++  TG  L   A  L + FEF   +   + 
Sbjct  536   ALAARPGGPP-TLRLTGV------GHPAAAVRETGRHLASLAASLRVPFEFHAAVADRLE  588

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNR  794
              L  ++      E LAVN + +L+ +       +G  L +     P I+TL E E   N 
Sbjct  589   RLRPAALHRRVGEALAVNAVNRLHRV---PAVHLGPLLSMIRDQAPKIMTLVEQEAGHNG  645

Query  795   VGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTE  968
               FL RF  AL YYSAIF+SLD     DS +R+KVE  LL   I  ++  E  E+ A+ E
Sbjct  646   PYFLGRFLEALHYYSAIFDSLDATFPADSAQRMKVEQCLLAPEIRNVVACEGAERVARHE  705

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
                        D WR +ME  GF+ V +S  A +Q+++LL  Y     Y L +   G L 
Sbjct  706   ---------RLDRWRRIMEGRGFEPVPLSPAAVAQSQVLLGLYGAGDGYRLTED-RGCLL  755

Query  1149  LAWNDEPLLTVSSW  1190
             L W D   +  S+W
Sbjct  756   LGWQDRATIAASAW  769



>gb|KDP39239.1| hypothetical protein JCGZ_00996 [Jatropha curcas]
Length=528

 Score =   191 bits (484),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 177/360 (49%), Gaps = 21/360 (6%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLSYKALND  305
             +  +R  VS  G+P +R+  Y  E L  RLS+S     K     + +S EL      L +
Sbjct  181   MAELRQMVSVSGEPIQRLGAYMLEGLVARLSSSGSSIYKALRCKEPTSAELLSYMHILYE  240

Query  306   ACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRIS  485
              CPY KF +++AN AI EA +  S++HIIDF I QG QW  L+QALA R GG P  IR++
Sbjct  241   VCPYFKFGYMSANGAIAEAMKTESRVHIIDFQISQGSQWVTLIQALAARPGGPPH-IRLT  299

Query  486   GIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAV  665
             GI       +    L   G RL   A+   + FEF         +   + R+ PDE +AV
Sbjct  300   GIDDSSAAYARGGGLDIVGQRLSRLAESCKVPFEFHAAAVSASEIQLENLRIQPDEAIAV  359

Query  666   NFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             NF L L+++ DE+  T       L+L  SL+P +VTL E E + N   F+ RF   L YY
Sbjct  360   NFALMLHHMPDESVGTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAPFIPRFNEVLNYY  419

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKDHW  1010
              A+FES+D  + R+  ER+ VE   L R I  ++  E  E+  + E +           W
Sbjct  420   LAVFESIDVTLPREHKERINVEQHCLAREIVNIVACEGAERVERHELL---------GKW  470

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             +     AGF    +S Y ++  K LL      S    ++   G L L W + PL+   +W
Sbjct  471   KSRFAMAGFTPCPLSSYVNATIKALL---ESYSKNYTLEERDGSLYLGWMNRPLIASCAW  527



>gb|KHN27990.1| Chitin-inducible gibberellin-responsive protein 1 [Glycine soja]
Length=386

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 182/381 (48%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPA  251
             + CA+       N    L+ R +D+VS  G+P +R+  Y  E L  R     NS      
Sbjct  20    IACAKALSENNMNDFDQLVGRAKDAVSINGEPIQRLGAYMVEGLVARTQASGNSIYHALR  79

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +   +EL    + L + CPY KF ++ AN AI EA     +IHIIDF I QG QW  L
Sbjct  80    CKEPEGDELLTYMQLLFEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQGTQWMTL  139

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R GG P  +RI+GI  PV   +        G RL   ++   +  EF   PV  
Sbjct  140   LQALAARPGGAP-HVRITGIDDPVSKYARGDGPEVVGKRLALMSEKFGIPVEFHGVPVFA  198

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +      + P E LAVNF LQL++  DE+          L+L  SL+P + TL E 
Sbjct  199   P--DVTREMLDIRPGEALAVNFPLQLHHTADESVHVSNPRDGLLRLVRSLSPKVTTLVEQ  256

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   F  RF   L YY AIFES+D  + RDS ER+ VE   L R I  ++  E  E
Sbjct  257   ESNTNTTPFFNRFIETLDYYLAIFESIDVTLPRDSKERINVEQHCLARDIVNIIACEGKE  316

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+  ++ AGF+   +S Y +S  + LL  Y+   +    D 
Sbjct  317   RVERHELF---------GKWKSRLKMAGFQQCPLSSYVNSVIRSLLRCYSEHYTLVEKD-  366

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W D  L++ S+WH
Sbjct  367   --GAMLLGWKDRNLISASAWH  385



>gb|ACR48080.1| scarecrow 2 [Lupinus albus]
 gb|ACR48081.1| scarecrow 2 [Lupinus albus]
Length=770

 Score =   193 bits (490),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 137/370 (37%), Positives = 196/370 (53%), Gaps = 24/370 (6%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             CA  ++    E+A K L+ I    +  G   +RVA YFSEA+  RL +S     A F ++
Sbjct  409   CAEAVSAENVEDANKMLLEISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATFPST  468

Query  267   --SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
               S ++  +Y+  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   
Sbjct  469   VVSHKVASAYQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHI  528

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LA+R GG P  +R++G     LG S  A L ATGNRL DFA  L L FEF PV   + +L
Sbjct  529   LASRPGGPP-YVRLTG-----LGTSMEA-LEATGNRLSDFANKLGLPFEFSPVPHKVGNL  581

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             +     V   E +AV+++   ++L D T +   T L L   L P +VT+ E ++S N   
Sbjct  582   DLEILNVSKTEAVAVHWL--QHSLYDVTGSDTNT-LWLLQRLAPKVVTVVEQDLS-NAGS  637

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             FL RF  A+ YYSA+F+SL  +   +S ER  VE  LL R I  ++         E    
Sbjct  638   FLGRFVEAIHYYSALFDSLGCSYGEESEERHVVEQQLLSREIRNVLAIGGPSRTGEFKF-  696

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                     +WR  ++  GF+ +++S  A +QA +LL  +       + D+  G L L W 
Sbjct  697   -------HNWREKLQQCGFRGISLSGNAATQASLLLGMFPSEGYTLVEDN--GILKLGWK  747

Query  1161  DEPLLTVSSW  1190
             D  LLT S+W
Sbjct  748   DLCLLTASAW  757



>ref|XP_006447014.1| hypothetical protein CICLE_v10018153mg [Citrus clementina]
 ref|XP_006470106.1| PREDICTED: protein SCARECROW-like [Citrus sinensis]
 gb|ESR60254.1| hypothetical protein CICLE_v10018153mg [Citrus clementina]
Length=680

 Score =   192 bits (488),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 186/366 (51%), Gaps = 31/366 (8%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS--------PEKRPANFDASSEEL  278
             A + L  +   VS LGD  +RVA  F+EAL  RL+ +             + F  +S E+
Sbjct  334   ARRYLHHLNRVVSPLGDSMQRVASCFTEALSARLAATLTTKPSTSTPTPFSPFPPNSLEV  393

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  394   LKIYQIVYQACPYVKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPG  453

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+ + +       S   TG  L + A  L + FEF PV   +  L    F 
Sbjct  454   GAP-FLRITGVGATI------ESAKETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMFN  506

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +    +  +G  L +     P+IVT+ E E S N   FL RF 
Sbjct  507   RRVGEALAVNAVNRLHRV---PSNCLGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFL  563

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E  E+ A+ E        
Sbjct  564   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGGERTARHE--------  615

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                + WR +ME  GF+ V +S  A +Q+KILL  Y+        D+  G L L W D  L
Sbjct  616   -RLEKWRKIMEGKGFRGVPLSANAVTQSKILLGLYSCDGYRLTEDN--GCLLLGWQDRAL  672

Query  1173  LTVSSW  1190
             L  S+W
Sbjct  673   LAASAW  678



>ref|XP_011097940.1| PREDICTED: scarecrow-like protein 21 [Sesamum indicum]
Length=541

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 139/379 (37%), Positives = 193/379 (51%), Gaps = 22/379 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIR-IRDSVSQLGDPTERVAYYFSEALYNR--LSNSPEKRPAN  254
             + CAR       N  + L++  R +VS  G+P +R+  Y  E L  R  LS +       
Sbjct  176   ISCARALSEDKLNEFEELVKHARAAVSISGEPIQRLGAYMLEGLIARKELSGTHIYHALK  235

Query  255   FDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                   +  LSY + L + CPY KF ++ AN AI EA +   +IHIIDF I QG QW  L
Sbjct  236   CSELDSKDLLSYMRILYEICPYYKFGYMAANGAIAEACKNEDRIHIIDFQIAQGTQWITL  295

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
             LQALA R GG P  +RISGI  P    +    L A   R    +K  ++  EF  V  P+
Sbjct  296   LQALAARPGGAP-GVRISGIDDPFSEYARGDGLAAVRKRFEAISKKYNIPVEFHAV--PV  352

Query  612   HSLNGSSFRVD--PDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
              +L+ +   +D  P E LAVNF LQL++  DE+          L++  SL+P +VTL E 
Sbjct  353   FALDVTRNMLDIRPGEALAVNFPLQLHHTPDESVDVSNPRDGLLRMVKSLSPKVVTLVEQ  412

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQR  956
             E + N   FL RF   L YY A+FES+D  M R+  ER+ VE   L R I  ++   E +
Sbjct  413   ESNTNTAPFLARFTETLDYYLAMFESIDVTMPREGKERINVEQQCLAREIVNVIAC-EGK  471

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
             A+ E  E+         WR     AGF+ + +S Y +S  + LL    YS  Y+L++   
Sbjct  472   ARVERHELF------GKWRSRFMMAGFRQLPLSSYVNSVIRGLL--RCYSEHYTLLEKDG  523

Query  1137  GFLSLAWNDEPLLTVSSWH  1193
             G L L W D  L++ S+WH
Sbjct  524   GML-LGWKDRNLISASAWH  541



>ref|XP_009388384.1| PREDICTED: protein MONOCULM 1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 134/363 (37%), Positives = 191/363 (53%), Gaps = 33/363 (9%)
 Frame = +3

Query  153   SVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDASSEELTLSYKALNDACPYSKFAH  332
             + S  GD T+R+ + F+ AL  R+       P+   AS E L  SY + N   P+ +FAH
Sbjct  66    TASPYGDSTDRLVHQFARALSLRVD---PLFPSVDAASPEALQSSYLSFNQITPFLRFAH  122

Query  333   LTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG-GKPDSIRISGIPSPVLG  509
             LTANQAILEA +   ++HI+DF    G+QW  LLQA++ RS    P SIRI+G    +  
Sbjct  123   LTANQAILEAVDGHRQVHILDFDTSHGLQWPPLLQAISERSDPNNPPSIRITGTGRNL--  180

Query  510   NSPAASLLATGNRLRDFAKVLDLNFEFEPVL----------GPIHSLNGSSFRVDPDEIL  659
                   L  TG+RL+ FA  L L FEF  +L                  SS R+ P EIL
Sbjct  181   ----DVLRRTGDRLQTFADSLGLGFEFHALLFPSTTSDPSSSTTTDFTSSSLRLHPGEIL  236

Query  660   AVNFMLQLYNLLDETTAT-----VGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
              VN +L L+NLL + + +     +   L+   ++NP++VT+ E E + N   F +RF  A
Sbjct  237   TVNCVLFLHNLLQDGSGSDDSRDLRAFLQAVRAMNPAVVTVAEREANHNAPIFFQRFMEA  296

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKD  1004
             L YY+A+FESL+  +   S ER  VE + LGR I +++  E +R +      +       
Sbjct  297   LDYYTAVFESLEATLPPTSRERAAVEQVWLGREIEDVVAREGERRRERHERFDR------  350

Query  1005  HWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVS  1184
              W  LM  AGF  + +S +A SQA++LL  +  S  Y L      F  L W ++PL +VS
Sbjct  351   -WETLMRGAGFTNLPLSPFALSQARLLLRLHYPSEGYQLHTVRDSFF-LGWQNKPLFSVS  408

Query  1185  SWH  1193
             SWH
Sbjct  409   SWH  411



>ref|XP_008797426.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
isoform X2 [Phoenix dactylifera]
Length=528

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 188/386 (49%), Gaps = 36/386 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIR-IRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CA        N  + L++  R SVS +G+P +R+  Y  E L  R  +S         
Sbjct  163   IRCAEALSEDKINEFEMLVQEARASVSIIGEPIQRLGAYMLEGLVARKESSGTNIYRALR  222

Query  240   -KRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGI  416
              ++PA     S+EL    + L D CPY KF ++ AN AI EA     +IHIIDF I QG 
Sbjct  223   CQKPA-----SKELLSYMRILYDICPYFKFGYMAANGAIAEALRHEDRIHIIDFQIAQGT  277

Query  417   QWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE-  593
             QW  L+QALA R GG P  +RI+GI       +    L   G  L D +K  ++  EF  
Sbjct  278   QWVTLIQALAARPGGPPH-VRITGIDDAESEYARGDGLQLVGKMLSDMSKKFNIPLEFNG  336

Query  594   -PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIV  761
              PV GP   +      + P E LAVNF LQL++  DE+          L++   L+P + 
Sbjct  337   LPVFGP--DVTREMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVT  394

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             TL E E + N   FL RF   L YY A+FES+D  + RDS +R+ VE   L + I  ++ 
Sbjct  395   TLVEQESNTNTTPFLMRFLETLDYYYAMFESIDVTLPRDSKQRINVEQHCLAKDIVNIIA  454

Query  942   PE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssy  1115
              E  E+  + E +           WR  +  AGFK + +S Y +S  K LL  Y+   + 
Sbjct  455   CEGKERVERHELL---------GKWRSRLTMAGFKPLPLSSYVNSVIKSLLGCYSDKYTL  505

Query  1116  sLIDSPPGFLSLAWNDEPLLTVSSWH  1193
                D   G + L W D  L++ S+WH
Sbjct  506   VEKD---GAMLLGWKDRNLISASAWH  528



>gb|AJC52496.1| SCL10 [Pinus radiata]
Length=701

 Score =   191 bits (486),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 192/377 (51%), Gaps = 22/377 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPAN  254
             ++CA+ A++   NA   +  +R  V+  GDP  R+A Y  E L  RL  S     K    
Sbjct  338   IECAK-AIADGRNADNLIAGLRQVVNIYGDPLHRLAAYMVEGLVARLHFSGGHIYKTLKC  396

Query  255   FDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALL  434
              + +S EL      L + CPY KF ++ AN AI EA +   ++HIIDF I QG QW  L+
Sbjct  397   KEPTSSELLSYMHILYEVCPYFKFGYVAANGAIAEAFKDKDRVHIIDFQIAQGSQWVTLI  456

Query  435   QALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIH  614
             QA A R GG P  +RI+G+  P    +    L   G RL   A+   + FEF  +     
Sbjct  457   QAFAARQGGSP-HVRITGVDDPQSEYARGQGLNLVGERLSKLAESYQVPFEFHGLSVFGS  515

Query  615   SLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMS  785
              ++    ++ P E LAVNF LQL+++ DE+  T       L++  + +P++VTL E E +
Sbjct  516   DVHAEMLKIRPGEALAVNFPLQLHHMPDESVNTSNHRDRLLRMVKNFSPNVVTLVEQEAN  575

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRA  959
              N   F  RF   L YY+A+FESLD  + RDS ERV VE   L R I  ++  E  E+  
Sbjct  576   TNTAPFFPRFMETLSYYTAMFESLDVTLPRDSKERVSVEQHCLARDIVNVIACEGDERVE  635

Query  960   KTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPG  1139
             + E             WR  +  AGFK+  +S + +S  K++L   +Y+ +Y LI+    
Sbjct  636   RHELFGK---------WRSRLTMAGFKSYPLSAHVNSTIKVVL--NSYNENYRLIEKDEA  684

Query  1140  FLSLAWNDEPLLTVSSW  1190
              L L W D  L+  S+W
Sbjct  685   -LYLGWLDRDLIVASAW  700



>ref|XP_001769597.1| predicted protein [Physcomitrella patens]
 gb|EDQ65590.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 184/355 (52%), Gaps = 23/355 (6%)
 Frame = +3

Query  156   VSQLGDPTERVAYYFSEALYNRLSNSP-----EKRPANFDA-SSEELTLSYKALNDACPY  317
             VS  GD +ERVA  F EAL  R S        E  P+     S++E+  +Y ALN   P+
Sbjct  33    VSTTGDSSERVASCFFEALATRFSRVSGIQINELLPSRIQGPSNQEMISAYLALNQVTPF  92

Query  318   SKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI---RISG  488
              +FAHLTANQA+LEA    + +HI+D  I  GIQW   +QALA   G +  +I   RI+G
Sbjct  93    MRFAHLTANQALLEALTGENFVHIVDLEIGHGIQWPLFMQALADLRGEEGYTIQHLRITG  152

Query  489   IPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVN  668
             +            L  TG RL +FA+ ++L FEF P++     L      +   E +A+N
Sbjct  153   V------GQDRDVLNRTGIRLAEFAQSINLPFEFSPLVQISEHLVPRMLGLRVGEAVAIN  206

Query  669   FMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIF  848
              MLQL+ LL +    + + L +  SL P +VTL E E S N+  FL RF  AL +YS +F
Sbjct  207   CMLQLHRLLAKGPEKLISFLCMLESLTPKVVTLAELEASHNQPHFLDRFAEALNHYSTLF  266

Query  849   ESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMES  1028
             +SLD  +   S +R++VE       I  ++         +  E  V  +  + WR     
Sbjct  267   DSLDATLPPTSADRIRVEQTWCKMEIVNIV-------ACDGAERIVRHQRFELWRRYFHR  319

Query  1029  AGFKAVAISHYAHSQAKILLWnynysssysLIDS-PPGFLSLAWNDEPLLTVSSW  1190
             AGF+ ++ S +A SQA++LL  +     Y L+++   G L L W D PL  VSSW
Sbjct  320   AGFQLLSTSRFATSQARLLLRLHYPCDDYQLLENVDDGCLLLGWQDHPLFCVSSW  374



>ref|XP_003562960.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1 
[Brachypodium distachyon]
Length=571

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 129/380 (34%), Positives = 181/380 (48%), Gaps = 28/380 (7%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------K  242
             CA  L+  + E  +K +   R  VS  G+P +R+  Y  E L  R  NS          +
Sbjct  208   CAEALSEDRTEEFLKLVQEARGIVSINGEPIQRLGAYLLEGLVARHGNSGRNIYRALRCR  267

Query  243   RPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQW  422
             +P      S+EL    K L + CPY KF ++ AN AI EA      IHIIDF I QG QW
Sbjct  268   KP-----ESKELLSYMKILYNICPYFKFGYMAANGAIAEALRSEDNIHIIDFQIAQGTQW  322

Query  423   AALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVL  602
               L+QALA R GG P  +RI+GI  PV   +    L   GN L+  +K  ++  EF P+ 
Sbjct  323   ITLIQALAARPGGPP-HVRITGIDDPVSEYARGEGLEIVGNMLKGMSKEFNIPLEFTPLP  381

Query  603   GPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGE  773
                  +      + P E LAVNF LQL++  DE+          L++   L+P + TL E
Sbjct  382   VYATQVTKEMLEIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVE  441

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ  953
              E   N   F+ RF   + YYSA+FES+D N+ RD+ ER+ VE   L + I  ++     
Sbjct  442   QESHTNTTPFMMRFAETMDYYSAMFESIDANLPRDNKERISVEQHCLAKDIVNII-----  496

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
                 E  +     E    W+  +  AGFK   +S Y +S  K LL      S    ++  
Sbjct  497   --ACEGKDRVERHELLGKWKSRLTMAGFKPYPLSSYVNSVIKKLL---ACYSDKYTLEEK  551

Query  1134  PGFLSLAWNDEPLLTVSSWH  1193
              G + L W    L++ S+WH
Sbjct  552   DGAMLLGWKKRKLISASAWH  571



>ref|XP_007021111.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 gb|EOY12636.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
Length=454

 Score =   187 bits (476),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/365 (36%), Positives = 180/365 (49%), Gaps = 25/365 (7%)
 Frame = +3

Query  129   KSLIRIRDSVSQLGDPTERVAYYFSEALYNR--LSNSPEKRPANFDASSEELTLSY-KAL  299
             K + + R++VS  G+P +R+  Y  EAL  R   S S   R         +  LSY + L
Sbjct  102   KLIAKARNAVSICGEPIQRLGAYMVEALVARKEASGSNIYRARRCREPEGKDLLSYMQIL  161

Query  300   NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIR  479
              + CPY KF ++ AN AI EA     +IHIIDF I QG QW  LLQALA R GG P  +R
Sbjct  162   YEICPYLKFGYMAANGAIAEACRTEDRIHIIDFHIGQGTQWVTLLQALAARPGGAP-HVR  220

Query  480   ISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLGPIHSLNGSSFRVDPDE  653
             I+GI  P+   +    L A G RL   ++  ++  EF   PV  P   +      V P E
Sbjct  221   ITGIDDPLSKYARGGGLEAVGRRLAALSEKFNIPVEFHGVPVFAP--DITRGMLDVRPGE  278

Query  654   ILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
              LAVNF LQL++  DE+          L++  SL+P + TL E E + N   FL RF   
Sbjct  279   ALAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLSPKVTTLVEQESNTNTAPFLPRFIET  338

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveD  998
             L YY A+FES+D  + RD  ER+ VE   L R I  ++  E  E+  + E          
Sbjct  339   LDYYLAMFESIDETLPRDRKERINVEQHCLARDIVNVIACEGKERVERHELF--------  390

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
                W+  +  AGF+   +S Y +S  + LL  Y+        D   G + L W D  L++
Sbjct  391   -GKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYSKHYKLVEKD---GAMLLGWKDRNLIS  446

Query  1179  VSSWH  1193
              S+WH
Sbjct  447   ASAWH  451



>emb|CDP05816.1| unnamed protein product [Coffea canephora]
Length=586

 Score =   190 bits (482),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 137/381 (36%), Positives = 186/381 (49%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPAN  254
             ++CAR    ++ EN  K +   R +VS  G+P +R+  Y  E L  R   S     R   
Sbjct  221   MECARAFYENELENFEKLVETARGAVSITGEPIQRLGAYMLEGLIARKEASGTNIYRTLR  280

Query  255   FDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                   +  LSY   L + CPY KF ++ AN AI EA     +IHI+DF I QG QW  L
Sbjct  281   CKEPEGKDLLSYMHILYEICPYLKFGYMAANGAIAEACRNEDRIHIVDFQIAQGTQWMTL  340

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R  G P  +RI+GI  PV   +    L A G RL   ++  ++  EF   PV  
Sbjct  341   LQALAARPSGAPH-VRITGIDDPVSQYARGEGLAAVGKRLAAISEKFNIPVEFHAVPVFA  399

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDET---TATVGTALKLANSLNPSIVTLGEY  776
             P   +      + P E LAVNF LQL++  DE+   T      L++  +LNP +VTL E 
Sbjct  400   P--EVTRDMLCIRPGEALAVNFPLQLHHTPDESVDVTNPRDGLLRMVKALNPKVVTLVEQ  457

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E   N   FL RF   L+YYSAIFES+D  M RD  ER+ VE   L R I  ++  E  E
Sbjct  458   ESKTNTAPFLPRFWETLEYYSAIFESIDVTMPRDRKERINVEQHCLARDIVNIIACEGKE  517

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+     AGF+   +S Y +S  + LL  Y+   +    D 
Sbjct  518   RVERHELF---------GKWKSRFTMAGFRQYPLSSYVNSVIRGLLRCYSEHYTLVEAD-  567

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W D  L++ S+WH
Sbjct  568   --GAMLLGWKDRNLISASAWH  586



>gb|EMT27957.1| hypothetical protein F775_07373 [Aegilops tauschii]
Length=721

 Score =   191 bits (486),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 130/375 (35%), Positives = 184/375 (49%), Gaps = 18/375 (5%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANF  257
             CA  L+  + E  +K +   R +VS  G+P +R+  Y  E L  R  NS     +     
Sbjct  358   CAEALSEDRTEEFLKLVQEARGTVSINGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCR  417

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             +  S+EL    K L + CPY KF ++ AN AI EA      IHIIDF I QG QW  L+Q
Sbjct  418   EPESKELLSYMKILYNICPYFKFGYMAANGAIAEALRSEDNIHIIDFQIAQGTQWITLIQ  477

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALA R GG P  +RI+GI  PV   +    L   GN L   +   ++  EF P+      
Sbjct  478   ALAARPGGPP-HVRITGIDDPVSEYARGEGLEIVGNMLTSMSNEFNIPLEFTPLSVYATQ  536

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSP  788
             +     ++ P E +AVNF LQL++  DE+          L++   L+P + TL E E   
Sbjct  537   VTEEMLKIRPGEAVAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHT  596

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTE  968
             N   FL RF   + YYSA+FES+D N+ RDS ER+ VE   L + I  ++   E + + E
Sbjct  597   NTTPFLMRFLETMDYYSAMFESIDANLPRDSKERISVEQHCLAKDIVNIIAC-EGKDRVE  655

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
               E+         W+  +  AGFK   +S Y +S  K LL      S    ++   G + 
Sbjct  656   RHELL------GKWKSRLSMAGFKPYPLSSYVNSVIKKLL---ACYSDKYTLEEKDGAML  706

Query  1149  LAWNDEPLLTVSSWH  1193
             L WN   L++ S+WH
Sbjct  707   LGWNTRKLISASAWH  721



>gb|EYU42066.1| hypothetical protein MIMGU_mgv1a005350mg [Erythranthe guttata]
Length=487

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/361 (37%), Positives = 193/361 (53%), Gaps = 21/361 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA--SSEELTLSY  290
             E A   L+ I    +  G   +RVA YFSEA+  RL +S             S+++  ++
Sbjct  132   EEANTMLLEISQLATPFGTSAQRVAAYFSEAMSARLVSSCLGIYTALPTVPHSQKMASAF  191

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             +  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   LA+R GG P 
Sbjct  192   QVFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPP-  250

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
              +R++G     LGNS  A L ATG RL DFA+ L L FEF PV   + +LN     V   
Sbjct  251   FVRLTG-----LGNSTDA-LEATGKRLSDFAEKLGLPFEFSPVAERVGNLNPERLNVSKR  304

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E +AV+++   ++L D T +   T L L   L P +VT+ E ++S +   FL RF  A+ 
Sbjct  305   EAVAVHWL--QHSLYDVTGSDTNT-LSLLQRLCPKVVTVVEQDLS-HAGSFLGRFVEAIH  360

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR-PEEQRAKTECveveveveDKDH  1007
             YYSA+F+SL      +S ER  VE  LL R I  ++      R+ T    V+      ++
Sbjct  361   YYSAMFDSLGACYGEESEERHIVEQQLLSREIRNVLGVGGPSRSSTSISMVKF-----NN  415

Query  1008  WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             WR  +E +GFK ++++  A +QA +LL  +       + D+  G L L W D  LLT S+
Sbjct  416   WREKLEQSGFKGISLAGNAAAQATLLLGMFPSDGYTLVEDN--GALKLGWKDLCLLTASA  473

Query  1188  W  1190
             W
Sbjct  474   W  474



>ref|XP_009344215.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=699

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 137/364 (38%), Positives = 184/364 (51%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V  LGD  +RVA  F+EAL  RL+ +    P+         F  +S E+
Sbjct  353   ARRYLHHLNRVVMPLGDSMQRVASCFTEALSARLAATLTTTPSGSAPKPFSPFPPNSFEI  412

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  413   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPG  472

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+   + G      +  TG  L + A  L + FEF  V   +  L    F 
Sbjct  473   GAP-FLRITGVGPFIEG------VKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  525

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  526   RRIGEALAVNTVNRLHRV---PVNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  582

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E    +TE        E 
Sbjct  583   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAE-RTE------RHER  635

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +MES GFK+V +S  A +Q+KILL  Y+        D   G L L W D  ++ 
Sbjct  636   LEKWRKVMESKGFKSVPLSANAVTQSKILLGLYSCDGYRMTEDK--GCLLLGWQDRSIMA  693

Query  1179  VSSW  1190
              S+W
Sbjct  694   ASAW  697



>ref|XP_009378007.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
 ref|XP_009350709.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=701

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 137/364 (38%), Positives = 185/364 (51%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPAN--------FDASSEEL  278
             A + L  +   V  LGD  +RVA  F+EAL  RL+ +    P+         F  +S E+
Sbjct  355   ARRYLHHLNRVVMPLGDSMQRVASCFTEALSARLAATLTTTPSGSAPKPFSPFPPNSFEI  414

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R G
Sbjct  415   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPG  474

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+  P +      ++  TG  L + A  L + FEF  V   +  L    F 
Sbjct  475   GAP-FLRITGV-GPCI-----EAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  527

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  528   RRIGEALAVNTVNRLHRV---PVNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  584

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E    +TE        E 
Sbjct  585   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAE-RTE------RHER  637

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +MES GFK+V +S  A +Q+KILL  Y+        D   G L L W D  ++ 
Sbjct  638   LEKWRKVMESKGFKSVPLSANAVTQSKILLGLYSCDGYRMTEDK--GCLLLGWQDRSIMA  695

Query  1179  VSSW  1190
              S+W
Sbjct  696   ASAW  699



>ref|XP_010260476.1| PREDICTED: scarecrow-like protein 1 [Nelumbo nucifera]
Length=534

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 129/383 (34%), Positives = 189/383 (49%), Gaps = 32/383 (8%)
 Frame = +3

Query  87    DCARLAVSQP--ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             DCA +A+S+   E A   +  +R  VS  GDP++R+A Y  E L  R++ S +       
Sbjct  170   DCA-VAISEGNMEEASAMITELRRVVSIQGDPSQRIAAYMVEGLAARMAASGKGLYKALK  228

Query  240   -KRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGI  416
              K P     SS+ L+ + + L + CPY KF  + AN AI EA +   ++HIIDF I QG 
Sbjct  229   CKEPP----SSDRLS-AMQVLFEVCPYFKFGVMAANTAIAEAIKDERRVHIIDFDINQGT  283

Query  417   QWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEP  596
             Q+  LLQALA +   KP +I+I+ +  P         L   G RL + A+ + L FEF  
Sbjct  284   QYIQLLQALAIQPS-KPQNIKITVVDDPESVQRAVGGLKVIGQRLENLAEAVKLPFEFRA  342

Query  597   VLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTL  767
             +      +  S     P E + VNF  QL+++ DE+ +TV      L++  SLNP +VT+
Sbjct  343   LAAKTADVTPSKLDCQPGEAVIVNFSFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTV  402

Query  768   GEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE  947
              E +M+ N   F  RF  A  YY+A+F SLD  + R+SP+R+ VE   L R I  ++  E
Sbjct  403   IEQDMNANTAPFFPRFIEAYNYYTAVFNSLDATLPRESPDRMNVERQCLARDIVNIVACE  462

Query  948   -EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E R +          E    WR  M  AGF +  +S Y +   + LL           +
Sbjct  463   GEDRIE--------RYEVAGKWRARMMMAGFTSCPLSAYVNETVQKLL---KQYCDRYTV  511

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
                 G L   W D+ L+  S+W 
Sbjct  512   KKEEGALHFGWEDKMLIVSSAWR  534



>ref|XP_008797425.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
isoform X1 [Phoenix dactylifera]
Length=574

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 188/386 (49%), Gaps = 36/386 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIR-IRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CA        N  + L++  R SVS +G+P +R+  Y  E L  R  +S         
Sbjct  209   IRCAEALSEDKINEFEMLVQEARASVSIIGEPIQRLGAYMLEGLVARKESSGTNIYRALR  268

Query  240   -KRPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGI  416
              ++PA     S+EL    + L D CPY KF ++ AN AI EA     +IHIIDF I QG 
Sbjct  269   CQKPA-----SKELLSYMRILYDICPYFKFGYMAANGAIAEALRHEDRIHIIDFQIAQGT  323

Query  417   QWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE-  593
             QW  L+QALA R GG P  +RI+GI       +    L   G  L D +K  ++  EF  
Sbjct  324   QWVTLIQALAARPGGPPH-VRITGIDDAESEYARGDGLQLVGKMLSDMSKKFNIPLEFNG  382

Query  594   -PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIV  761
              PV GP   +      + P E LAVNF LQL++  DE+          L++   L+P + 
Sbjct  383   LPVFGP--DVTREMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVT  440

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             TL E E + N   FL RF   L YY A+FES+D  + RDS +R+ VE   L + I  ++ 
Sbjct  441   TLVEQESNTNTTPFLMRFLETLDYYYAMFESIDVTLPRDSKQRINVEQHCLAKDIVNIIA  500

Query  942   PE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssy  1115
              E  E+  + E +           WR  +  AGFK + +S Y +S  K LL  Y+   + 
Sbjct  501   CEGKERVERHELL---------GKWRSRLTMAGFKPLPLSSYVNSVIKSLLGCYSDKYTL  551

Query  1116  sLIDSPPGFLSLAWNDEPLLTVSSWH  1193
                D   G + L W D  L++ S+WH
Sbjct  552   VEKD---GAMLLGWKDRNLISASAWH  574



>ref|XP_006592888.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
isoform X2 [Glycine max]
Length=485

 Score =   187 bits (476),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 182/381 (48%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPA  251
             + CA+       N    L+ R +D+VS  G+P +R+  Y  E L  R     NS      
Sbjct  119   IACAKALSENNMNDFDQLVGRAKDAVSINGEPIQRLGAYMVEGLVARTQASGNSIYHALR  178

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +   +EL    + L + CPY KF ++ AN AI EA     +IHIIDF I QG QW  L
Sbjct  179   CKEPEGDELLTYMQLLFEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQGTQWMTL  238

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R GG P  +RI+GI  PV   +        G RL   ++   +  EF   PV  
Sbjct  239   LQALAARPGGAP-HVRITGIDDPVSKYARGDGPEVVGKRLALMSEKFGIPVEFHGVPVFA  297

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +      + P E LAVNF LQL++  DE+          L+L  SL+P + TL E 
Sbjct  298   P--DVTREMLDIRPGEALAVNFPLQLHHTADESVHVSNPRDGLLRLVRSLSPKVTTLVEQ  355

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   F  RF   L YY AIFES+D  + RDS ER+ VE   L R I  ++  E  E
Sbjct  356   ESNTNTTPFFNRFIETLDYYLAIFESIDVTLPRDSKERINVEQHCLARDIVNIIACEGKE  415

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+  ++ AGF+   +S Y +S  + LL  Y+   +    D 
Sbjct  416   RVERHELFGK---------WKSRLKMAGFQQCPLSSYVNSVIRSLLRCYSEHYTLVEKD-  465

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W D  L++ S+WH
Sbjct  466   --GAMLLGWKDRNLISASAWH  484



>dbj|BAI94488.1| GRAS family transcription factor [Dianthus caryophyllus]
Length=573

 Score =   189 bits (480),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 135/387 (35%), Positives = 192/387 (50%), Gaps = 38/387 (10%)
 Frame = +3

Query  84    VDCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             ++CAR L+ ++ ++  K + + +  VS  G+P +R+  Y  E L  R  +S         
Sbjct  208   IECARALSENRIDDFEKLVEQAKGEVSISGEPIQRLGAYMIEGLVARTQSSGNNIYHALR  267

Query  240   -KRPANFDASSEELTLSYKAL-NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K P   D       LSY  +  + CPY KF ++ AN AI EA     +IHIIDF I QG
Sbjct  268   CKEPLGKD------LLSYMHIPYEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQG  321

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW  LLQALA R GG P  +RI+GI  P+   +   +L   G RL+  ++   +  EF 
Sbjct  322   TQWLTLLQALAKRPGGAPH-VRITGIDDPISKYARGTNLEPVGLRLKALSEKYQIPVEFH  380

Query  594   --PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSI  758
               PV GP   +      V P E LAVNF LQL++  DE+          L++  SLNP +
Sbjct  381   PVPVFGP--DVTREMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDNLLRMVKSLNPKV  438

Query  759   VTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM  938
              TL E E + N   FL RF   L+YYSA+FES+D  M RD  ER+ VE   L + I  ++
Sbjct  439   TTLVEQESNTNTTPFLTRFIETLEYYSAMFESIDVTMARDRKERINVEQHCLAKDIVNVI  498

Query  939   RPE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysss  1112
               E  E+  + E             W+  +  AGF+   +S Y +S  + LL  Y+   +
Sbjct  499   ACEGKERVERHELF---------GKWKSRLTMAGFRQYPLSSYVNSVIRGLLRCYSEHYT  549

Query  1113  ysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
                 D   G + L W D  L++ S+WH
Sbjct  550   LVEKD---GAMLLGWKDRMLISASAWH  573



>ref|XP_006356310.1| PREDICTED: scarecrow-like protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356311.1| PREDICTED: scarecrow-like protein 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356312.1| PREDICTED: scarecrow-like protein 1-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006356313.1| PREDICTED: scarecrow-like protein 1-like isoform X4 [Solanum 
tuberosum]
Length=559

 Score =   189 bits (479),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 180/366 (49%), Gaps = 21/366 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLS  287
             E A   +  +R  VS  GDP ER A Y  EAL  R++ S     K     +A+S E   +
Sbjct  206   EQASSMINELRQMVSIQGDPLERTAAYMVEALAARMATSGRGLYKALKCKEATSSERLSA  265

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
              + L + CPY +F  + AN AILEA +   ++HIIDF + QG Q+  LLQ LA+  G KP
Sbjct  266   MQVLFEVCPYFRFGFMAANGAILEAFKDEKRVHIIDFDLNQGSQYYTLLQTLASMPG-KP  324

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +R++G+  P         L   G RL + AK L ++FEF+ V      +  +     P
Sbjct  325   PHVRLTGVDDPESVQRAIGGLNVIGLRLAELAKDLKISFEFQAVSSNTGLVTPAMLNCRP  384

Query  648   DEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
              E + VNF  QL+++ DE+ +TV      L++  SLNP +VT+ E +M+ N   FL+RF 
Sbjct  385   GEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFA  444

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
                 YY  +FESLD  ++RDS ERV VE   L R I  ++  E  E+  + E        
Sbjct  445   EVYNYYCVVFESLDATLSRDSQERVNVERQCLARDIINIVACEGLERIERYEVA------  498

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR  M  AGF    IS   +   + L+  Y+        +   G L   W D+ L
Sbjct  499   ---GKWRARMMMAGFTPSPISRNVYDSIRNLIKQYSERYKA---EEEAGALYFGWEDKTL  552

Query  1173  LTVSSW  1190
                S+W
Sbjct  553   TVASAW  558



>ref|NP_001234315.1| GRAS6 protein [Solanum lycopersicum]
 gb|ABD72962.1| GRAS6 [Solanum lycopersicum]
Length=563

 Score =   189 bits (479),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 179/366 (49%), Gaps = 21/366 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLS  287
             E A   +  +R  VS  GDP ER A Y  EAL  R++ S     K     +A+S E   +
Sbjct  210   EQASSMINELRQMVSIQGDPLERTAAYMVEALAARMATSGRGLYKALKCKEATSSERLSA  269

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
              + L + CPY +F  + AN AILEA +   ++HIIDF + QG Q+  LLQ L +  G KP
Sbjct  270   MQVLFEVCPYFRFGFMAANGAILEAFKDEKRVHIIDFDVNQGSQYYTLLQTLGSMPG-KP  328

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +R++G+  P         L   G RL   AK L ++FEF+ V      +  +     P
Sbjct  329   PHVRLTGVDDPESVQRAIGGLNVIGLRLAQLAKDLKISFEFQAVSSNTALVTPAMLNCRP  388

Query  648   DEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
              E + VNF  QL+++ DE+ +TV      L++  SLNP +VT+ E +M+ N   FL+RF 
Sbjct  389   GEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFA  448

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
                 YY A+FESLD  ++RDS ERV VE   L R I  ++  E  E+  + E        
Sbjct  449   EVYNYYCAVFESLDATLSRDSQERVNVERQCLARDIINIVACEGLERIERYEVA------  502

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR  M  AGF    IS   +   + L+  Y+        +   G L   W D+ L
Sbjct  503   ---GKWRARMMMAGFTPSPISRNVYESIRNLIKQYSERYKA---EEEAGALYFGWEDKTL  556

Query  1173  LTVSSW  1190
                S+W
Sbjct  557   TVASAW  562



>ref|XP_008776123.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
[Phoenix dactylifera]
Length=561

 Score =   189 bits (479),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 185/381 (49%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIR-IRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPA  251
             + CA        N  + L++  RD VS  G P +R+  Y  E L  R  +S     +   
Sbjct  196   ISCAEALSENKINEFEMLVQEARDYVSITGGPIQRLGAYMLEGLVARHESSGTNIYRTLG  255

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +  S+EL    + L D CPY KF ++ AN AI EA     +IHIIDF I QG QW  L
Sbjct  256   CREPESKELLSYMRILYDICPYFKFGYMAANGAIAEALRHEDRIHIIDFQISQGTQWITL  315

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             +QALA R  G P  +RI+GI  PV   +    L   G  L D +K  ++  EF   PV G
Sbjct  316   IQALAARPAGPPH-VRITGIDDPVSAYARGDGLQLVGKMLSDMSKNFNIPLEFNGLPVYG  374

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +      + P E LAVNF LQL++  DE+          L++   L+P + TL E 
Sbjct  375   P--QVTREMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQ  432

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   FL RF   L YYSA+FES+D  + RD+ ER+ VE   L + I  ++  E  E
Sbjct  433   ESNTNTTPFLMRFLETLDYYSAMFESIDVTLPRDNKERIHVEQHCLAKDIVNIIACEGKE  492

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E +           WR  +  AGFK   +S Y +S  K LL  Y+   +    D 
Sbjct  493   RVERHELL---------GKWRSRLTMAGFKPYPLSSYVNSVIKTLLGYYSDKYTLVEKD-  542

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W +  L++ S+W+
Sbjct  543   --GAMLLGWKNRNLISASAWY  561



>ref|XP_008246525.1| PREDICTED: scarecrow-like protein 18 [Prunus mume]
Length=471

 Score =   186 bits (473),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 135/375 (36%), Positives = 199/375 (53%), Gaps = 43/375 (11%)
 Frame = +3

Query  165   LGDPTERVAYYFSEALYNRLSN--------------SPEKRPANFDASSEE-------LT  281
              GD TER+ + F +AL  RL+N              +     +N+    EE       L 
Sbjct  108   FGDSTERLTHQFVKALSLRLNNPNPSSSAALTTAATAAASSSSNYLLLEEEDDNNEEALH  167

Query  282   LSYKALNDACPYSKFAHLTANQAILEATEKASK-IHIIDFGIVQGIQWAALLQALATRSG  458
               Y  LN   P+ +F+HLTANQAILEA + +   IHI+DF I+ G+QW  L+QALA RS 
Sbjct  168   SCYLTLNQITPFIRFSHLTANQAILEAIDSSHHSIHILDFDIMHGVQWPPLMQALAERSY  227

Query  459   GKPDSIRISGIPSPVL-----GNSPAASLLATGNRLRDFAKVLDLNFEFEPVL-----GP  608
                +S R    P P+L     G+S  A LL TG+RL  FA  L L F F P++      P
Sbjct  228   ---NSDRTVQHPPPMLRITATGHS-LALLLKTGDRLLKFANSLGLAFHFHPLVLNDAVRP  283

Query  609   IHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSP  788
                ++ S+  + P+E LA+N +L L+ L+ + +  +   L+   SLNP ++T+   E + 
Sbjct  284   SDIISPSTLGLLPNEALAINCVLYLHTLVTDDSGELSLFLRKIKSLNPKVLTIANKEANH  343

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTE  968
             N   F  RF  AL++Y AIF+SL+  +  +S ER  VE + +GR I +++  EE R +  
Sbjct  344   NHPLFFNRFVEALEHYGAIFDSLEATLPPNSRERQAVEDVWMGREIRDVVGAEEGRRRQR  403

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
               +       + +W +++  AGF+ VA+S +A SQAK+LL  +  S  Y L      F  
Sbjct  404   HEKY------ETYWEVMLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQLRIINDSFF-  456

Query  1149  LAWNDEPLLTVSSWH  1193
             L W + PL +VSSWH
Sbjct  457   LGWQNRPLFSVSSWH  471



>gb|KDO64235.1| hypothetical protein CISIN_1g014896mg [Citrus sinensis]
Length=416

 Score =   185 bits (470),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 129/362 (36%), Positives = 191/362 (53%), Gaps = 25/362 (7%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSP----EKRPANFDASSEELTL  284
             E A K L+ I    +  G   +RVA YFSEA+  RL +S        P+     ++++  
Sbjct  56    EEANKMLLEISQLSTPYGTSAQRVAAYFSEAMSARLVSSCLGIYAALPSLPQTHTQKMVS  115

Query  285   SYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK  464
             +++  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   LA+R GG 
Sbjct  116   AFQVFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGP  175

Query  465   PDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVD  644
             P  +R++G     LG S  A L ATG RL DFA+ L L FEF PV   + +L+     + 
Sbjct  176   P-YVRLTG-----LGTSMEA-LEATGKRLSDFAEKLGLPFEFCPVAEKVGNLDPERLNIS  228

Query  645   PDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
               E +AV+++   ++L D T +   T L L   L P +VT+ E ++SP    FL RF  A
Sbjct  229   KREAVAVHWL--QHSLYDVTGSDTNT-LCLLQRLAPKVVTVVEQDLSPAG-SFLGRFVEA  284

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKD  1004
             + YYSA+F+SL  +   +S ER  VE  LL R I  ++         +            
Sbjct  285   IHYYSALFDSLGASYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKF--------H  336

Query  1005  HWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVS  1184
             +WR  ++ +GFK ++++  A +QA +LL  +       + D+  G L L W D  LLT S
Sbjct  337   NWREKLQRSGFKGISLAGNAATQATLLLGMFPCDGYTLVEDN--GTLKLGWKDLCLLTAS  394

Query  1185  SW  1190
             +W
Sbjct  395   AW  396



>ref|XP_010912567.1| PREDICTED: scarecrow-like protein 21 [Elaeis guineensis]
Length=461

 Score =   186 bits (472),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 134/377 (36%), Positives = 196/377 (52%), Gaps = 36/377 (10%)
 Frame = +3

Query  120   NAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL--SNSPEKRPANFDASSEELTLSYK  293
             +AV +L  +   VS  GDP +RVA YF++ L  R+    SP  R      ++EE   ++ 
Sbjct  89    SAVDALHELYHRVSLNGDPIQRVAAYFTDGLAARILTRRSPFYRTIMAHTTAEEEFSAFT  148

Query  294   ALNDACPYSKFAHLTANQAILEATEK-----ASKIHIIDFGIVQGIQWAALLQALATR-S  455
              L  A PY +FAH TANQAI+EA EK       ++H+IDF +  G QW +L+Q+L+ + +
Sbjct  149   QLYQASPYYQFAHFTANQAIIEAFEKEEMQNGRRLHVIDFDVSYGFQWPSLIQSLSDKAT  208

Query  456   GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAK-VLDLNFEFEPVLGPIHSLNGSS  632
                P S+RI G    +        L  T  RL +F K   +L F+FE   G +   + S 
Sbjct  209   SSMPISLRIMGFGGSI------EELKETEIRLVNFTKGCRNLIFKFE---GLLRGSSSSD  259

Query  633   FRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKR  812
             F+++ D  L VN +  L NL   +++ +   L   +SLNPS+V L E E S     FL R
Sbjct  260   FKIEKDATLVVNLVFYLQNL--RSSSEIYHTLMAISSLNPSVVVLVEKEGSQRPQNFLSR  317

Query  813   FKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvevevev  992
             F  +L YY+A+F+SL+  +  +S ER+ +E   LGR I   M  EE+  +       +  
Sbjct  318   FMESLHYYAAMFDSLNDCLPAESTERLSIEKNHLGREIQAAMTNEEKEEEKHLRFERL--  375

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF----------  1142
                D W+  MES GF+ + +S  + SQAK+LL   ++ SS    D   GF          
Sbjct  376   ---DTWKKKMESFGFEEIKLSSRSMSQAKLLLKIRSHCSSIEH-DGGGGFRISERDEGHA  431

Query  1143  LSLAWNDEPLLTVSSWH  1193
             +SL W D  L TVS+WH
Sbjct  432   ISLGWQDRHLTTVSAWH  448



>ref|XP_002884379.1| hypothetical protein ARALYDRAFT_477591 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60638.1| hypothetical protein ARALYDRAFT_477591 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   188 bits (477),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 136/379 (36%), Positives = 196/379 (52%), Gaps = 32/379 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             V CA     +  N   +L+ R+    +       +VA YF++AL  R+            
Sbjct  179   VACAEAIQQENLNLADALVKRVGTLAASQAGAMGKVATYFAQALARRIYRDYTAETDVSG  238

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
              S EE+   +    D+CPY KFAH TANQAILEA   A ++H+ID G+ QG+QW AL+QA
Sbjct  239   GSFEEVLQMH--FYDSCPYLKFAHFTANQAILEAVATARRVHVIDLGLNQGMQWPALMQA  296

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLG-PIHS  617
             LA R GG P S R++GI  P   NS   SL   G +L  FA+ + + FEF+ +    +  
Sbjct  297   LALRPGGPP-SFRLTGIGPPQTENSD--SLQQLGWKLAQFAQNMGVEFEFKGLATESLSD  353

Query  618   LNGSSFRVDPD-EILAVNFMLQLYNLLDETTATVGTALKLANS---LNPSIVTLGEYEMS  785
             L    F   PD E L VN + +L+ LL    A  G+  KL N+   + PSI+T+ E E +
Sbjct  354   LEPEMFETRPDSETLVVNSVFELHRLL----ARSGSIEKLLNTVKAIKPSIITVVEQEAN  409

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE----Q  953
              N + FL RF  AL YYS++F+SL+ + +  S +RV  E + LGR+I  ++  E     +
Sbjct  410   HNGIVFLDRFNEALHYYSSLFDSLEDSGSLPSQDRVMSE-VYLGRQILNVVAAEGSDRVE  468

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
             R +T              WRI M+SAGF  V +   A  QA +LL +   +     ++  
Sbjct  469   RHETVA-----------QWRIRMKSAGFDPVHLGSSAFKQASMLL-SLYATGDGYRVEEN  516

Query  1134  PGFLSLAWNDEPLLTVSSW  1190
              G L + W   PL+T S+W
Sbjct  517   DGCLMIGWQTRPLITTSAW  535



>gb|ACQ84011.1| scarecrow 1 [Lupinus albus]
 gb|ACQ84012.1| scarecrow 1 [Lupinus albus]
Length=776

 Score =   190 bits (483),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 134/363 (37%), Positives = 190/363 (52%), Gaps = 26/363 (7%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA-----SSEELT  281
             E+A K L+ I    +  G   +RVA YFSEA+  RL +S     A   +     SS ++ 
Sbjct  420   EDANKMLLEISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATLPSTLVSHSSHKVA  479

Query  282   LSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGG  461
              +Y+  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   LA+R GG
Sbjct  480   SAYQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG  539

Query  462   KPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRV  641
              P  +R++G     LG S  A L ATG RL DFA  L L FEF PV   + +L+     V
Sbjct  540   PP-YVRLTG-----LGTSMEA-LEATGKRLSDFANKLGLPFEFSPVADKVGNLDPQRLNV  592

Query  642   DPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKN  821
                E +AV+++   ++L D T +   T L L   L+P +VT+ E +MS N   FL RF  
Sbjct  593   TKTEAVAVHWL--QHSLYDVTGSDTNT-LWLLQRLSPKVVTVVEQDMS-NAGSFLGRFVE  648

Query  822   ALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDK  1001
             A+ YYSA+F+SL  +   +S ER  VE  LL R I  ++         +           
Sbjct  649   AIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAIGGPSRTGDLKF--------  700

Query  1002  DHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTV  1181
              +WR   +  GF+ +++S  A +QA +LL  +       + D+  G L L W D  LLT 
Sbjct  701   HNWREKFQQCGFRGISLSGNAATQASLLLGMFPSEGYTLVEDN--GILKLGWKDLCLLTA  758

Query  1182  SSW  1190
             S+W
Sbjct  759   SAW  761



>ref|XP_002276880.1| PREDICTED: scarecrow-like protein 28 [Vitis vinifera]
Length=676

 Score =   189 bits (481),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 126/358 (35%), Positives = 184/358 (51%), Gaps = 21/358 (6%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRLSN-----SPEKRPANFDASSEELTLSYKAL  299
             + ++ D  S  G P  RV  YF+EAL  R+S           P   D + ++   + + L
Sbjct  318   IAKLGDLASPKGSPISRVTAYFTEALALRVSRLWPAIFHVTTPRELDRADDDTWTALRLL  377

Query  300   NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIR  479
             N   P  KF H T+N+ +L A E   ++HIIDF I QG+QW +L Q+LA+R+   P  +R
Sbjct  378   NQVSPIPKFIHFTSNEILLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLASRT-NPPSHVR  436

Query  480   ISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEIL  659
             I+G+     G S    L  TG+RL  FA+ L+L FEF PV+  +  +      V   E +
Sbjct  437   ITGV-----GES-KQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKDKESV  490

Query  660   AVNFMLQLY-NLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             AVN + QL+  L D +   +   L L  S NPSIV + E E   N +    R  N+L+YY
Sbjct  491   AVNCIFQLHKTLYDGSGGALRDFLGLIRSTNPSIVLMAEQEAEHNELSLETRVSNSLRYY  550

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRI  1016
             SAIF+S+D ++  DSP R+KVE  +  R I  ++         E  +     E  + WR 
Sbjct  551   SAIFDSIDYSLPLDSPVRMKVEE-MFAREIRNII-------ACEGSDRVERHESFEKWRR  602

Query  1017  LMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
              ME  GF+ V IS     Q+++LL  Y+  +           L+L+W D+PL TVS+W
Sbjct  603   RMEQGGFRCVGISEREMLQSQMLLKMYSCENYSVSKRGQDAALTLSWLDQPLYTVSAW  660



>ref|XP_004980521.1| PREDICTED: DELLA protein GAI-like [Setaria italica]
Length=753

 Score =   190 bits (482),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 142/384 (37%), Positives = 193/384 (50%), Gaps = 45/384 (12%)
 Frame = +3

Query  111   QPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL--------------SNSPEK--  242
             QP +A++ L  +R   S LGD  +RVA YF++AL  RL              + +P    
Sbjct  391   QP-SALRHLHLLRRVASPLGDSMQRVASYFADALAARLSLSSNPSSSSSSSGAATPRGGA  449

Query  243   ----RPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQ  410
                  P  F  S E L + Y+ L  ACPY KFAH TANQAI EA     ++H++D  I+Q
Sbjct  450   AAGVAPYTFPPSPETLKI-YQILYQACPYIKFAHFTANQAIFEAFAGEDRVHVVDLDILQ  508

Query  411   GIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEF  590
             G QW A LQALA R GG P ++R++G+        PAA++  TG  L   A  L + FEF
Sbjct  509   GYQWPAFLQALAARPGGPP-TLRLTGV------GHPAAAVRETGRHLASLAASLRVPFEF  561

Query  591   EPVLGP-IHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTL  767
                    +  L  ++ +    E LAVN + +L+ +    +A +G  L +     P I+TL
Sbjct  562   HAAAADRLERLRPAALQRRVGEALAVNAVNRLHRV---PSAHLGPLLSMIRDQAPKIMTL  618

Query  768   GEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE  947
              E E   N   FL RF  AL YYSAIF+SLD     DS  R+KVE  LL   I  ++  E
Sbjct  619   VEQEAGHNGPYFLGRFLEALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACE  678

Query  948   --EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysL  1121
               E+ A+ E           D WR LME  GF+ V +S  A  Q+++LL  Y  S  Y L
Sbjct  679   GAERVARHE---------RLDRWRRLMEGRGFEPVPLSPAAIGQSQVLLGLYGASDGYRL  729

Query  1122  IDSPPGFLSLAWNDEPLLTVSSWH  1193
              +   G L L W D  ++  S+W 
Sbjct  730   TED-KGCLLLGWQDRAIIAASAWQ  752



>ref|XP_008448967.1| PREDICTED: scarecrow-like protein 18 [Cucumis melo]
Length=393

 Score =   184 bits (468),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 191/357 (54%), Gaps = 40/357 (11%)
 Frame = +3

Query  168   GDPTERVAYYFSEALYNRLS----NSPEKRPANFDASSEELTLSYKALNDACPYSKFAHL  335
             GD T+R+ +YFS +L + L     +S      +     E++   Y +LN   P+ +F HL
Sbjct  62    GDSTQRLLHYFSSSLSHLLPSSNYSSSFHHHHHHHHDIEKIQSCYLSLNQITPFIRFTHL  121

Query  336   TANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNS  515
             TANQAILE  E++  IH++DF I+ G+QW  L+QALA R             PSP+L  +
Sbjct  122   TANQAILEGIEESGMIHVLDFDIMHGVQWPPLMQALADR------------FPSPMLRIT  169

Query  516   PAA----SLLATGNRLRDFAKVLDLNFEFEPVL----GPIHSLNGSSFRVDPDEILAVNF  671
                     L  TG+RL  FA+ L L F+F P+L       H +  ++  + PDE LAVN 
Sbjct  170   ATGLDLNFLHKTGDRLSKFAQSLGLRFQFHPLLLLHDRDHHRVIPAALTLFPDEALAVNC  229

Query  672   MLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFE  851
             +L L+ L+ +    +   +K   +LNP +VT+ E E + N   F++RF  AL +Y++IF+
Sbjct  230   VLYLHRLMKDEVRALLNKIK---ALNPKVVTIAEKEANFNHPLFMQRFVEALNHYTSIFD  286

Query  852   SLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMESA  1031
             SL+  +  +S ER+ VE +  GR I +++  E  + K    E        + W I+++S 
Sbjct  287   SLEATLPPNSRERLAVEQVWFGREINDIVSGEANKKKQHYAERY------ESWEIMLKSL  340

Query  1032  GFKAVAISHYAHSQAKILL---WnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             GF  + +S +A SQAK+LL   +         L DS    L L W ++PL +VSSWH
Sbjct  341   GFSNIPLSPFALSQAKLLLRLHYPSEGYHLQILHDS----LFLGWQNQPLFSVSSWH  393



>gb|KHG14123.1| Scarecrow-like protein 5 [Gossypium arboreum]
Length=539

 Score =   187 bits (476),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 129/381 (34%), Positives = 185/381 (49%), Gaps = 32/381 (8%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------K  242
             CA+   S        LI ++R  VS  G+P +R+  Y  E L  RL++S          K
Sbjct  175   CAKAIESNDMYMADCLIAQLRQMVSVSGEPMQRLGAYMLEGLVARLASSGSSIYKALRCK  234

Query  243   RPANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQW  422
              PA     S EL      L + CPY KF +++AN AI EA ++ S++HIIDF I QG QW
Sbjct  235   EPA-----SPELLSYMHILYEICPYFKFGYMSANGAIAEAMKEESRVHIIDFQIAQGSQW  289

Query  423   AALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVL  602
               L+ ALA R GG P SIRI+GI  P    +    L   G RLR  A+   + FEF    
Sbjct  290   LTLINALAGRPGGPP-SIRITGIDDPTSAFARGGGLEIVGQRLRKLAESCKVPFEFHAAA  348

Query  603   GPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGE  773
                  +   +  + P E +AVNF + L+++ DE+  T       L+LA SL+P +VTL E
Sbjct  349   ISGTEVQLENLGIQPGEAIAVNFAMMLHHMPDESVDTQNHRDRLLRLAKSLSPKVVTLVE  408

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--  947
              E + N   F++RF   + Y+S+IFES+D +M R+  ER+ VE   L R I  ++  E  
Sbjct  409   QEANTNTSPFIRRFLETMGYFSSIFESIDVSMPREHKERINVEQHCLAREIVNIIACEGK  468

Query  948   EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLID  1127
             E+  + E             WR     AGF    +S + ++  K LL           ++
Sbjct  469   ERVERYELF---------GKWRSRFIMAGFTPSPLSPFVNATIKTLL---QSYCDKYTLE  516

Query  1128  SPPGFLSLAWNDEPLLTVSSW  1190
                G L L W D  ++   +W
Sbjct  517   ERDGVLYLGWMDRAIIASCAW  537



>ref|XP_011072178.1| PREDICTED: scarecrow-like protein 28 [Sesamum indicum]
Length=672

 Score =   189 bits (481),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 129/382 (34%), Positives = 193/382 (51%), Gaps = 32/382 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVK-SLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNS-PE----KR  245
             V CA    S+   AV   L R+ +  S LG P  R+  YF+E L  R++   P       
Sbjct  298   VACAEQIGSKNIAAVNHCLARLGELASPLGSPLHRLVAYFTEGLALRVARLWPHIFHITT  357

Query  246   PANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWA  425
             P   D   E+   + + LN   P  KF H T+N+ +L A E   ++HIIDF I QG+QW 
Sbjct  358   PRELDRVDEDSGTALRLLNQVSPIPKFIHFTSNEILLRAFEGKDRVHIIDFDIKQGLQWP  417

Query  426   ALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLG  605
             +L Q+LA+R+   P  +RI+GI     G S    L+ TG+RL  FA+ L+L FEF PV+ 
Sbjct  418   SLFQSLASRT-NPPSHVRITGI-----GES-KQELIETGDRLAGFAEALNLPFEFHPVVD  470

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLL-DETTATVGTALKLANSLNPSIVTLGEYEM  782
              +  +      V   E + VN + QL+ +L D T  T+   L L  S N   + + E E 
Sbjct  471   RLEDVRLWMLHVKEKETVVVNCVFQLHKMLYDSTGGTIMDFLGLIRSTNAEAIVMAEQEA  530

Query  783   SPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM----RPEE  950
             S N +    R  N+LKYYSA+F+S+D ++  DSP R+K+E  +  R I  ++    R   
Sbjct  531   SHNEISVDARLSNSLKYYSAVFDSVDSSLPLDSPVRIKIEE-MFAREIRNIIACEGRDRY  589

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL--WnynysssysLI  1124
             +R +T            + W+ LME  GF+ + IS     Q +++L  ++          
Sbjct  590   ERHET-----------FEKWQQLMEQGGFRCMGISDRELLQGQMMLKMYSCESYRVDKRE  638

Query  1125  DSPPGFLSLAWNDEPLLTVSSW  1190
              +    L+L+W D+PL TVS+W
Sbjct  639   QNGAASLTLSWLDQPLYTVSAW  660



>ref|XP_011101883.1| PREDICTED: scarecrow-like protein 1 [Sesamum indicum]
 ref|XP_011101887.1| PREDICTED: scarecrow-like protein 1 [Sesamum indicum]
 ref|XP_011101891.1| PREDICTED: scarecrow-like protein 1 [Sesamum indicum]
 ref|XP_011101898.1| PREDICTED: scarecrow-like protein 1 [Sesamum indicum]
Length=574

 Score =   188 bits (477),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 183/367 (50%), Gaps = 23/367 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE----KRPANFDASSEELTL  284
             E A   +  +R  VS  G+P+ER+A Y  EAL  R++ S +            SSE L+ 
Sbjct  221   EEASHMINVLRQRVSIQGEPSERIAAYMVEALAARIATSGKGLYRALKCKEQPSSERLS-  279

Query  285   SYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK  464
             + + L + CP  +F  +TAN AILEA E   ++HIIDF + QG Q+  LLQ LA   G +
Sbjct  280   AMQVLFEVCPCFRFGFMTANGAILEACEDEKRVHIIDFDVNQGSQYYTLLQTLAKSPGKR  339

Query  465   PDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVD  644
             P  +R++G+  P         L   G RL   A+ L L+FEF+ V      ++ S     
Sbjct  340   P-HVRLTGVDDPESVQRAVGGLKIIGRRLEQLAEDLQLSFEFDAVAAETALVSPSMLDCQ  398

Query  645   PDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRF  815
             P E + VNF  QL+++ DE+ +TV      L++  SL P +VT+ E +++ N   FL RF
Sbjct  399   PGEAVVVNFAFQLHHMPDESVSTVNLRDQLLRMVKSLKPKLVTVVEQDVNTNTAPFLSRF  458

Query  816   KNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM--RPEEQRAKTECveveve  989
               A  YYSA+FESLD  + RDS +R+ VE   L R I  ++    EE+  + E       
Sbjct  459   AEAYNYYSAVFESLDATLPRDSQDRMNVEKQCLARDIINVVACEGEERIERYEVAGK---  515

Query  990   veDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEP  1169
                   WR  M  AGF    IS   + + + L+  Y+       +    G L   W D+ 
Sbjct  516   ------WRARMSMAGFSPCPISQNLNIEIRKLITQYSDRYK---VKEETGALHFGWEDKI  566

Query  1170  LLTVSSW  1190
             L+  S+W
Sbjct  567   LIVSSAW  573



>ref|XP_010252869.1| PREDICTED: scarecrow-like protein 18 [Nelumbo nucifera]
Length=531

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 122/324 (38%), Positives = 181/324 (56%), Gaps = 40/324 (12%)
 Frame = +3

Query  267   SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALA  446
             SE L  SY +LN   P+ +F+HLTANQAILEA E    +HI+DF I+QG+QW  L+QA+A
Sbjct  231   SEALQSSYLSLNQITPFIRFSHLTANQAILEAIEGHQSVHILDFDIMQGVQWPPLMQAIA  290

Query  447   TRS--GGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
              RS     P +IRI+G    +       +L  TG+RL+ FA  L L F+F P+L     L
Sbjct  291   ERSDPSNPPPTIRITGTGQDL------DALRRTGDRLQRFAHSLGLKFQFNPLL-----L  339

Query  621   NGSS---------FRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGE  773
             N  S           + PDEILAVN +L L+ LL + +      L+   ++NP +VT+ E
Sbjct  340   NDPSSIALHLPPAIVLLPDEILAVNCVLFLHRLLRDDSRDARLFLRTIKAMNPKVVTVAE  399

Query  774   YEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP--E  947
              E + N   FL+RF +AL +Y+A+F+SL+  +  +S ER+ VE +  G+ I +++    +
Sbjct  400   REANHNHPFFLQRFVDALDHYTALFDSLEATLPPNSRERLAVEQVWFGKEILDIVSADGD  459

Query  948   EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL---Wnynysssys  1118
             ++R + E           + W  ++ S+GF  V +S +A SQAK+LL   +         
Sbjct  460   DRRQRHERF---------ETWVEMLRSSGFSNVPLSPFALSQAKLLLRLHYPSEGYQLQI  510

Query  1119  LIDSPPGFLSLAWNDEPLLTVSSW  1190
             L DS    L L W ++PL +VSSW
Sbjct  511   LNDS----LFLGWQNQPLFSVSSW  530



>ref|XP_003543283.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
[Glycine max]
 gb|KHN36746.1| Chitin-inducible gibberellin-responsive protein 1 [Glycine soja]
Length=577

 Score =   188 bits (477),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 128/361 (35%), Positives = 176/361 (49%), Gaps = 25/361 (7%)
 Frame = +3

Query  141   RIRDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPANFDASSEELTLSYKALNDAC  311
             + +D+VS  G+P +R+  Y  E L  R+    NS        +   EEL    + L + C
Sbjct  231   KAKDAVSINGEPIQRLGAYMVEGLVARMQASGNSIYHALRCREPEGEELLTYMQLLFEIC  290

Query  312   PYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGI  491
             PY KF ++ AN AI +A      IHIIDF I QG QW  LLQALA R GG P  +RI+GI
Sbjct  291   PYLKFGYMAANGAIAQACRNEDHIHIIDFQIAQGTQWMTLLQALAARPGGAPH-VRITGI  349

Query  492   PSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLGPIHSLNGSSFRVDPDEILAV  665
               PV   +    L   G RL   ++   +  EF   PV  P  ++      + P E LAV
Sbjct  350   DDPVSKYARGDGLEVVGKRLALMSEKFGIPVEFHGVPVFAP--NVTREMLDIRPGEALAV  407

Query  666   NFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYY  836
             NF LQL++  DE+          L+L  SL+P + TL E E + N   F  RF   L YY
Sbjct  408   NFPLQLHHTADESVHVSNPRDGLLRLVRSLSPKVTTLVEQESNTNTTPFFNRFIETLDYY  467

Query  837   SAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKDHW  1010
              AIFES+D  + RDS ER+ VE   L R I  ++  E  E+  + E             W
Sbjct  468   LAIFESIDVTLPRDSKERINVEQHCLARDIVNIIACEGKERVERHELF---------GKW  518

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             +  +  AGF+   +S Y +S  + LL  Y+   +    D   G + L W D  L++ S+W
Sbjct  519   KSRLTMAGFRQCPLSSYVNSVIRSLLMCYSEHYTLVEKD---GAMLLGWKDRNLISASAW  575

Query  1191  H  1193
             H
Sbjct  576   H  576



>ref|XP_011014635.1| PREDICTED: scarecrow-like transcription factor PAT1 [Populus 
euphratica]
 ref|XP_011014636.1| PREDICTED: scarecrow-like transcription factor PAT1 [Populus 
euphratica]
Length=533

 Score =   187 bits (475),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 129/361 (36%), Positives = 174/361 (48%), Gaps = 29/361 (8%)
 Frame = +3

Query  144   IRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------KRPANFDASSEELTLSYKAL  299
             +R  VS  G+P +R+  Y  E L  RL++S          K PA  D       LSY  L
Sbjct  189   LRQMVSVTGEPIQRLGAYMLEGLVARLASSGSSIYNALRCKEPAGAD------LLSYMLL  242

Query  300   -NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI  476
               +ACPY KF +++AN AI +A +    +HIIDF I QG QW  L+QALA R GG P  I
Sbjct  243   LYEACPYFKFGYMSANGAIADAMKDEISVHIIDFQIAQGSQWVTLIQALAARPGGPP-RI  301

Query  477   RISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEI  656
             RI+GI       +    L   G RL   A+   + FEF         +   +  + P E 
Sbjct  302   RITGIDDSTSAYARGGGLDIVGKRLLKLAESYKVPFEFHTAGVSASEIQIENLGIQPGEA  361

Query  657   LAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNAL  827
             +AVNF L L++L DE+  T       L+L  SL+P +VTL E E + N V F  RF   L
Sbjct  362   VAVNFALTLHHLPDESVGTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTVPFFARFVETL  421

Query  828   KYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDH  1007
              YY AIFES+D  + R++ ER+ VE   L R +  ++         E  E     E    
Sbjct  422   NYYLAIFESIDVTLPRENKERINVEQHCLAREVVNII-------ACEGAERVERHEPLGK  474

Query  1008  WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             WR   E AGF    +S + +S  KILL      S    ++   G L L W + PL+   +
Sbjct  475   WRSRFEMAGFTPYPLSSFVNSTIKILL---ENYSEKYTLEERDGALFLGWMNRPLVASCA  531

Query  1188  W  1190
             W
Sbjct  532   W  532



>gb|ACJ65328.1| scarecrow-like protein [Capsicum annuum]
Length=582

 Score =   188 bits (477),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 136/385 (35%), Positives = 182/385 (47%), Gaps = 34/385 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CAR       N  + LI + R++VS  GDP ER+  Y  E L  R   S         
Sbjct  217   IACARALAENNLNDFEQLIAKARNAVSITGDPIERLGAYIVEGLVARKDGSGTNIYRALR  276

Query  240   -KRPANFDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K PA  D       LSY   L + CPY KF ++ AN AI EA     +IHIIDF I QG
Sbjct  277   CKEPAGRD------LLSYMHILYEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQG  330

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW  LLQALA R  G P  +RI+GI  PV   +    L A G RL   +   ++  EF 
Sbjct  331   TQWMTLLQALAARPSGAP-YVRITGIDDPVSKYARGDGLTAVGKRLAAISAKFNIPIEFH  389

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVT  764
              V      +      V P E LAVNF L L++  DE+          L++    +P +VT
Sbjct  390   AVPVFASEVTRDMLDVRPGEALAVNFPLALHHTPDESVDVTNPRDELLRMVKFFSPKVVT  449

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             L E E + N   F  RF  AL YYSA+FES+D  + RD  ER+ VE   L R I  ++  
Sbjct  450   LVEQESNTNTAPFFPRFLEALDYYSAMFESIDVTLERDRKERINVEQHCLARDIVNVIAC  509

Query  945   E--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssys  1118
             E  E+  + E +           W++ +  AGF    +S Y +S  K LL  Y+   +  
Sbjct  510   EGKERVERHELL---------GKWKLRLTMAGFHQYPLSSYVNSVIKSLLRCYSKHYTLV  560

Query  1119  LIDSPPGFLSLAWNDEPLLTVSSWH  1193
               D   G + L W +  L++ S+WH
Sbjct  561   EKD---GAMLLGWKERNLISASAWH  582



>ref|XP_008379744.1| PREDICTED: DELLA protein RGL1-like [Malus domestica]
Length=704

 Score =   189 bits (480),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 187/364 (51%), Gaps = 27/364 (7%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRP--------ANFDASSEEL  278
             A + L  +   V+ LGD  +RVA  F++AL  RL+ +    P        + F  +S E+
Sbjct  358   ARRYLHHLNRVVTPLGDSMQRVASCFTDALSARLAATLTTNPRASAPQPFSPFPPNSLEI  417

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSG  458
                Y+ +  ACPY KFAH TANQAI EA E   ++H+ID  I+QG QW A +QALA R  
Sbjct  418   LKIYQIVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPS  477

Query  459   GKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFR  638
             G P  +RI+G+  P +      ++  TG  L + A  L + FEF  V   +  L    F 
Sbjct  478   GAP-FLRITGV-GPCI-----EAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFN  530

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
                 E LAVN + +L+ +       +G  L +     P+IVTL E E S N   FL RF 
Sbjct  531   RRIGEALAVNTVNRLHRV---PVNXLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFL  587

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveD  998
              AL YYSAIF+SLD     DS +R KVE  +    I  ++  E    +TE        E 
Sbjct  588   EALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAE-RTE------RHER  640

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
              + WR +MES GFK+VA+S  A +Q+KILL  Y+        D+  G L L W D  ++ 
Sbjct  641   LEKWRKVMESKGFKSVALSANAVTQSKILLGLYSCDGYRMTEDN--GCLLLGWQDRSIMA  698

Query  1179  VSSW  1190
              S+W
Sbjct  699   ASAW  702



>gb|EPS64600.1| lateral suppressor protein, partial [Genlisea aurea]
Length=392

 Score =   184 bits (466),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 131/369 (36%), Positives = 194/369 (53%), Gaps = 35/369 (9%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKR-PANFD-ASSEELTLSYKA  296
             A + L  +  S S  GD TER+ + F++AL  RL+     R P + +  ++ +L  SY A
Sbjct  46    ASRMLTLLSASSSPYGDSTERLVHQFTKALTLRLAGPGFFRVPTSVNPTAARDLQSSYLA  105

Query  297   LNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI  476
             LN   P+ +F+ LTANQAILE  E    IHI+DF I+ G+QW  L+QALA +    P S+
Sbjct  106   LNQVTPFIRFSQLTANQAILETIEGQHAIHIVDFDIMHGVQWPPLMQALAEKF--PPPSL  163

Query  477   RISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVL------GPIHSLNGSSFR  638
             RI+G  S +        L  TG+RL  FA  L L F+F P++       P    +  +  
Sbjct  164   RITGTGSDL------DILRRTGDRLAKFAHSLGLRFQFNPLIIRDDEQNPQIIFSSPAII  217

Query  639   VDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
             + P+E LAVNF   L+  L +  A +   L+   SL P+I++L E E + N   F  RF 
Sbjct  218   LSPEETLAVNFNHYLHRHLRDRDA-LRLFLRRIKSLGPAIISLAEREANHNHPIFHHRFV  276

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQ--RAKTECvevevev  992
              AL +Y  +F+SL+  +  +S +R  VE +  G+ IA+++  E +  R + E        
Sbjct  277   EALNHYGVVFDSLEATLPPNSHDRYAVEQIWFGKEIADIVAAEGEVRRERHERFRS----  332

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILL---WnynysssysLIDSPPGFLSLAWND  1163
                  W ++M S GF  VA+S +A SQAK+LL   +       +   DS    L L W +
Sbjct  333   -----WDLMMRSCGFNNVALSPFAVSQAKLLLRLHYPSEGYQLHVFNDS----LFLGWQN  383

Query  1164  EPLLTVSSW  1190
             +PL +VSSW
Sbjct  384   QPLFSVSSW  392



>ref|XP_006408301.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
 gb|ESQ49754.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
Length=554

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 132/379 (35%), Positives = 197/379 (52%), Gaps = 29/379 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPA  251
             V CA     +  N   +L+ R+    +       +VA YF++ L  R+   + + E   +
Sbjct  184   VACAEAIQREDLNLADALVKRVGTLAASQAGAMGKVATYFAQGLARRIYRRAYTTETDIS  243

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                 S EE+   +    ++CPY KFAH TANQAILEA   A ++H+ID G+ QG+QW AL
Sbjct  244   GVGPSFEEVLQMH--FYESCPYLKFAHFTANQAILEAITTARRVHVIDLGLNQGMQWPAL  301

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLG-P  608
             +QALA RSGG P S R++GI  P   NS   SL   G +L  FA+ + + FEF+ +    
Sbjct  302   MQALAVRSGGPP-SFRLTGIGPPQTENSD--SLQQLGWKLAQFAQAIGVEFEFKGLAAES  358

Query  609   IHSLNGSSFRVDPD-EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS  785
             +  L    F   P+ E + VN + +L+ LL  +  ++   L    ++ PSIVT+ E E +
Sbjct  359   LSDLKPEMFETRPESETVVVNSVFELHRLL-ASPGSIDKLLATVKAVKPSIVTVVEQEAN  417

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEE----Q  953
              N + FL RF  AL YYS++F+SL+ + +  S +RV  E + LGR+I  ++  E     +
Sbjct  418   HNGIVFLDRFNEALHYYSSLFDSLEDSYSLPSQDRVMSE-VYLGRQILNVVAAEGSDRVE  476

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
             R +T              WRI M SAGF  V++   A  QA +LL +         ++  
Sbjct  477   RHETLA-----------QWRIRMGSAGFDPVSLGSSAFKQASMLL-SLFAGGDGYRVEEK  524

Query  1134  PGFLSLAWNDEPLLTVSSW  1190
              G L L W   PL+T S+W
Sbjct  525   DGCLMLGWQTRPLITTSAW  543



>ref|XP_004957943.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
[Setaria italica]
Length=570

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 181/376 (48%), Gaps = 19/376 (5%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANF  257
             CA  L+  + E  +K + + R  VS  G+P +R+  Y  E L  R  NS     +     
Sbjct  206   CAEALSEERIEEFLKLVQQARGVVSITGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCR  265

Query  258   DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             +  S EL    K L + CPY KF ++ AN AI EA     KIHI+DF I QG QW  L+Q
Sbjct  266   EPESNELLSYMKILYNICPYFKFGYMAANGAIAEALRNEDKIHIVDFQIAQGTQWITLIQ  325

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALA R GG P  +RI+GI  PV   +    L   G  L+  ++   +  EF P+ G   +
Sbjct  326   ALAARPGGPP-HVRITGIDDPVSEYARGEGLDLVGKMLKSMSEEFRIPLEFTPLPGVYAT  384

Query  618   -LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMS  785
              +      + P E LAVNF LQL++  DE+          L++   L+P + TL E E  
Sbjct  385   QVTKEMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESH  444

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKT  965
              N   FL RF   + YYSA+FES+D N+ RDS ER+ VE   L + I  ++         
Sbjct  445   TNTTPFLMRFSETMDYYSAMFESIDANLPRDSKERINVEQHCLAKDIVNII-------AC  497

Query  966   ECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFL  1145
             E  +     E    W+  +  AGFK   +S Y +S  + LL      S    ++   G +
Sbjct  498   EGKDRVERHELLGKWKSRLTMAGFKPYPLSSYVNSVIRKLL---ACYSDKYTLEEKDGAM  554

Query  1146  SLAWNDEPLLTVSSWH  1193
              L W    L++ S+WH
Sbjct  555   LLGWKSRKLISASAWH  570



>ref|XP_007206810.1| hypothetical protein PRUPE_ppa025834mg [Prunus persica]
 gb|EMJ08009.1| hypothetical protein PRUPE_ppa025834mg [Prunus persica]
Length=398

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/376 (36%), Positives = 198/376 (53%), Gaps = 44/376 (12%)
 Frame = +3

Query  165   LGDPTERVAYYFSEALYNRLSN--------------SPEKRPANFDASSEE--------L  278
              GD TER+ + F +AL  RL+N              +     +N+    EE        L
Sbjct  34    FGDSTERLTHQFVKALSLRLNNPNPSSSAALTTAATAAASSSSNYLLLEEEDDNNNEEAL  93

Query  279   TLSYKALNDACPYSKFAHLTANQAILEATEKASK-IHIIDFGIVQGIQWAALLQALATRS  455
                Y  LN   P+ +F+HLTANQAILEA + +   IHI+DF I+ G+QW  L+QAL  RS
Sbjct  94    HSCYLTLNQITPFIRFSHLTANQAILEAIDSSHHSIHILDFDIMHGVQWPPLMQALTDRS  153

Query  456   GGKPDSIRISGIPSPVL-----GNSPAASLLATGNRLRDFAKVLDLNFEFEPVL-----G  605
                 +S R    P P+L     G+S  A LL TG+RL  FA  L L F F P++      
Sbjct  154   Y---NSDRTVQHPPPMLRITATGHS-LALLLKTGDRLLKFANSLGLAFHFHPLVLNDAVQ  209

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS  785
             P   ++ S+  + P+E LAVN +L L+ L+ + +  +   L+   SLNP ++T+   E +
Sbjct  210   PSDIISPSTLGLLPNEALAVNCVLYLHTLVTDDSRELSLFLRKIKSLNPKVLTIANKEAN  269

Query  786   PNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKT  965
              N   F  RF  AL++Y A+F+SL+  +  +S ER  VE + +GR I +++  EE R + 
Sbjct  270   HNHPLFFNRFVEALEHYGAVFDSLEATLPPNSRERQAVEDVWMGREIRDVVGAEEGRRRQ  329

Query  966   ECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFL  1145
                +       + +W +++  AGF+ VA+S +A SQAK+LL  +  S  Y L      F 
Sbjct  330   RHEKY------ETYWEVMLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQLRIINDSFF  383

Query  1146  SLAWNDEPLLTVSSWH  1193
              L W + PL +VSSWH
Sbjct  384   -LGWQNRPLFSVSSWH  398



>ref|XP_011000401.1| PREDICTED: scarecrow-like protein 18 [Populus euphratica]
Length=420

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 144/414 (35%), Positives = 197/414 (48%), Gaps = 69/414 (17%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIR--IRDSVSQLGDPTERVAYYFSEAL---YNRLSNSPEKRP  248
             V CA L      +A + L    +  + S  GD TER+   F  AL    NR S      P
Sbjct  32    VSCADLISQSDFSAAQRLFSHLLSSNSSPYGDSTERLVRQFVRALSFRLNRHSTPTSTAP  91

Query  249   ANFD------------------ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKA  374
              +F                      E L   Y +LN   P+ +F HLTANQAILEA +  
Sbjct  92    LDFSPPCTTNTNNKMMMISYESTDQETLRSCYLSLNQITPFIRFCHLTANQAILEAIQVG  151

Query  375   SK-IHIIDFGIVQGIQWAALLQALATRSGGK---PDSIRISGIPSPVLGNSPAASLLATG  542
              + IHIIDF I+ G+QW  L+QALA RS      P  +RI+G    +        L  TG
Sbjct  152   QQAIHIIDFDIMHGVQWPPLMQALADRSNNTLHPPPMLRITGTGHDL------NILQRTG  205

Query  543   NRLRDFAKVLDLNFEFEPVLGPIHSLNG----------SSFRVDPDEILAVNFMLQLYNL  692
             +RL  FA  L L F+F P+L     LN           S+  + PDE LAVN +L L+  
Sbjct  206   DRLLKFAHSLGLGFQFHPLL----LLNNDPTFLALHLPSAITLLPDEALAVNCVLYLHRF  261

Query  693   LDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMT  872
             L + +  +   L    +LNP +VT+ E E S N   FL+RF  AL +Y+A+F+SL+  + 
Sbjct  262   LKDDSRELLLFLHKIKALNPKVVTVAEREASHNNPLFLQRFLEALDHYTALFDSLEATLP  321

Query  873   RDSPERVKVESLLLGRRI-------AELMRPEEQRAKTECveveveveDKDHWRILMESA  1031
              ++ ER+ VE +  GR I        E+ R   QR +T              W +L++S 
Sbjct  322   PNNRERLAVEQIWFGREIMDIVAAEGEVRRERHQRFET--------------WEMLLKSV  367

Query  1032  GFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             GF +V +S +A SQAK+LL  +  S  Y L      F  L W +  L +VSSWH
Sbjct  368   GFSSVPLSPFALSQAKLLLRLHYPSEGYQLRILNNSFF-LGWQNHSLFSVSSWH  420



>ref|XP_007021110.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
 ref|XP_007021112.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
 gb|EOY12635.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
 gb|EOY12637.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
Length=596

 Score =   187 bits (475),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/365 (36%), Positives = 180/365 (49%), Gaps = 25/365 (7%)
 Frame = +3

Query  129   KSLIRIRDSVSQLGDPTERVAYYFSEALYNR--LSNSPEKRPANFDASSEELTLSY-KAL  299
             K + + R++VS  G+P +R+  Y  EAL  R   S S   R         +  LSY + L
Sbjct  244   KLIAKARNAVSICGEPIQRLGAYMVEALVARKEASGSNIYRARRCREPEGKDLLSYMQIL  303

Query  300   NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIR  479
              + CPY KF ++ AN AI EA     +IHIIDF I QG QW  LLQALA R GG P  +R
Sbjct  304   YEICPYLKFGYMAANGAIAEACRTEDRIHIIDFHIGQGTQWVTLLQALAARPGGAP-HVR  362

Query  480   ISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLGPIHSLNGSSFRVDPDE  653
             I+GI  P+   +    L A G RL   ++  ++  EF   PV  P   +      V P E
Sbjct  363   ITGIDDPLSKYARGGGLEAVGRRLAALSEKFNIPVEFHGVPVFAP--DITRGMLDVRPGE  420

Query  654   ILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
              LAVNF LQL++  DE+          L++  SL+P + TL E E + N   FL RF   
Sbjct  421   ALAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLSPKVTTLVEQESNTNTAPFLPRFIET  480

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveD  998
             L YY A+FES+D  + RD  ER+ VE   L R I  ++  E  E+  + E          
Sbjct  481   LDYYLAMFESIDETLPRDRKERINVEQHCLARDIVNVIACEGKERVERHELFGK------  534

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
                W+  +  AGF+   +S Y +S  + LL  Y+        D   G + L W D  L++
Sbjct  535   ---WKSRLTMAGFRQYPLSSYVNSVIRSLLRCYSKHYKLVEKD---GAMLLGWKDRNLIS  588

Query  1179  VSSWH  1193
              S+WH
Sbjct  589   ASAWH  593



>ref|XP_001766594.1| predicted protein [Physcomitrella patens]
 gb|EDQ68659.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 194/378 (51%), Gaps = 36/378 (10%)
 Frame = +3

Query  90    CARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLS------NSPEKRP  248
             CA    S   +   +++ ++R+ V+  G   +RV  YF+E + +RL       NSP   P
Sbjct  24    CAEAVSSGNHDEANTILPQLREQVTPYGSSVQRVVAYFAEGMASRLVTSCLGINSP--LP  81

Query  249   ANFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAA  428
              N   ++   T + +  N+ CP+ KF+H TA QAI EA E  + +H+ID  I+ G+QW  
Sbjct  82    RNDLVNNPSFTSAIQVFNEICPFVKFSHFTAIQAISEAFEGMNNVHVIDMDIMHGLQWHL  141

Query  429   LLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGP  608
             LLQ LA R GG P  + I+G+ + V       +L ATG RL DFA  L ++F+F  V   
Sbjct  142   LLQNLAKRPGGPPH-VHITGLGTSV------ETLDATGKRLIDFAATLGVSFQFTAVAEK  194

Query  609   IHSLNGSSFRVDPDEILAVNFMLQ-LYNLLDETTATVGTALKLANSLNPSIVTLGEYEMS  785
                L+ S+ +V+  + LAV++M   LY++    +AT+G    L + L+P I+T+ E ++ 
Sbjct  195   FGKLDPSALKVEFSDALAVHWMHHSLYDVSGCDSATLG----LMHKLSPKIITIVEQDL-  249

Query  786   PNRVG--FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR-PEEQR  956
               R G  FL RF  AL YYSA+F+SL  +  R S +R  VE  LL   I  ++      R
Sbjct  250   --RHGGPFLNRFVEALHYYSALFDSLGASYNRKSLKRHMVEQQLLSCEIKNILAIGGPGR  307

Query  957   AKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPP  1136
             + T            DHWR  +  AGF  VA+S  A  QA +LL    Y      +    
Sbjct  308   SGT---------TKFDHWRDKLSEAGFNPVALSAQAVHQAALLLSQGFYPGEGYTLLEDL  358

Query  1137  GFLSLAWNDEPLLTVSSW  1190
             G L L W D  L T S+W
Sbjct  359   GALKLGWEDLCLFTASAW  376



>ref|XP_010694285.1| PREDICTED: scarecrow-like protein 21 [Beta vulgaris subsp. vulgaris]
 ref|XP_010694286.1| PREDICTED: scarecrow-like protein 21 [Beta vulgaris subsp. vulgaris]
Length=579

 Score =   187 bits (475),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 136/385 (35%), Positives = 185/385 (48%), Gaps = 34/385 (9%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             ++CAR       +    L+ + R  VS  G P +R+  Y  E L  R  +S         
Sbjct  214   IECARALSDNRLDDFDELVEQARKEVSISGQPIQRLGAYMIEGLVARKESSGNNIYRALR  273

Query  240   -KRPANFDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K P   D       LS+   L + CPY KF ++ AN AI EA     +IHIIDF I QG
Sbjct  274   CKEPLGKD------LLSFMHILYEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQG  327

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW  LLQALA R GG P  +RI+GI  PV   +  ASL A G RL   ++  +++ EF 
Sbjct  328   TQWLTLLQALAARPGGAPH-VRITGIDDPVSQYARGASLEAVGKRLASLSEKYNISVEFH  386

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVT  764
              V   +  +      V P E LAVNF LQL++  DE+          L++  SL   + T
Sbjct  387   AVPVFLPDVTREMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLGSKVTT  446

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             L E E + N   FL RF  AL YYSA+FES+D  M RD  ER+ VE   L + I  ++  
Sbjct  447   LVEQESNTNTTPFLTRFTEALSYYSAMFESIDVTMPRDRKERINVEQHCLAKDIVNVIAC  506

Query  945   E--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssys  1118
             E  E+  + E +           W+     AGFK   +S Y +S  + LL  Y+   +  
Sbjct  507   EGKERVERHELLGK---------WKSRFTMAGFKQYPLSSYVNSVIRGLLRCYSEHYTLV  557

Query  1119  LIDSPPGFLSLAWNDEPLLTVSSWH  1193
               D   G + L W D  L++ S+WH
Sbjct  558   EKD---GAMLLGWKDRMLISASAWH  579



>gb|EPS59520.1| hypothetical protein M569_15285, partial [Genlisea aurea]
Length=501

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/358 (36%), Positives = 177/358 (49%), Gaps = 23/358 (6%)
 Frame = +3

Query  147   RDSVSQLGDPTERVAYYFSEALYNRLSNSP-----EKRPANFDASSEELTLSYKALNDAC  311
             R  VS  G+P +R+  Y  E L  R   S        R       S++L      L + C
Sbjct  157   RGVVSVSGEPIQRLGAYMLEGLVARKEASGLNIYRSLRCHQPMPESKDLLSYMHILYEIC  216

Query  312   PYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGI  491
             PY KF ++ AN AI EA +    IHI+DF I QG QW  LLQALA R GG P  +RI+GI
Sbjct  217   PYLKFGYMAANGAIAEACKNEDAIHIVDFQIAQGTQWMTLLQALAARPGGPP-RVRITGI  275

Query  492   PSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNF  671
               PV   +  A L A G RL   ++   +  EF PV      +        P E LAVNF
Sbjct  276   DDPVSEYARGAGLAAVGRRLAAVSEKFSIPVEFHPVPVFAPDVTREMLGARPGEALAVNF  335

Query  672   MLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSA  842
              LQL++  DE+          L++  SL P +VTL E E + N   FL RFK AL YYSA
Sbjct  336   PLQLHHTADESVDVSNPRDGILRMVRSLGPRVVTLVEQESNANTAPFLPRFKEALDYYSA  395

Query  843   IFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKDHWRI  1016
             +FES+D  M RDS ER+ VE   L R I  ++  E  E+  + E +           W++
Sbjct  396   MFESIDVTMARDSRERINVEQHCLARDIVNVIACEGKERVERHELL---------GKWQL  446

Query  1017  LMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
               + AGF+   ++ Y +S    LL +Y+   + +  D   G + L W D  L++ S+W
Sbjct  447   RFKMAGFRPFPLNSYVNSVIGGLLRSYSDHYTLTERD---GAMLLGWKDRNLVSASAW  501



>ref|XP_003540429.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
isoform X1 [Glycine max]
Length=571

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 182/381 (48%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPA  251
             + CA+       N    L+ R +D+VS  G+P +R+  Y  E L  R     NS      
Sbjct  205   IACAKALSENNMNDFDQLVGRAKDAVSINGEPIQRLGAYMVEGLVARTQASGNSIYHALR  264

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +   +EL    + L + CPY KF ++ AN AI EA     +IHIIDF I QG QW  L
Sbjct  265   CKEPEGDELLTYMQLLFEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQGTQWMTL  324

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R GG P  +RI+GI  PV   +        G RL   ++   +  EF   PV  
Sbjct  325   LQALAARPGGAP-HVRITGIDDPVSKYARGDGPEVVGKRLALMSEKFGIPVEFHGVPVFA  383

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +      + P E LAVNF LQL++  DE+          L+L  SL+P + TL E 
Sbjct  384   P--DVTREMLDIRPGEALAVNFPLQLHHTADESVHVSNPRDGLLRLVRSLSPKVTTLVEQ  441

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   F  RF   L YY AIFES+D  + RDS ER+ VE   L R I  ++  E  E
Sbjct  442   ESNTNTTPFFNRFIETLDYYLAIFESIDVTLPRDSKERINVEQHCLARDIVNIIACEGKE  501

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+  ++ AGF+   +S Y +S  + LL  Y+   +    D 
Sbjct  502   RVERHELFGK---------WKSRLKMAGFQQCPLSSYVNSVIRSLLRCYSEHYTLVEKD-  551

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W D  L++ S+WH
Sbjct  552   --GAMLLGWKDRNLISASAWH  570



>ref|XP_002300358.2| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 ref|XP_006369988.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 ref|XP_006369989.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 gb|EEE85163.2| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 gb|ERP66557.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 gb|ERP66558.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
Length=533

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 128/361 (35%), Positives = 175/361 (48%), Gaps = 29/361 (8%)
 Frame = +3

Query  144   IRDSVSQLGDPTERVAYYFSEALYNRLSNSPE--------KRPANFDASSEELTLSYKAL  299
             +R  VS  G+P +R+  Y  E L  RL++S          K PA  D       LSY  L
Sbjct  189   LRQMVSVTGEPIQRLGAYMLEGLVARLASSGSSIYNALRCKEPAGAD------LLSYMLL  242

Query  300   -NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSI  476
               +ACPY KF +++AN AI +A +    +HIIDF I QG QW  L+QALA R GG P  I
Sbjct  243   LYEACPYFKFGYMSANGAIADAMKDEISVHIIDFQIAQGSQWVTLIQALAARPGGPP-RI  301

Query  477   RISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEI  656
             RI+GI       +    L   G RL   A+   + FEF         +   +  + P E 
Sbjct  302   RITGIDDSTSAYARGGGLDIVGKRLLKLAESYKVPFEFHTAGVSASEIQIENLGIQPGEA  361

Query  657   LAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNAL  827
             +AVNF L L++L DE+  T       L+L  SL+P +VTL E+E + N V F  RF   L
Sbjct  362   VAVNFALTLHHLPDESVGTQNHRDRLLRLVKSLSPKVVTLVEHESNTNTVPFFARFVETL  421

Query  828   KYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDH  1007
              YY AIFES+D  + R++ +R+ VE   L R +  ++         E  E     E    
Sbjct  422   NYYLAIFESIDVTLPRENKKRISVEQHCLAREVVNIV-------ACEGAERVERHEPLGK  474

Query  1008  WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSS  1187
             WR   E AGF    +S + +S  KILL      S    ++   G L L W + PL+   +
Sbjct  475   WRSRFEMAGFTPYPLSSFVNSTIKILL---ENYSEKYTLEERDGALFLGWMNRPLVASCA  531

Query  1188  W  1190
             W
Sbjct  532   W  532



>ref|XP_006346062.1| PREDICTED: scarecrow-like protein 18-like [Solanum tuberosum]
Length=431

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/394 (35%), Positives = 196/394 (50%), Gaps = 42/394 (11%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             + CA L      +A K L+ I  + S   GD TER+ + F+ AL  RL+        +F 
Sbjct  54    ISCAELISRSDFSAAKRLLTILSTNSSPFGDSTERLVHQFTRALSLRLNRYISSTTNHFM  113

Query  261   ASSE----------------ELTLSYKALNDACPYSKFAHLTANQAILEATEKASK-IHI  389
                E                 +  SY +LN   P+ +F  LTANQAILEA     + IHI
Sbjct  114   TPVETTPTDSSSSLPSSSLALIQSSYLSLNQVTPFIRFTQLTANQAILEAINGNHQAIHI  173

Query  390   IDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKV  569
             +DF I  G+QW  L+QALA R      ++RI+G      GN    +L  TG+RL  FA  
Sbjct  174   VDFDINHGVQWPPLMQALADRYPAP--TLRITGT-----GND-LDTLRRTGDRLAKFAHS  225

Query  570   LDLNFEFEPVLGPIHSLNG-------SSFRVDPDEILAVNFMLQLYNLLDETTATVGTAL  728
             L L F+F P+    ++ +        SS  + PDE LA+N +  L+ LL +    +   L
Sbjct  226   LGLRFQFHPLYIANNNRDHDEDPSIISSIVLLPDETLAINCVFYLHRLLKDR-EKLRIFL  284

Query  729   KLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESL  908
                 S+NP IVT+ E E + N   FL+RF  AL YY+A+F+SL+  +   S ER+ VE +
Sbjct  285   HRVKSMNPKIVTIAEKEANHNHPLFLQRFIEALDYYTAVFDSLEATLPPGSRERMTVEQV  344

Query  909   LLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILL  1088
               GR I +++  E  + K               W +++ S GF  VA+S +A SQAK+LL
Sbjct  345   WFGREIVDIVAMEGDKRKERHERFRS-------WEVMLRSCGFSNVALSPFALSQAKLLL  397

Query  1089  WnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
               +  S  Y L  S   F  L W ++PL ++SSW
Sbjct  398   RLHYPSEGYQLGVSSNSFF-LGWQNQPLFSISSW  430



>ref|XP_008791129.1| PREDICTED: DELLA protein RGL3-like [Phoenix dactylifera]
Length=717

 Score =   188 bits (478),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 141/371 (38%), Positives = 188/371 (51%), Gaps = 47/371 (13%)
 Frame = +3

Query  123   AVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK----RPANFDASSEELTLSY  290
             A + L  +   VS LGD  +RVA  F++AL  R+S SP      RP  +  + + L + Y
Sbjct  377   ARRYLHHLNSVVSPLGDSMQRVASCFADALAARISPSPSSSSSPRP--WFPTLDTLKI-Y  433

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             + L  ACPY KFAH TANQAI EA E   ++H++D  IVQG QW A LQALA R GG P 
Sbjct  434   QILYQACPYIKFAHFTANQAIFEAFESEDRVHVVDLDIVQGYQWPAFLQALAARPGGPP-  492

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVL---------GPIHSLN  623
             ++RI+G+        PA S+  TG  L + A  L + FEF   +         G +H   
Sbjct  493   ALRITGV------GHPAESVRQTGRHLAELAHSLRVPFEFHAAVADRLEDLLPGMLHRRI  546

Query  624   GSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGF  803
             G        E LAVN + +L+ +     A +G  L +     P IVTL E+E S N   F
Sbjct  547   G--------EALAVNAVCRLHRV---PGAHLGQLLSMIRDQAPKIVTLVEHEASHNGPYF  595

Query  804   LKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECve  977
             L RF  AL YYSAIF+SLD     DS  R KVE  +    I  ++  E  E+ A+ E   
Sbjct  596   LGRFLEALHYYSAIFDSLDATFPADSAARAKVEQYIFAPEIKNIVASEGAERVARHE---  652

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAW  1157
                       WR +ME  GFK VA+S  + +Q++ILL  Y         D+  G L L W
Sbjct  653   ------RLGRWRKVMEGRGFKGVALSANSVNQSRILLGLYACDGYRLTEDN--GCLLLGW  704

Query  1158  NDEPLLTVSSW  1190
              D  ++  S+W
Sbjct  705   QDRAIIAASAW  715



>ref|XP_010923996.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
[Elaeis guineensis]
Length=574

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 133/380 (35%), Positives = 184/380 (48%), Gaps = 24/380 (6%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIR-IRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPAN  254
             + CA        N  + L++  R  VS +G+P +R+  Y  E L  R  +S     R   
Sbjct  209   IRCAEALSEDKINEFEMLVQEARALVSIVGEPIQRLGAYMVEGLVARKESSGTNIYRALR  268

Query  255   FDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                   +  LSY + L D CPY KF ++ AN AI EA     +IHIIDF I QG QW  L
Sbjct  269   CQKPESKELLSYMRILYDICPYFKFGYMAANGAIAEALRNEDRIHIIDFQIAQGTQWITL  328

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             +QALA R GG P  +RI+GI  PV   +    L   G  L D +K  ++  EF    V G
Sbjct  329   IQALAARPGGPPH-VRITGIDDPVSEYARGDGLQLVGKMLSDMSKKFNIPLEFHSLSVYG  387

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +      + P E LAVNF LQL++  DE+          L++   L+P + TL E 
Sbjct  388   P--QVTREMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQ  445

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQ  953
             E + N   FL R    L YYSA+FES+D  + RDS ER+ VE   L + I  ++  E E+
Sbjct  446   ESNTNTTPFLTRCMETLDYYSAMFESIDVTLPRDSKERINVEQHCLAKDIVNIIACEGEE  505

Query  954   RAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSP  1133
             R +   +           WR  +  AGFK   +S Y +S  K LL  Y+   +    D  
Sbjct  506   RVERHELL--------GKWRSRLTMAGFKPFPLSSYVNSVIKNLLGCYSDKYTLVEKD--  555

Query  1134  PGFLSLAWNDEPLLTVSSWH  1193
              G + L W +  L++ S+WH
Sbjct  556   -GAMLLGWKNRNLISASAWH  574



>ref|XP_008386036.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
Length=583

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/383 (36%), Positives = 188/383 (49%), Gaps = 30/383 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANF-  257
             + CA    +   ++ + LI + R +VS  G+P  R+  Y  E L  R     E   AN  
Sbjct  218   IACAEALSNNDMDSFEKLIEKARGAVSISGEPIXRLGAYLVEGLIAR----KEISGANIY  273

Query  258   ------DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
                   +  S EL    + L + CPY KF +L AN AI EA     +IHIIDF I QG Q
Sbjct  274   HALRCREPESNELLSYMQILYEICPYLKFGYLAANGAIAEACRNEDRIHIIDFQIAQGSQ  333

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--  593
             W  LLQALA R GG P  +RI+GI  P+  ++    L A G RL+  +   ++  EF   
Sbjct  334   WVTLLQALAARPGGAPH-VRITGIDDPLSKHARGDGLEAVGRRLKAISDKFNIPVEFHGV  392

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVT  764
             PV  P  +L+     V P E LAVNF L+L++  DE+          L+   SLNP + T
Sbjct  393   PVFSPNVTLD--MLDVRPGEALAVNFPLELHHTPDESVVENNPRDGLLRTVKSLNPKVTT  450

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             L E E + N   F  RF  AL+YY A+FES+D  + R S ER+ VE   L R I  ++  
Sbjct  451   LVEQESNTNTTPFFNRFVEALEYYMAMFESIDVALPRSSKERINVEQHCLARDIVNVIAC  510

Query  945   EEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E R + E  E+         W+     AGF+   +S Y +S  K LL  Y+   +    
Sbjct  511   -EGRERVERHELF------GKWKSRFTMAGFRQYPLSSYVNSVIKSLLRCYSEHYTLVER  563

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
             D   G + L W D  L++ S+WH
Sbjct  564   D---GAMLLGWKDRNLVSASAWH  583



>ref|XP_007021113.1| GRAS family transcription factor isoform 4, partial [Theobroma 
cacao]
 gb|EOY12638.1| GRAS family transcription factor isoform 4, partial [Theobroma 
cacao]
Length=592

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/365 (36%), Positives = 180/365 (49%), Gaps = 25/365 (7%)
 Frame = +3

Query  129   KSLIRIRDSVSQLGDPTERVAYYFSEALYNR--LSNSPEKRPANFDASSEELTLSY-KAL  299
             K + + R++VS  G+P +R+  Y  EAL  R   S S   R         +  LSY + L
Sbjct  240   KLIAKARNAVSICGEPIQRLGAYMVEALVARKEASGSNIYRARRCREPEGKDLLSYMQIL  299

Query  300   NDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIR  479
              + CPY KF ++ AN AI EA     +IHIIDF I QG QW  LLQALA R GG P  +R
Sbjct  300   YEICPYLKFGYMAANGAIAEACRTEDRIHIIDFHIGQGTQWVTLLQALAARPGGAP-HVR  358

Query  480   ISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLGPIHSLNGSSFRVDPDE  653
             I+GI  P+   +    L A G RL   ++  ++  EF   PV  P   +      V P E
Sbjct  359   ITGIDDPLSKYARGGGLEAVGRRLAALSEKFNIPVEFHGVPVFAP--DITRGMLDVRPGE  416

Query  654   ILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
              LAVNF LQL++  DE+          L++  SL+P + TL E E + N   FL RF   
Sbjct  417   ALAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLSPKVTTLVEQESNTNTAPFLPRFIET  476

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveD  998
             L YY A+FES+D  + RD  ER+ VE   L R I  ++  E  E+  + E          
Sbjct  477   LDYYLAMFESIDETLPRDRKERINVEQHCLARDIVNVIACEGKERVERHELF--------  528

Query  999   KDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLT  1178
                W+  +  AGF+   +S Y +S  + LL  Y+        D   G + L W D  L++
Sbjct  529   -GKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYSKHYKLVEKD---GAMLLGWKDRNLIS  584

Query  1179  VSSWH  1193
              S+WH
Sbjct  585   ASAWH  589



>ref|XP_006857885.1| hypothetical protein AMTR_s00069p00112440 [Amborella trichopoda]
 gb|ERN19352.1| hypothetical protein AMTR_s00069p00112440 [Amborella trichopoda]
Length=676

 Score =   187 bits (476),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/357 (36%), Positives = 184/357 (52%), Gaps = 21/357 (6%)
 Frame = +3

Query  135   LIRIRDSVSQLGDPTERVAYYFSEALYNRL----SNSPEKRPANFDASSEELTLSYKALN  302
             L R+ +  S  G    RV  YF+EAL  R+     +     P   D S ++  + ++ LN
Sbjct  315   LSRLGELASPEGTSIHRVVAYFTEALTLRVFKLWPHIFHLFPLQSDFSEDDSAIGFRLLN  374

Query  303   DACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRI  482
                P  KF H TAN+ IL A E   ++HIIDF I QG+QW  L Q+LATR    P  +RI
Sbjct  375   QMNPIPKFMHFTANEMILRAFEGKDQVHIIDFDIKQGLQWPGLFQSLATRP-NPPSHVRI  433

Query  483   SGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILA  662
             +GI     G S    L  TG RL  FA+ ++L FEF  V+  +  +      V   E + 
Sbjct  434   TGI-----GES-KHELQETGERLAGFAEAMNLKFEFHAVVDKLEDVRLWMLHVKEGESVV  487

Query  663   VNFMLQLYNLL-DETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYS  839
             VN +LQL+ +L D+    +   L L  S  P +V + E E S N   +  RF   LKYYS
Sbjct  488   VNCILQLHTVLYDDNVGALRDLLGLMQSTRPVMVVIAEQEASHNDPNWELRFLRTLKYYS  547

Query  840   AIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRIL  1019
             AIF+S+D +  RDSP R+KVE  +  R I  ++   E R +TE        E  + W+ L
Sbjct  548   AIFDSIDASFPRDSPARIKVEE-MFAREIRNIVAC-EGRERTE------RHESFETWKRL  599

Query  1020  MESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             ME  GF+++ +      Q++++L  Y+  S   +     G L+L W D+PL TVSSW
Sbjct  600   MEEVGFRSLRVEERERLQSQMILKMYDCDSYNVVKQGEEG-LTLCWLDQPLFTVSSW  655



>ref|XP_008366473.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
Length=583

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/383 (36%), Positives = 188/383 (49%), Gaps = 30/383 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANF-  257
             + CA    +   ++ + LI + R +VS  G+P  R+  Y  E L  R     E   AN  
Sbjct  218   IACAEALSNNDMDSFEKLIEKARGAVSISGEPIXRLGAYLVEGLIAR----KEISGANIY  273

Query  258   ------DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
                   +  S EL    + L + CPY KF +L AN AI EA     +IHIIDF I QG Q
Sbjct  274   HALRCREPESNELLSYMQILYEICPYLKFGYLAANGAIAEACRNEDRIHIIDFQIAQGSQ  333

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--  593
             W  LLQALA R GG P  +RI+GI  P+  ++    L A G RL+  +   ++  EF   
Sbjct  334   WVTLLQALAARPGGAPH-VRITGIDDPLSKHARGDGLEAVGRRLKAISDKFNIPVEFHGV  392

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVT  764
             PV  P  +L+     V P E LAVNF L+L++  DE+          L+   SLNP + T
Sbjct  393   PVFSPNVTLD--MLDVRPGEALAVNFPLELHHTPDESVVENNPRDGLLRTVKSLNPKVTT  450

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             L E E + N   F  RF  AL+YY A+FES+D  + R S ER+ VE   L R I  ++  
Sbjct  451   LVEQESNTNTTPFFNRFVEALEYYMAMFESIDVALPRSSKERINVEQHCLARDIVNVIAC  510

Query  945   EEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLI  1124
              E R + E  E+         W+     AGF+   +S Y +S  K LL  Y+   +    
Sbjct  511   -EGRERVERHELF------GKWKSRFTMAGFRQYPLSSYVNSVIKSLLRCYSEHYTLVER  563

Query  1125  DSPPGFLSLAWNDEPLLTVSSWH  1193
             D   G + L W D  L++ S+WH
Sbjct  564   D---GAMLLGWKDRNLVSASAWH  583



>gb|KDP21811.1| hypothetical protein JCGZ_00598 [Jatropha curcas]
Length=840

 Score =   189 bits (479),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 136/374 (36%), Positives = 198/374 (53%), Gaps = 28/374 (7%)
 Frame = +3

Query  87    DCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSP----EKRPA  251
              CA  ++V   E A K L+ I +  +  G   +RVA YFSEA+  RL NS        P+
Sbjct  461   QCAEAVSVDNFEEANKMLLEISELSTPYGTSAQRVAAYFSEAMSARLVNSCLGIYATLPS  520

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                + ++++  +++  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L
Sbjct  521   MPISHTQKMASAFQVFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGL  580

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPI  611
                LA+R GG P  +R++G     LG S  A L ATG RL DFA+ L L FEF PV   +
Sbjct  581   FHILASRPGGPP-YVRLTG-----LGTSMEA-LEATGKRLSDFAQKLGLPFEFFPVADKV  633

Query  612   HSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPN  791
              +L+     V   E +AV+++   ++L D T +   T L L   L P +VT+ E ++S +
Sbjct  634   GNLDPERLNVSKREAVAVHWL--QHSLYDVTGSDTNT-LWLLQRLAPKVVTVVEQDLS-H  689

Query  792   RVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM-RPEEQRAKTE  968
                FL RF  A+ YYSA+F+SL  +   +S ER  VE  LL R I  ++ R    R    
Sbjct  690   AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSREIRNVLARGGPSRTG--  747

Query  969   CveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLS  1148
                         +WR  +  +GFK +++S  A +QA +LL  +       + D+  G L 
Sbjct  748   -------DLKFHNWREKLRQSGFKGISLSGNAATQATLLLGMFPCDGYTLVEDN--GTLK  798

Query  1149  LAWNDEPLLTVSSW  1190
             L W D  LLT S+W
Sbjct  799   LGWKDLCLLTASAW  812



>ref|XP_004506678.1| PREDICTED: scarecrow-like protein 5-like isoform X1 [Cicer arietinum]
 ref|XP_004506679.1| PREDICTED: scarecrow-like protein 5-like isoform X2 [Cicer arietinum]
Length=547

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 186/375 (50%), Gaps = 20/375 (5%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             CA+ +AV+  E     +  +R  VS  G P ER+  Y  EAL +R+++S      +   S
Sbjct  184   CAKAVAVNDIETIEWMVTELRKIVSISGSPIERLGAYVLEALVSRMASSGSTIYKSLKCS  243

Query  267   ---SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
                  EL      L + CPY KF +++AN AI EA +  +++HIIDF I QG QW +L+Q
Sbjct  244   EPTGNELLSYMHVLYEICPYFKFGYMSANGAIAEAMKDENEVHIIDFQISQGTQWVSLIQ  303

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
             ALA R GG P  IRI+G+       +    +   G RL   A+   + FEF  V      
Sbjct  304   ALARRPGGPP-RIRITGVDDSFSAYARGGGVDVVGERLSTLAQSCHVPFEFHAVRVSASE  362

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSP  788
             +    F + PDE +AVNF + L+++ DE+          L+L   L+P +VTL E E + 
Sbjct  363   VQLEDFELRPDEAVAVNFAIMLHHVPDESVNVHNHRDRLLRLVKHLSPKVVTLVEQEFNT  422

Query  789   NRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE-EQRAKT  965
             N   FL+RF   + YYSAI+ES+D  + RD  ER+ VE   L R +  L+  E E+R + 
Sbjct  423   NNAPFLQRFVETMNYYSAIYESIDVVLPRDHKERINVEQHCLAREVVNLIACEGEERVER  482

Query  966   ECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFL  1145
               +  +        W +    AGF    +S + +S  K LL        +  ++   G L
Sbjct  483   HELLSK--------WSMRFAMAGFTPYPLSSFINSSIKDLL---ESYRGHYTLEERDGAL  531

Query  1146  SLAWNDEPLLTVSSW  1190
              L W ++ L+   +W
Sbjct  532   YLGWMNQVLIASCAW  546



>ref|XP_009355562.1| PREDICTED: scarecrow-like protein 21 [Pyrus x bretschneideri]
Length=583

 Score =   186 bits (473),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 136/384 (35%), Positives = 187/384 (49%), Gaps = 32/384 (8%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANF-  257
             V CA    +   +  + LI + R +VS  G+P +R+  Y  E L  R     E   AN  
Sbjct  218   VACAGALSNNDMDGFEKLIEKARGAVSISGEPIQRLGAYLVEGLIAR----KEISGANIY  273

Query  258   ------DASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQ  419
                   +  S EL    + L + CPY KF ++ AN AI EA     +IHIIDF I QG Q
Sbjct  274   HALRCREPESNELLSYMQILFEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQGSQ  333

Query  420   WAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--  593
             W  LLQALA R GG P  +RI+GI  P   ++    L A G RL+  +   ++  EF   
Sbjct  334   WVTLLQALAARPGGAP-HVRITGIDDPRSKHARGDGLEAVGRRLKAISDKFNIPVEFHGV  392

Query  594   PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVT  764
             PV  P  ++      V P E LAVNF LQL++  DE+          L+   SLNP + T
Sbjct  393   PVFSP--NVTRDMLDVRPGEALAVNFPLQLHHTPDESVDENNPRDGLLRTVRSLNPKVTT  450

Query  765   LGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRP  944
             L E E + N   F  RF  AL+YY A+FES+D  M R S ER+ VE   L R I  ++  
Sbjct  451   LVEQESNTNTTPFFNRFVEALEYYMAMFESIDVAMPRSSKERINVEQHCLARDIVNVIAC  510

Query  945   E-EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysL  1121
             E +QR +   +           W+  +  AGF+   +S Y +S  + LL  Y+   +   
Sbjct  511   EGKQRVERHELF--------GKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYSEHYTLVE  562

Query  1122  IDSPPGFLSLAWNDEPLLTVSSWH  1193
              D   G + L W D  L++ S+WH
Sbjct  563   RD---GAMLLGWKDRNLVSASAWH  583



>ref|XP_008781654.1| PREDICTED: DELLA protein RGL2-like [Phoenix dactylifera]
Length=467

 Score =   184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 138/382 (36%), Positives = 196/382 (51%), Gaps = 44/382 (12%)
 Frame = +3

Query  120   NAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRL--SNSPEKRPANFDASSEELTLSYK  293
             +A+ +L  +   VS  GDP +RVA YF++ L  RL    SP         +SEE  L++ 
Sbjct  93    SAIDALHELYQLVSTNGDPIQRVAAYFADGLAARLLTKTSPFYETIMAQPASEEELLAFT  152

Query  294   ALNDACPYSKFAHLTANQAILEATEKASK-------IHIIDFGIVQGIQWAALLQAL---  443
              L  A P+ +FAH TANQAI+EA E+  +       +H+IDF +  G QW +L+Q+L   
Sbjct  153   ELYQASPFHQFAHFTANQAIMEAFEEGQQRPHNGRSLHVIDFDVSYGFQWPSLIQSLSDK  212

Query  444   ATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLD-LNFEFEPVL-GPIHS  617
             ATRS  KP S+RI+G    +        L  T  RL +F K  D L  +FE +L G + S
Sbjct  213   ATRS--KPISLRITGFGRSI------EELRETETRLVNFTKGCDNLFMKFEGLLRGSVRS  264

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
                  F+++ +  L VN +  L  L   +++ V  AL    SLNPS+V + E E      
Sbjct  265   ----DFKIEKNATLVVNLVFYLQTL--RSSSEVSDALMAVCSLNPSLVVVVEKEGGRRPC  318

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
              FL RF  +L YY+A+F+SL+  +  +S ER+K+E   LGR I   M  EE+        
Sbjct  319   TFLSRFMESLHYYAAMFDSLNDCLPAESTERLKIEKNHLGREIKIAMTEEEKEEGKHLEF  378

Query  978   veveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGF-----  1142
                     D W+  MES GF  + +S  + SQAK+LL   ++ S+    D   GF     
Sbjct  379   ERT-----DTWKGKMESFGFGEIKLSSRSVSQAKLLLKIKSHLSTIEH-DGGCGFRILER  432

Query  1143  -----LSLAWNDEPLLTVSSWH  1193
                  +SLAW D  L TVS+WH
Sbjct  433   DEGRAISLAWQDRHLATVSAWH  454



>gb|KHN29457.1| Protein SCARECROW [Glycine soja]
Length=651

 Score =   187 bits (475),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 140/393 (36%), Positives = 199/393 (51%), Gaps = 38/393 (10%)
 Frame = +3

Query  87    DCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
              CA  ++    E+A K L+ I    +  G   +RVA YFSEA+  RL +S     A    
Sbjct  290   QCAEAVSAENLEDANKMLLEISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATLPH  349

Query  264   S--SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             +  S ++  +++  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L  
Sbjct  350   THQSHKVASAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFH  409

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
              LA+R GG P  +R++G     LG S  A L ATG RL DFA  L L FEF PV   + +
Sbjct  410   ILASRPGGAP-YVRLTG-----LGTSMEA-LEATGKRLSDFANKLCLPFEFFPVAEKVGN  462

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+     V   E +AV+++   ++L D T +   T L L   L P +VT+ E ++S N  
Sbjct  463   LDPERLNVSKTEAVAVHWL--QHSLYDVTGSDTNT-LWLLQRLAPKVVTVVEQDLS-NTG  518

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
              FL RF  A+ YYSA+F+SL  +   +S ER  VE  LL R I  ++         E   
Sbjct  519   SFLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAVGGPSRTGE---  575

Query  978   veveveDKDH-WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                    K H WR  ++  GF+ ++++  A +QA +LL  +       + D+  G L L 
Sbjct  576   ------PKFHNWREKLQQCGFRGISLAGNAATQASLLLGMFPSEGYTLVEDN--GILKLG  627

Query  1155  WNDEPLLTVSSWH*LNFNISIEFGRPPLPGIFT  1253
             W D  LLT S+W            RPP  G  T
Sbjct  628   WKDLCLLTASAW------------RPPFHGAIT  648



>ref|XP_010319995.1| PREDICTED: GRAS6 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010319996.1| PREDICTED: GRAS6 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010319997.1| PREDICTED: GRAS6 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010319999.1| PREDICTED: GRAS6 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010320000.1| PREDICTED: GRAS6 protein isoform X1 [Solanum lycopersicum]
Length=563

 Score =   186 bits (472),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 178/366 (49%), Gaps = 21/366 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLS  287
             E A   +  +R  VS  GDP  R A Y  EAL  R++ S     K     +A+S E   +
Sbjct  210   EQASSMINELRQMVSIQGDPLGRTAAYMVEALAARMATSGRGLYKALKCKEATSSERLSA  269

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
              + L + CPY +F  + AN AILEA +   ++HIIDF + QG Q+  LLQ L +  G KP
Sbjct  270   MQVLFEVCPYFRFGFMAANGAILEAFKDEKRVHIIDFDVNQGSQYYTLLQTLGSMPG-KP  328

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +R++G+  P         L   G RL   AK L ++FEF+ V      +  +     P
Sbjct  329   PHVRLTGVDDPESVQRAIGGLNVIGLRLAQLAKDLKISFEFQAVSSNTALVTPAMLNCRP  388

Query  648   DEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
              E + VNF  QL+++ DE+ +TV      L++  SLNP +VT+ E +M+ N   FL+RF 
Sbjct  389   GEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFA  448

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECvevevev  992
                 YY A+FESLD  ++RDS ERV VE   L R I  ++  E  E+  + E        
Sbjct  449   EVYNYYCAVFESLDATLSRDSQERVNVERQCLARDIINIVACEGLERIERYEVA------  502

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR  M  AGF    IS   +   + L+  Y+        +   G L   W D+ L
Sbjct  503   ---GKWRARMMMAGFTPSPISRNVYESIRNLIKQYSERYKA---EEEAGALYFGWEDKTL  556

Query  1173  LTVSSW  1190
                S+W
Sbjct  557   TVASAW  562



>ref|XP_009628410.1| PREDICTED: scarecrow-like protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628411.1| PREDICTED: scarecrow-like protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628412.1| PREDICTED: scarecrow-like protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628413.1| PREDICTED: scarecrow-like protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628414.1| PREDICTED: scarecrow-like protein 1 [Nicotiana tomentosiformis]
Length=565

 Score =   186 bits (472),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 179/366 (49%), Gaps = 21/366 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLS  287
             E A   +  +R  VS  G+P ER A Y  EAL  R++ S +   K     +A   E   +
Sbjct  212   EQASSMINELRQMVSIQGEPLERTAAYMVEALAARMATSGKGLYKALKCKEALFSERLSA  271

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
              + L + CPY +F  + AN AILEA +   ++HIIDF I QG Q+  LLQ LA+  G KP
Sbjct  272   MQVLFEVCPYFRFGFMAANGAILEAFKDEKRVHIIDFDINQGSQYYTLLQTLASMPG-KP  330

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +R++G+  P         L   G RL + AK L + FEF+ V      +  +     P
Sbjct  331   PHLRLTGVDDPESIQRAIGGLNVIGLRLEELAKDLKIPFEFQAVASNTALVTPAMLNCHP  390

Query  648   DEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
              E L VNF  QL+++ DE+ +TV      L++  SLNP +VT+ E +M+ N   FL+R  
Sbjct  391   GEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTTPFLQRVA  450

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM--RPEEQRAKTECvevevev  992
                 YYSA+FESLD  ++RDS ERV VE   L R I  ++    EE+  + E        
Sbjct  451   EVHNYYSAVFESLDATLSRDSQERVNVERQCLARDIINIVACEGEERIERYEVAG-----  505

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR  M  AGF    IS   +   + L+  Y+            G L   W D+ L
Sbjct  506   ----KWRARMMMAGFTPSPISRNVYDSIQNLIKQYSERYKAK---EEAGALHFGWEDKSL  558

Query  1173  LTVSSW  1190
             +  S+W
Sbjct  559   IVASAW  564



>ref|XP_006381294.1| hypothetical protein POPTR_0006s11500g [Populus trichocarpa]
 gb|ERP59091.1| hypothetical protein POPTR_0006s11500g [Populus trichocarpa]
Length=847

 Score =   188 bits (478),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 133/372 (36%), Positives = 194/372 (52%), Gaps = 27/372 (7%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSP----EKRPANFDASSEELTL  284
             E A K L+ I +  +  G   +RVA YFSEA+  RL +S        P+   + ++++  
Sbjct  481   EEANKMLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYATLPSMPQSHTQKMAS  540

Query  285   SYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK  464
             +++  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   LA+R GG 
Sbjct  541   AFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGP  600

Query  465   PDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVD  644
             P  +R++G     LG S  A L ATG RL DFA  L L FEF PV   + +LN     V 
Sbjct  601   P-FVRLTG-----LGTSTEA-LEATGKRLSDFANKLGLPFEFIPVAEKVGNLNPERLNVS  653

Query  645   PDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
               E +AV++   L + L + T +    L L   L P +VT+ E ++S +   FL RF  A
Sbjct  654   KSEAVAVHW---LQHSLYDVTGSDTNMLYLLQRLAPKVVTVVEQDLS-HAGSFLGRFVEA  709

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKD  1004
             + YYSA+F+SL  +   +S ER  VE  LL R I  ++         +            
Sbjct  710   VHYYSALFDSLGASYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKF--------H  761

Query  1005  HWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVS  1184
             +WR  ++ +GFK ++++  A +QA +LL  +         D   G L L W D  LLT S
Sbjct  762   NWREKLQQSGFKCISLAGNAANQANLLLGMFPSDGYTLAEDK--GTLKLGWKDLCLLTAS  819

Query  1185  SWH*LNFNISIE  1220
             +W    F++SIE
Sbjct  820   AWR--PFHVSIE  829



>ref|NP_001234179.1| lateral suppressor protein [Solanum lycopersicum]
 ref|XP_010324190.1| PREDICTED: lateral suppressor protein isoform X1 [Solanum lycopersicum]
 gb|AAD05242.1| lateral suppressor protein [Solanum lycopersicum]
 emb|CAC36399.1| lateral suppressor [Solanum lycopersicum]
Length=428

 Score =   183 bits (464),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 196/391 (50%), Gaps = 39/391 (10%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEKRPANFD  260
             + CA L      +A K L+ I  + S   GD TER+ + F+ AL  RL+        +F 
Sbjct  54    ISCAELISQSDFSAAKRLLTILSTNSSPFGDSTERLVHQFTRALSLRLNRYISSTTNHFM  113

Query  261   ASSE-------------ELTLSYKALNDACPYSKFAHLTANQAILEATEKASK-IHIIDF  398
                E              +  SY +LN   P+ +F  LTANQAILEA     + IHI+DF
Sbjct  114   TPVETTPTDSSSSSSLALIQSSYLSLNQVTPFIRFTQLTANQAILEAINGNHQAIHIVDF  173

Query  399   GIVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDL  578
              I  G+QW  L+QALA R      ++RI+G      GN    +L  TG+RL  FA  L L
Sbjct  174   DINHGVQWPPLMQALADRYPAP--TLRITGT-----GND-LDTLRRTGDRLAKFAHSLGL  225

Query  579   NFEFEPVLGPIHSLNG-------SSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLA  737
              F+F P+    ++ +        SS  + PDE LA+N +  L+ LL +    +   L   
Sbjct  226   RFQFHPLYIANNNHDHDEDPSIISSIVLLPDETLAINCVFYLHRLLKDR-EKLRIFLHRV  284

Query  738   NSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLG  917
              S+NP IVT+ E E + N   FL+RF  AL YY+A+F+SL+  +   S ER+ VE +  G
Sbjct  285   KSMNPKIVTIAEKEANHNHPLFLQRFIEALDYYTAVFDSLEATLPPGSRERMTVEQVWFG  344

Query  918   RRIAELMRPEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWny  1097
             R I +++  E  + K               W +++ S GF  VA+S +A SQAK+LL  +
Sbjct  345   REIVDIVAMEGDKRKERHERFRS-------WEVMLRSCGFSNVALSPFALSQAKLLLRLH  397

Query  1098  nysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
               S  Y L  S   F  L W ++PL ++SSW
Sbjct  398   YPSEGYQLGVSSNSFF-LGWQNQPLFSISSW  427



>gb|KHN40575.1| Protein SCARECROW [Glycine soja]
Length=572

 Score =   186 bits (471),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 136/372 (37%), Positives = 194/372 (52%), Gaps = 26/372 (7%)
 Frame = +3

Query  87    DCARLAVSQP-ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDA  263
              CA    S+  E+A K L+ I    +  G   +RVA YFSEA+  RL +S     A    
Sbjct  211   QCAEAVSSENLEDANKMLLEISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATLPH  270

Query  264   S--SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQ  437
             +  S ++  +++  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L  
Sbjct  271   THQSHKVASAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFH  330

Query  438   ALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHS  617
              LA+R GG P  +R++G     LG S  A L ATG RL DFA  L L FEF PV   + +
Sbjct  331   ILASRPGGAP-YVRLTG-----LGTSMEA-LEATGKRLSDFANKLGLPFEFFPVAEKVGN  383

Query  618   LNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRV  797
             L+     V   E +AV+++   ++L D T +   T L L   L P +VT+ E ++S N  
Sbjct  384   LDPERLNVCKTEAVAVHWL--QHSLYDVTGSDTNT-LWLLQRLAPKVVTVVEQDLS-NTG  439

Query  798   GFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECve  977
              FL RF  A+ YYSA+F+SL  +   +S ER  VE  LL R I  ++         E   
Sbjct  440   SFLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAVGGPSRTGE---  496

Query  978   veveveDKDH-WRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLA  1154
                    K H WR  ++  GF+ ++++  A +QA +LL  +       + D+  G L L 
Sbjct  497   ------PKFHNWREKLQQCGFRGISLAGNAATQASLLLGMFPSEGYTLVEDN--GILKLG  548

Query  1155  WNDEPLLTVSSW  1190
             W D  LLT S+W
Sbjct  549   WKDLCLLTASAW  560



>ref|XP_002994174.1| hypothetical protein SELMODRAFT_432115 [Selaginella moellendorffii]
 gb|EFJ04764.1| hypothetical protein SELMODRAFT_432115 [Selaginella moellendorffii]
Length=768

 Score =   187 bits (476),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 130/355 (37%), Positives = 189/355 (53%), Gaps = 25/355 (7%)
 Frame = +3

Query  141   RIRDSVSQLGDPTERVAYYFSEALYNRLSNSP----EKRPANFDASSEELTLSYKALNDA  308
             ++ +  S  G   +RVA YF+EA+  R+ NS        P      +  +  +++  N  
Sbjct  433   QLTELASPYGSSVQRVAAYFAEAMAARMVNSCLGICSALPGIHHVYNHSIAAAFQIFNGM  492

Query  309   CPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISG  488
             CP  KF+H TANQAILEA E    +HI+D  I+QG+QW AL   LA+R GG P+ +RI+G
Sbjct  493   CPLVKFSHFTANQAILEAFEGEQSVHIVDIDIMQGLQWPALFHILASRPGGPPN-VRITG  551

Query  489   IPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVN  668
                  LG S A +L ATG RL DFA  L L FEF  V   I   + ++ +V P + LAV+
Sbjct  552   -----LGTS-AEALEATGKRLSDFASSLGLPFEFFAVADKIGHCDAATLKVRPGDALAVH  605

Query  669   FMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIF  848
             +   L++ L + T +    LKL  SL P +VT+ E ++S +   FL RF  AL YYSA+F
Sbjct  606   W---LHHSLYDVTGSDSKTLKLLGSLEPKVVTMVEQDLS-HAGSFLNRFVEALHYYSALF  661

Query  849   ESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMES  1028
             +SL  +   DSP+R  VE  LL   I  ++         E           + WR  ++ 
Sbjct  662   DSLGASFPEDSPDRHMVEQQLLSCEIKNILAVGGPARTGEVKF--------EQWRDQLKQ  713

Query  1029  AGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             +GF+ ++++  A +QA +LL  +       + D+  G L L W D  LLT S+WH
Sbjct  714   SGFRPISLAGNAATQATLLLGMFPLQGYTLVEDN--GTLKLGWKDLCLLTASAWH  766



>ref|XP_006657807.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like 
[Oryza brachyantha]
Length=571

 Score =   186 bits (471),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 173/355 (49%), Gaps = 17/355 (5%)
 Frame = +3

Query  147   RDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLSYKALNDACPY  317
             R  VS  G+P +R+  Y  E L  R  NS     +     +  S+EL    K L + CPY
Sbjct  228   RGVVSITGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCREPDSKELLSYMKILYNICPY  287

Query  318   SKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIPS  497
              KF ++ AN AI EA    + IHIIDF I QG QW  L+QALA R GG P  +RI+GI  
Sbjct  288   FKFGYMAANGAIAEALRTENNIHIIDFQIAQGTQWITLIQALAARPGGPP-HVRITGIDD  346

Query  498   PVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFML  677
             PV   +  A L   G  L+  ++  ++  EF P+      +      + P E LAVNF L
Sbjct  347   PVSEYARGAGLDIVGKLLKSMSEEFNIPLEFTPLPVTATQVTKEMLDIRPGEALAVNFTL  406

Query  678   QLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAIF  848
             QL++  DE+          L++   L+P + TL E E   N   FL RF   + YYSA+F
Sbjct  407   QLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFGETMDYYSAMF  466

Query  849   ESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHWRILMES  1028
             ES+D N+ RD+ ER+ VE   L + I  ++         E  +     E    W+  +  
Sbjct  467   ESIDANLPRDNKERISVEQHCLAKDIVNIV-------ACEGKDRVERHELLGKWKSRLTM  519

Query  1029  AGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             AGF+   +S Y +S  + LL      S    ++   G + L W +  L++ S+WH
Sbjct  520   AGFRPYPLSSYVNSVIRKLL---ACYSDKYTLEEKDGAMLLGWKNRKLISASAWH  571



>ref|NP_001234168.1| GRAS2 protein [Solanum lycopersicum]
 gb|ABD72959.1| GRAS2 [Solanum lycopersicum]
Length=583

 Score =   186 bits (472),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 134/387 (35%), Positives = 188/387 (49%), Gaps = 38/387 (10%)
 Frame = +3

Query  84    VDCAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE-------  239
             + CAR LA +  ++  K + + R +VS  GDP +R+  Y  E L  R   S         
Sbjct  218   IACARALAENNLDDFEKLIAKARSAVSITGDPIQRLGAYIVEGLVARKEASGTNIYRALR  277

Query  240   -KRPANFDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQG  413
              K PA +D       LSY   L + CPY KF ++ AN AI +A    ++IHIIDF I QG
Sbjct  278   CKEPAGWD------LLSYMHILYEICPYLKFGYMAANGAIADACRNENRIHIIDFQIAQG  331

Query  414   IQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE  593
              QW  LLQALA R  G P  +RI+GI  PV   +    L   G +L   ++  ++  EF 
Sbjct  332   TQWLTLLQALAARPSGAP-YVRITGIDDPVSKYARGDGLAVVGKKLAAISEKFNIPVEFH  390

Query  594   --PVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSI  758
               PV  P   +      V P E LAVNF L L++  DE+          L++  S +P +
Sbjct  391   AVPVFAP--EVTRDMLDVRPGEALAVNFPLTLHHTPDESVDVTNPRDELLRMVKSFSPKV  448

Query  759   VTLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM  938
             VTL E E + N   F  RF+ AL YYSA+FES+D  + RD  ER+ VE   L R I  ++
Sbjct  449   VTLVEQESNTNTAPFFPRFQEALDYYSAMFESIDVTLERDRKERINVEQHCLARDIVNVI  508

Query  939   RPE--EQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysss  1112
               E  E+  + E +           W++    AGF    +S Y +S  K L+  Y+   +
Sbjct  509   ACEGMERVERHELLGK---------WKLRFTMAGFHQYPLSSYVNSVIKSLMRCYSEHYT  559

Query  1113  ysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
                 D   G + L W    L++ S+WH
Sbjct  560   LVEKD---GAMLLGWKKRNLISASAWH  583



>ref|XP_011030905.1| PREDICTED: scarecrow-like protein 21 isoform X2 [Populus euphratica]
Length=551

 Score =   185 bits (470),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 183/381 (48%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPAN  254
             + CA+       N    LI + R  VS  G+P +R+  Y  E L  R  +S     R   
Sbjct  186   IACAKALAENKVNDFDKLIEKARSVVSISGEPIQRLGAYLVEGLVARKESSGTNIYRALR  245

Query  255   FDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                   +  LSY   L + CPY KF ++ AN AI EA +    IHI+DF I QG QW  L
Sbjct  246   CKEPEGKDLLSYMHTLYEICPYLKFGYMAANGAIAEACKNEDHIHIVDFHIAQGTQWMTL  305

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R GG P  +RI+GI  P+   +    L A   RL   ++  ++  EF   PV  
Sbjct  306   LQALAARPGGAP-HVRITGIDDPISKYARGDGLDAVARRLTAISEKFNIPIEFHGVPVFA  364

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +    F V P E LAVNF L+L++  DE+          L++  SLNP +VTL E 
Sbjct  365   P--DVTKEMFDVRPGEALAVNFPLELHHTPDESVDVNNPRDGLLRMIKSLNPKVVTLVEQ  422

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   FL RF   L YY A+FES+D  + R+  ER+ VE   L R I  ++  E  E
Sbjct  423   ESNTNTTPFLTRFVETLNYYLAMFESIDVRLPRNQKERISVEQHCLARDIVNVIACEGME  482

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+     AGF+   +S Y +S  + LL  Y+   +   ID 
Sbjct  483   REERHELFGK---------WKSRFMMAGFRQCPLSSYVNSVIRSLLRCYSEHYTLVEID-  532

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W D  L++ S+W+
Sbjct  533   --GAMLLGWKDRNLISASAWY  551



>gb|AHA85560.1| lateral [Dimocarpus longan]
Length=453

 Score =   183 bits (465),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 140/418 (33%), Positives = 204/418 (49%), Gaps = 64/418 (15%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRIRDSVSQ-LGDPTERVAYYFSEALYNRLSNSPEKRP----  248
             + CA L      +A   LI I  + S   GD TER+ + F  AL  RL+           
Sbjct  52    ISCAELVSQSDFSAADRLISILSANSSPYGDSTERLIHQFVRALSLRLNRHHHLHASATG  111

Query  249   -----------------------------ANFDASSE--ELTLSYKALNDACPYSKFAHL  335
                                          AN+  S++   L   Y +LN   P+ +F+HL
Sbjct  112   FMMNLITTNIATTSINTTSSSTTPSISASANYIISNDLSALQTCYLSLNQITPFIRFSHL  171

Query  336   TANQAILEATEKASK-IHIIDFGIVQGIQWAALLQALATRSGGK---PDSIRISGIPSPV  503
             TANQAILEA +   + IHI+DF I+ G+QW  L+QALA RS      P  +RI+G    +
Sbjct  172   TANQAILEAIQVGQQSIHILDFDIMHGVQWPPLMQALAERSNNTLHPPPMLRITGTGHDL  231

Query  504   LGNSPAASLLATGNRLRDFAKVLDLNFEFEPVL------GPIHSLNGSSFRVDPDEILAV  665
                     L  TG+RL  FA+ L L F+F P+L        +     S+  + PDE LAV
Sbjct  232   ------DILHRTGDRLFMFAQSLGLRFQFHPLLLLNDDPTSVAVYLSSALSLLPDEALAV  285

Query  666   NFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAI  845
             N +L L+ L+ E +  +   L    SLNP++VT+ E E + N   F++RF  AL +YSAI
Sbjct  286   NCVLYLHRLVKEDSRDLRLFLHKIKSLNPAVVTIAEREANHNHPVFMRRFVEALDHYSAI  345

Query  846   FESLDPNMTRDSPERVKVESLLLGRRIAELM--RPEEQRAKTECveveveveDKDHWRIL  1019
             +ESL+  +  +S ER+ VE +  GR I +++    E +R + E           + W ++
Sbjct  346   YESLEATLPPNSKERLAVEQIWFGREIMDIVGAEGENRRERHE---------RLESWEVM  396

Query  1020  MESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSWH  1193
             + S+GF  V +S +A SQAK+LL  +  S  Y +      F  L W +  L +VSSWH
Sbjct  397   LRSSGFANVPLSPFALSQAKLLLRLHYPSEGYQIQILNNSFF-LGWQNRALFSVSSWH  453



>ref|XP_001780523.1| predicted protein [Physcomitrella patens]
 gb|EDQ54617.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 122/384 (32%), Positives = 194/384 (51%), Gaps = 32/384 (8%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEKRPANFDAS  266
             CA  + + Q   A   L R+R      G+P  R+A YF+EAL+ RL+    ++ ++   S
Sbjct  8     CAEAVDMCQSATAGPMLARLRSIYDPEGEPMRRIALYFAEALFERLTIEMNRKQSSHHGS  67

Query  267   ---------------SEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFG  401
                            S E  ++Y+A     P+ KF HLTANQA+LE      ++HIIDF 
Sbjct  68    CVRFPEPEVDSAASPSLECDIAYQAYYQILPFKKFTHLTANQALLEGVANYPRVHIIDFN  127

Query  402   IVQGIQWAALLQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLN  581
             I QG+QW + +Q+LA    G P  ++ + +       + AA++  TGNRL +FA+ + + 
Sbjct  128   IRQGLQWPSFIQSLAMLPRGPPQ-LKFTAV------QTDAATVQKTGNRLAEFARTMHVP  180

Query  582   FEFEPVLGPIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIV  761
             FEF  +   + S +        +E LAVN    L+ LL +    +   L    SL P +V
Sbjct  181   FEFYILEESVESFHQGMISPRAEEALAVNCSDMLHRLLRK-EGKLTELLGKIRSLQPVVV  239

Query  762   TLGEYEMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMR  941
             T+ E + + N   F+ RF +AL YY A+F+SL+  + R+S +R+++E+     +I  ++ 
Sbjct  240   TVLEVDANHNEPSFMPRFVHALHYYCAVFDSLEAALLRNSLDRLRIENHCFSTQIRSIIA  299

Query  942   PEEQRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysL  1121
              E+   +             + W+     AGF+AV +S YA  QA++LL  Y  S     
Sbjct  300   LEDVDREIR-------HVRAETWQSHFLQAGFRAVTVSRYAADQAQLLLGLYKPSDRMPF  352

Query  1122  -IDSPPGFLSLAWNDEPLLTVSSW  1190
              + S  G LSL W + P++ VSSW
Sbjct  353   TLSSGFGGLSLGWRETPVVAVSSW  376



>ref|XP_011018909.1| PREDICTED: protein SCARECROW-like [Populus euphratica]
Length=845

 Score =   187 bits (476),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 133/372 (36%), Positives = 194/372 (52%), Gaps = 27/372 (7%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSP----EKRPANFDASSEELTL  284
             E A K L+ I +  +  G   +RVA YFSEA+  RL +S        P+   + ++++  
Sbjct  479   EEANKMLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYATLPSMPQSHTQKMAS  538

Query  285   SYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGK  464
             +++  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   LA+R GG 
Sbjct  539   AFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGP  598

Query  465   PDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVD  644
             P  +R++G     LG S  A L ATG RL DFA  L L FEF PV   + +LN     V 
Sbjct  599   P-YVRLTG-----LGTSTEA-LEATGKRLSDFANKLGLPFEFIPVAEKVGNLNPERLNVS  651

Query  645   PDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNA  824
               E +AV++   L + L + T +    L L   L P +VT+ E ++S +   FL RF  A
Sbjct  652   KSEAVAVHW---LQHSLYDVTGSDTNMLYLLQRLAPKVVTVVEQDLS-HAGSFLGRFVEA  707

Query  825   LKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKD  1004
             + YYSA+F+SL  +   +S ER  VE  LL R I  ++         +            
Sbjct  708   VHYYSALFDSLGASYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKF--------H  759

Query  1005  HWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVS  1184
             +WR  ++ +GFK ++++  A +QA +LL  +         D   G L L W D  LLT S
Sbjct  760   NWREKLQQSGFKCISLAGNAANQANLLLGMFPSDGYTLAEDK--GTLKLGWKDLCLLTAS  817

Query  1185  SWH*LNFNISIE  1220
             +W    F++SIE
Sbjct  818   AWR--PFHMSIE  827



>ref|XP_009766061.1| PREDICTED: scarecrow-like protein 1 [Nicotiana sylvestris]
 ref|XP_009766062.1| PREDICTED: scarecrow-like protein 1 [Nicotiana sylvestris]
 ref|XP_009766064.1| PREDICTED: scarecrow-like protein 1 [Nicotiana sylvestris]
 ref|XP_009766065.1| PREDICTED: scarecrow-like protein 1 [Nicotiana sylvestris]
 ref|XP_009766066.1| PREDICTED: scarecrow-like protein 1 [Nicotiana sylvestris]
Length=574

 Score =   185 bits (470),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 178/366 (49%), Gaps = 21/366 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLS  287
             E A   +  +R  VS  G+P ER A Y  EAL  R++ S +   K     +A   E   +
Sbjct  221   EQASSMINELRQMVSIQGEPLERTAAYMVEALAARMATSGKGLYKALKCKEALFSERLSA  280

Query  288   YKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKP  467
              + L + CPY +F  + AN AILEA +   ++HIIDF I QG Q+  LLQ LA+  G KP
Sbjct  281   MQVLFEVCPYFRFGFMAANGAILEAFKDEKRVHIIDFDINQGSQYYTLLQTLASMPG-KP  339

Query  468   DSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDP  647
               +R++G+  P         L   G RL + AK   + FEF+ V      +  +     P
Sbjct  340   PHLRLTGVDDPESVQRAIGGLNVIGLRLEELAKDFKIPFEFQAVASNTALVTPAMLNCHP  399

Query  648   DEILAVNFMLQLYNLLDETTATVGTA---LKLANSLNPSIVTLGEYEMSPNRVGFLKRFK  818
              E L VNF  QL+++ DE+ +TV      L++  SLNP +VT+ E +M+ N   FL+R  
Sbjct  400   GEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTTPFLQRVA  459

Query  819   NALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELM--RPEEQRAKTECvevevev  992
                 YYSA+FESLD  ++RDS ERV VE   L R I  ++    EE+  + E        
Sbjct  460   EVYNYYSAVFESLDATLSRDSQERVNVERQCLARDIINIVACEGEERIERYEVAGK----  515

Query  993   eDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPL  1172
                  WR  M  AGF    IS   +   K L+  Y+            G L   W D+ L
Sbjct  516   -----WRARMMMAGFTPSPISPNVYDSIKNLIKQYSERYKAK---EEAGALHFGWEDKSL  567

Query  1173  LTVSSW  1190
             +  S+W
Sbjct  568   IVASAW  573



>gb|ABD72963.1| GRAS7 [Solanum lycopersicum]
Length=366

 Score =   181 bits (458),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 172/357 (48%), Gaps = 21/357 (6%)
 Frame = +3

Query  144   IRDSVSQLGDPTERVAYYFSEALYNRLSNSPE---KRPANFDASSEELTLSYKALNDACP  314
             +R  VS  G P +R+  Y  E L  RL++S     K     + +S EL      L + CP
Sbjct  22    LRTVVSVCGSPIQRLGAYMLEGLVARLASSGSSIYKALRCKEPTSVELFSYMHLLYEICP  81

Query  315   YSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPDSIRISGIP  494
             Y KF +L+AN AI++A +  + IHIIDF I QG QW  L+ ALA R GG P  IRI+GI 
Sbjct  82    YFKFGYLSANGAIVDAMKDENSIHIIDFQIAQGSQWITLIHALAARPGGPP-RIRITGID  140

Query  495   SPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPDEILAVNFM  674
                   +    +   G RL   A   ++ FEF PV      +     +V P E LAVNF 
Sbjct  141   DSTSAYARGGGIEIVGRRLSSIAASCNVPFEFHPVSASCPDIEIEHLKVLPGEPLAVNFA  200

Query  675   LQLYNLLDETTATVG---TALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALKYYSAI  845
             L L+++ DE+  T       L++  SL+P IVTL E E + N   F  RF   L YY ++
Sbjct  201   LVLHHMPDESVGTQNHRDRLLRMVKSLSPKIVTLVEQESNTNTAQFFPRFLETLNYYLSV  260

Query  846   FESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--EQRAKTECveveveveDKDHWRIL  1019
             FES+D  + RD  ER+ VE   L R I  ++  E  E+  + E +         + WR  
Sbjct  261   FESIDVALPRDHKERINVEQHCLAREIVNILACEGAERVERHELL---------ERWRSR  311

Query  1020  MESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
                AGFK   +S   ++  K LL           ++   G L L W +  L+   +W
Sbjct  312   FAVAGFKPYPLSSSVNATIKTLL---ENYYQSYTLNERNGALYLGWMNRDLVASCAW  365



>ref|XP_011030903.1| PREDICTED: scarecrow-like protein 21 isoform X1 [Populus euphratica]
Length=577

 Score =   185 bits (470),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 183/381 (48%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLI-RIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPAN  254
             + CA+       N    LI + R  VS  G+P +R+  Y  E L  R  +S     R   
Sbjct  212   IACAKALAENKVNDFDKLIEKARSVVSISGEPIQRLGAYLVEGLVARKESSGTNIYRALR  271

Query  255   FDASSEELTLSY-KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
                   +  LSY   L + CPY KF ++ AN AI EA +    IHI+DF I QG QW  L
Sbjct  272   CKEPEGKDLLSYMHTLYEICPYLKFGYMAANGAIAEACKNEDHIHIVDFHIAQGTQWMTL  331

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R GG P  +RI+GI  P+   +    L A   RL   ++  ++  EF   PV  
Sbjct  332   LQALAARPGGAP-HVRITGIDDPISKYARGDGLDAVARRLTAISEKFNIPIEFHGVPVFA  390

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +    F V P E LAVNF L+L++  DE+          L++  SLNP +VTL E 
Sbjct  391   P--DVTKEMFDVRPGEALAVNFPLELHHTPDESVDVNNPRDGLLRMIKSLNPKVVTLVEQ  448

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   FL RF   L YY A+FES+D  + R+  ER+ VE   L R I  ++  E  E
Sbjct  449   ESNTNTTPFLTRFVETLNYYLAMFESIDVRLPRNQKERISVEQHCLARDIVNVIACEGME  508

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+     AGF+   +S Y +S  + LL  Y+   +   ID 
Sbjct  509   REERHELFGK---------WKSRFMMAGFRQCPLSSYVNSVIRSLLRCYSEHYTLVEID-  558

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W D  L++ S+W+
Sbjct  559   --GAMLLGWKDRNLISASAWY  577



>ref|XP_008804655.1| PREDICTED: protein SCARECROW 2-like [Phoenix dactylifera]
Length=700

 Score =   186 bits (473),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 129/360 (36%), Positives = 191/360 (53%), Gaps = 23/360 (6%)
 Frame = +3

Query  117   ENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPANFDASSEELTLSY  290
             ++A + L+ I +  +  G   +RVA YFSEA+  R+ +S      P +       L  ++
Sbjct  342   DDANRLLLEISELSTPFGTSAQRVAAYFSEAMSARIVSSCLGLYGPLSSVPHRARLASAF  401

Query  291   KALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQALATRSGGKPD  470
             +  N   P+ KF+H TANQAI EA E+  ++HIID  I+QG+QW  L   LA+R GG P 
Sbjct  402   QLFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPP-  460

Query  471   SIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSLNGSSFRVDPD  650
              +R++G     LG+S  A L ATG RL DFA+ L L+FEF PV   + +L+     V+  
Sbjct  461   RVRLTG-----LGSSMEA-LEATGKRLSDFAQTLGLHFEFCPVAEKVGNLDPDRLGVNRR  514

Query  651   EILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVGFLKRFKNALK  830
             E LAV++   L++ L + T +    L L   L P +VT+ E ++S     FL RF  A+ 
Sbjct  515   EALAVHW---LHHSLYDVTGSDTNTLWLLQRLAPKVVTIVEQDLS-QAGSFLGRFVEAIH  570

Query  831   YYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECveveveveDKDHW  1010
             YYSA+F+SL  +   DSPER  VE  LL R I  ++         E            +W
Sbjct  571   YYSALFDSLGASYGEDSPERHIVEQQLLSREIRNVLAVGGPARTGEVKF--------GNW  622

Query  1011  RILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWNDEPLLTVSSW  1190
             R  +  +GF+ ++++  A +QA +LL  +       + +S  G L L W D  LLT S+W
Sbjct  623   REKLSQSGFRGISLAGNAAAQATLLLGMFPSDGYTLIEES--GALKLGWKDICLLTASAW  680



>ref|XP_009401608.1| PREDICTED: protein SCARECROW 2-like [Musa acuminata subsp. malaccensis]
Length=802

 Score =   187 bits (475),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 136/376 (36%), Positives = 194/376 (52%), Gaps = 24/376 (6%)
 Frame = +3

Query  90    CAR-LAVSQPENAVKSLIRIRDSVSQLGDPTERVAYYFSEALYNRLSNSPEK--RPANFD  260
             CA  +A    E A + L+ I +  +  G   +RVA YFSEA+  RL +S      P    
Sbjct  435   CAEAVAADNLEEANRLLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGLYAPLPTV  494

Query  261   ASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAALLQA  440
                  L  +++  N   P+ KF+H TANQAI EA E+  ++HIIDF I+QG+QW  L   
Sbjct  495   PHRHRLASAFQVFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDFDIMQGLQWPGLFHI  554

Query  441   LATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFEPVLGPIHSL  620
             LA+R GG P  +R++G     LG+S  A L ATG RL DFA+ L L FEF PV   + +L
Sbjct  555   LASRPGGPP-RVRLTG-----LGSSMDA-LEATGKRLSDFAETLGLPFEFVPVAEKVGNL  607

Query  621   NGSSFRVDPDEILAVNFMLQLYNLLDETTATVGTALKLANSLNPSIVTLGEYEMSPNRVG  800
             +     V   E LAV++   L++ L + T +    L L   L P IVT+ E ++S     
Sbjct  608   DPERLGVSRREALAVHW---LHHSLYDVTGSDTNTLWLLQRLAPKIVTMVEQDLS-QAGS  663

Query  801   FLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPEEQRAKTECvev  980
             FL RF  A+ YYSA+F+SL  +   DS ER  VE  LL R I  ++         E    
Sbjct  664   FLARFVEAIHYYSALFDSLGASYGEDSQERHIVEQQLLSREIRNVLAVGGPARTGEVKF-  722

Query  981   eveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDSPPGFLSLAWN  1160
                     +WR  +  +GF+ V+++  A +QA +LL  +       + ++  G L L W 
Sbjct  723   -------SNWREKLSQSGFRGVSLAGNAAAQATLLLGMFPSDGYTLVEEN--GTLKLGWK  773

Query  1161  DEPLLTVSSWH*LNFN  1208
             D  LLT S+W  +N +
Sbjct  774   DLCLLTASAWRPINHH  789



>ref|XP_003596568.1| GRAS family transcription factor [Medicago truncatula]
 gb|AES66819.1| GRAS family transcription factor [Medicago truncatula]
Length=579

 Score =   185 bits (470),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 133/381 (35%), Positives = 180/381 (47%), Gaps = 26/381 (7%)
 Frame = +3

Query  84    VDCARLAVSQPENAVKSLIRI-RDSVSQLGDPTERVAYYFSEALYNRL---SNSPEKRPA  251
             + CA+            LI   R++VS  G+P +R+  Y  E L  R     NS      
Sbjct  214   IACAKAMAENNTELFDRLIETARNAVSINGEPIQRLGAYMVEGLVARTEASGNSIYHALK  273

Query  252   NFDASSEELTLSYKALNDACPYSKFAHLTANQAILEATEKASKIHIIDFGIVQGIQWAAL  431
               +   EEL    + L + CPY KF ++ AN AI EA      IHIIDF I QG QW  L
Sbjct  274   CREPEGEELLTYMQLLFEICPYLKFGYMAANGAIAEACRNEDHIHIIDFQIAQGTQWMTL  333

Query  432   LQALATRSGGKPDSIRISGIPSPVLGNSPAASLLATGNRLRDFAKVLDLNFEFE--PVLG  605
             LQALA R GG P  +RI+GI  PV   +    L   G RL   +K   +  EF   PV G
Sbjct  334   LQALAARPGGAPH-VRITGIDDPVSKYARGKGLEVVGERLSLMSKKFGIPVEFHGIPVFG  392

Query  606   PIHSLNGSSFRVDPDEILAVNFMLQLYNLLDETTATVG---TALKLANSLNPSIVTLGEY  776
             P   +      +   E LAVNF LQL++  DE+          L+L  SL+P +VTL E 
Sbjct  393   P--DVTRDMLDIRHGEALAVNFPLQLHHTADESVDVNNPRDGLLRLVKSLSPKVVTLVEQ  450

Query  777   EMSPNRVGFLKRFKNALKYYSAIFESLDPNMTRDSPERVKVESLLLGRRIAELMRPE--E  950
             E + N   F  RF   L YY AIFES+D  ++R+S ER+ VE   L R I  ++  E  E
Sbjct  451   ESNTNTTPFFNRFIETLDYYLAIFESIDVTLSRNSKERINVEQHCLARDIVNVIACEGKE  510

Query  951   QRAKTECveveveveDKDHWRILMESAGFKAVAISHYAHSQAKILLWnynysssysLIDS  1130
             +  + E             W+  +  AGF+   +S Y +S  + LL  Y+   +    D 
Sbjct  511   RVERHELFGK---------WKSRLTMAGFRQCPLSSYVNSVIRSLLRCYSEHYTLVEKD-  560

Query  1131  PPGFLSLAWNDEPLLTVSSWH  1193
               G + L W    L++ S+WH
Sbjct  561   --GAMLLGWKSRNLISASAWH  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4294633319592