BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8599_g2_i1 len=1474 path=[267:0-1473]

Length=1474
                                                                      Score     E

ref|XP_009614218.1|  PREDICTED: lysosomal beta glucosidase-like         691   0.0      
ref|XP_009804819.1|  PREDICTED: lysosomal beta glucosidase-like         689   0.0      
emb|CBI24413.3|  unnamed protein product                                683   0.0      
emb|CAN63654.1|  hypothetical protein VITISV_027177                     685   0.0      Vitis vinifera
ref|XP_010651644.1|  PREDICTED: lysosomal beta glucosidase-like         686   0.0      
ref|XP_006340437.1|  PREDICTED: lysosomal beta glucosidase-like         684   0.0      
ref|XP_002325849.2|  beta-D-glucan exohydrolase family protein          683   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006371173.1|  hypothetical protein POPTR_0019s05340g             682   0.0      
ref|XP_010313613.1|  PREDICTED: lysosomal beta glucosidase-like         681   0.0      
gb|ABK95015.1|  unknown                                                 681   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004236622.1|  PREDICTED: lysosomal beta glucosidase-like         681   0.0      
ref|XP_006350208.1|  PREDICTED: lysosomal beta glucosidase-like         679   0.0      
ref|XP_011094168.1|  PREDICTED: lysosomal beta glucosidase-like         678   0.0      
gb|EYU18175.1|  hypothetical protein MIMGU_mgv1a002782mg                678   0.0      
ref|XP_010279030.1|  PREDICTED: lysosomal beta glucosidase-like         677   0.0      
ref|XP_008240500.1|  PREDICTED: lysosomal beta glucosidase-like         677   0.0      
ref|XP_011021458.1|  PREDICTED: lysosomal beta glucosidase-like         677   0.0      
ref|XP_007204092.1|  hypothetical protein PRUPE_ppa002894mg             676   0.0      
ref|XP_009610986.1|  PREDICTED: lysosomal beta glucosidase-like         676   0.0      
ref|XP_004295138.1|  PREDICTED: lysosomal beta glucosidase-like         676   0.0      
ref|XP_006487803.1|  PREDICTED: lysosomal beta glucosidase-like i...    676   0.0      
gb|KDO54375.1|  hypothetical protein CISIN_1g006872mg                   676   0.0      
ref|XP_009757149.1|  PREDICTED: lysosomal beta glucosidase-like         675   0.0      
gb|EYU18174.1|  hypothetical protein MIMGU_mgv1a002879mg                674   0.0      
ref|XP_004489701.1|  PREDICTED: lysosomal beta glucosidase-like         674   0.0      
emb|CDP15627.1|  unnamed protein product                                674   0.0      
ref|XP_011089010.1|  PREDICTED: lysosomal beta glucosidase-like         672   0.0      
ref|XP_003601350.1|  Beta-D-glucosidase                                 672   0.0      
ref|XP_006424024.1|  hypothetical protein CICLE_v10028018mg             672   0.0      
ref|XP_008777969.1|  PREDICTED: lysosomal beta glucosidase-like i...    669   0.0      
ref|XP_010917875.1|  PREDICTED: lysosomal beta glucosidase-like i...    671   0.0      
ref|XP_002319151.2|  beta-D-glucan exohydrolase family protein          670   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010908055.1|  PREDICTED: lysosomal beta glucosidase-like i...    667   0.0      
ref|XP_010908054.1|  PREDICTED: lysosomal beta glucosidase-like i...    669   0.0      
gb|KEH25597.1|  beta-D-glucoside glucohydrolase                         669   0.0      
gb|KHN20835.1|  Lysosomal beta glucosidase                              669   0.0      
ref|XP_009619848.1|  PREDICTED: lysosomal beta glucosidase-like         669   0.0      
ref|XP_010908052.1|  PREDICTED: lysosomal beta glucosidase-like i...    670   0.0      
gb|KEH25593.1|  beta-D-glucoside glucohydrolase                         669   0.0      
ref|XP_008777968.1|  PREDICTED: lysosomal beta glucosidase-like i...    670   0.0      
ref|XP_008777967.1|  PREDICTED: lysosomal beta glucosidase-like i...    670   0.0      
ref|XP_004489688.1|  PREDICTED: lysosomal beta glucosidase-like         667   0.0      
gb|KHM99112.1|  Lysosomal beta glucosidase                              665   0.0      
ref|XP_006361124.1|  PREDICTED: lysosomal beta glucosidase-like         667   0.0      
ref|XP_009760946.1|  PREDICTED: lysosomal beta glucosidase-like         667   0.0      
gb|AEP33579.1|  b-1,4-glucanase                                         667   0.0      
ref|XP_003551104.1|  PREDICTED: lysosomal beta glucosidase-like         667   0.0      
ref|XP_008391778.1|  PREDICTED: lysosomal beta glucosidase-like         674   0.0      
gb|KDP39682.1|  hypothetical protein JCGZ_02702                         667   0.0      
gb|AEP33563.1|  b-1,4-glucanase                                         667   0.0      
gb|AEP33580.1|  b-1,4-glucanase                                         666   0.0      
emb|CBI22347.3|  unnamed protein product                                662   0.0      
ref|XP_003594509.1|  Beta-D-glucosidase                                 667   0.0      
ref|XP_011094175.1|  PREDICTED: lysosomal beta glucosidase-like         666   0.0      
gb|AEP33562.1|  b-1,4-glucanase                                         666   0.0      
gb|KDP34274.1|  hypothetical protein JCGZ_12843                         667   0.0      
gb|EPS66822.1|  hypothetical protein M569_07948                         664   0.0      
ref|XP_010054740.1|  PREDICTED: lysosomal beta glucosidase-like         665   0.0      
ref|XP_004489700.1|  PREDICTED: lysosomal beta glucosidase-like         665   0.0      
emb|CBI27259.3|  unnamed protein product                                662   0.0      
ref|XP_010266636.1|  PREDICTED: lysosomal beta glucosidase-like         666   0.0      
gb|KHG06451.1|  gluA                                                    664   0.0      
ref|XP_003545548.1|  PREDICTED: lysosomal beta glucosidase-like         664   0.0      
gb|AEP33561.1|  b-1,4-glucanase                                         664   0.0      
emb|CBI22348.3|  unnamed protein product                                661   0.0      
gb|AEP33567.1|  b-1,4-glucanase                                         664   0.0      
ref|XP_007147489.1|  hypothetical protein PHAVU_006G128800g             665   0.0      
gb|KHG06450.1|  gluA                                                    664   0.0      
gb|AEP33560.1|  b-1,4-glucanase                                         664   0.0      
ref|XP_002271545.1|  PREDICTED: lysosomal beta glucosidase              664   0.0      Vitis vinifera
ref|XP_010312450.1|  PREDICTED: lysosomal beta glucosidase-like i...    660   0.0      
ref|XP_002266589.1|  PREDICTED: lysosomal beta glucosidase-like         664   0.0      Vitis vinifera
ref|NP_001130296.1|  exoglucanase1 precursor                            663   0.0      Zea mays [maize]
gb|KHN22996.1|  Lysosomal beta glucosidase                              665   0.0      
gb|ADZ16108.1|  endo-alpha-1,4-glucanase                                662   0.0      
ref|XP_007015581.1|  Glycosyl hydrolase family protein                  662   0.0      
gb|EPS66823.1|  hypothetical protein M569_07949                         662   0.0      
ref|XP_004502135.1|  PREDICTED: lysosomal beta glucosidase-like         665   0.0      
ref|XP_002266675.1|  PREDICTED: lysosomal beta glucosidase-like         662   0.0      Vitis vinifera
gb|AEP33582.1|  b-1,4-glucanase                                         662   0.0      
ref|XP_003546253.1|  PREDICTED: lysosomal beta glucosidase-like i...    663   0.0      
ref|XP_003535075.1|  PREDICTED: lysosomal beta glucosidase-like i...    663   0.0      
gb|ADZ16110.1|  endo-alpha-1,4-glucanase                                662   0.0      
gb|AEP33577.1|  b-1,4-glucanase                                         662   0.0      
gb|AEP33565.1|  b-1,4-glucanase                                         662   0.0      
gb|AEP33574.1|  b-1,4-glucanase                                         661   0.0      
gb|KHN14336.1|  Lysosomal beta glucosidase                              664   0.0      
gb|AAF79936.1|  exoglucanase precursor                                  661   0.0      Zea mays [maize]
ref|XP_010653212.1|  PREDICTED: lysosomal beta glucosidase-like i...    661   0.0      
emb|CAA07070.1|  beta-D-glucosidase                                     662   0.0      Tropaeolum majus
ref|XP_010097917.1|  Periplasmic beta-glucosidase                       660   0.0      
emb|CDP15624.1|  unnamed protein product                                661   0.0      
ref|XP_004228467.1|  PREDICTED: lysosomal beta glucosidase-like i...    661   0.0      
gb|AAZ15705.1|  endo-alpha-1,4-glucanase                                661   0.0      Gossypium hirsutum [American cotton]
ref|XP_011094173.1|  PREDICTED: lysosomal beta glucosidase-like i...    658   0.0      
emb|CBI39076.3|  unnamed protein product                                661   0.0      
ref|XP_008664722.1|  PREDICTED: exoglucanase1 isoform X2                662   0.0      
ref|XP_004141128.1|  PREDICTED: lysosomal beta glucosidase-like         660   0.0      
ref|XP_007015579.1|  Glycosyl hydrolase family protein isoform 2        660   0.0      
ref|XP_006361125.1|  PREDICTED: lysosomal beta glucosidase-like         660   0.0      
emb|CDP15622.1|  unnamed protein product                                660   0.0      
ref|XP_006367581.1|  PREDICTED: lysosomal beta glucosidase-like         660   0.0      
ref|XP_007030059.1|  Glycosyl hydrolase family protein                  679   0.0      
ref|XP_002266470.2|  PREDICTED: lysosomal beta glucosidase-like i...    661   0.0      Vitis vinifera
ref|XP_008464959.1|  PREDICTED: lysosomal beta glucosidase-like         659   0.0      
gb|AEP33566.1|  b-1,4-glucanase                                         659   0.0      
gb|KEH25594.1|  beta-D-glucoside glucohydrolase                         659   0.0      
ref|XP_011094172.1|  PREDICTED: lysosomal beta glucosidase-like i...    658   0.0      
gb|AEP33568.1|  b-1,4-glucanase                                         658   0.0      
ref|XP_007145577.1|  hypothetical protein PHAVU_007G250300g             658   0.0      
ref|XP_009412936.1|  PREDICTED: lysosomal beta glucosidase-like         656   0.0      
ref|XP_008385601.1|  PREDICTED: lysosomal beta glucosidase-like         658   0.0      
ref|XP_003519468.1|  PREDICTED: lysosomal beta glucosidase-like i...    657   0.0      
ref|XP_009368634.1|  PREDICTED: lysosomal beta glucosidase-like         657   0.0      
ref|XP_007151483.1|  hypothetical protein PHAVU_004G050500g             657   0.0      
ref|XP_009417082.1|  PREDICTED: lysosomal beta glucosidase-like         658   0.0      
ref|XP_009342674.1|  PREDICTED: lysosomal beta glucosidase-like         656   0.0      
ref|XP_008443733.1|  PREDICTED: lysosomal beta glucosidase-like         655   0.0      
gb|KHG30203.1|  Lysosomal beta glucosidase                              655   0.0      
ref|XP_002311926.2|  beta-D-glucan exohydrolase family protein          655   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007141605.1|  hypothetical protein PHAVU_008G210100g             655   0.0      
ref|XP_011077752.1|  PREDICTED: lysosomal beta glucosidase-like         655   0.0      
ref|XP_011032946.1|  PREDICTED: lysosomal beta glucosidase-like         654   0.0      
ref|XP_010088030.1|  Lysosomal beta glucosidase                         654   0.0      
ref|XP_008230878.1|  PREDICTED: lysosomal beta glucosidase-like         654   0.0      
ref|XP_006379440.1|  hypothetical protein POPTR_0008s01410g             654   0.0      
ref|XP_004242118.1|  PREDICTED: lysosomal beta glucosidase-like         653   0.0      
gb|KDP39683.1|  hypothetical protein JCGZ_02703                         653   0.0      
ref|XP_009418960.1|  PREDICTED: lysosomal beta glucosidase-like         654   0.0      
gb|AAQ17461.1|  beta-D-glucosidase                                      653   0.0      Gossypium hirsutum [American cotton]
gb|KGN59736.1|  hypothetical protein Csa_3G842090                       653   0.0      
dbj|BAD13764.1|  exo-1,3-beta-glucanase                                 652   0.0      Lilium longiflorum [Easter lily]
ref|XP_003548716.1|  PREDICTED: lysosomal beta glucosidase-like i...    653   0.0      
ref|XP_004981774.1|  PREDICTED: lysosomal beta glucosidase-like i...    652   0.0      
ref|XP_010103976.1|  Lysosomal beta glucosidase                         653   0.0      
ref|XP_008375543.1|  PREDICTED: lysosomal beta glucosidase              652   0.0      
ref|XP_004981771.1|  PREDICTED: lysosomal beta glucosidase-like i...    651   0.0      
ref|XP_004981770.1|  PREDICTED: lysosomal beta glucosidase-like i...    652   0.0      
gb|EYU38727.1|  hypothetical protein MIMGU_mgv1a003439mg                649   0.0      
ref|XP_006598973.1|  PREDICTED: lysosomal beta glucosidase-like i...    652   0.0      
ref|NP_001051275.1|  Os03g0749300                                       650   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230855.1|  PREDICTED: lysosomal beta glucosidase-like         650   0.0      
ref|XP_008464960.1|  PREDICTED: lysosomal beta glucosidase-like         650   0.0      
gb|AFS50097.1|  beta-D-glucan exohydolase                               650   0.0      
gb|KHN46760.1|  Lysosomal beta glucosidase                              651   0.0      
ref|XP_010031608.1|  PREDICTED: lysosomal beta glucosidase-like         651   0.0      
ref|NP_001044387.1|  Os01g0771900                                       651   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006826367.1|  hypothetical protein AMTR_s00004p00129620          649   0.0      
ref|XP_008344965.1|  PREDICTED: lysosomal beta glucosidase-like         649   0.0      
ref|XP_004981768.1|  PREDICTED: lysosomal beta glucosidase-like i...    651   0.0      
ref|XP_004981769.1|  PREDICTED: lysosomal beta glucosidase-like i...    650   0.0      
ref|XP_009588263.1|  PREDICTED: lysosomal beta glucosidase-like         649   0.0      
emb|CDM84404.1|  unnamed protein product                                649   0.0      
ref|XP_011087395.1|  PREDICTED: lysosomal beta glucosidase-like         651   0.0      
ref|XP_010031611.1|  PREDICTED: lysosomal beta glucosidase-like         648   0.0      
gb|KHN34680.1|  Lysosomal beta glucosidase                              648   0.0      
gb|AAR14129.1|  exo-beta-glucanase                                      647   0.0      Lilium longiflorum [Easter lily]
gb|KHN38459.1|  Lysosomal beta glucosidase                              648   0.0      
ref|XP_010086714.1|  Lysosomal beta glucosidase                         647   0.0      
ref|XP_003569924.1|  PREDICTED: lysosomal beta glucosidase-like         649   0.0      
ref|XP_008355265.1|  PREDICTED: lysosomal beta glucosidase-like         647   0.0      
ref|XP_006604247.1|  PREDICTED: lysosomal beta glucosidase-like i...    647   0.0      
ref|XP_009400035.1|  PREDICTED: lysosomal beta glucosidase-like         647   0.0      
ref|XP_009394272.1|  PREDICTED: lysosomal beta glucosidase-like         647   0.0      
ref|XP_011101353.1|  PREDICTED: lysosomal beta glucosidase-like         647   0.0      
ref|XP_008245228.1|  PREDICTED: lysosomal beta glucosidase-like         647   0.0      
gb|KGN66708.1|  hypothetical protein Csa_1G661750                       646   0.0      
ref|XP_004230073.1|  PREDICTED: lysosomal beta glucosidase              647   0.0      
ref|XP_004171886.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    646   0.0      
ref|XP_004300933.1|  PREDICTED: lysosomal beta glucosidase-like         646   0.0      
ref|XP_006347720.1|  PREDICTED: lysosomal beta glucosidase-like i...    646   0.0      
ref|XP_007205098.1|  hypothetical protein PRUPE_ppa014607mg             645   0.0      
ref|XP_006479136.1|  PREDICTED: lysosomal beta glucosidase-like         646   0.0      
ref|XP_006443452.1|  hypothetical protein CICLE_v10019305mg             645   0.0      
ref|XP_006644778.1|  PREDICTED: lysosomal beta glucosidase-like         647   0.0      
gb|AIO11756.1|  beta-glucosidase                                        645   0.0      
ref|XP_003535890.1|  PREDICTED: lysosomal beta glucosidase              645   0.0      
gb|KHN45535.1|  Lysosomal beta glucosidase                              645   0.0      
ref|XP_007206306.1|  hypothetical protein PRUPE_ppa025914mg             646   0.0      
ref|XP_010088029.1|  Periplasmic beta-glucosidase                       646   0.0      
ref|XP_006388312.1|  hypothetical protein POPTR_0231s00220g             644   0.0      
ref|XP_002514453.1|  Periplasmic beta-glucosidase precursor, puta...    645   0.0      Ricinus communis
ref|XP_006445670.1|  hypothetical protein CICLE_v10014537mg             642   0.0      
ref|XP_009395659.1|  PREDICTED: lysosomal beta glucosidase-like         644   0.0      
ref|XP_006347719.1|  PREDICTED: lysosomal beta glucosidase-like i...    645   0.0      
ref|XP_004301060.1|  PREDICTED: lysosomal beta glucosidase-like         638   0.0      
ref|XP_006445671.1|  hypothetical protein CICLE_v10014537mg             644   0.0      
ref|XP_009799725.1|  PREDICTED: lysosomal beta glucosidase-like         644   0.0      
ref|XP_004135054.1|  PREDICTED: lysosomal beta glucosidase-like         644   0.0      
ref|XP_002278363.1|  PREDICTED: lysosomal beta glucosidase-like         642   0.0      Vitis vinifera
ref|XP_010553801.1|  PREDICTED: lysosomal beta glucosidase-like         643   0.0      
ref|XP_009595457.1|  PREDICTED: lysosomal beta glucosidase-like i...    642   0.0      
ref|XP_002456420.1|  hypothetical protein SORBIDRAFT_03g035970          644   0.0      Sorghum bicolor [broomcorn]
ref|XP_008446717.1|  PREDICTED: lysosomal beta glucosidase isofor...    643   0.0      
ref|XP_004970125.1|  PREDICTED: lysosomal beta glucosidase-like         643   0.0      
ref|XP_011004424.1|  PREDICTED: lysosomal beta glucosidase-like         641   0.0      
emb|CDP10537.1|  unnamed protein product                                636   0.0      
gb|KEH23536.1|  beta-D-glucoside glucohydrolase                         640   0.0      
ref|XP_009595456.1|  PREDICTED: lysosomal beta glucosidase-like i...    642   0.0      
ref|XP_008385616.1|  PREDICTED: lysosomal beta glucosidase-like         640   0.0      
gb|EYU38726.1|  hypothetical protein MIMGU_mgv1a002845mg                640   0.0      
gb|AAC49170.1|  beta-D-glucan exohydrolase, isoenzyme ExoII             640   0.0      Hordeum vulgare [barley]
gb|KCW50975.1|  hypothetical protein EUGRSUZ_J00604                     640   0.0      
ref|XP_010917869.1|  PREDICTED: lysosomal beta glucosidase-like i...    640   0.0      
ref|XP_003624652.1|  Periplasmic beta-glucosidase                       640   0.0      
gb|KHN46759.1|  Lysosomal beta glucosidase                              640   0.0      
gb|AAM13694.1|  beta-D-glucan exohydrolase                              639   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_002523937.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    639   0.0      Ricinus communis
gb|KHN34681.1|  Lysosomal beta glucosidase                              639   0.0      
ref|XP_010034246.1|  PREDICTED: lysosomal beta glucosidase-like         639   0.0      
gb|KHG09998.1|  Lysosomal beta glucosidase                              641   0.0      
ref|XP_007218946.1|  hypothetical protein PRUPE_ppa002559mg             640   0.0      
ref|XP_006604246.1|  PREDICTED: lysosomal beta glucosidase-like i...    639   0.0      
ref|XP_003548467.1|  PREDICTED: lysosomal beta glucosidase-like i...    639   0.0      
ref|XP_006651822.1|  PREDICTED: lysosomal beta glucosidase-like         639   0.0      
ref|XP_004493185.1|  PREDICTED: lysosomal beta glucosidase-like i...    635   0.0      
ref|XP_008446716.1|  PREDICTED: lysosomal beta glucosidase isofor...    644   0.0      
tpg|DAA51355.1|  TPA: hypothetical protein ZEAMMB73_928187              638   0.0      
ref|XP_002313632.1|  beta-D-glucan exohydrolase family protein          638   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU25636.1|  hypothetical protein MIMGU_mgv1a002814mg                638   0.0      
ref|XP_006487879.1|  PREDICTED: lysosomal beta glucosidase-like         638   0.0      
ref|XP_011100592.1|  PREDICTED: lysosomal beta glucosidase-like         638   0.0      
ref|XP_006379343.1|  hypothetical protein POPTR_0009s15590g             637   0.0      
gb|KDO54374.1|  hypothetical protein CISIN_1g038523mg                   637   0.0      
gb|EYU26866.1|  hypothetical protein MIMGU_mgv1a002476mg                639   0.0      
ref|XP_008648090.1|  PREDICTED: LOC541703 isoform X1                    637   0.0      
gb|KEH25595.1|  beta-D-glucoside glucohydrolase                         637   0.0      
emb|CDP06849.1|  unnamed protein product                                637   0.0      
ref|XP_004493183.1|  PREDICTED: lysosomal beta glucosidase-like i...    637   0.0      
ref|XP_006424026.1|  hypothetical protein CICLE_v10030270mg             637   0.0      
dbj|BAK05680.1|  predicted protein                                      637   0.0      
dbj|BAJ97948.1|  predicted protein                                      637   0.0      
ref|XP_010535771.1|  PREDICTED: lysosomal beta glucosidase-like         636   0.0      
gb|AAD23382.1|AF102868_1  beta-D-glucan exohydrolase isoenzyme ExoI     636   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_004493184.1|  PREDICTED: lysosomal beta glucosidase-like i...    636   0.0      
ref|XP_007010542.1|  Glycosyl hydrolase family protein isoform 1        637   0.0      
ref|XP_009609159.1|  PREDICTED: lysosomal beta glucosidase-like i...    637   0.0      
ref|XP_008648088.1|  PREDICTED: LOC541703 isoform X2                    637   0.0      
ref|NP_001051277.1|  Os03g0749500                                       635   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009609160.1|  PREDICTED: lysosomal beta glucosidase-like i...    637   0.0      
ref|XP_007010543.1|  Glycosyl hydrolase family protein isoform 2        637   0.0      
tpg|DAA51354.1|  TPA: exhydrolase II                                    637   0.0      
ref|XP_008644502.1|  PREDICTED: lysosomal beta glucosidase-like i...    635   0.0      
ref|XP_004159282.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    636   0.0      
gb|ADC55526.1|  beta-D-glucan glucohydrolase precursor                  634   0.0      
tpg|DAA51353.1|  TPA: exhydrolase II                                    637   0.0      
ref|XP_004493181.1|  PREDICTED: lysosomal beta glucosidase-like i...    635   0.0      
gb|KHG23007.1|  Lysosomal beta glucosidase                              655   0.0      
pdb|1EX1|A  Chain A, Beta-D-Glucan Exohydrolase From Barley             634   0.0      
ref|XP_004306422.1|  PREDICTED: lysosomal beta glucosidase-like         635   0.0      
ref|XP_008231858.1|  PREDICTED: lysosomal beta glucosidase isofor...    635   0.0      
ref|XP_011090231.1|  PREDICTED: lysosomal beta glucosidase-like         634   0.0      
ref|XP_007161966.1|  hypothetical protein PHAVU_001G112700g             634   0.0      
ref|XP_008644501.1|  PREDICTED: lysosomal beta glucosidase-like i...    635   0.0      
gb|KEH25596.1|  beta-D-glucoside glucohydrolase                         636   0.0      
ref|XP_009609161.1|  PREDICTED: lysosomal beta glucosidase-like i...    634   0.0      
ref|XP_009801866.1|  PREDICTED: lysosomal beta glucosidase-like i...    635   0.0      
ref|XP_009801863.1|  PREDICTED: lysosomal beta glucosidase-like i...    634   0.0      
ref|XP_010550691.1|  PREDICTED: lysosomal beta glucosidase-like         634   0.0      
pdb|1LQ2|A  Chain A, Crystal Structure Of Barley Beta-D-Glucan Gl...    632   0.0      
gb|AAL58976.1|AC091811_25  putative exohydrolase                        635   0.0      Oryza sativa [red rice]
ref|XP_002523935.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    633   0.0      Ricinus communis
ref|XP_008672746.1|  PREDICTED: uncharacterized protein LOC100280...    634   0.0      
dbj|BAJ96045.1|  predicted protein                                      634   0.0      
ref|XP_008231857.1|  PREDICTED: lysosomal beta glucosidase isofor...    635   0.0      
ref|XP_009412935.1|  PREDICTED: lysosomal beta glucosidase-like         632   0.0      
gb|EEE55456.1|  hypothetical protein OsJ_03617                          631   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008363217.1|  PREDICTED: lysosomal beta glucosidase-like         634   0.0      
ref|XP_007161964.1|  hypothetical protein PHAVU_001G112600g             630   0.0      
ref|XP_003519089.1|  PREDICTED: lysosomal beta glucosidase-like         630   0.0      
gb|KDP42928.1|  hypothetical protein JCGZ_23870                         628   0.0      
gb|ABK24242.1|  unknown                                                 630   0.0      Picea sitchensis
ref|XP_010229891.1|  PREDICTED: lysosomal beta glucosidase-like i...    630   0.0      
ref|XP_003559552.1|  PREDICTED: lysosomal beta glucosidase-like i...    630   0.0      
gb|KHN03708.1|  Lysosomal beta glucosidase                              630   0.0      
ref|XP_011089216.1|  PREDICTED: uncharacterized protein LOC105170243    653   0.0      
ref|NP_001104913.1|  LOC541703 precursor                                629   0.0      Zea mays [maize]
ref|XP_004952004.1|  PREDICTED: lysosomal beta glucosidase-like         628   0.0      
ref|XP_011089217.1|  PREDICTED: lysosomal beta glucosidase-like         629   0.0      
emb|CBI24995.3|  unnamed protein product                                628   0.0      
ref|XP_004296272.1|  PREDICTED: probable beta-glucosidase J-like        628   0.0      
ref|XP_009786310.1|  PREDICTED: lysosomal beta glucosidase-like         628   0.0      
ref|XP_010917928.1|  PREDICTED: uncharacterized protein LOC105042425    650   0.0      
ref|XP_010685489.1|  PREDICTED: lysosomal beta glucosidase-like         627   0.0      
ref|XP_010679654.1|  PREDICTED: lysosomal beta glucosidase-like         628   0.0      
dbj|BAK02950.1|  predicted protein                                      627   0.0      
ref|XP_011032947.1|  PREDICTED: lysosomal beta glucosidase              628   0.0      
ref|XP_011089012.1|  PREDICTED: lysosomal beta glucosidase-like         627   0.0      
ref|XP_010558244.1|  PREDICTED: lysosomal beta glucosidase              627   0.0      
ref|XP_002262992.1|  PREDICTED: lysosomal beta glucosidase              627   0.0      
ref|XP_008453517.1|  PREDICTED: lysosomal beta glucosidase-like         625   0.0      
gb|EPS69367.1|  hypothetical protein M569_05399                         623   0.0      
ref|XP_002525724.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    624   0.0      
ref|XP_004241371.1|  PREDICTED: lysosomal beta glucosidase-like         624   0.0      
ref|XP_010694376.1|  PREDICTED: lysosomal beta glucosidase              625   0.0      
ref|XP_010541670.1|  PREDICTED: lysosomal beta glucosidase-like         624   0.0      
gb|EMT13488.1|  Lysosomal beta glucosidase                              623   0.0      
ref|XP_009769527.1|  PREDICTED: lysosomal beta glucosidase-like         622   0.0      
ref|XP_008791319.1|  PREDICTED: uncharacterized protein LOC103708257    642   0.0      
ref|XP_009801845.1|  PREDICTED: lysosomal beta glucosidase-like         622   0.0      
ref|XP_004137360.1|  PREDICTED: lysosomal beta glucosidase-like         622   0.0      
ref|XP_003559563.1|  PREDICTED: lysosomal beta glucosidase-like         621   0.0      
ref|XP_010067089.1|  PREDICTED: lysosomal beta glucosidase              622   0.0      
gb|EEC71555.1|  hypothetical protein OsI_03907                          635   0.0      
ref|XP_010034247.1|  PREDICTED: lysosomal beta glucosidase-like         620   0.0      
ref|XP_009396473.1|  PREDICTED: lysosomal beta glucosidase-like         619   0.0      
ref|XP_004954723.1|  PREDICTED: lysosomal beta glucosidase-like         619   0.0      
ref|XP_009395658.1|  PREDICTED: lysosomal beta glucosidase-like         619   0.0      
ref|XP_006286473.1|  hypothetical protein CARUB_v10000466mg             618   0.0      
emb|CDY16581.1|  BnaC09g36920D                                          618   0.0      
ref|XP_010034245.1|  PREDICTED: lysosomal beta glucosidase-like         618   0.0      
ref|XP_010493212.1|  PREDICTED: lysosomal beta glucosidase-like         617   0.0      
ref|XP_010535769.1|  PREDICTED: lysosomal beta glucosidase-like         617   0.0      
gb|EMS53505.1|  Lysosomal beta glucosidase                              617   0.0      
ref|XP_010034248.1|  PREDICTED: lysosomal beta glucosidase-like         617   0.0      
ref|XP_010679080.1|  PREDICTED: lysosomal beta glucosidase-like         616   0.0      
ref|XP_010696623.1|  PREDICTED: lysosomal beta glucosidase-like         615   0.0      
ref|XP_010677827.1|  PREDICTED: lysosomal beta glucosidase-like         615   0.0      
ref|XP_004241372.1|  PREDICTED: lysosomal beta glucosidase-like         614   0.0      
ref|XP_009368627.1|  PREDICTED: lysosomal beta glucosidase-like         614   0.0      
ref|XP_002987109.1|  hypothetical protein SELMODRAFT_125622             613   0.0      
ref|XP_002985402.1|  hypothetical protein SELMODRAFT_157260             613   0.0      
dbj|BAA33065.1|  beta-D-glucan exohydrolase                             613   0.0      
ref|XP_007208190.1|  hypothetical protein PRUPE_ppa020836mg             614   0.0      
gb|AAS97960.1|  cell wall beta-glucosidase                              613   0.0      
ref|XP_003559555.1|  PREDICTED: lysosomal beta glucosidase-like         613   0.0      
ref|XP_004971583.1|  PREDICTED: lysosomal beta glucosidase-like         614   0.0      
ref|XP_010420941.1|  PREDICTED: lysosomal beta glucosidase-like         615   0.0      
gb|EPS57810.1|  hypothetical protein M569_17006                         611   0.0      
ref|XP_007208726.1|  hypothetical protein PRUPE_ppa015239mg             612   0.0      
ref|XP_009131828.1|  PREDICTED: lysosomal beta glucosidase              613   0.0      
ref|XP_006398941.1|  hypothetical protein EUTSA_v10012900mg             614   0.0      
ref|XP_006340297.1|  PREDICTED: lysosomal beta glucosidase-like         612   0.0      
gb|EMT23539.1|  Lysosomal beta glucosidase                              613   0.0      
gb|EMT27147.1|  Periplasmic beta-glucosidase                            612   0.0      
ref|XP_008245226.1|  PREDICTED: lysosomal beta glucosidase-like         611   0.0      
ref|XP_002874024.1|  glycosyl hydrolase family 3 protein                611   0.0      
gb|KCW50974.1|  hypothetical protein EUGRSUZ_J00603                     610   0.0      
dbj|BAC42711.1|  unknown protein                                        609   0.0      
ref|XP_006400664.1|  hypothetical protein EUTSA_v10012963mg             611   0.0      
gb|EPS64616.1|  hypothetical protein M569_10162                         608   0.0      
ref|XP_010452390.1|  PREDICTED: lysosomal beta glucosidase-like         610   0.0      
ref|XP_009620993.1|  PREDICTED: lysosomal beta glucosidase-like         608   0.0      
ref|XP_006361126.1|  PREDICTED: lysosomal beta glucosidase-like i...    608   0.0      
emb|CDX92422.1|  BnaA10g14610D                                          607   0.0      
ref|XP_007207411.1|  hypothetical protein PRUPE_ppa014605mg             608   0.0      
ref|XP_004954724.1|  PREDICTED: lysosomal beta glucosidase-like         609   0.0      
ref|XP_002874025.1|  glycosyl hydrolase family 3 protein                608   0.0      
ref|XP_006826369.1|  hypothetical protein AMTR_s00004p00131000          608   0.0      
ref|XP_008679990.1|  PREDICTED: lysosomal beta glucosidase-like i...    609   0.0      
ref|XP_004952003.1|  PREDICTED: lysosomal beta glucosidase-like         608   0.0      
ref|XP_010491016.1|  PREDICTED: lysosomal beta glucosidase-like         608   0.0      
ref|XP_006287219.1|  hypothetical protein CARUB_v10000396mg             607   0.0      
ref|XP_010423523.1|  PREDICTED: lysosomal beta glucosidase-like i...    607   0.0      
ref|NP_680141.2|  Glycosyl hydrolase family protein                     607   0.0      
ref|XP_010313473.1|  PREDICTED: lysosomal beta glucosidase isofor...    606   0.0      
ref|XP_010423524.1|  PREDICTED: lysosomal beta glucosidase-like i...    606   0.0      
emb|CDX80926.1|  BnaC03g01800D                                          607   0.0      
ref|XP_009120747.1|  PREDICTED: lysosomal beta glucosidase-like         605   0.0      
ref|XP_002960733.1|  hypothetical protein SELMODRAFT_74114              605   0.0      
ref|XP_010423522.1|  PREDICTED: lysosomal beta glucosidase-like i...    607   0.0      
ref|XP_010313472.1|  PREDICTED: lysosomal beta glucosidase isofor...    606   0.0      
ref|XP_004251206.1|  PREDICTED: lysosomal beta glucosidase isofor...    606   0.0      
emb|CDY11314.1|  BnaA03g01500D                                          606   0.0      
ref|XP_007202161.1|  hypothetical protein PRUPE_ppa006354mg             596   0.0      
gb|EPS62891.1|  hypothetical protein M569_11897                         604   0.0      
ref|XP_002983938.1|  hypothetical protein SELMODRAFT_119324             603   0.0      
ref|XP_002871119.1|  glycosyl hydrolase family 3 protein                605   0.0      
ref|XP_006485566.1|  PREDICTED: lysosomal beta glucosidase-like         603   0.0      
emb|CDX70953.1|  BnaC03g10370D                                          604   0.0      
ref|XP_009130844.1|  PREDICTED: lysosomal beta glucosidase-like         604   0.0      
emb|CDX98794.1|  BnaC09g50410D                                          605   0.0      
ref|XP_007015578.1|  Glycosyl hydrolase family protein isoform 1        600   0.0      
emb|CDY09090.1|  BnaA02g05160D                                          601   0.0      
ref|XP_006445675.1|  hypothetical protein CICLE_v10017853mg             601   0.0      
ref|NP_197595.2|  glycosyl hydrolase family protein                     600   0.0      
ref|XP_009126493.1|  PREDICTED: lysosomal beta glucosidase-like         600   0.0      
ref|XP_010420942.1|  PREDICTED: lysosomal beta glucosidase-like         599   0.0      
ref|XP_002451476.1|  hypothetical protein SORBIDRAFT_04g002570          600   0.0      
ref|XP_008385600.1|  PREDICTED: lysosomal beta glucosidase-like         600   0.0      
ref|NP_197594.2|  glycosyl hydrolase family protein                     598   0.0      
emb|CDX70189.1|  BnaA10g25380D                                          602   0.0      
ref|XP_006289165.1|  hypothetical protein CARUB_v10002603mg             596   0.0      
ref|XP_006575592.1|  PREDICTED: lysosomal beta glucosidase-like i...    593   0.0      
gb|AFW66696.1|  hypothetical protein ZEAMMB73_778261                    595   0.0      
ref|XP_008679988.1|  PREDICTED: lysosomal beta glucosidase-like i...    595   0.0      
ref|XP_009368884.1|  PREDICTED: lysosomal beta glucosidase-like         594   0.0      
ref|NP_001045791.2|  Os02g0131400                                       592   0.0      
ref|XP_010456613.1|  PREDICTED: lysosomal beta glucosidase-like         594   0.0      
ref|XP_002453253.1|  hypothetical protein SORBIDRAFT_04g002560          593   0.0      
emb|CDP10535.1|  unnamed protein product                                585   0.0      
dbj|BAD07748.1|  putative beta-D-glucan exohydrolase                    592   0.0      
gb|EAY91867.1|  hypothetical protein OsI_13514                          589   0.0      
ref|NP_001051274.1|  Os03g0749100                                       589   0.0      
gb|EMT13489.1|  Lysosomal beta glucosidase                              589   0.0      
ref|XP_006650588.1|  PREDICTED: lysosomal beta glucosidase-like         588   0.0      
gb|EMS50680.1|  Periplasmic beta-glucosidase                            592   0.0      
emb|CDX88832.1|  BnaA03g08170D                                          583   0.0      
tpg|DAA57426.1|  TPA: hypothetical protein ZEAMMB73_853432              581   0.0      
ref|XP_001761531.1|  predicted protein                                  581   0.0      
ref|XP_002466456.1|  hypothetical protein SORBIDRAFT_01g008050          578   0.0      
gb|KFK26305.1|  hypothetical protein AALP_AA8G230300                    573   0.0      
ref|XP_004981777.1|  PREDICTED: lysosomal beta glucosidase-like         577   0.0      
ref|XP_001786487.1|  predicted protein                                  576   0.0      
ref|XP_003559419.1|  PREDICTED: lysosomal beta glucosidase-like         574   0.0      
ref|NP_001105671.1|  beta-glucanase precursor                           571   0.0      
ref|XP_010525248.1|  PREDICTED: lysosomal beta glucosidase-like         571   0.0      
ref|XP_008230844.1|  PREDICTED: uncharacterized protein LOC103330075    589   0.0      
ref|XP_010545174.1|  PREDICTED: lysosomal beta glucosidase              570   0.0      
emb|CAN80947.1|  hypothetical protein VITISV_023986                     566   0.0      
gb|EMT00661.1|  Lysosomal beta glucosidase                              567   0.0      
ref|XP_001777176.1|  predicted protein                                  566   0.0      
ref|XP_007010544.1|  Glycosyl hydrolase family protein isoform 3        560   0.0      
ref|XP_006402350.1|  hypothetical protein EUTSA_v10005832mg             563   0.0      
ref|XP_003638320.1|  Beta-D-glucosidase                                 554   0.0      
emb|CDY68165.1|  BnaUnng02770D                                          555   0.0      
emb|CDY25116.1|  BnaC06g18580D                                          561   0.0      
ref|XP_008347332.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    559   0.0      
ref|XP_010917874.1|  PREDICTED: lysosomal beta glucosidase-like i...    559   0.0      
emb|CDX67902.1|  BnaA07g19420D                                          560   0.0      
ref|XP_009105551.1|  PREDICTED: lysosomal beta glucosidase-like         559   0.0      
ref|XP_009609162.1|  PREDICTED: lysosomal beta glucosidase-like i...    556   0.0      
ref|XP_009138723.1|  PREDICTED: lysosomal beta glucosidase              558   0.0      
emb|CDX89145.1|  BnaA04g00410D                                          558   0.0      
ref|XP_004172339.1|  PREDICTED: lysosomal beta glucosidase-like         546   0.0      
gb|KFK35444.1|  hypothetical protein AALP_AA5G285000                    552   0.0      
gb|AFW67621.1|  hypothetical protein ZEAMMB73_646186                    551   0.0      
ref|XP_006292741.1|  hypothetical protein CARUB_v10018993mg             548   0.0      
gb|ACR36695.1|  unknown                                                 537   0.0      
ref|XP_010473764.1|  PREDICTED: lysosomal beta glucosidase-like         546   0.0      
ref|XP_008366240.1|  PREDICTED: lysosomal beta glucosidase-like i...    545   0.0      
ref|NP_191830.1|  glycosyl hydrolase family protein                     546   0.0      
gb|KDP46532.1|  hypothetical protein JCGZ_08504                         545   0.0      
ref|XP_008354865.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    543   0.0      
ref|XP_010512667.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    545   0.0      
ref|XP_004294237.1|  PREDICTED: lysosomal beta glucosidase-like         544   0.0      
emb|CBI24414.3|  unnamed protein product                                534   0.0      
ref|XP_002878473.1|  glycosyl hydrolase family 3 protein                545   0.0      
ref|XP_007207129.1|  hypothetical protein PRUPE_ppa003012mg             543   0.0      
gb|EMS45826.1|  Periplasmic beta-glucosidase                            539   0.0      
ref|XP_008220446.1|  PREDICTED: lysosomal beta glucosidase-like         542   0.0      
gb|KFK26306.1|  hypothetical protein AALP_AA8G230300                    535   0.0      
gb|EEE56242.1|  hypothetical protein OsJ_05253                          543   0.0      
ref|XP_009346879.1|  PREDICTED: lysosomal beta glucosidase-like i...    542   0.0      
ref|XP_009346882.1|  PREDICTED: lysosomal beta glucosidase-like         541   0.0      
ref|XP_004141202.1|  PREDICTED: lysosomal beta glucosidase-like         539   0.0      
ref|XP_008457395.1|  PREDICTED: lysosomal beta glucosidase-like i...    536   0.0      
ref|XP_009337307.1|  PREDICTED: lysosomal beta glucosidase-like         541   0.0      
ref|XP_004296697.1|  PREDICTED: periplasmic beta-glucosidase-like       540   0.0      
ref|XP_006848113.1|  hypothetical protein AMTR_s00029p00216320          540   0.0      
emb|CBI16000.3|  unnamed protein product                                539   0.0      
ref|XP_006425018.1|  hypothetical protein CICLE_v10028048mg             539   0.0      
ref|XP_010650935.1|  PREDICTED: lysosomal beta glucosidase-like         538   0.0      
ref|XP_008457393.1|  PREDICTED: lysosomal beta glucosidase-like i...    537   0.0      
emb|CAN81230.1|  hypothetical protein VITISV_033665                     537   0.0      
gb|EEC79317.1|  hypothetical protein OsI_20160                          536   0.0      
dbj|BAJ90161.1|  predicted protein                                      536   0.0      
ref|XP_010043470.1|  PREDICTED: lysosomal beta glucosidase-like         535   0.0      
ref|XP_010256652.1|  PREDICTED: lysosomal beta glucosidase-like i...    534   0.0      
ref|XP_004150625.1|  PREDICTED: lysosomal beta glucosidase-like         535   0.0      
gb|EEE63918.1|  hypothetical protein OsJ_18743                          535   0.0      
ref|XP_010256651.1|  PREDICTED: lysosomal beta glucosidase-like i...    535   0.0      
ref|XP_010256654.1|  PREDICTED: lysosomal beta glucosidase-like i...    535   0.0      
gb|KGN65790.1|  hypothetical protein Csa_1G528550                       534   0.0      
ref|XP_004169524.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    533   0.0      
ref|XP_010686158.1|  PREDICTED: lysosomal beta glucosidase-like         545   0.0      
ref|XP_010923122.1|  PREDICTED: lysosomal beta glucosidase-like         533   0.0      
ref|XP_007016176.1|  Glycosyl hydrolase family protein isoform 2        530   1e-180   
ref|XP_010253611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    563   2e-180   
ref|XP_008457394.1|  PREDICTED: lysosomal beta glucosidase-like i...    531   4e-180   
ref|XP_010043457.1|  PREDICTED: lysosomal beta glucosidase-like         531   4e-180   
ref|XP_007016175.1|  Glycosyl hydrolase family protein isoform 1        530   1e-179   
ref|XP_003568338.1|  PREDICTED: lysosomal beta glucosidase-like         530   1e-179   
ref|XP_011080690.1|  PREDICTED: lysosomal beta glucosidase-like         529   1e-179   
ref|XP_001781708.1|  predicted protein                                  530   1e-179   
ref|XP_007016181.1|  Glycosyl hydrolase family protein                  528   3e-179   
gb|EMS53026.1|  Lysosomal beta glucosidase                              529   4e-179   
ref|XP_006382849.1|  hypothetical protein POPTR_0005s06070g             520   6e-179   
ref|NP_190284.1|  glycosyl hydrolase family protein                     528   9e-179   
gb|EMS50990.1|  Lysosomal beta glucosidase                              524   1e-178   
ref|XP_002525596.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    526   2e-178   
ref|XP_002313393.1|  glycosyl hydrolase family 3 family protein         526   3e-178   
ref|XP_007220051.1|  hypothetical protein PRUPE_ppa026252mg             526   3e-178   
ref|XP_011032150.1|  PREDICTED: lysosomal beta glucosidase-like         526   4e-178   
ref|XP_007016177.1|  Glycosyl hydrolase family protein isoform 3        525   7e-178   
ref|XP_004961906.1|  PREDICTED: lysosomal beta glucosidase-like i...    525   8e-178   
gb|KDO52251.1|  hypothetical protein CISIN_1g036635mg                   523   1e-177   
ref|XP_004961905.1|  PREDICTED: lysosomal beta glucosidase-like i...    526   1e-177   
ref|XP_008649670.1|  PREDICTED: lysosomal beta glucosidase-like         525   1e-177   
ref|XP_009404581.1|  PREDICTED: lysosomal beta glucosidase-like         525   1e-177   
ref|NP_001145784.1|  hypothetical protein                               525   1e-177   
gb|EYU45973.1|  hypothetical protein MIMGU_mgv1a003210mg                523   5e-177   
ref|XP_002877536.1|  glycosyl hydrolase family 3 protein                522   2e-176   
ref|XP_004169235.1|  PREDICTED: periplasmic beta-glucosidase-like       516   3e-176   
ref|XP_004241177.1|  PREDICTED: lysosomal beta glucosidase-like         520   4e-176   
ref|XP_006290760.1|  hypothetical protein CARUB_v10016864mg             520   7e-176   
ref|XP_006350824.1|  PREDICTED: lysosomal beta glucosidase-like         520   9e-176   
ref|XP_006404424.1|  hypothetical protein EUTSA_v10010212mg             516   2e-175   
ref|XP_006655369.1|  PREDICTED: lysosomal beta glucosidase-like         520   4e-175   
ref|XP_008785418.1|  PREDICTED: lysosomal beta glucosidase-like         518   5e-175   



>ref|XP_009614218.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=639

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/453 (73%), Positives = 379/453 (84%), Gaps = 3/453 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIVK MTEIIPGLQGD P     G+PYV GK KVAACAKH+V D
Sbjct  181   RDPRWGRCYESYSEDPEIVKQMTEIIPGLQGDHPPR-KAGIPYVAGKEKVAACAKHFVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVTDWH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHA+ +L+T+F
Sbjct  240   GGTTKGINENNTVTDWHTLLSIHMPGYYQSIIKGVSTVMVSYSSWNGVKMHAHHNLVTNF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GID+IT    +NYT+SVL  + AGIDM+MVP N++ FI    SL
Sbjct  300   LKDTLKFRGFVISDWQGIDKITSPPHANYTHSVLTGVQAGIDMIMVPLNHTEFIDILTSL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N FIPMSRIDDAV RILRVKFTMGLFENP ADY L  +LG QAHRDLAREAVRKSLVL
Sbjct  360   VNNNFIPMSRIDDAVRRILRVKFTMGLFENPLADYRLVKHLGSQAHRDLAREAVRKSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +  +P+LPLPK A+RILVAG+HANNLGYQCGGWTITW+G+ G  +T GTTIL  I
Sbjct  420   LKNGANADEPVLPLPKKATRILVAGSHANNLGYQCGGWTITWQGVEGNNVTLGTTILDAI  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP+T++VY+E+   EFM+SN F+YAIVVVGE PY+E  GD LNLTIP  G+ T+ N
Sbjct  480   TATVDPSTEVVYSENPTTEFMESNKFSYAIVVVGELPYAETAGDSLNLTIPEQGITTMNN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVVL+SGRPLV++PHL ++D+LVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  540   VCGS-IKCVVVLISGRPLVVQPHLSNIDSLVAAWLPGTEGQGVADVLFGDYEFTGKLSRT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTV+QLPMNVGD HYDPLFPFGFGLTT  ++
Sbjct  599   WFKTVNQLPMNVGDSHYDPLFPFGFGLTTTATK  631



>ref|XP_009804819.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009804820.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=634

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/449 (74%), Positives = 379/449 (84%), Gaps = 3/449 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIVK MTEIIPGLQGD P   + G+PYV GK KVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDPEIVKQMTEIIPGLQGDHPPRKA-GIPYVAGKEKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVTDWH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHA+ +L+T+F
Sbjct  237   GGTTKGINENNTVTDWHTLLSIHMPGYYQSIIKGVSTVMVSYSSWNGVKMHAHHNLVTNF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYT+SVL  + AGIDM+MVP N++ FI    SL
Sbjct  297   LKDTLKFRGFVISDWQGIDRITSPPHANYTHSVLTGVQAGIDMIMVPLNHTEFIDILTSL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N +IPMSRIDDAV RILRVKFTMGLFENP ADY L  +LG QAHRDLAREAVRKSLVL
Sbjct  357   VNNNYIPMSRIDDAVRRILRVKFTMGLFENPLADYRLVKHLGSQAHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +  +P+LPLPK A+RILVAG+HANNLGYQCGGWTITW+G+ G  +T GTTI+  I
Sbjct  417   LKNGANADEPVLPLPKKATRILVAGSHANNLGYQCGGWTITWQGVEGNNVTLGTTIVDAI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP+T++VY+E+   E+M+SN F+YAIVVVGE PY+E  GD+LNLTIP  G+ T+ N
Sbjct  477   TATVDPSTEVVYSENPTTEYMESNKFSYAIVVVGELPYAETAGDNLNLTIPEQGITTMNN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVVL+SGRPLV++PHL ++DALVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  537   VCGS-IKCVVVLISGRPLVVQPHLSNIDALVAAWLPGTEGQGVADVLFGDYEFTGKLSRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  596   WFKTVDQLPMNVGDSHYDPLFPFGFGLTT  624



>emb|CBI24413.3| unnamed protein product [Vitis vinifera]
Length=532

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/450 (73%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIV++MTEIIPGLQGD+P N  +G+PYVGGK KVAACAKH+V D
Sbjct  80    RDPRWGRCYESYSEDPEIVRAMTEIIPGLQGDIPANSRKGIPYVGGKDKVAACAKHFVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ DWHGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHA+  L+T+F
Sbjct  140   GGTISGINENNTIIDWHGLLSIHMPAYYDSIIKGVATVMVSYSSWNGKKMHAHNQLITEF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GID+IT    +NYTYSV  +INAGIDMVM P N+S FI     L
Sbjct  200   LKNTLKFRGFVISDWQGIDKITSPPGANYTYSVEAAINAGIDMVMTPFNHSEFIGDLTDL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK     MSRIDDAV RILRVKFTMGLFENP AD S   +LG QAHRDLAREAVRKSLVL
Sbjct  260   VKKNVTSMSRIDDAVARILRVKFTMGLFENPLADLSFVSHLGSQAHRDLAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   PLLPLPK A++ILVAGTHANNLGYQCGGWTI+W+GL G  +T GTTILSGI
Sbjct  320   LKNGENADPPLLPLPKKANKILVAGTHANNLGYQCGGWTISWQGLEGNNLTTGTTILSGI  379

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + A+DP+TQ+VY+E+ + E +KS +F+YAIVVVGEKPY+E FGD+LNLTIP  G  TI N
Sbjct  380   SAAIDPSTQVVYSENPDVELVKSGNFSYAIVVVGEKPYAETFGDNLNLTIPEPGPSTITN  439

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVVL+SGRPL+++P+LP +DALVAAWLPGSEGQGVADVLFGDY FTGKL+ T
Sbjct  440   VCTS-IKCVVVLISGRPLLIQPYLPLIDALVAAWLPGSEGQGVADVLFGDYEFTGKLAHT  498

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+ LPMN GD HYDPLFP GFGLTTK
Sbjct  499   WFKTVEHLPMNFGDPHYDPLFPLGFGLTTK  528



>emb|CAN63654.1| hypothetical protein VITISV_027177 [Vitis vinifera]
Length=607

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/450 (73%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIV++MTEIIPGLQGD+P N  +G+PYVGGK KVAACAKH+V D
Sbjct  155   RDPRWGRCYESYSEDPEIVRAMTEIIPGLQGDIPANSRKGIPYVGGKDKVAACAKHFVGD  214

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ DWHGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHA+  L+T+F
Sbjct  215   GGTISGINENNTIIDWHGLLSIHMPAYYDSIIKGVATVMVSYSSWNGKKMHAHNQLITEF  274

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GID+IT    +NYTYSV  +INAGIDMVM P N+S FI     L
Sbjct  275   LKNTLKFRGFVISDWQGIDKITSPPGANYTYSVEAAINAGIDMVMTPFNHSEFIGDLTDL  334

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK     MSRIDDAV RILRVKFTMGLFENP AD S   +LG QAHRDLAREAVRKSLVL
Sbjct  335   VKKNVTSMSRIDDAVARILRVKFTMGLFENPLADLSFVSHLGSQAHRDLAREAVRKSLVL  394

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   PLLPLPK A++ILVAGTHANNLGYQCGGWTI+W+GL G  +T GTTILSGI
Sbjct  395   LKNGENADPPLLPLPKKANKILVAGTHANNLGYQCGGWTISWQGLEGNNLTTGTTILSGI  454

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + A+DP+TQ+VY+E+ + E +KS +F+YAIVVVGEKPY+E FGD+LNLTIP  G  TI N
Sbjct  455   SAAIDPSTQVVYSENPDVELVKSGNFSYAIVVVGEKPYAETFGDNLNLTIPEPGPSTITN  514

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVVL+SGRPL+++P+LP +DALVAAWLPGSEGQGVADVLFGDY FTGKL+ T
Sbjct  515   VCTS-IKCVVVLISGRPLLIQPYLPLIDALVAAWLPGSEGQGVADVLFGDYEFTGKLAHT  573

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+ LPMN GD HYDPLFP GFGLTTK
Sbjct  574   WFKTVEHLPMNFGDPHYDPLFPLGFGLTTK  603



>ref|XP_010651644.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=626

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/450 (73%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIV++MTEIIPGLQGD+P N  +G+PYVGGK KVAACAKH+V D
Sbjct  174   RDPRWGRCYESYSEDPEIVRAMTEIIPGLQGDIPANSRKGIPYVGGKDKVAACAKHFVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ DWHGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHA+  L+T+F
Sbjct  234   GGTISGINENNTIIDWHGLLSIHMPAYYDSIIKGVATVMVSYSSWNGKKMHAHNQLITEF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GID+IT    +NYTYSV  +INAGIDMVM P N+S FI     L
Sbjct  294   LKNTLKFRGFVISDWQGIDKITSPPGANYTYSVEAAINAGIDMVMTPFNHSEFIGDLTDL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK     MSRIDDAV RILRVKFTMGLFENP AD S   +LG QAHRDLAREAVRKSLVL
Sbjct  354   VKKNVTSMSRIDDAVARILRVKFTMGLFENPLADLSFVSHLGSQAHRDLAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   PLLPLPK A++ILVAGTHANNLGYQCGGWTI+W+GL G  +T GTTILSGI
Sbjct  414   LKNGENADPPLLPLPKKANKILVAGTHANNLGYQCGGWTISWQGLEGNNLTTGTTILSGI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + A+DP+TQ+VY+E+ + E +KS +F+YAIVVVGEKPY+E FGD+LNLTIP  G  TI N
Sbjct  474   SAAIDPSTQVVYSENPDVELVKSGNFSYAIVVVGEKPYAETFGDNLNLTIPEPGPSTITN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVVL+SGRPL+++P+LP +DALVAAWLPGSEGQGVADVLFGDY FTGKL+ T
Sbjct  534   VCTS-IKCVVVLISGRPLLIQPYLPLIDALVAAWLPGSEGQGVADVLFGDYEFTGKLAHT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+ LPMN GD HYDPLFP GFGLTTK
Sbjct  593   WFKTVEHLPMNFGDPHYDPLFPLGFGLTTK  622



>ref|XP_006340437.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=635

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/449 (73%), Positives = 375/449 (84%), Gaps = 3/449 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEIIPGLQGD+P N   G+PYVGGK KV ACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDPQIVKQMTEIIPGLQGDLPTNIV-GIPYVGGKEKVVACAKHFVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTV DWH L+SIHMP Y  SIIKGVST+M SYSS+NGVKMHAN  L+T+F
Sbjct  238   GGTIKGINENNTVADWHTLLSIHMPAYYHSIIKGVSTIMVSYSSLNGVKMHANHDLVTNF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L FRGFVISDW GIDRIT    SNYT+SVL  + AGIDM+MVP NY+ FI T  SL
Sbjct  298   LKGTLNFRGFVISDWEGIDRITSPPHSNYTHSVLAGVQAGIDMIMVPLNYTEFIDTLTSL  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPM+RIDDAV RILRVKFT+GLFENP ADY L  ++G QAHR+LAREAVRKSLVL
Sbjct  358   VKNNFIPMTRIDDAVRRILRVKFTLGLFENPLADYKLVKHVGSQAHRELAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +   P+LPLPK ASRILVAG+HANNLGYQCGGWTITW+G+ G  +T GTTIL  I
Sbjct  418   LKNGANANDPMLPLPKKASRILVAGSHANNLGYQCGGWTITWQGVEGNNVTIGTTILDAI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               +VD  T++VY+ES   EF+KSN+F+Y+IVVVGE PY+E  GD +NLTI   G+DT+ N
Sbjct  478   TASVDSNTEVVYSESPTTEFLKSNNFSYSIVVVGELPYAETAGDSMNLTITKGGIDTMSN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC    KCVVVL+SGRPLV++P+L ++DALVAAWLPGSEGQGVADVLFGDY F GKLSRT
Sbjct  538   VC-GNTKCVVVLISGRPLVVQPYLSNIDALVAAWLPGSEGQGVADVLFGDYEFRGKLSRT  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK V+QLPMNVGD++YDPL+P+GFGLTT
Sbjct  597   WFKNVNQLPMNVGDKNYDPLYPYGFGLTT  625



>ref|XP_002325849.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEF00231.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=621

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/453 (72%), Positives = 380/453 (84%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEI+ GLQGD+P N S+GVP+V GKTKVAACAKHYV D
Sbjct  168   RDPRWGRCYESYSEDPKLVQAMTEIVSGLQGDIPANSSKGVPFVAGKTKVAACAKHYVGD  227

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT    HGL+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR ++T F
Sbjct  228   GGTTKGINENNTQISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGF  287

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRF+GFVISDW GIDRIT    +NY+YS+   I+AGIDM+MVPNNY  FI    S 
Sbjct  288   LKNILRFKGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSH  347

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAVTRILRVKFTMGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  348   VKNKVIPMSRIDDAVTRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVL  407

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A++ILVAG+HA+NLGYQCGGWTI W+GL G  +T+GTTIL+ I
Sbjct  408   LKNGESAAEPLLPLPKKATKILVAGSHADNLGYQCGGWTIEWQGLGGNNLTSGTTILTAI  467

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY E+ + +F+KSN+F+YAIVVVGE PY+E FGD LNLTI   G  TI+N
Sbjct  468   KNTVDPSTEVVYKENPDADFVKSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQN  527

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCV V++SGRP+V++P++  MDALVAAWLPGSEGQGVAD LFGDY FTG LSRT
Sbjct  528   VCGT-VKCVTVIISGRPVVIQPYVSLMDALVAAWLPGSEGQGVADALFGDYGFTGTLSRT  586

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN+GD+HYDPLFPFGFGL+TK ++
Sbjct  587   WFKTVDQLPMNIGDQHYDPLFPFGFGLSTKPTK  619



>ref|XP_006371173.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
 gb|ERP48970.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
Length=626

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/453 (72%), Positives = 380/453 (84%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEI+ GLQGD+P N S+GVP+V GKTKVAACAKHYV D
Sbjct  173   RDPRWGRCYESYSEDPKLVQAMTEIVSGLQGDIPANSSKGVPFVAGKTKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT    HGL+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR ++T F
Sbjct  233   GGTTKGINENNTQISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRF+GFVISDW GIDRIT    +NY+YS+   I+AGIDM+MVPNNY  FI    S 
Sbjct  293   LKNILRFKGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSH  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAVTRILRVKFTMGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  353   VKNKVIPMSRIDDAVTRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A++ILVAG+HA+NLGYQCGGWTI W+GL G  +T+GTTIL+ I
Sbjct  413   LKNGESAAEPLLPLPKKATKILVAGSHADNLGYQCGGWTIEWQGLGGNNLTSGTTILTAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY E+ + +F+KSN+F+YAIVVVGE PY+E FGD LNLTI   G  TI+N
Sbjct  473   KNTVDPSTEVVYKENPDADFVKSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCV V++SGRP+V++P++  MDALVAAWLPGSEGQGVAD LFGDY FTG LSRT
Sbjct  533   VCGT-VKCVTVIISGRPVVIQPYVSLMDALVAAWLPGSEGQGVADALFGDYGFTGTLSRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN+GD+HYDPLFPFGFGL+TK ++
Sbjct  592   WFKTVDQLPMNIGDQHYDPLFPFGFGLSTKPTK  624



>ref|XP_010313613.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=594

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 373/449 (83%), Gaps = 3/449 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEIIPGLQGD+P N   G+PYVGGK KV ACAKH+V D
Sbjct  142   RDPRWGRCYESYSEDPQIVKQMTEIIPGLQGDLPKNVV-GIPYVGGKEKVVACAKHFVGD  200

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DWH L+SIHMP Y  SIIKGVST+M SYSS+NGVKMHAN  L+T F
Sbjct  201   GGTTKGINENNTVADWHKLLSIHMPGYYHSIIKGVSTIMVSYSSLNGVKMHANHDLVTKF  260

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L FRGFVISDW GIDRIT    SNYT+SVL  + AGIDM+MVP NY+ FI T  SL
Sbjct  261   LKGTLNFRGFVISDWQGIDRITSPPHSNYTHSVLAGVQAGIDMIMVPLNYTEFIDTLTSL  320

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPM+RIDDAV RILRVKFT+GLFENP ADY L  ++G QAHR+LAREAVRKSLVL
Sbjct  321   VKNNFIPMTRIDDAVRRILRVKFTLGLFENPLADYKLVKHVGSQAHRELAREAVRKSLVL  380

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +   P+LPLPK ASRILVAG+HANNLGYQCGGWTITW+G+ G  +T GTT L  I
Sbjct  381   LKNGANANDPILPLPKKASRILVAGSHANNLGYQCGGWTITWQGVEGNNVTTGTTFLDAI  440

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               +VD  T++VY+ES   EF+KSN+F+Y+IVVVGE PY+E  GD +NLTI   G+DT+ +
Sbjct  441   TASVDSNTEVVYSESPTTEFVKSNNFSYSIVVVGELPYAETAGDSMNLTITKGGIDTMSS  500

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC    KCVVVL+SGRPLV++P+L ++D LVAAWLPGSEGQGVADVLFGDY F GKLSRT
Sbjct  501   VC-GNTKCVVVLISGRPLVVQPYLSNIDGLVAAWLPGSEGQGVADVLFGDYEFRGKLSRT  559

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK+VDQLPMNVGD+ YDPL+P+GFGLTT
Sbjct  560   WFKSVDQLPMNVGDKDYDPLYPYGFGLTT  588



>gb|ABK95015.1| unknown [Populus trichocarpa]
Length=626

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 380/453 (84%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTE++ GLQGD+P N S+GVP+V GKTKVAACAKHYV D
Sbjct  173   RDPRWGRCYESYSEDPKLVQAMTEMVSGLQGDIPANSSKGVPFVAGKTKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT    HGL+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR ++T F
Sbjct  233   GGTTKGINENNTQISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRF+GFVISDW GIDRIT    +NY+YS+   I+AGIDM+MVPNNY  FI    S 
Sbjct  293   LKNILRFKGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSH  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAVTRILRVKFTMGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  353   VKNKVIPMSRIDDAVTRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A++ILVAG+HA+NLGYQCGGWTI W+GL G  +T+GTTIL+ I
Sbjct  413   LKNGESAAEPLLPLPKKATKILVAGSHADNLGYQCGGWTIEWQGLGGNNLTSGTTILTAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY E+ + +F+KSN+F+YAIVVVGE PY+E FGD LNLTI   G  TI+N
Sbjct  473   KNTVDPSTEVVYKENPDADFVKSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCV V++SGRP+V++P++  MDALVAAWLPGSEGQGVAD LFGDY FTG LSRT
Sbjct  533   VCGT-VKCVTVIISGRPVVIQPYVSLMDALVAAWLPGSEGQGVADALFGDYGFTGTLSRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN+GD+HYDPLFPFGFGL+TK ++
Sbjct  592   WFKTVDQLPMNIGDQHYDPLFPFGFGLSTKPTK  624



>ref|XP_004236622.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
 ref|XP_010319196.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=631

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 374/449 (83%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SM+E++PGLQGD+P+N   GVP+V  K KVAACAKHYV D
Sbjct  180   RDPRWGRCYESYSEDPNIVRSMSEMVPGLQGDIPSNGRLGVPFVANKQKVAACAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGL+SIHM  Y  SIIKGVSTVM SYSS NG++MHAN+ ++T F
Sbjct  240   GGTVKGINENNTIIDRHGLLSIHMAGYYSSIIKGVSTVMVSYSSWNGLRMHANKEMVTGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVISDW GID++T    +NYTYS+LE +N+GIDMVM+P NY+ FI     L
Sbjct  300   LKGTLRFRGFVISDWAGIDKLTYPWHTNYTYSILEGVNSGIDMVMLPYNYTEFIDGLTYL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N F+ M+RIDDAV RILRVKF MGLFENP ADYSL  YLG   HR+LAREAVR+SLVL
Sbjct  360   VNNNFVQMTRIDDAVKRILRVKFQMGLFENPLADYSLTKYLGSPEHRELAREAVRRSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG +  +P+LPLPK A+ ILVAG HANN+GYQCGGWTITW+GLSG  T GTTILS I 
Sbjct  420   LKNGANADEPVLPLPKKATNILVAGAHANNMGYQCGGWTITWQGLSGNTTTGTTILSAIE  479

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++VY E+ + EF+KSN+F+YAIVVVGE PY+E  GD LNLTIPA G D +  V
Sbjct  480   NTVDPETKVVYKENPDSEFVKSNNFSYAIVVVGETPYAEGSGDSLNLTIPAPGPDIMTTV  539

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ VKCVVVLV+GRP+V++P+L  MDALVAAWLPG+EGQGVADVLFGDY FTGKL+RTW
Sbjct  540   CAS-VKCVVVLVTGRPVVIQPYLAQMDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTW  598

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FKTVDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  599   FKTVDQLPMNVGDLHYDPLFPFGFGLTTE  627



>ref|XP_006350208.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=631

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/449 (71%), Positives = 374/449 (83%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED  IV+SM+E++PGLQGDVP+N   GVP+V  K KVAACAKHYV D
Sbjct  180   RDPRWGRCFESYSEDPNIVRSMSEMVPGLQGDVPSNGRLGVPFVANKQKVAACAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGL+SIHM  Y  SIIKGVSTVM SYSS NG++MH N+ ++T F
Sbjct  240   GGTVKGINENNTIIDRHGLLSIHMAGYYSSIIKGVSTVMVSYSSWNGLRMHENKEMVTGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVISDW GID++T    +NYTYS+LE +N+GIDMVM+P NY+ FI     L
Sbjct  300   LKGTLRFRGFVISDWAGIDKLTYPWHTNYTYSILEGVNSGIDMVMLPYNYTEFIDGLTYL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N F+ M+RIDDAV RILRVKF MGLFENP ADYSL  YLGC  HR+LAREAVR+SLVL
Sbjct  360   VNNNFVQMTRIDDAVKRILRVKFQMGLFENPLADYSLTKYLGCPEHRELAREAVRRSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG +  +P+LPLPK A+ ILVAG HANN+GYQCGGWTITW+GLSG  T GTTILS I 
Sbjct  420   LKNGANADEPVLPLPKKATNILVAGAHANNMGYQCGGWTITWQGLSGNTTIGTTILSAIE  479

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++VY E+ + EF+KSN+F+YAIVVVGE PY+E  GD LNLTIPA G D +  V
Sbjct  480   NTVDPETKVVYKENPDSEFVKSNNFSYAIVVVGETPYAEGSGDTLNLTIPAPGPDIMTTV  539

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ VKCVVVL++GRP+V++P+L  MDA+VAAWLPG+EGQGVADVLFGDY FTGKL+RTW
Sbjct  540   CAS-VKCVVVLLTGRPVVIQPYLAQMDAVVAAWLPGTEGQGVADVLFGDYGFTGKLARTW  598

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FKTVDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  599   FKTVDQLPMNVGDSHYDPLFPFGFGLTTE  627



>ref|XP_011094168.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011094170.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011094171.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=627

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/449 (70%), Positives = 379/449 (84%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIV++MTEIIPGLQGD+P N  +GVPYV GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDSEIVQAMTEIIPGLQGDIPANSRQGVPYVAGKKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG+++NNTVT  HGL+SIHMPPY  SIIKGV+T+M SYSS NG+KMHANR L+T F
Sbjct  235   GGTTKGINQNNTVTSKHGLLSIHMPPYDDSIIKGVATIMVSYSSFNGIKMHANRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISD+ GID+IT    +NYTYS+L  I AGIDMVM+PNNY+ FI     L
Sbjct  295   LKKTLRFRGFVISDYKGIDQITSPIHANYTYSILAGIGAGIDMVMIPNNYTEFIDGLTFL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP ADYS+  YLG + H++LAREAVRKSLVL
Sbjct  355   VKNNFIPMSRIDDAVKRILRVKFIMGLFENPLADYSMTKYLGSRVHKELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG+   +PL+PLPK AS++LVAGTHA+N+G QCGGWTI W+G +G IT+GTTIL+ I 
Sbjct  415   LKNGESADEPLIPLPKRASKVLVAGTHADNIGNQCGGWTIEWQGKTGNITSGTTILTAIK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VD  T+++++E+ + +++K+N+F+YAIVVVGE PY+E +GD LNLT+P      I NV
Sbjct  475   NTVDSKTKVIFHENPDAKYVKANEFSYAIVVVGEPPYAEGYGDSLNLTLPDPSYSIITNV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ +KCVVVL++GRP+V++P+L  +DALVAAWLPGSEGQGVADVLFG+Y F+GKL +TW
Sbjct  535   CAS-LKCVVVLITGRPVVIQPYLAQIDALVAAWLPGSEGQGVADVLFGEYGFSGKLPQTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FKTVDQLPMNVGD+ YDPLFPFGFGLTT+
Sbjct  594   FKTVDQLPMNVGDQQYDPLFPFGFGLTTQ  622



>gb|EYU18175.1| hypothetical protein MIMGU_mgv1a002782mg [Erythranthe guttata]
Length=638

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/452 (70%), Positives = 377/452 (83%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++MTEIIPGLQGD+P N ++GVPY+ GK KV ACAKHYV D
Sbjct  187   RDPRWGRCYESYSEDTSVVRAMTEIIPGLQGDIPANSTKGVPYISGKEKVVACAKHYVGD  246

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG+++N+TV    GL+SIHMPPY  SI+KGV+T+M SYSS NGVKMHANR L+T +
Sbjct  247   GGTTKGINQNDTVISNRGLLSIHMPPYNDSIVKGVATIMISYSSFNGVKMHANRDLITGY  306

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISD+ GID IT    +NYTYS+L  + AGIDM+M+P NY+ FI     L
Sbjct  307   LKNTLRFRGFVISDFEGIDHITTPPHANYTYSILAGVGAGIDMIMIPYNYTEFIDGLTFL  366

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK +FIPMSRIDDAV RILRVKFTMGLFENP ADYS+  YLG Q HR+LAREAVRKSLVL
Sbjct  367   VKKKFIPMSRIDDAVIRILRVKFTMGLFENPLADYSMTKYLGSQEHRELAREAVRKSLVL  426

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PL+PLPK AS++LVAGTHA+++G QCGGWTI W+G SG IT GTTIL+ + 
Sbjct  427   LKNGKSSDKPLIPLPKKASKVLVAGTHADDIGNQCGGWTIQWQGQSGNITFGTTILNAVK  486

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             NAVDP  ++V+ E  + E++KSN+F+YAIVVVGE PY+E +GD+LNLT+P +G  TI NV
Sbjct  487   NAVDPTMEVVFVEKPDIEYVKSNEFSYAIVVVGESPYAEGYGDNLNLTLPESGYSTITNV  546

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVVL++GRP+V+ P+L  +D LVAAWLPG+EGQGVADVLFGDY F+GKLSRTW
Sbjct  547   CGS-VKCVVVLITGRPIVIGPYLGQIDGLVAAWLPGTEGQGVADVLFGDYGFSGKLSRTW  605

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLTTKG +
Sbjct  606   FKSVDQLPMNVGDPHYDPLFPFGFGLTTKGVK  637



>ref|XP_010279030.1| PREDICTED: lysosomal beta glucosidase-like [Nelumbo nucifera]
Length=628

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/450 (72%), Positives = 379/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+IIPGLQG++P N  +GVP+VGGKTKVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQLMTDIIPGLQGEIPANSRKGVPFVGGKTKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   +GL +IHMP Y  SI KGV+T+M SYSS NG KMHANR L+TD+
Sbjct  235   GGTTKGINENNTVISRNGLFNIHMPAYLNSISKGVATIMVSYSSWNGKKMHANRDLVTDY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK HL FRGFVISDW+GIDRIT    +NY+YSV   I+AGIDM+MVPNN++ FI      
Sbjct  295   LKNHLHFRGFVISDWMGIDRITSPPHANYSYSVQAGISAGIDMIMVPNNFTEFIDILTFQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV+RILRVKFTMGLFE+P AD SLA  LG Q HR+LAREAVRKSLVL
Sbjct  355   VKNNIIPMSRIDDAVSRILRVKFTMGLFEDPLADLSLADQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK AS+ILVAG+HA+NLG QCGGWTITW+GL G  +T+GTTIL+ I
Sbjct  415   LKNGESADKPLLPLPKKASKILVAGSHADNLGAQCGGWTITWQGLQGNNLTSGTTILNAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+TQ+VY E+ +  F+KSN F++AIVVVGE PY+E FGD +NL IP  G  TI N
Sbjct  475   KNTVDPSTQVVYKENPDANFVKSNKFSFAIVVVGEPPYAETFGDSMNLIIPEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC++ VKCVV+L+SGRP+V++P++ SMDALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCSS-VKCVVILISGRPVVIQPYIDSMDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WF+TVDQLP+NVGD HYDPLFPFGFGLTTK
Sbjct  594   WFRTVDQLPLNVGDPHYDPLFPFGFGLTTK  623



>ref|XP_008240500.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=636

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/449 (72%), Positives = 375/449 (84%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQG++P N  +GVP+V G  KVAACAKH+V D
Sbjct  183   RDPRWGRCYESYSEDPKIVQAMTEIIPGLQGEIPANSRKGVPFVAGNKKVAACAKHFVGD  242

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + HGL+SIHMP Y  SIIKGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  243   GGTTKGINENNTVINRHGLLSIHMPGYYNSIIKGVATIMVSYSSWNGVKMHANHDLVTAF  302

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   INAGIDMVMVP NY+ FI     L
Sbjct  303   LKNTLRFRGFVISDWEGIDRITSPPHANYSYSIQAGINAGIDMVMVPYNYTEFIDGLTFL  362

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFE PFAD SL H LG Q HR+LAREAVR+SLVL
Sbjct  363   VKNNIIPISRIDDAVKRILRVKFVMGLFEEPFADMSLVHQLGSQEHRELAREAVRRSLVL  422

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+  ++PLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+GLSG  +T GTTIL+ I
Sbjct  423   LKNGESAEKPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTEGTTILTAI  482

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP  Q+VY E+ + +F+KSN+F+YAIV+VGE PY+E FGD LNLTIP  G  TI N
Sbjct  483   KDTVDPKAQVVYKENPDADFVKSNNFSYAIVIVGEHPYAETFGDSLNLTIPDPGPTTITN  542

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRP+V++P++ S+DALVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  543   VCGA-VKCVVIVISGRPVVIQPYVVSIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRT  601

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  602   WFKTVDQLPMNVGDAHYDPLFPFGFGLTT  630



>ref|XP_011021458.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=626

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 377/453 (83%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTE++ GLQGD+P N S+GVP+V GKTKVAACAKH+V D
Sbjct  173   RDPRWGRCYESYSEDPKLVQAMTEMVSGLQGDIPANSSKGVPFVAGKTKVAACAKHFVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT    HGL+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR ++T F
Sbjct  233   GGTTKGINENNTQISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT     NY+YS+   I+AGIDM+MVPNNY  FI    S 
Sbjct  293   LKNILRFRGFVISDWEGIDRITSPPHGNYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSH  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  +PMSRIDDAV RILRVKFTMGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  353   VKNEVVPMSRIDDAVKRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A++ILVAG+HA+NLGYQCGGWTI W+G+ G  +T+GTTIL+ I
Sbjct  413   LKNGESAAEPLLPLPKKATKILVAGSHADNLGYQCGGWTIEWQGVGGNNLTSGTTILTAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY E+ + +F++SN+F+YAIVVVGE PY+E FGD LNLTI   G  TI+N
Sbjct  473   KNTVDPSTEVVYKENPDADFVRSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKC  V++SGRP+V++P++  MDALVAAWLPGSEGQGVADVLFGDY FTG LS+T
Sbjct  533   VCGT-VKCATVIISGRPVVIQPYVSLMDALVAAWLPGSEGQGVADVLFGDYGFTGTLSQT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK ++
Sbjct  592   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKPTK  624



>ref|XP_007204092.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
 gb|EMJ05291.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
Length=623

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/449 (72%), Positives = 372/449 (83%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQG++P N  +GVP+V G  KVAACAKH+V D
Sbjct  170   RDPRWGRCYESYSEDPKIVQAMTEIIPGLQGEIPANSRKGVPFVAGNKKVAACAKHFVGD  229

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + HGL+SIHMP Y  SIIKGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  230   GGTTKGINENNTVINRHGLLSIHMPGYYNSIIKGVATIMVSYSSWNGVKMHANHDLVTAF  289

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   INAGIDMVMVP NY  FI     L
Sbjct  290   LKNTLRFRGFVISDWEGIDRITSPPHANYSYSIQAGINAGIDMVMVPYNYMEFIDGLTFL  349

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RILRVKF MGLFE PFAD SL H LG Q HR+LAREAVR+SLVL
Sbjct  350   VKNKIIPMSRIDDAVKRILRVKFVMGLFEEPFADMSLVHQLGSQEHRELAREAVRRSLVL  409

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+  ++PLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+GLSG  +T GTTIL+ I
Sbjct  410   LKNGESAEKPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTEGTTILTAI  469

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP  Q+VY E+ + +F+KSN+ +YAIVVVGE PY+E FGD LNLTIP  G  TI N
Sbjct  470   KNTVDPKAQVVYKENPDADFVKSNNISYAIVVVGEHPYAETFGDSLNLTIPDPGPTTITN  529

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVV+++SGRP+V++P++ S+DALV AWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  530   VCGT-VKCVVIVISGRPVVIQPYVASIDALVTAWLPGTEGQGVADVLFGDYGFTGKLSRT  588

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  589   WFKTVDQLPMNVGDAHYDPLFPFGFGLTT  617



>ref|XP_009610986.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=628

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/452 (71%), Positives = 375/452 (83%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++M+E++PGLQGDVP+N   GVP+V  K KVAACAKHYV D
Sbjct  176   RDPRWGRCYESYSEDPNIVRAMSEMVPGLQGDVPSNGRLGVPFVANKQKVAACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGL+SIHM  Y  SIIKGV+TVM SYSS NGV+MH NR L+T F
Sbjct  236   GGTVKGINENNTIIDRHGLLSIHMAGYYNSIIKGVATVMVSYSSWNGVRMHGNRELVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVISDW GID++T    +NYTYS+LE +NAGIDMVM+P N + FI     L
Sbjct  296   LKGTLRFRGFVISDWAGIDKLTYPWHANYTYSILEGVNAGIDMVMLPYNTTEFIDGLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN F+ MSRIDDAV RILRVKF MGLFE+P ADYS+  YLG   HR+LAREAVR+SLVL
Sbjct  356   VKNNFVQMSRIDDAVKRILRVKFQMGLFESPLADYSMVKYLGSAEHRELAREAVRRSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG +  +P+LPLPK AS ILVAG HANN+GYQCGGWTITW+GLSG  T GTTILS I 
Sbjct  416   LKNGANADEPVLPLPKKASSILVAGIHANNMGYQCGGWTITWQGLSGNTTVGTTILSAIE  475

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++V+NE+ + EF+KSN+F+YAIVVVGE PY+E  GD LNLTIPA G DT+  V
Sbjct  476   NTVDPETKVVFNENPDAEFIKSNNFSYAIVVVGETPYAEGSGDTLNLTIPAPGPDTMTTV  535

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA  VKCVVVL++GRP+V++P+L  +DALV AWLPG+EGQGVADVLFGDY FTGKL+RTW
Sbjct  536   CAT-VKCVVVLLTGRPVVIQPYLAQVDALVEAWLPGTEGQGVADVLFGDYGFTGKLARTW  594

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FKTVDQLPMN+GD HYDPLFPFGFGLTT+ ++
Sbjct  595   FKTVDQLPMNIGDPHYDPLFPFGFGLTTEPTK  626



>ref|XP_004295138.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=628

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/454 (71%), Positives = 377/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P +F +G PYVGGK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDMPPSFQKGAPYVGGKGKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV DW+GL+ IHMP Y  SI+KGV+TVM SYSS NG KMHAN+ L+T +
Sbjct  235   GGTTRGINENNTVIDWNGLLGIHMPAYLNSILKGVATVMVSYSSWNGKKMHANQDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP N++ FI      
Sbjct  295   LKNKLRFRGFVISDWEGIDRITSPPKANYSYSVQAGVSAGIDMIMVPYNFTEFIDDLTYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP AD SLA  LG + HR+LAREAVRKSLVL
Sbjct  355   VKNNIIPMSRIDDAVKRILRVKFVMGLFENPLADLSLADQLGNKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   +PLLPL K A +IL+AG+HA+NLG+QCGGWTITW+GL G  +T GTTIL+ +
Sbjct  415   LKNGKSATKPLLPLSKKAGKILIAGSHADNLGFQCGGWTITWQGLGGNDLTVGTTILNAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP TQ+VYNES +  F+KSN F++A+VVVGE PY+E FGD +NLTI  AGL TI N
Sbjct  475   KTTVDPTTQVVYNESPDANFVKSNKFSHAVVVVGEPPYAETFGDSMNLTISEAGLSTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-VKCVVVIISGRPVVVQPYLSKIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFK+VDQLPMNVGD HYDPLFPFGFGLTTK +++
Sbjct  594   WFKSVDQLPMNVGDAHYDPLFPFGFGLTTKPTKN  627



>ref|XP_006487803.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487804.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Citrus 
sinensis]
Length=628

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 376/453 (83%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDLPANSKKGVPFVAGKKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + +GL+SIHMP Y  SI KGV+TVM SYSS NG KMHAN  L+T F
Sbjct  235   GGTTKGINENNTVINLNGLLSIHMPAYYNSISKGVATVMVSYSSWNGKKMHANHELVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YSV   ++AGIDMVMVPNNY  FI      
Sbjct  295   LKNKLKFRGFVISDWEGIDRITAPPHANYSYSVQAGVSAGIDMVMVPNNYKEFIDDLTDQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLF++P AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKKNIIPMSRIDDAVKRILRVKFVMGLFDSPLADTSLVNQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   +PLLPLPK AS+ILVAG+HA+NLGYQCGGWTITW+GL G  +TAG+TIL  +
Sbjct  415   LKNGEAADKPLLPLPKKASKILVAGSHADNLGYQCGGWTITWQGLGGNDLTAGSTILHAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +N VDP TQ+V+NE+ +  F+KSN F+YAIVVVGE+PY+E +GD LNLTI   GL TI N
Sbjct  475   SNTVDPTTQVVFNENPDANFVKSNKFSYAIVVVGEQPYAETYGDSLNLTISEPGLSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-VKCVVVVISGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTK ++
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTK  626



>gb|KDO54375.1| hypothetical protein CISIN_1g006872mg [Citrus sinensis]
Length=628

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 376/453 (83%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDLPANSKKGVPFVAGKKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + +GL+SIHMP Y  SI KGV+TVM SYSS NG KMHAN  L+T F
Sbjct  235   GGTTKGINENNTVINLNGLLSIHMPAYYNSISKGVATVMVSYSSWNGKKMHANHELVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YSV   ++AGIDMVMVPNNY  FI      
Sbjct  295   LKNKLKFRGFVISDWEGIDRITAPPHANYSYSVQAGVSAGIDMVMVPNNYKEFIDDLTDQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLF++P AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKKNIIPMSRIDDAVKRILRVKFVMGLFDSPLADTSLVNELGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   +PLLPLPK AS+ILVAG+HA+NLGYQCGGWTITW+GL G  +TAG+TIL  +
Sbjct  415   LKNGEAADKPLLPLPKKASKILVAGSHADNLGYQCGGWTITWQGLGGNDLTAGSTILHAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +N VDP TQ+V+NE+ +  F+KSN F+YAIVVVGE+PY+E +GD LNLTI   GL TI N
Sbjct  475   SNTVDPTTQVVFNENPDANFVKSNKFSYAIVVVGEQPYAETYGDSLNLTISEPGLSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-VKCVVVVISGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTK ++
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTK  626



>ref|XP_009757149.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=628

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/452 (71%), Positives = 374/452 (83%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++M+E++PGLQGDVP+N   GVP+V  K KVAACAKHYV D
Sbjct  176   RDPRWGRCYESYSEDPNIVRAMSEMVPGLQGDVPSNGRLGVPFVANKQKVAACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGL+SIHM  Y  SIIKGV+TVM SYSS NG++MH NR ++T F
Sbjct  236   GGTVKGINENNTIIDRHGLLSIHMAGYYNSIIKGVATVMVSYSSWNGLRMHGNREMVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVISDW GID++T    +NYTYS+LE +NAGIDMVM+P N + FI     L
Sbjct  296   LKGTLRFRGFVISDWAGIDKLTYPWHANYTYSILEGVNAGIDMVMLPYNTTEFIDGLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN F+ MSRIDDAV RILRVKF MGLFENP ADYS+  YLG   HR+LAREAVR+SLVL
Sbjct  356   VKNNFVSMSRIDDAVKRILRVKFQMGLFENPLADYSMVKYLGSAEHRELAREAVRRSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG +  +P+LPLPK AS ILVAG HANN+GYQCGGWTITW+GLSG  T GTTILS I 
Sbjct  416   LKNGANADEPVLPLPKKASSILVAGIHANNMGYQCGGWTITWQGLSGNTTIGTTILSAIE  475

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++V+ E+ + EF+K N+F+YAIVVVGE PY+E  GD LNLTIPA G DT+  V
Sbjct  476   NTVDPETKVVFKENPDAEFIKPNNFSYAIVVVGETPYAEGSGDTLNLTIPAPGPDTMTTV  535

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA  VKCVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RTW
Sbjct  536   CAT-VKCVVVLLTGRPVVIQPYLAQVDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTW  594

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  595   FKTVDQLPMNVGDSHYDPLFPFGFGLTTEPTK  626



>gb|EYU18174.1| hypothetical protein MIMGU_mgv1a002879mg [Erythranthe guttata]
Length=628

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 378/452 (84%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+SMTEII GLQG++P+N  +GVP++ G+ KV A AKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKVVRSMTEIISGLQGEIPSNSRKGVPFLAGQEKVLATAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKGM+ENNT+   HGL+SIHMP Y  SIIKGV T+M SYSS NGVKMHANR L+T F
Sbjct  236   GGTTKGMNENNTLATRHGLLSIHMPAYYDSIIKGVGTIMVSYSSWNGVKMHANRDLITVF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT  E +NYTYS++  INAGIDM+MVP NY+ FI    SL
Sbjct  296   LKNTLRFRGFVISDWQGIDRITTPEHANYTYSIITGINAGIDMIMVPYNYTEFIDGLTSL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RILRVKFT+GLFE+P ADYS+  +LG + HR++AREAVRKSLVL
Sbjct  356   VKNKVIPMSRIDDAVARILRVKFTIGLFEHPLADYSMVKHLGSKEHREIAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +P+LPLPK AS+ILV G+HANN+G QCGGWTI W+G +G +T GTTIL+ + 
Sbjct  416   LKNGKSADKPVLPLPKKASKILVVGSHANNIGNQCGGWTIQWQGQTGNVTVGTTILTAVK  475

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N V P T++V+NE+ + +F+K N F+YA+VVVGE PY+E FGD LNLT+P +G  TIKN+
Sbjct  476   NTVHPETKVVFNENPDSKFLKLNKFSYAVVVVGEPPYAETFGDSLNLTLPESGYSTIKNM  535

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ VKCVVVL++GRP+V+ P+L  +DALVAAWLPG+EGQGVADVLFGDY F+GKL  TW
Sbjct  536   CAS-VKCVVVLITGRPVVIGPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPHTW  594

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLTTKG++
Sbjct  595   FKSVDQLPMNVGDPHYDPLFPFGFGLTTKGAK  626



>ref|XP_004489701.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=614

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/450 (72%), Positives = 374/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+SMTEIIPGLQGD+P+N  +GVP+V G  KVAACAKH+V D
Sbjct  161   RDPRWGRCYESYSEDHTVVQSMTEIIPGLQGDIPSNSPKGVPFVAGNKKVAACAKHFVGD  220

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+SIHMP Y  SII+GVST+M SYSS NG KMHANR L+T F
Sbjct  221   GGTTKGINENNTVVSRHELLSIHMPAYYNSIIQGVSTIMVSYSSWNGEKMHANRDLITGF  280

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISD+ GIDRIT    +NYTYS+  ++NAGIDM+M+P NY+ FI     L
Sbjct  281   LKNTLRFRGFVISDFQGIDRITSTPHANYTYSIQTAVNAGIDMIMIPYNYTEFIDGITFL  340

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG Q HR+LAREAVRKSLVL
Sbjct  341   VKNNAIPMSRIDDAVKRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRKSLVL  400

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +PLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+GLSG +IT+GTTILS I
Sbjct  401   LKNGENADKPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLSGNHITSGTTILSAI  460

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T I+Y E  + +++KSN+F+YAIVVVGEKPY+E  GD LNLTI + G DTI N
Sbjct  461   KNTVDKDTDIIYKEYPDLDYVKSNNFSYAIVVVGEKPYAETSGDSLNLTISSHGYDTINN  520

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC AGVKCVVVL++GRP+V++P+L  ++ LVAAWLPGSEG GV DVLFGDY F+GKLSRT
Sbjct  521   VC-AGVKCVVVLITGRPVVIQPYLDKIEGLVAAWLPGSEGHGVTDVLFGDYGFSGKLSRT  579

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  580   WFKSVDQLPMNVGDSHYDPLFPFGFGLTTQ  609



>emb|CDP15627.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/448 (71%), Positives = 371/448 (83%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGDVP NF +G+PY+ G+ KVA CAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDVPANFPKGIPYIAGRNKVAGCAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV DW+GL SIHMP Y  SI KGV+TVM SYSS NG KMHAN+ L+T +
Sbjct  235   GGTTNGINENNTVIDWNGLQSIHMPAYLDSIKKGVATVMVSYSSWNGEKMHANKKLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISD  GIDRIT    +NYTYSV   I AGIDM+MVP  ++ FI    SL
Sbjct  295   LKKQLKFKGFVISDSQGIDRITSPPHANYTYSVEAGILAGIDMIMVPEKFTEFIDDLTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF +GLFENP ADYSL H LG Q HR+LAREAVRKSLVL
Sbjct  355   VKKNVIPMSRIDDAVRRILRVKFVLGLFENPMADYSLVHELGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK+  +PLLPLPK AS+ILVAG+HA+N+G QCGGWTI W+GL+G IT GTTIL+ + 
Sbjct  415   LKNGKNIDEPLLPLPKRASKILVAGSHAHNIGNQCGGWTIEWRGLAGNITVGTTILTAVK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++VY E+   E +KSN F+YAIVVVGE PYSE FGD++NLTIP +G+ TI NV
Sbjct  475   NTVDPLTEVVYRENPETELLKSNKFSYAIVVVGEPPYSESFGDNMNLTIPESGIRTITNV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A +KCVVV++SGRP+V+EP+L  ++ALVAAWLPG+EGQGVADVLFG Y FTGKL+RTW
Sbjct  535   CEA-IKCVVVIISGRPVVIEPYLAKIEALVAAWLPGTEGQGVADVLFGGYGFTGKLARTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FKTVDQLPMNVGD HYDPLFPFG+GLTT
Sbjct  594   FKTVDQLPMNVGDPHYDPLFPFGYGLTT  621



>ref|XP_011089010.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011089011.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=636

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 381/453 (84%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED +IV+ MT+II GLQG++P N  +GVPY+GG+ KV ACAKH+V D
Sbjct  184   RDPRWGRCYESFSEDPKIVEEMTDIIEGLQGEIPPNSRKGVPYIGGQDKVVACAKHFVGD  243

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT  DWH L+SIHMP Y  SI KGVST+M SYSS+NGVKMH NR+L+T+F
Sbjct  244   GGTKDGINENNTKADWHELLSIHMPGYYHSIKKGVSTIMISYSSLNGVKMHTNRNLITNF  303

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVISDW G+D+ T  E +NY+ S+L++I+AGIDMVMVP N++ F S  +S 
Sbjct  304   LKGALRFRGFVISDWQGVDKTTYPEHANYSDSLLKAIDAGIDMVMVPYNHTEFSSILVSH  363

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILR+KFTMGLFENP ADYS A  LG Q HRDLAREAVRKSLVL
Sbjct  364   VKNNLIPMSRIDDAVRRILRIKFTMGLFENPMADYSRADKLGSQVHRDLAREAVRKSLVL  423

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGL-SGYITAGTTILSGI  577
             LKNG++   P+LPLPK  S+ILVAG HANNLG QCGGWTITW+GL S  +TAGTTIL+ I
Sbjct  424   LKNGENADSPILPLPKETSKILVAGKHANNLGLQCGGWTITWQGLDSKNLTAGTTILNAI  483

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +NAV P+T++VY+E+ + +F+K+ +F+YAIVVVGE PYSE  GD+ NLTIP  GL  +KN
Sbjct  484   SNAVHPSTELVYSENPDPKFVKAENFSYAIVVVGEPPYSETAGDNQNLTIPEPGLSIMKN  543

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVVL+SGRPLV++P+L S+DALVAAWLPGSEGQGVADVLFG+Y F+GKL RT
Sbjct  544   VCGS-VKCVVVLISGRPLVVQPYLSSIDALVAAWLPGSEGQGVADVLFGEYGFSGKLPRT  602

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTKG +
Sbjct  603   WFKTVDQLPMNVGDEHYDPLFPFGFGLTTKGIK  635



>ref|XP_003601350.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES71601.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=627

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/454 (70%), Positives = 376/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK+MTEIIPGLQGD+P N  +G P+V GK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDPKIVKTMTEIIPGLQGDIPGNSRKGTPFVAGKNKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV  + GL+ IHMP Y  S+IKGVSTVM SY+S NG KMHANR L+T +
Sbjct  235   GGTTKGINENNTVISYKGLLGIHMPAYYDSVIKGVSTVMISYTSWNGKKMHANRDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP N++ FI      
Sbjct  295   LKNKLRFRGFVISDWQGIDRITSPPHANYSYSVEAGVSAGIDMIMVPYNFTEFIDDLTFQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKFTMGLFENP AD SL + LG + HR+LAREAVRKSLVL
Sbjct  355   VKNNIIPISRIDDAVARILRVKFTMGLFENPLADLSLINQLGSKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   +PLLPLPK AS++LVAG+HA+NLG QCGGWTITW+GLSG  +T GTTIL GI
Sbjct  415   LKNGKYANKPLLPLPKKASKVLVAGSHADNLGNQCGGWTITWQGLSGSDLTTGTTILDGI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPAT++VYNE+ +  F+KSN F+YAIV+VGEKPY+E FGD LNLTI   G  TI N
Sbjct  475   KQTVDPATEVVYNENPDANFIKSNKFSYAIVIVGEKPYAETFGDSLNLTIAEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + ++CVVVLV+GRP+V++P+L  +DALVAAWLPG+EGQGVADVL+GD+ FTGKL+RT
Sbjct  535   VCGS-IQCVVVLVTGRPVVIQPYLSKIDALVAAWLPGTEGQGVADVLYGDFEFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD+HYDPLFPFGFGLTT  +++
Sbjct  594   WFKTVDQLPMNVGDKHYDPLFPFGFGLTTNLTKY  627



>ref|XP_006424024.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 ref|XP_006424025.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37264.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37265.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
Length=628

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 375/453 (83%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDLPANSKKGVPFVAGKKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + +GL+SIHMP Y  SI KGV+TVM SYSS NG KMHAN  L+T F
Sbjct  235   GGTTKGINENNTVINLNGLLSIHMPAYYNSISKGVATVMVSYSSWNGKKMHANHELVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YSV   ++AGIDMVMVPNNY  FI      
Sbjct  295   LKNKLKFRGFVISDWEGIDRITAPPHANYSYSVQAGVSAGIDMVMVPNNYKEFIDDLTDQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLF++P AD SL + LG Q HR LAREAVRKSLVL
Sbjct  355   VKKNIIPMSRIDDAVKRILRVKFVMGLFDSPLADTSLVNELGSQEHRQLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   +PL+PLPK AS+ILVAG+HA+NLGYQCGGWTITW+GL G  +TAGTTIL  +
Sbjct  415   LKNGEAADKPLVPLPKKASKILVAGSHADNLGYQCGGWTITWQGLGGNDLTAGTTILHAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +N VDP TQ+V+NE+ +  F+KSN F++AIVVVGE+PY+E +GD LNLTI   GL TI N
Sbjct  475   SNTVDPTTQVVFNENPDANFVKSNKFSHAIVVVGEQPYAETYGDSLNLTISEPGLSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-VKCVVVVISGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN+GD HYDPLFPFGFGLTTK ++
Sbjct  594   WFKTVDQLPMNLGDPHYDPLFPFGFGLTTKPTK  626



>ref|XP_008777969.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008777970.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Phoenix 
dactylifera]
Length=564

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 369/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED ++V+ MTE+IPGLQGD+P N+S+GVPYV GK KVAACAKHYV D
Sbjct  80    RDPRWGRCYESFSEDYQVVRDMTEVIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+S+HMP Y  SIIKGVSTVM SYSS NG KMHAN  L+T F
Sbjct  140   GGTHDGINENNTIIDSHGLLSMHMPAYDISIIKGVSTVMVSYSSWNGEKMHANHDLVTGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI+   SL
Sbjct  200   LKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+   IPM+RIDDAV RIL VKFTMGLFENP +D SL   LG + HR LAREAVRKSLVL
Sbjct  260   VQKNIIPMTRIDDAVRRILLVKFTMGLFENPLSDLSLVDQLGKKEHRVLAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   + LLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  320   LKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGASGNITIGTTILDAIK  379

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T I+Y+E+ +  F+K NDF+YAIVVVGE PY+E  GD LNLT+P  G  TI+ V
Sbjct  380   STVDPSTTIIYSENPDASFVKDNDFSYAIVVVGEPPYTETAGDSLNLTLPDPGPSTIQTV  439

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+A VKCVVV++SGRP+V+EP++P MDALVAAWLPGSEGQGVADVLFGDY F+GKL RTW
Sbjct  440   CSA-VKCVVVIISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTW  498

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  499   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  527



>ref|XP_010917875.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917876.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=627

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/449 (71%), Positives = 374/449 (83%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N+S+G PYV GK  VAAC+KH+V D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDLPVNYSKGFPYVAGKNNVAACSKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNT+ D  GL SIHMP Y  SI KGVSTVM SYSS NG++MHANR L+T F
Sbjct  235   GGTHNGIDENNTIIDQRGLFSIHMPAYYDSIAKGVSTVMVSYSSWNGLRMHANRGLVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GIDRIT    +NYTYSVL  INAGIDMVMVPN+Y++FI T  SL
Sbjct  295   LKNKLGFKGFVISDWQGIDRITTPPGANYTYSVLAGINAGIDMVMVPNDYTQFIDTLTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKFTMGLFENP AD S    LG + HR+LARE+VRKSLVL
Sbjct  355   VNNKFIPMSRIDDAVRRILRVKFTMGLFENPLADLSFVDQLGKKEHRELARESVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL+ I 
Sbjct  415   LKNGKSTNKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGGSGEITVGTTILNAIK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDPAT ++++E+ +  F+KSN+F++AIVVVGE PY+E +GD LNLTIP  G  TI+ V
Sbjct  475   STVDPATNVLFSENPDANFVKSNNFSHAIVVVGEHPYTEMYGDSLNLTIPDPGPRTIQTV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A VKCVVV++SGRP+V+EP++  +DALVAAWLPGSEGQG+ADVLFGDY F+GKL RTW
Sbjct  535   CGA-VKCVVVIISGRPVVIEPYVTLIDALVAAWLPGSEGQGIADVLFGDYGFSGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+ YDPLFPFGFGLTTK
Sbjct  594   FKSVDQLPMNVGDKSYDPLFPFGFGLTTK  622



>ref|XP_002319151.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE95074.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 375/453 (83%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEI+PGLQGD+P N S+G+P+V GKTKVAACAKHY+ D
Sbjct  174   RDPRWGRCYESYSEDPKLVQAMTEIVPGLQGDIPANSSKGIPFVAGKTKVAACAKHYLGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNT    HGL+S HMP Y  SIIKGVST+M SYSS NGVKMHANR ++T F
Sbjct  234   GGTTDGINENNTQISRHGLLSTHMPGYYNSIIKGVSTIMVSYSSWNGVKMHANRDMVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   I+AGIDM+MVPNNY   I    S 
Sbjct  294   LKNILRFRGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKELIDGLTSH  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  354   VKNKVIPMSRIDDAVKRILRVKFVMGLFENPLADKSLVNELGSQEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   +PLLPL K AS+ILVAG+HA+NLGYQCGGWTI W+GLSG  +T+GTTIL+ I
Sbjct  414   LKNGESADEPLLPLHKKASKILVAGSHADNLGYQCGGWTIEWQGLSGKNLTSGTTILTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY E+ + +F+KSN+F+YAIVVVGE PY+E FGD LNLTI   G  TI+N
Sbjct  474   ENTVDPSTEVVYKENPDADFVKSNNFSYAIVVVGEPPYAETFGDCLNLTISEPGPSTIQN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCV V+ SGRP+V++P+L  MDALVAAWLPG+EGQGVADVLFGDY FTGKL RT
Sbjct  534   VCGS-VKCVTVISSGRPVVIQPYLSLMDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGDRHYD LFPFG+GLTT  ++
Sbjct  593   WFKTVDQLPMNVGDRHYDALFPFGYGLTTDPTK  625



>ref|XP_010908055.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Elaeis 
guineensis]
Length=564

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/449 (72%), Positives = 368/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED  IV+ MTEIIPGLQGD+P N+S+GVPYV GK KVAACAKHYV D
Sbjct  80    RDPRWGRCYESFSEDYHIVREMTEIIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNTV D+HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHAN  L+T F
Sbjct  140   GGTHDGINENNTVIDYHGLLSIHMPAYDISIIKGVSTVMVSYSSWNGAKMHANHDLVTGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI+   SL
Sbjct  200   LKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAV RIL VKFTMGLFENP AD SL   LG + HR+LAREAVRKSLVL
Sbjct  260   VHKNIIPMSRIDDAVRRILLVKFTMGLFENPLADLSLVDQLGKKEHRELAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   + LLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  320   LKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGDSGNITVGTTILDAIK  379

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T I+Y+E+ +   +K+NDF++AIVVVGE PY+E  GD LNLT+P  G  T++ V
Sbjct  380   STVDPSTTIIYSENPDASSVKNNDFSHAIVVVGEPPYTETAGDSLNLTLPDPGPSTVQTV  439

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVV++SGRP+V+EP++P MDALVAAWLPGSEGQGVADVLFGDY F+GKL RTW
Sbjct  440   CGS-VKCVVVVISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTW  498

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  499   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  527



>ref|XP_010908054.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Elaeis 
guineensis]
Length=614

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/449 (72%), Positives = 368/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED  IV+ MTEIIPGLQGD+P N+S+GVPYV GK KVAACAKHYV D
Sbjct  130   RDPRWGRCYESFSEDYHIVREMTEIIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGD  189

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNTV D+HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHAN  L+T F
Sbjct  190   GGTHDGINENNTVIDYHGLLSIHMPAYDISIIKGVSTVMVSYSSWNGAKMHANHDLVTGF  249

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI+   SL
Sbjct  250   LKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSL  309

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAV RIL VKFTMGLFENP AD SL   LG + HR+LAREAVRKSLVL
Sbjct  310   VHKNIIPMSRIDDAVRRILLVKFTMGLFENPLADLSLVDQLGKKEHRELAREAVRKSLVL  369

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   + LLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  370   LKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGDSGNITVGTTILDAIK  429

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T I+Y+E+ +   +K+NDF++AIVVVGE PY+E  GD LNLT+P  G  T++ V
Sbjct  430   STVDPSTTIIYSENPDASSVKNNDFSHAIVVVGEPPYTETAGDSLNLTLPDPGPSTVQTV  489

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVV++SGRP+V+EP++P MDALVAAWLPGSEGQGVADVLFGDY F+GKL RTW
Sbjct  490   CGS-VKCVVVVISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTW  548

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  549   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  577



>gb|KEH25597.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=609

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 371/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+SMTE+IPGLQGD+P N+S+GVPYVGG  KVAACAKH+V D
Sbjct  156   RDPRWGRCYESYSEDHKIVQSMTELIPGLQGDLPANWSKGVPYVGGSKKVAACAKHFVGD  215

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + H +  IHMP Y  SIIKGV+TVM SYSS+NG KMHAN  L+T F
Sbjct  216   GGTTKGINENNTVANRHQIYGIHMPAYYNSIIKGVATVMISYSSLNGHKMHANHDLVTGF  275

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGF ISDW GIDRIT    +NYTYS+  S+NAG+DM+MVP NY+ FI    SL
Sbjct  276   LKNKLRFRGFTISDWEGIDRITSPPHANYTYSIEASVNAGLDMIMVPMNYTEFIDGLTSL  335

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLFENP ADYSLA  +G   HR+LAREAVRKSLVL
Sbjct  336   VKKNAIPMSRIDDAVKRILRVKFVMGLFENPLADYSLADQIGSPEHRELAREAVRKSLVL  395

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   +P+LPLPK A +ILVAG+HA+N+G QCGGWTITW+G SG  +T GTTIL+ I
Sbjct  396   LKNGKSSDKPILPLPKKAPKILVAGSHADNIGNQCGGWTITWQGQSGNNMTTGTTILNAI  455

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T + Y E   ++++KSN F+YAIVVVGEKPY+E  GD LNLT+PA G++TIKN
Sbjct  456   KNTVDKETVVEYKEQPTQDYVKSNGFSYAIVVVGEKPYAETDGDSLNLTLPAHGIETIKN  515

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVVL+SGRP+V++P L ++D LVAAWLPGSEG GVADVLFGDY FTGKLSRT
Sbjct  516   VCGA-VKCVVVLISGRPVVIQPFLHNIDGLVAAWLPGSEGTGVADVLFGDYGFTGKLSRT  574

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTV QLPMNVGDRHYDPLFPFGFGLTT   +
Sbjct  575   WFKTVHQLPMNVGDRHYDPLFPFGFGLTTAAGK  607



>gb|KHN20835.1| Lysosomal beta glucosidase [Glycine soja]
Length=628

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/450 (72%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKVVQAMTEIIPGLQGDIPPNSRKGVPFVAGKKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   HGL+SIHMP Y  SIIKGVST+M SYSS NG KMHAN +L+TDF
Sbjct  235   GGTTKGINENNTVISRHGLLSIHMPAYYNSIIKGVSTIMISYSSWNGQKMHANHNLITDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+   I AGIDM+MVP NY+ FI    S 
Sbjct  295   LKNTLRFRGFVISDWQGIDRITTPSHANYTYSIYAGITAGIDMIMVPYNYTEFIDGLTSQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG + HR LAR+AVRKSLVL
Sbjct  355   VKNNLIPMSRIDDAVKRILRVKFIMGLFENPLADYSLVKQLGSKKHRKLARKAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGL-SGYITAGTTILSGI  577
             LKNG+D  QPLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+GL +  +T GTTILS I
Sbjct  415   LKNGEDADQPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLETNNLTKGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T++VY E+ + +++KSN F+YAIVVVGEKPY+E  GD +NLTI   G DTI N
Sbjct  475   KNTVDKDTEVVYKENPDLDYVKSNGFSYAIVVVGEKPYAETNGDSMNLTISEPGPDTIMN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GVKCV V++SGRP+V++P+L  +DALVAAWLPGSEG GV DVLFGDY F GKL RT
Sbjct  535   VC-GGVKCVAVIISGRPVVIQPYLHLIDALVAAWLPGSEGHGVTDVLFGDYGFRGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPFGFGL TK
Sbjct  594   WFKTVDQLPMNVGDSHYDPLFPFGFGLETK  623



>ref|XP_009619848.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=624

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/450 (72%), Positives = 366/450 (81%), Gaps = 4/450 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             R+PRWGRCYESYSEDV IV+SMTEIIPGLQGDVP N S+GVP+V GK KV ACAKH+VAD
Sbjct  173   RNPRWGRCYESYSEDVNIVRSMTEIIPGLQGDVPANMSKGVPFVDGKKKVVACAKHFVAD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV D  GL SIHMP Y  S+IKGV+TVMASYSS+NG +MHAN HLLT F
Sbjct  233   GGTVNGIDENNTVIDSQGLFSIHMPAYYDSVIKGVATVMASYSSLNGERMHANTHLLTGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GI+RIT   +SNYTYSV  S+ AG+DM+MVP NY+ FI     L
Sbjct  293   LKERLNFRGFVISDWEGINRITNPANSNYTYSVQASVMAGVDMIMVPENYTDFIGNLTFL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN F+PMSRIDDAV RILRVKF MGLFE+P AD SLA YLGCQ HR+LAREAVRKSLVL
Sbjct  353   VKNNFVPMSRIDDAVKRILRVKFVMGLFEDPMADLSLAKYLGCQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   QPLLPLPK A RILVAGTHA NLGYQCGGWTI W+G+ G  +T GTTI   I
Sbjct  413   LKNGKKPDQPLLPLPKKARRILVAGTHAENLGYQCGGWTIQWQGVPGNNLTIGTTISKAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY +  N   ++S+ F YAIVVVGE PY+E +GD  NLTI   G   IKN
Sbjct  473   MNTVDPSTEVVYQQ--NPVLVESSQFDYAIVVVGEPPYAEMYGDSSNLTILDPGPSIIKN  530

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP++  MDALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  531   VCGI-VKCVVVVISGRPVVIEPYIERMDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  589

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  590   WFKRVDQLPMNVGDPHYDPLFPFGFGLTTQ  619



>ref|XP_010908052.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=660

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/449 (72%), Positives = 368/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED  IV+ MTEIIPGLQGD+P N+S+GVPYV GK KVAACAKHYV D
Sbjct  176   RDPRWGRCYESFSEDYHIVREMTEIIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNTV D+HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHAN  L+T F
Sbjct  236   GGTHDGINENNTVIDYHGLLSIHMPAYDISIIKGVSTVMVSYSSWNGAKMHANHDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI+   SL
Sbjct  296   LKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAV RIL VKFTMGLFENP AD SL   LG + HR+LAREAVRKSLVL
Sbjct  356   VHKNIIPMSRIDDAVRRILLVKFTMGLFENPLADLSLVDQLGKKEHRELAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   + LLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  416   LKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGDSGNITVGTTILDAIK  475

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T I+Y+E+ +   +K+NDF++AIVVVGE PY+E  GD LNLT+P  G  T++ V
Sbjct  476   STVDPSTTIIYSENPDASSVKNNDFSHAIVVVGEPPYTETAGDSLNLTLPDPGPSTVQTV  535

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVV++SGRP+V+EP++P MDALVAAWLPGSEGQGVADVLFGDY F+GKL RTW
Sbjct  536   CGS-VKCVVVVISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTW  594

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  595   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  623



>gb|KEH25593.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=622

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/449 (72%), Positives = 371/449 (83%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+SMTE+IPGLQGD+P N+S+GVPYVGG  KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHKIVQSMTELIPGLQGDLPANWSKGVPYVGGSKKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+SIHMP Y  SIIKGVST+M SYSS NG KMHANR L+T F
Sbjct  235   GGTTKGINENNTVATRHELLSIHMPAYYNSIIKGVSTIMVSYSSWNGEKMHANRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+   +NAGIDM+M+P NY+ FI     L
Sbjct  295   LKNTLRFRGFVISDWEGIDRITSPPHANYTYSIEAGVNAGIDMIMIPFNYTEFIDGLTLL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG Q HR+LAREAVRKSLVL
Sbjct  355   VKSNAIPMSRIDDAVKRILRVKFVMGLFENPLADYSLTDQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+GLSG  IT+GTTILS I
Sbjct  415   LKNGENADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIQWQGLSGNNITSGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T++VY E+ + +++KSNDF+YA+VVVGE PY+E  GD LNLTI   G +TI N
Sbjct  475   KNTVDKETKVVYEENPSLDYVKSNDFSYAVVVVGETPYAETNGDSLNLTISGNGTETINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVVLV+GRP+ ++P+L  +D LVAAWLPGSEG GVADVLFGDY FTGKL+RT
Sbjct  535   VCGR-VKCVVVLVTGRPVAIQPYLNKIDGLVAAWLPGSEGTGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFGL++
Sbjct  594   WFKTVDQLPMNVGDSHYDPLFPFGFGLSS  622



>ref|XP_008777968.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Phoenix 
dactylifera]
Length=660

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 369/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED ++V+ MTE+IPGLQGD+P N+S+GVPYV GK KVAACAKHYV D
Sbjct  176   RDPRWGRCYESFSEDYQVVRDMTEVIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+S+HMP Y  SIIKGVSTVM SYSS NG KMHAN  L+T F
Sbjct  236   GGTHDGINENNTIIDSHGLLSMHMPAYDISIIKGVSTVMVSYSSWNGEKMHANHDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI+   SL
Sbjct  296   LKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+   IPM+RIDDAV RIL VKFTMGLFENP +D SL   LG + HR LAREAVRKSLVL
Sbjct  356   VQKNIIPMTRIDDAVRRILLVKFTMGLFENPLSDLSLVDQLGKKEHRVLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   + LLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  416   LKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGASGNITIGTTILDAIK  475

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T I+Y+E+ +  F+K NDF+YAIVVVGE PY+E  GD LNLT+P  G  TI+ V
Sbjct  476   STVDPSTTIIYSENPDASFVKDNDFSYAIVVVGEPPYTETAGDSLNLTLPDPGPSTIQTV  535

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+A VKCVVV++SGRP+V+EP++P MDALVAAWLPGSEGQGVADVLFGDY F+GKL RTW
Sbjct  536   CSA-VKCVVVIISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTW  594

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  595   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  623



>ref|XP_008777967.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Phoenix 
dactylifera]
Length=661

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 369/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED ++V+ MTE+IPGLQGD+P N+S+GVPYV GK KVAACAKHYV D
Sbjct  177   RDPRWGRCYESFSEDYQVVRDMTEVIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+S+HMP Y  SIIKGVSTVM SYSS NG KMHAN  L+T F
Sbjct  237   GGTHDGINENNTIIDSHGLLSMHMPAYDISIIKGVSTVMVSYSSWNGEKMHANHDLVTGF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI+   SL
Sbjct  297   LKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+   IPM+RIDDAV RIL VKFTMGLFENP +D SL   LG + HR LAREAVRKSLVL
Sbjct  357   VQKNIIPMTRIDDAVRRILLVKFTMGLFENPLSDLSLVDQLGKKEHRVLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   + LLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  417   LKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGASGNITIGTTILDAIK  476

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T I+Y+E+ +  F+K NDF+YAIVVVGE PY+E  GD LNLT+P  G  TI+ V
Sbjct  477   STVDPSTTIIYSENPDASFVKDNDFSYAIVVVGEPPYTETAGDSLNLTLPDPGPSTIQTV  536

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+A VKCVVV++SGRP+V+EP++P MDALVAAWLPGSEGQGVADVLFGDY F+GKL RTW
Sbjct  537   CSA-VKCVVVIISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTW  595

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  596   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  624



>ref|XP_004489688.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=628

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/450 (72%), Positives = 370/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SMTEIIPGLQGD+P+N  +GVP+V G  KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHTIVQSMTEIIPGLQGDIPSNSPKGVPFVAGNKKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+SIHMP Y  SII GVST+M SYSS NG KMHANR L+T F
Sbjct  235   GGTTKGINENNTVVSRHELLSIHMPAYYNSIIHGVSTIMVSYSSWNGEKMHANRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFV SDW GID IT    +NYTYS+  ++NAGIDM+M+P NY+ FI     L
Sbjct  295   LKNTLRFRGFVTSDWQGIDLITSTPHANYTYSIQTAVNAGIDMIMIPYNYTEFIDGLTFL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG Q HR+LAREAVRKSLVL
Sbjct  355   VKNNAIPMSRIDDAVKRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +PLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+G SG +IT+GTTILS I
Sbjct  415   LKNGENADKPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGHSGNHITSGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T I+Y E  + +++KSN+F+YAIVVVGEKPY+E  GD LNLTI + G DTI N
Sbjct  475   KNTVDKDTDIIYKEYPDPDYVKSNNFSYAIVVVGEKPYAETSGDSLNLTISSHGYDTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC AGVKCVVVL++GRP+V++P+L  ++ LVAAWLPGSEG GV DVLFGDY F+GKLSRT
Sbjct  535   VC-AGVKCVVVLITGRPVVIQPYLDKIEGLVAAWLPGSEGHGVTDVLFGDYGFSGKLSRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  594   WFKSVDQLPMNVGDSHYDPLFPFGFGLTTQ  623



>gb|KHM99112.1| Lysosomal beta glucosidase [Glycine soja]
Length=586

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/454 (69%), Positives = 375/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+ +N  +GVP+V GK KVAACAKHYV D
Sbjct  134   RDPRWGRCYESYSEDPKIVQAMTEIIPGLQGDISDNSRKGVPFVAGKNKVAACAKHYVGD  193

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV  ++GL+ IHMP Y  SI+KGVSTVM SYSS NG KMHAN  L+TD+
Sbjct  194   GGTTKGINENNTVVSYNGLLRIHMPAYHDSIVKGVSTVMVSYSSWNGQKMHANHFLVTDY  253

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F GFVISDWLGIDRIT    SNY+YS+   + AGIDM+MVP N++ FI      
Sbjct  254   LKNKLKFMGFVISDWLGIDRITSPSHSNYSYSIQVGVGAGIDMIMVPFNFTEFIDVLTYQ  313

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP AD SL + LG + HR LAREAVRKSLVL
Sbjct  314   VKNNIIPVSRIDDAVRRILRVKFVMGLFENPHADISLVNQLGSEEHRQLAREAVRKSLVL  373

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  ++PLLPLPK A++ILVAG+HA+NLGYQCGGWTITW+G  G  +T GTTIL  +
Sbjct  374   LKNGKSAEKPLLPLPKKAAKILVAGSHADNLGYQCGGWTITWQGGGGNNLTVGTTILDAV  433

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               A+DPAT++VYNE+ +  F+KSN+F+YAIV+VGE PY+E FGD LNLTIP  G  TI N
Sbjct  434   KQAIDPATKVVYNENPDSNFVKSNNFSYAIVIVGEHPYAETFGDSLNLTIPEPGPSTITN  493

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + ++CVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGV D+LFGDY FTGKL+RT
Sbjct  494   VCGS-IQCVVVLITGRPVVIQPYLSKIDALVAAWLPGTEGQGVTDLLFGDYGFTGKLART  552

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD++YDPLFPFGFGL+T  +R+
Sbjct  553   WFKTVDQLPMNVGDKYYDPLFPFGFGLSTNTTRY  586



>ref|XP_006361124.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=628

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 371/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQGD+P N  +GVP+V GK+KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHNIVRTMTEIIPGLQGDLPANSRKGVPFVDGKSKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G+DENNTV + +GL  IHMP Y  SIIKGVSTVM SYSS NG +MHANR L+T F
Sbjct  235   GGTVRGIDENNTVINSNGLFGIHMPAYYDSIIKGVSTVMVSYSSWNGERMHANRDLVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYTYSV   ++AGIDM+MVP NY+ FI T   L
Sbjct  295   LKDRLNFRGFVISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYNEFIDTLTLL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPMSRIDDAV RILRVKFTMGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKDNIIPMSRIDDAVKRILRVKFTMGLFENPLADLSLVNQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILVAGTHA+NLGYQCGGWTI W+G++G  +T GTTILS I
Sbjct  415   LKNGKSTSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP+TQ+VY ++ +  F+KSN+F YAIVVVGE PY+E  GD  NLTI   G  TI N
Sbjct  475   KKTVDPSTQVVYQQNPDANFVKSNEFDYAIVVVGEVPYAEMMGDSSNLTITEPGPSTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV+VSGRP+VLEP++  +DA+VAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-VKCVVVIVSGRPVVLEPYVEKIDAVVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGDR+Y+PLFPFGFGLTT+  +
Sbjct  594   WFKSVDQLPMNVGDRNYNPLFPFGFGLTTQAVK  626



>ref|XP_009760946.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=624

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/450 (72%), Positives = 367/450 (82%), Gaps = 4/450 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             R+PRWGRCYESYSEDV IV+SMTEIIPGLQGDVP N S+GVP+V GK KV ACAKH+VAD
Sbjct  173   RNPRWGRCYESYSEDVNIVRSMTEIIPGLQGDVPANMSKGVPFVDGKKKVVACAKHFVAD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV D  GL SIHMP Y  S+IKGV+TVMASYSS+NG +MHAN HLLT F
Sbjct  233   GGTVNGIDENNTVIDPQGLFSIHMPAYYDSVIKGVATVMASYSSLNGERMHANTHLLTGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GI+RIT   +SNYTYSV  S+ AG+DMVMVP NY+ FI     L
Sbjct  293   LKERLNFRGFVISDWEGINRITNPANSNYTYSVQASVMAGVDMVMVPENYTDFIGNLTFL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN F+PMSRIDDAV RILRVKF MGLFE+P AD S+A YLGC+ HR+LAREAVRKSLVL
Sbjct  353   VKNNFVPMSRIDDAVKRILRVKFVMGLFEDPMADLSMAKYLGCKEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   QPLLPLPK A RILVAGTHA+NLGYQCGGWTI W+G+ G  +T GTTI   I
Sbjct  413   LKNGKKPDQPLLPLPKKARRILVAGTHADNLGYQCGGWTIQWQGVPGNNLTIGTTISKAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+T++VY +  N   ++S+ F YAIVVVGE PY+E +GD  NLTI   G   IKN
Sbjct  473   MNTVDPSTEVVYQQ--NPVLVESSQFDYAIVVVGEPPYAEMYGDSSNLTILDPGPSIIKN  530

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             +C   VKCVVV++SGRP+V+EP++  MDALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  531   ICGT-VKCVVVVISGRPVVIEPYVEKMDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  589

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  590   WFKRVDQLPMNVGDPHYDPLFPFGFGLTTQ  619



>gb|AEP33579.1| b-1,4-glucanase [Gossypium aridum]
Length=627

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRRLAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHHADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILISGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_003551104.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=628

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/450 (72%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKVVQAMTEIIPGLQGDIPPNSRKGVPFVAGKKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   HGL+SIH+P Y  SIIKGVST+M SYSS NG KMHAN +L+TDF
Sbjct  235   GGTTKGINENNTVISRHGLLSIHVPAYYNSIIKGVSTIMISYSSWNGQKMHANHNLITDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+   I AGIDM+MVP NY+ FI    S 
Sbjct  295   LKNTLRFRGFVISDWQGIDRITTPSHANYTYSIYAGITAGIDMIMVPYNYTEFIDGLTSQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG + HR LAR+AVRKSLVL
Sbjct  355   VKNNLIPMSRIDDAVKRILRVKFIMGLFENPLADYSLVKQLGSKKHRKLARKAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGL-SGYITAGTTILSGI  577
             LKNG+D  QPLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+GL +  +T GTTILS I
Sbjct  415   LKNGEDADQPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLETNNLTKGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T++VY E+ + +++KSN F+YAIVVVGEKPY+E  GD +NLTI   G DTI N
Sbjct  475   KNTVDKDTEVVYKENPDLDYVKSNGFSYAIVVVGEKPYAETNGDSMNLTISEPGPDTIMN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GVKCV V++SGRP+V++P+L  +DALVAAWLPGSEG GV DVLFGDY F GKL RT
Sbjct  535   VC-GGVKCVAVIISGRPVVIQPYLHLIDALVAAWLPGSEGHGVTDVLFGDYGFRGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPFGFGL TK
Sbjct  594   WFKTVDQLPMNVGDSHYDPLFPFGFGLETK  623



>ref|XP_008391778.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=820

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/449 (72%), Positives = 373/449 (83%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQG++P N  +G+P+VGG  KVAACAKHYV D
Sbjct  367   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGELPANSRKGIPFVGGNKKVAACAKHYVGD  426

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV + HGL+SIHMP Y  SIIKGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  427   GGTTRGINENNTVINRHGLLSIHMPGYYDSIIKGVATIMVSYSSWNGVKMHANHDLVTGF  486

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NY+YS+   +NAGIDMVM+P NY+ FI    SL
Sbjct  487   LKNTLHFRGFVISDWEGIDRITSPPHANYSYSIQAGVNAGIDMVMIPYNYTEFIDGLTSL  546

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFE P AD SL   LG + HR+LAREAVR+SLVL
Sbjct  547   VKNGIIPMSRIDDAVKRILRVKFVMGLFEEPLADRSLVDQLGSKEHRELAREAVRRSLVL  606

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   + LLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+GLSG  +T GTTILS I
Sbjct  607   LKNGKSADELLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTEGTTILSAI  666

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T++VY E+ + +F+KSNDF+YAIVVVGE PY+E FGD LNLTIP  G   I N
Sbjct  667   KNTVDPKTKVVYKENPDADFVKSNDFSYAIVVVGEHPYAETFGDSLNLTIPDPGPSAITN  726

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRP+V++P++P MDALVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  727   VCGS-VKCVVIVISGRPVVIQPYVPLMDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRT  785

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFG+GLTT
Sbjct  786   WFKTVDQLPMNVGDAHYDPLFPFGYGLTT  814



>gb|KDP39682.1| hypothetical protein JCGZ_02702 [Jatropha curcas]
Length=644

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/456 (71%), Positives = 378/456 (83%), Gaps = 8/456 (2%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+SMTEIIPGLQGD+P+   +GVP+V  KTKVAACAKHYV D
Sbjct  186   RDPRWGRCYESYSEDPKVVQSMTEIIPGLQGDIPSGSPKGVPFVADKTKVAACAKHYVGD  245

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++E+NTVT  HGL+SIHMP Y  SIIKGVSTVM SYSS NG+KMH N  L+T F
Sbjct  246   GGTTNGINEDNTVTSRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGIKMHTNGELITGF  305

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDM------VMVPNNYSRFI  952
             LK  LRFRGFVISDW GIDRIT    +NYTYS+   I+AGIDM      +MVP NY+ FI
Sbjct  306   LKKTLRFRGFVISDWQGIDRITSPPHANYTYSIQAGISAGIDMASPILQIMVPFNYTEFI  365

Query  951   STALSLVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAV  772
                   VK   IPMSRIDDAV RILRVKFTMGLFENP+AD SL + LG Q HR+LAREAV
Sbjct  366   DGLTDQVKKNIIPMSRIDDAVKRILRVKFTMGLFENPYADESLVNQLGSQEHRELAREAV  425

Query  771   RKSLVLLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGT  595
             RKSLVLLKNGK+  +PLLPLPK +S+ILVAG+HA+NLGYQCGGWTI W+GLSG   T+GT
Sbjct  426   RKSLVLLKNGKNANEPLLPLPKKSSKILVAGSHADNLGYQCGGWTIEWQGLSGNNHTSGT  485

Query  594   TILSGIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAG  415
             TIL+ I N VDP+T+IVYNE+ + +F+KSN F+YAIVVVGE PY+E  GD +NLT+   G
Sbjct  486   TILTAIKNTVDPSTKIVYNENPDADFVKSNKFSYAIVVVGEHPYAETQGDSMNLTLSNPG  545

Query  414   LDTIKNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFT  235
               TI+NVC A VKCVV++VSGRP+V++P++ S++ALVAAWLPG+EGQGVADVLFGDY FT
Sbjct  546   PSTIQNVCGA-VKCVVIVVSGRPVVMQPYVNSIEALVAAWLPGTEGQGVADVLFGDYGFT  604

Query  234   GKLSRTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             GKLSRTWFK+VDQLPMNVGDR+YDPLFPFGFGLTT+
Sbjct  605   GKLSRTWFKSVDQLPMNVGDRNYDPLFPFGFGLTTE  640



>gb|AEP33563.1| b-1,4-glucanase [Gossypium turneri]
 gb|AEP33571.1| b-1,4-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEP33575.1| b-1,4-glucanase [Gossypium armourianum]
 gb|AEP33576.1| b-1,4-glucanase [Gossypium harknessii]
Length=627

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRRLAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHHADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILISGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|AEP33580.1| b-1,4-glucanase [Gossypium gossypioides]
Length=627

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>emb|CBI22347.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 371/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQG++P N  +GVPYV GK KVAACAKH+V D
Sbjct  80    RDPRWGRCYESYSEDPNIVRAMTEIIPGLQGEIPANSRKGVPYVNGKDKVAACAKHFVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHAN  L+T F
Sbjct  140   GGTTNGINENNTVIDRHGLLSIHMPAYYSSIIKGVATVMVSYSSWNGQKMHANHELVTGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV   + AGIDMVM+P N++ FI    +L
Sbjct  200   LKNTLQFRGFVISDWQGIDRITSPPHANYTYSVQAGVQAGIDMVMLPFNHTEFIDILTNL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V++ FIPMSRIDDAV RILRVKF+MGLFENP A+ S    LG QAHRDLAREAVRKSLVL
Sbjct  260   VESNFIPMSRIDDAVRRILRVKFSMGLFENPLANLSFVDQLGSQAHRDLAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +   PLLPLPK A++ILVAGTHA++LGYQCGGWTITW+GLSG   T GTTILS I
Sbjct  320   LKNGDETDAPLLPLPKKANKILVAGTHAHDLGYQCGGWTITWQGLSGNNHTTGTTILSAI  379

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVDP+T+IV+ E+ + EF+KSN+F+YA+VV+GE PY+E  GD LNLTI   G  TI N
Sbjct  380   SAAVDPSTEIVFTENPDAEFVKSNNFSYAVVVIGEPPYAETAGDSLNLTISEPGPSTITN  439

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +GVKCVVV++SGRP+V++P+L S+ ALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  440   VC-SGVKCVVVVISGRPVVIQPYLSSIHALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRT  498

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD HYDPLFP GFGLTT+
Sbjct  499   WFKTVDQLPMNSGDPHYDPLFPIGFGLTTQ  528



>ref|XP_003594509.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES64760.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=660

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/453 (72%), Positives = 370/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGD+P    +GVPYVGGKTKVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDPKIVREMTEIIPGLQGDIPPGARKGVPYVGGKTKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENN V DWH LMS+HMP Y  SIIKGVSTVMASYSS NGVKMHANR L+T +
Sbjct  237   GGTTKGLNENNAVVDWHTLMSLHMPAYIDSIIKGVSTVMASYSSWNGVKMHANRDLITGY  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GID+IT    SNYTYSV  SI AG+DMVMVP  +  FI     L
Sbjct  297   LKNTLKFKGFVISDWQGIDKITTPPGSNYTYSVQASIEAGVDMVMVPYEFEDFIKDLTLL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPM RIDDAV RIL VKFTMGLFENP AD+SL + LG QAHRDLAREAVRKSLVL
Sbjct  357   VKNNIIPMDRIDDAVERILVVKFTMGLFENPLADFSLVNELGSQAHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK++   LLPLPK A +ILVAGTHA+NLGYQCGGWTI W+G  G   T+GTTILS I
Sbjct  417   LKNGKNQSAQLLPLPKKARKILVAGTHADNLGYQCGGWTIKWQGFIGNGDTSGTTILSAI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E+ +  F+KSN+F YAIVVVGE PY+E  GD   LTI   G + I N
Sbjct  477   NSTVDPSTEVVFRENPDAGFVKSNNFEYAIVVVGEPPYAETAGDSTALTILDPGPNIINN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV V+GRP+V+EP+L S+DALVAAWLPGSEGQGVADVLFGDY FTGKL+RT
Sbjct  537   VCGA-VKCVVVTVTGRPVVIEPYLSSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLART  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFP+GFGLT++  R
Sbjct  596   WFKSVDQLPMNVGDPHYDPLFPYGFGLTSESVR  628



>ref|XP_011094175.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=632

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/448 (70%), Positives = 369/448 (82%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQGD+P N  +GVP++ G+ KV A AKHYV D
Sbjct  180   RDPRWGRCYESYSEDPKVVRAMTEIIPGLQGDIPANSRKGVPFLAGQQKVLATAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT+   H L+ IHMP Y  SIIKGV T+M SYSS NGVKMHANR L+T F
Sbjct  240   GGTTKGINENNTLASRHDLLRIHMPAYHDSIIKGVGTIMISYSSWNGVKMHANRDLITGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW G+DRIT    +NYTYS++  + AGIDM+M+P NY+ FI    SL
Sbjct  300   LKNTLRFRGFVISDWQGLDRITSPPHANYTYSIIAGVGAGIDMIMIPYNYTEFIDGLTSL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKFT+GLFE+P ADYS+  YLG Q HR+LAREAVRKSLVL
Sbjct  360   VKNNFIPMSRIDDAVKRILRVKFTIGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG+   +PL+PLPK AS+ILVAGTHA+N+G QCGGWTI W+G  G +T GTTIL+ I 
Sbjct  420   LKNGESANKPLIPLPKKASKILVAGTHADNIGNQCGGWTIQWQGQPGNVTVGTTILTAIR  479

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N V P T+IV+NE+ +  ++KSND++YAIVVVGE PYSE FGD  NLTIP  G   I NV
Sbjct  480   NTVHPETKIVFNENPDPGYVKSNDYSYAIVVVGEPPYSETFGDSTNLTIPDPGPSIITNV  539

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ VKCVVVL++GRP+ ++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL RTW
Sbjct  540   CAS-VKCVVVLITGRPVAIQPYLTQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTW  598

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FKTVDQLPMNVGD+HYDPLFPFG+GLTT
Sbjct  599   FKTVDQLPMNVGDQHYDPLFPFGYGLTT  626



>gb|AEP33562.1| b-1,4-glucanase [Gossypium schwendimanii]
Length=627

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAR+AVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELARDAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYAHQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TIKN
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIKN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|KDP34274.1| hypothetical protein JCGZ_12843 [Jatropha curcas]
Length=660

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 365/449 (81%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MTEIIPGLQGDVP N  RGVPYVGGK KVAACAKH+V D
Sbjct  173   RDPRWGRCYESYSEDHKVVEQMTEIIPGLQGDVPANSRRGVPYVGGKKKVAACAKHFVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS NG KMHANR L+T F
Sbjct  233   GGTTKGINENNTVIDMHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELITGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    +NY+YSV  +I AGIDMVMVP NYS FI     L
Sbjct  293   LKGTLKFKGFVISDWQGIDRITSPPHANYSYSVQAAIQAGIDMVMVPFNYSEFIDDLTHL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPM RIDDAV RIL VKFTMGLFENP AD S  + LG Q HRDLAREAVRKSLVL
Sbjct  353   VKNNVIPMDRIDDAVGRILFVKFTMGLFENPLADLSFVNELGSQEHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+   PLLPLPK AS +LVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL  I
Sbjct  413   LKNGKNGTDPLLPLPKKASAVLVAGTHADNLGYQCGGWTIAWQGFSGNNYTRGTTILGAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E+ +  F+KSN FAYAIVVVGE PY+E  GD  +LT+   G   I N
Sbjct  473   RSTVDPSTKVVFQENPDSNFVKSNKFAYAIVVVGEPPYAETAGDSTDLTMMDPGPSVINN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKC+VV++SGRP+V+EP++ S+DALVAAWLPGSEGQGV+DVLFGDY FTGKLSRT
Sbjct  533   VCEA-VKCIVVIISGRPIVIEPYVSSIDALVAAWLPGSEGQGVSDVLFGDYGFTGKLSRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK V+QLPMNVGD HYDPLFPFGFGL T
Sbjct  592   WFKNVEQLPMNVGDSHYDPLFPFGFGLKT  620



>gb|EPS66822.1| hypothetical protein M569_07948 [Genlisea aurea]
Length=610

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/449 (71%), Positives = 369/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +VK+MTEII GLQG++P+N  +GVP++  +  VAACAKHYV D
Sbjct  158   RDPRWGRCYESYSEDPAVVKTMTEIINGLQGEIPSNSMKGVPFLASQKHVAACAKHYVGD  217

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV   H L+SIHMP Y  SII+GVSTVM SYSS NGVKMHANR L+T F
Sbjct  218   GGTTEGINENNTVASRHNLLSIHMPAYFDSIIRGVSTVMISYSSWNGVKMHANRDLITGF  277

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG  RFRGFVISDW GIDRIT     NYTYS+L  INAGIDM+MVP NY+ FI     L
Sbjct  278   LKGTQRFRGFVISDWQGIDRITSPPHLNYTYSILTGINAGIDMIMVPYNYTEFIDGLTEL  337

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK  FIPMSRIDDAV RILRVKFTMGLFE+P ADYSL   LG Q HRD+AREAVRKSLVL
Sbjct  338   VKANFIPMSRIDDAVKRILRVKFTMGLFEHPLADYSLTKQLGSQEHRDIAREAVRKSLVL  397

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG+   +PLLPL K A +ILVAGTHA+N+GYQCGGWTITW+G SG  T GTTIL GI 
Sbjct  398   LKNGESADEPLLPLSKTAPKILVAGTHADNIGYQCGGWTITWQGGSGATTEGTTILEGIK  457

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AV   T +V+NE+ + ++++SN+F++A+VVVGE PY+E  GD LNLTIP+ G   I +V
Sbjct  458   KAVSKETAVVFNENPSSDYVRSNNFSHAVVVVGEFPYAETLGDSLNLTIPSPGPSIIADV  517

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVVL+SGRPLV+EP++  +DALVAAWLPGSEGQGVADVLFGDY FTGKLSRTW
Sbjct  518   CGS-VKCVVVLISGRPLVIEPYVSQVDALVAAWLPGSEGQGVADVLFGDYGFTGKLSRTW  576

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             F++VDQLPMNVGD+HYDPLFPFGFGLTT+
Sbjct  577   FRSVDQLPMNVGDKHYDPLFPFGFGLTTE  605



>ref|XP_010054740.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW89890.1| hypothetical protein EUGRSUZ_A02118 [Eucalyptus grandis]
Length=631

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 370/449 (82%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P    +GVPYV GK  VAAC+KHYV D
Sbjct  178   RDPRWGRCYESYSEDPKIVQAMTEIIPGLQGDLPAGSRKGVPYVAGKKNVAACSKHYVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTVTDWHGL+ IHMP Y  SIIKGVSTVM SYSS NGVKMHAN +L+T F
Sbjct  238   GGTTNGVNENNTVTDWHGLLGIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANGNLVTGF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   I+AGIDMVMVP+N++ FI      
Sbjct  298   LKNKLRFRGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMVMVPSNFTEFIDGLTFQ  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RILRVKFTMGLFE+P AD SL + LG Q HR+LAREAVR+SLVL
Sbjct  358   VKNKIIPMSRIDDAVRRILRVKFTMGLFEDPLADTSLVNQLGSQEHRELAREAVRRSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+    PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+GLSG  +T+GTTILS I
Sbjct  418   LKNGEGADAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIQWQGLSGNNLTSGTTILSAI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T++VY E+ + + +KS  F+YAIVVVGE PY+E FGD  NLTI   G  TI N
Sbjct  478   KNTVDPKTKVVYEENPDTDTVKSGKFSYAIVVVGEHPYAETFGDSSNLTIADPGTSTIGN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P++  MDA+VAAWLPG+EGQGVADVLFGDY FTGKL RT
Sbjct  538   VCGA-VKCVVVIISGRPVVIQPYVAVMDAIVAAWLPGTEGQGVADVLFGDYGFTGKLPRT  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLP+NVGD HYDPLFPFGFGLTT
Sbjct  597   WFKTVDQLPLNVGDPHYDPLFPFGFGLTT  625



>ref|XP_004489700.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=628

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/450 (71%), Positives = 370/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+SMTEIIPGLQGD+P+N  +GVP+V G  KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHTVVQSMTEIIPGLQGDIPSNSPKGVPFVAGNKKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+SIHMP Y  SII+GVST+M SYSS NG KMHANR L+T F
Sbjct  235   GGTTKGINENNTVVSRHELLSIHMPAYYNSIIQGVSTIMVSYSSWNGEKMHANRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  ++NAGIDM+M+P NY+ FI     L
Sbjct  295   LKNTLRFRGFVISDWQGIDRITSTPHANYTYSIQTAVNAGIDMIMIPYNYTEFIDGLTFL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG Q HR+LAREAVRKSLVL
Sbjct  355   VKNNAIPMSRIDDAVKRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +PLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+GLSG YIT+GTTIL  I
Sbjct  415   LKNGENADKPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLSGNYITSGTTILGAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD  T I+Y E  + +++KSN+F+YAIVVVGEKPY+E  GD LNLTI + G DTI N
Sbjct  475   KNTVDKDTNIIYKEYPDLDYVKSNNFSYAIVVVGEKPYAETSGDSLNLTISSHGYDTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC AG+K VVVL++GRP+V++P+L  ++ LVAAWLP SEG GV DVL GDY F+GKLSRT
Sbjct  535   VC-AGMKWVVVLITGRPVVIQPYLDKIEGLVAAWLPRSEGHGVTDVLLGDYGFSGKLSRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  594   WFKSVDQLPMNVGDSHYDPLFPFGFGLTTQ  623



>emb|CBI27259.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK+MT II GLQG++P N   G+PYVGGK KVAACAKH+V D
Sbjct  80    RDPRWGRCYESYSEDPKIVKAMTTIITGLQGEIPTNSRAGMPYVGGKNKVAACAKHFVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV DW GLM IHMP Y PSI +GV+TVM SYSS NG KMHAN  L+T F
Sbjct  140   GGTTHGINENNTVIDWKGLMKIHMPAYHPSIGRGVATVMVSYSSWNGKKMHANHQLITGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK +L+F+GFVISDW GIDRIT    +NYTYSV   I AGIDMVMVP N+  FI     L
Sbjct  200   LKNNLKFKGFVISDWEGIDRITSPPHANYTYSVQAGIQAGIDMVMVPFNHIEFIGILTKL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+++ IPMSRIDDAV+RILRVKFTMGLFENP AD SL   LG QAHRDLAREAVRKS+VL
Sbjct  260   VESKVIPMSRIDDAVSRILRVKFTMGLFENPLADLSLVDQLGSQAHRDLAREAVRKSMVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+    PLLP PK A RILVAGTHA+NLGYQCGGWTITW+GL G   T GTTILS I
Sbjct  320   LKNGETADAPLLPFPKKADRILVAGTHADNLGYQCGGWTITWQGLDGNNHTQGTTILSAI  379

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + A+DP+T++VY E+ + EF+KS +F+YAIVVVGE PY+E  GD+ NLTIP  G  TI N
Sbjct  380   SAAIDPSTELVYRENPDAEFVKSGNFSYAIVVVGEHPYAETAGDNSNLTIPEPGPSTITN  439

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  G+KCVVV++SGRPLV++P+LPS+ ALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  440   VC-GGIKCVVVVISGRPLVIQPYLPSISALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  498

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+QLPMN  D +YDPLFP GFGLTT+
Sbjct  499   WFKTVEQLPMNFDDAYYDPLFPLGFGLTTE  528



>ref|XP_010266636.1| PREDICTED: lysosomal beta glucosidase-like [Nelumbo nucifera]
Length=665

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/450 (71%), Positives = 375/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ MT+IIPGLQG++P N  +GVP+V GKTKVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHSIVQLMTDIIPGLQGEIPANSQKGVPFVAGKTKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   +GL+SIHMP Y  SI KGV+T+M SYSS NG KMHAN  L+TD+
Sbjct  235   GGTTKGINENNTVIGRNGLLSIHMPAYLDSISKGVATIMVSYSSWNGKKMHANWDLVTDY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK HL+F GFVISDW+GIDRIT    +NY+YSV  +I+AGIDMVMVP NY+ F+      
Sbjct  295   LKNHLQFGGFVISDWMGIDRITSPPHANYSYSVQAAISAGIDMVMVPYNYTEFVDDLTFQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N+ IPMSRIDDAV+RILRVKFTMGLFENP AD +LA  LG   HR+LAREAVRKSLVL
Sbjct  355   VQNKIIPMSRIDDAVSRILRVKFTMGLFENPLADLTLADELGSHEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   +PLLPLPK A +ILVAG+HA+NLG QCGGWTITW+GL G  +T+GTTIL  I
Sbjct  415   LKNGKSADKPLLPLPKKAPKILVAGSHADNLGAQCGGWTITWQGLEGNSLTSGTTILGAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+TQ+VY+E+ +  F+KSN F+YAIVVVGE PY E FGD ++L IP  G  TI N
Sbjct  475   KNTVDPSTQVVYSENPDTNFIKSNKFSYAIVVVGEHPYVETFGDSMDLKIPEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC++ VKC+VV++SGRP+V++P++ S+DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCSS-VKCIVVIISGRPVVIQPYIDSIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTR  623



>gb|KHG06451.1| gluA [Gossypium arboreum]
Length=611

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 367/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  158   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  217

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  218   GGTTKGINENNTVINWHDLLSIHMPGYYSSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  277

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  278   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFL  337

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  338   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  397

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  398   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  457

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  458   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  517

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEG GVADVLFGDY F+GKL RT
Sbjct  518   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRT  576

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  577   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  609



>ref|XP_003545548.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=627

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/454 (69%), Positives = 374/454 (82%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+ +N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKIVQAMTEIIPGLQGDISDNSRKGVPFVAGKNKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV  ++GL+ IHMP Y  SI+KGVSTVM SYSS NG KMHAN  L+TD+
Sbjct  235   GGTTKGINENNTVVSYNGLLRIHMPAYHDSIVKGVSTVMVSYSSWNGQKMHANHFLVTDY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDWLGIDRIT    SNY+YS+   + AGIDM+MVP N++ FI      
Sbjct  295   LKNKLKFRGFVISDWLGIDRITSPSHSNYSYSIQVGVGAGIDMIMVPFNFTEFIDVLTYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP AD SL + LG + HR LAREAVRKSLVL
Sbjct  355   VKNNIIPVSRIDDAVRRILRVKFVMGLFENPHADISLVNQLGSEEHRQLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  ++PLLPLPK A++ILVAG+HA+NLGYQCGGWTITW+G  G  +T GTTIL  +
Sbjct  415   LKNGKSAEKPLLPLPKKAAKILVAGSHADNLGYQCGGWTITWQGGGGNNLTVGTTILDAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               A+DPAT++VYNE+ +  F+KSN+F+YAIV VGE PY+E FGD LNLTI   G  TI N
Sbjct  475   KQAIDPATKVVYNENPDSNFVKSNNFSYAIVTVGEHPYAETFGDSLNLTISEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + ++CVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGV D+LFGDY FTGKL+RT
Sbjct  535   VCGS-IQCVVVLITGRPVVIQPYLSKIDALVAAWLPGTEGQGVTDLLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD++YDPLFPFGFGL+T  +R+
Sbjct  594   WFKTVDQLPMNVGDKYYDPLFPFGFGLSTNTTRY  627



>gb|AEP33561.1| b-1,4-glucanase [Gossypium laxum]
 gb|AEP33569.1| b-1,4-glucanase [Gossypium tomentosum]
Length=627

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYAHQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F++SN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVESNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDAL+AAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALIAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>emb|CBI22348.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 370/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQG++P N  +GVPYV GK KVAACAKH+V D
Sbjct  80    RDPRWGRCYESYSEDPNIVRAMTEIIPGLQGEIPANSRKGVPYVNGKDKVAACAKHFVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHAN  L+T F
Sbjct  140   GGTTNGINENNTVIDRHGLLSIHMPAYYSSIIKGVATVMVSYSSWNGKKMHANHELVTGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV   + AGIDMVM+P N++ FI    +L
Sbjct  200   LKNTLQFRGFVISDWQGIDRITSPPHANYTYSVQAGVQAGIDMVMLPFNHTEFIDILTNL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V++  IPMSRIDDAV RILRVKF+MGLFENP AD S    LG QAHRDLAREAVRKSLVL
Sbjct  260   VESNVIPMSRIDDAVRRILRVKFSMGLFENPLADLSFVDQLGSQAHRDLAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +   PLLPLPK A++ILVAGTHA++LGYQCGGWTITW+GLSG   T GTTILS I
Sbjct  320   LKNGDEADAPLLPLPKKANKILVAGTHAHDLGYQCGGWTITWQGLSGNNHTTGTTILSAI  379

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVDP+T+IV+ E+ + EF+KSN+F+YA+VV+GE PY+E  GD LNLTI   G  TI N
Sbjct  380   SAAVDPSTEIVFTENPDAEFVKSNNFSYAVVVIGEPPYAETAGDSLNLTISEPGPSTITN  439

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +GVKCVVV++SGRP+V++P+L S+ ALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  440   VC-SGVKCVVVVISGRPVVIQPYLSSIHALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRT  498

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD HYDPLFP GFGLTT+
Sbjct  499   WFKTVDQLPMNSGDPHYDPLFPIGFGLTTQ  528



>gb|AEP33567.1| b-1,4-glucanase [Gossypium darwinii]
 gb|AEP33581.1| b-1,4-glucanase [Gossypium lobatum]
Length=627

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYAHQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F++SN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVESNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDAL+AAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALIAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_007147489.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
 gb|ESW19483.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
Length=661

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/453 (70%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEII GLQG +P N  +G PYVGGKTKVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDAKIVQEMTEIISGLQGSIPVNSRKGFPYVGGKTKVAACAKHFVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ DWHGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T F
Sbjct  238   GGTAKGVNENNTLIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGAKMHANRDLVTGF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT   DSNYTYSV  SI AG+DMVMVP  Y  FI     L
Sbjct  298   LKNTLKFKGFVISDWQGIDRITAPPDSNYTYSVQASIEAGVDMVMVPYKYDEFIQDLTLL  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFENP AD SL + LG Q HRDLAREAVRKSLVL
Sbjct  358   VKSNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK+E  PLLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTILS I
Sbjct  418   LKNGKNESTPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILSAI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ ++ + EF+KSN+F YA+VVVGE PY+E  GD L LT+  +G + I N
Sbjct  478   KSTVDPSTEVVFRDNPDNEFVKSNNFEYAVVVVGEPPYAETAGDSLALTMMESGPNVINN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   V+CVVV++SGRP+V+EP++ ++DALVAAWLPG+EGQGV DVLFGDY FTGKL+RT
Sbjct  538   VCGT-VRCVVVIISGRPIVIEPYVSTIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLART  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPL+PFGFGLTT+  +
Sbjct  597   WFKSVDQLPMNVGDPHYDPLYPFGFGLTTESVK  629



>gb|KHG06450.1| gluA [Gossypium arboreum]
Length=633

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 367/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  180   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  240   GGTTKGINENNTVINWHDLLSIHMPGYYSSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  300   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  360   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  420   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  480   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEG GVADVLFGDY F+GKL RT
Sbjct  540   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  599   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  631



>gb|AEP33560.1| b-1,4-glucanase [Gossypium thurberi]
Length=627

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF +GLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAVGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYADQPLLPLPKKKSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_002271545.1| PREDICTED: lysosomal beta glucosidase [Vitis vinifera]
Length=627

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK+MT II GLQG++P N   G+PYVGGK KVAACAKH+V D
Sbjct  174   RDPRWGRCYESYSEDPKIVKAMTTIITGLQGEIPTNSRAGMPYVGGKNKVAACAKHFVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV DW GLM IHMP Y PSI +GV+TVM SYSS NG KMHAN  L+T F
Sbjct  234   GGTTHGINENNTVIDWKGLMKIHMPAYHPSIGRGVATVMVSYSSWNGKKMHANHQLITGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK +L+F+GFVISDW GIDRIT    +NYTYSV   I AGIDMVMVP N+  FI     L
Sbjct  294   LKNNLKFKGFVISDWEGIDRITSPPHANYTYSVQAGIQAGIDMVMVPFNHIEFIGILTKL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+++ IPMSRIDDAV+RILRVKFTMGLFENP AD SL   LG QAHRDLAREAVRKS+VL
Sbjct  354   VESKVIPMSRIDDAVSRILRVKFTMGLFENPLADLSLVDQLGSQAHRDLAREAVRKSMVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+    PLLP PK A RILVAGTHA+NLGYQCGGWTITW+GL G   T GTTILS I
Sbjct  414   LKNGETADAPLLPFPKKADRILVAGTHADNLGYQCGGWTITWQGLDGNNHTQGTTILSAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + A+DP+T++VY E+ + EF+KS +F+YAIVVVGE PY+E  GD+ NLTIP  G  TI N
Sbjct  474   SAAIDPSTELVYRENPDAEFVKSGNFSYAIVVVGEHPYAETAGDNSNLTIPEPGPSTITN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  G+KCVVV++SGRPLV++P+LPS+ ALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  534   VC-GGIKCVVVVISGRPLVIQPYLPSISALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+QLPMN  D +YDPLFP GFGLTT+
Sbjct  593   WFKTVEQLPMNFDDAYYDPLFPLGFGLTTE  622



>ref|XP_010312450.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Solanum 
lycopersicum]
Length=538

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/450 (70%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             R+PRWGRCYES+SED+ IV+SMTEIIPGLQGD+P   S+G PYV GKTKVA CAKH+VAD
Sbjct  80    RNPRWGRCYESFSEDINIVRSMTEIIPGLQGDLPAGMSKGTPYVNGKTKVAGCAKHFVAD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNT+ D  GL SIHMP Y  S+IKGV+TVMASYSS+NG +MHAN HLLT F
Sbjct  140   GGTVNGLDENNTIVDSKGLFSIHMPAYYDSVIKGVATVMASYSSLNGDRMHANTHLLTGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GI+RIT   +SNYTYSV  SINAGIDMVMVPNNY+ FI     L
Sbjct  200   LKKRLNFRGFVISDWEGINRITNPANSNYTYSVEASINAGIDMVMVPNNYTDFIGNLTML  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    +PMSRIDDAV RILRVKF MGLFE+P  D+SLA +LG   HR++AREAVRKSLVL
Sbjct  260   VNKNIVPMSRIDDAVKRILRVKFVMGLFEDPMGDHSLAKHLGSPEHREIAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGL-SGYITAGTTILSGI  577
             LKNGK  +QPLLPLPK A++ILVAGTHA+NLGYQCGGWTI W+G+    +T GTT+L  +
Sbjct  320   LKNGKTPQQPLLPLPKKAAKILVAGTHAHNLGYQCGGWTILWQGVPHNNLTIGTTVLDAV  379

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPATQ+V+NE  +  F++S+ F YA+VVVGE  Y+E +GD  NLTIP  G   I+N
Sbjct  380   KKTVDPATQVVFNEVPDSNFVQSSKFDYAVVVVGENTYAEMYGDSSNLTIPDPGPSIIQN  439

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVV++SGRP+V+EP++  MDA+VAAWLPG+EGQG+ADVLFGDY FTGKL+RT
Sbjct  440   VCGA-MKCVVVIISGRPVVIEPYVEKMDAIVAAWLPGTEGQGIADVLFGDYGFTGKLART  498

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  499   WFKRVDQLPMNVGDPHYDPLFPFGFGLTTQ  528



>ref|XP_002266589.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=629

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 371/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQG++P N  +GVPYV GK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDPNIVRAMTEIIPGLQGEIPANSRKGVPYVNGKDKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHAN  L+T F
Sbjct  235   GGTTNGINENNTVIDRHGLLSIHMPAYYSSIIKGVATVMVSYSSWNGQKMHANHELVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV   + AGIDMVM+P N++ FI    +L
Sbjct  295   LKNTLQFRGFVISDWQGIDRITSPPHANYTYSVQAGVQAGIDMVMLPFNHTEFIDILTNL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V++ FIPMSRIDDAV RILRVKF+MGLFENP A+ S    LG QAHRDLAREAVRKSLVL
Sbjct  355   VESNFIPMSRIDDAVRRILRVKFSMGLFENPLANLSFVDQLGSQAHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +   PLLPLPK A++ILVAGTHA++LGYQCGGWTITW+GLSG   T GTTILS I
Sbjct  415   LKNGDETDAPLLPLPKKANKILVAGTHAHDLGYQCGGWTITWQGLSGNNHTTGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVDP+T+IV+ E+ + EF+KSN+F+YA+VV+GE PY+E  GD LNLTI   G  TI N
Sbjct  475   SAAVDPSTEIVFTENPDAEFVKSNNFSYAVVVIGEPPYAETAGDSLNLTISEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +GVKCVVV++SGRP+V++P+L S+ ALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  535   VC-SGVKCVVVVISGRPVVIQPYLSSIHALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD HYDPLFP GFGLTT+
Sbjct  594   WFKTVDQLPMNSGDPHYDPLFPIGFGLTTQ  623



>ref|NP_001130296.1| exoglucanase1 precursor [Zea mays]
 ref|XP_008664778.1| PREDICTED: exoglucanase1 isoform X1 [Zea mays]
 gb|ACF78471.1| unknown [Zea mays]
 gb|ACF78828.1| unknown [Zea mays]
 gb|ACL53568.1| unknown [Zea mays]
 gb|ACN33321.1| unknown [Zea mays]
 tpg|DAA51349.1| TPA: exoglucanase Precursor isoform 1 [Zea mays]
 tpg|DAA51350.1| TPA: exoglucanase Precursor isoform 2 [Zea mays]
 tpg|DAA51351.1| TPA: exoglucanase Precursor isoform 3 [Zea mays]
Length=622

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/452 (72%), Positives = 370/452 (82%), Gaps = 3/452 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+S+T +I GLQGD P + S G PYVGG  KVAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKVVQSLTSLISGLQGDAPAD-SAGRPYVGGSKKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+SIHMPPY  SII+GVSTVM SYSS NGVKMHAN  L+TDF
Sbjct  233   GGTHNGINENNTIIDTHGLLSIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHFLVTDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YS+   + AGIDM+MVP  Y+ FI    + 
Sbjct  293   LKNKLKFRGFVISDWEGIDRITTPPHANYSYSIEAGVGAGIDMIMVPFRYTEFIDDLTTQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N+ IPMSRIDDAV RILRVKFTMGLFENP+ D SLA  LG Q HR+LAREAVRKSLVL
Sbjct  353   VQNKVIPMSRIDDAVYRILRVKFTMGLFENPYPDSSLAGELGKQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A +ILVAG+HAN+LG QCGGWTITW+G SG  TAGTTILSGI 
Sbjct  413   LKNGKSSYAPLLPLPKKAGKILVAGSHANDLGNQCGGWTITWQGSSGNTTAGTTILSGIE  472

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
               VDP+TQ+VY+ES +   + ++ + YAIVVVGE PY+E FGD+LNLTIPA G   I++V
Sbjct  473   ATVDPSTQVVYSESPDSGVL-ADKYDYAIVVVGEPPYAETFGDNLNLTIPAPGPSVIQSV  531

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A  KCVVVL+SGRPLV+EP+L  MDALVAAWLPGSEGQGVADVLFGDY FTGKL RTW
Sbjct  532   CGA-AKCVVVLISGRPLVVEPYLGDMDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTW  590

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLTTKG++
Sbjct  591   FKSVDQLPMNVGDAHYDPLFPFGFGLTTKGTK  622



>gb|KHN22996.1| Lysosomal beta glucosidase [Glycine soja]
Length=689

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/453 (70%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG +P N  +G PYVGGKTKVAACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DWHGL+SIHMP Y  SIIKGVSTVM SYSS NGV+MHANR L+T F
Sbjct  239   GGTTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDR+T    SNYTYSV  SI AG+DMVMVP  Y +FI     L
Sbjct  299   LKNTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYDKFIQDLTLL  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFENP AD SL + LG Q HRDLAREAVRKSLVL
Sbjct  359   VKSNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK+E  PLLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTILS I
Sbjct  419   LKNGKNESAPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILSAI  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD +T++V+ ++ + EF++SN+F YAIVVVGE PY+E  GD   L +  +G + I N
Sbjct  479   KSAVDTSTEVVFRDNPDNEFVRSNNFEYAIVVVGEPPYAETAGDSTTLAMMESGPNVINN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP++ S+DALVAAWLPG+EGQGV DVLFGDY FTGKL+RT
Sbjct  539   VCGT-VKCVVVIISGRPIVIEPYVSSIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLART  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMN GD HYDPLFPFGFGLTT+  +
Sbjct  598   WFKSVDQLPMNFGDPHYDPLFPFGFGLTTESVK  630



>gb|ADZ16108.1| endo-alpha-1,4-glucanase [Gossypium barbadense]
 gb|ADZ16109.1| endo-alpha-1,4-glucanase [Gossypium herbaceum subsp. africanum]
 gb|ADZ16111.1| endo-alpha-1,4-glucanase [Gossypium hirsutum]
 gb|AEP33564.1| b-1,4-glucanase [Gossypium mustelinum]
 gb|AEP33570.1| b-1,4-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEP33572.1| b-1,4-glucanase [Gossypium barbadense var. peruvianum]
Length=627

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 367/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  354   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  414   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + S+DALVAAWLPGSEG GVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_007015581.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY33200.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=627

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/449 (71%), Positives = 368/449 (82%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIV+ MTEII GLQG++P N  +GVPY+GGK KVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDPEIVREMTEIINGLQGEIPQNSRKGVPYIGGKDKVAACAKHFVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHA+  L+T+F
Sbjct  238   GGTTNGINENNTVIDRHGLLSIHMPGYYESIIKGVSTVMVSYSSWNGEKMHAHHDLITNF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVI+DW GID+IT    SNYTYSVL  + AGIDM M+P N++ FI T   L
Sbjct  298   LKGTLRFRGFVITDWEGIDKITATPHSNYTYSVLAGVQAGIDMFMIPFNHTEFIHTLTKL  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+++FIPMSRIDDAV RILRVK+ +GLFENP AD S    LG QAHR+LAREAVRKSLVL
Sbjct  358   VRDKFIPMSRIDDAVRRILRVKYKLGLFENPMADESFVAELGSQAHRELAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG++    +LPLPK ASRILVAG+HAN+LG QCGGWTI+W+GLSG  TAGTTIL GI+
Sbjct  418   LKNGENADDAVLPLPKKASRILVAGSHANDLGNQCGGWTISWQGLSGNHTAGTTILEGIS  477

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP T+I + E+ + +F+KS +F+YAIVVVGE PY+E  GD +NLTIP     TI NV
Sbjct  478   AAVDPDTKIAFKENPDMDFVKSKNFSYAIVVVGEPPYAEGQGDSMNLTIPEQSQYTIYNV  537

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A +KCVVVL+SGRPL + PHL  +DA VAAWLPGSEGQGVADVLFGDY FTGKL RTW
Sbjct  538   C-ANIKCVVVLISGRPLEVMPHLDQVDAFVAAWLPGSEGQGVADVLFGDYGFTGKLPRTW  596

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FKTVDQLPMNVGD HYDPL+P G+GLTTK
Sbjct  597   FKTVDQLPMNVGDPHYDPLYPLGYGLTTK  625



>gb|EPS66823.1| hypothetical protein M569_07949, partial [Genlisea aurea]
Length=627

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/449 (71%), Positives = 373/449 (83%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +VK+MTEII GLQG++P+N  +GVP++  +  VAACAKHYV D
Sbjct  177   RDPRWGRCYESYSEDPTVVKTMTEIINGLQGEIPSNSMKGVPFLASQKHVAACAKHYVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+SIHMP Y  SIIKGVS+VM SYSS NGVKMHANR L+T F
Sbjct  237   GGTTKGINENNTVASRHDLLSIHMPAYFDSIIKGVSSVMISYSSWNGVKMHANRDLITGF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG  RFRGFVISDWLGIDRIT     NYTYS+L ++NAGIDM+MVP NY+ FI+    L
Sbjct  297   LKGTQRFRGFVISDWLGIDRITSPPHLNYTYSILTAVNAGIDMIMVPYNYTEFINGITEL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAVTRILRVKFTMGLFE+PF DYSL   LG Q HRD+AREAVRKSLVL
Sbjct  357   VKTNSIPMSRIDDAVTRILRVKFTMGLFEHPFGDYSLTKQLGSQEHRDIAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG  E +P LPL K+AS+ILVAGTHA+N+ YQCGGWTI W+G SG  T GTTIL GI 
Sbjct  417   LKNGGTE-EPFLPLSKSASKILVAGTHADNIAYQCGGWTINWQGGSGATTEGTTILEGIK  475

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             NAV   T +V+NES + ++++SN+F+YAIV VGE PY+E  GD+LNLT+P+ G   I++V
Sbjct  476   NAVSKETTVVFNESPSSDYVRSNNFSYAIVAVGEFPYAETLGDNLNLTLPSPGPGIIRDV  535

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCV+VL+SGRPLV+EP++  +DALVAAWLPGSEGQGVADVLFGDY FTGKLSRTW
Sbjct  536   CGS-VKCVLVLISGRPLVIEPYISQVDALVAAWLPGSEGQGVADVLFGDYGFTGKLSRTW  594

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             F++VDQLPMNVGD++YDPLFPFGFGLTT+
Sbjct  595   FRSVDQLPMNVGDKNYDPLFPFGFGLTTE  623



>ref|XP_004502135.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=705

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/449 (71%), Positives = 372/449 (83%), Gaps = 3/449 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P +  +GVP+V GK KVAACAKH+V D
Sbjct  254   RDPRWGRCYESYSEDHQIVRTMTEIIPGLQGDIPGDSRKGVPFVAGKNKVAACAKHFVGD  313

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ ++ GL+ IHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T +
Sbjct  314   GGTNKGINENNTLINYKGLLGIHMPAYYDSIIKGVSTVMISYSSWNGKKMHANRDLVTGY  373

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP N++ FI      
Sbjct  374   LKNKLRFRGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPYNFTEFIDDLTYQ  433

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKFTMGLFENP AD SLA+ LG + HR+LAREAVRKSLVL
Sbjct  434   VKNNIIPMSRIDDAVARILRVKFTMGLFENPLADLSLANQLGSKEHRELAREAVRKSLVL  493

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  K PLLPLPK AS+ILVAG+HA+NLG QCGGWT TW+GL G  +TAGTTIL  I
Sbjct  494   LKNGKSAK-PLLPLPKKASKILVAGSHADNLGRQCGGWTSTWQGLEGNDLTAGTTILDAI  552

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPAT++VYNE+ +  F+ SN F+YAIV+VGE PY+E FGD LNLTIP  G  TI N
Sbjct  553   KKTVDPATEVVYNENPDASFLSSNKFSYAIVIVGEPPYAETFGDSLNLTIPEPGPSTITN  612

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + ++CVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVADVL+GDY FTGKL+RT
Sbjct  613   VCGS-IQCVVVLITGRPVVIQPYLSKIDALVAAWLPGTEGQGVADVLYGDYAFTGKLART  671

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD+HYDPLFPFGFGLTT
Sbjct  672   WFKTVDQLPMNVGDKHYDPLFPFGFGLTT  700


 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKV  1324
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P +  +GVP+V GK  V
Sbjct  175   RDPRWGRCYESYSEDHQIVRTMTEIIPGLQGDIPGDSRKGVPFVAGKDPV  224



>ref|XP_002266675.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=629

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 370/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQG++P N  +GVPYV GK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDPNIVRAMTEIIPGLQGEIPANSRKGVPYVNGKDKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGV+TVM SYSS NG KMHAN  L+T F
Sbjct  235   GGTTNGINENNTVIDRHGLLSIHMPAYYSSIIKGVATVMVSYSSWNGKKMHANHELVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV   + AGIDMVM+P N++ FI    +L
Sbjct  295   LKNTLQFRGFVISDWQGIDRITSPPHANYTYSVQAGVQAGIDMVMLPFNHTEFIDILTNL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V++  IPMSRIDDAV RILRVKF+MGLFENP AD S    LG QAHRDLAREAVRKSLVL
Sbjct  355   VESNVIPMSRIDDAVRRILRVKFSMGLFENPLADLSFVDQLGSQAHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +   PLLPLPK A++ILVAGTHA++LGYQCGGWTITW+GLSG   T GTTILS I
Sbjct  415   LKNGDEADAPLLPLPKKANKILVAGTHAHDLGYQCGGWTITWQGLSGNNHTTGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVDP+T+IV+ E+ + EF+KSN+F+YA+VV+GE PY+E  GD LNLTI   G  TI N
Sbjct  475   SAAVDPSTEIVFTENPDAEFVKSNNFSYAVVVIGEPPYAETAGDSLNLTISEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +GVKCVVV++SGRP+V++P+L S+ ALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  535   VC-SGVKCVVVVISGRPVVIQPYLSSIHALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD HYDPLFP GFGLTT+
Sbjct  594   WFKTVDQLPMNSGDPHYDPLFPIGFGLTTQ  623



>gb|AEP33582.1| b-1,4-glucanase [Gossypium trilobum]
Length=627

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF +GLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAVGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYADQPLLPLPKKKSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + S+DALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSVDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_003546253.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006597657.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=661

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/453 (70%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG +P N  +G PYVGGKTKVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DWHGL+SIHMP Y  SIIKGVSTVM SYSS NGV+MHANR L+T F
Sbjct  238   GGTTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDR+T    SNYTYSV  SI AG+DMVMVP  Y +FI     L
Sbjct  298   LKNTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYGKFIQDLTLL  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFENP AD SL + LG Q HRDLAREAVRKSLVL
Sbjct  358   VKSNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK+E   LLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTIL+ I
Sbjct  418   LKNGKNESASLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILNAI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD +T++V+ ++ + EF+KSN+F YAIVVVGE PY+E  GD   LT+  +G + I N
Sbjct  478   KSAVDTSTEVVFRDNPDNEFVKSNNFEYAIVVVGEPPYAETAGDSTTLTMMESGPNVINN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP++ S+DALVAAWLPG+EGQG+ DVLFGDY FTGKL+RT
Sbjct  538   VCGT-VKCVVVIISGRPIVIEPYISSIDALVAAWLPGTEGQGMTDVLFGDYGFTGKLART  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+  +
Sbjct  597   WFKSVDQLPMNVGDPHYDPLFPFGFGLTTESVK  629



>ref|XP_003535075.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006586833.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=662

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/453 (70%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG +P N  +G PYVGGKTKVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DWHGL+SIHMP Y  SIIKGVSTVM SYSS NGV+MHANR L+T F
Sbjct  238   GGTTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDR+T    SNYTYSV  SI AG+DMVMVP  Y +FI     L
Sbjct  298   LKNTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYDKFIQDLTLL  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFENP AD SL + LG Q HRDLAREAVRKSLVL
Sbjct  358   VKSNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK+E  PLLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTILS I
Sbjct  418   LKNGKNESAPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILSAI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD +T++V+ ++ + EF++SN+F YAIVVVGE PY+E  GD   L +  +G + I N
Sbjct  478   KSAVDTSTEVVFRDNPDNEFVRSNNFEYAIVVVGEPPYAETAGDSTTLAMMESGPNVINN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP++ S+DALVAAWLPG+EGQGV DVLFGDY FTGKL+RT
Sbjct  538   VCGT-VKCVVVIISGRPIVIEPYVSSIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLART  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMN GD HYDPLFPFGFGLTT+  +
Sbjct  597   WFKSVDQLPMNFGDPHYDPLFPFGFGLTTESVK  629



>gb|ADZ16110.1| endo-alpha-1,4-glucanase [Gossypium raimondii]
Length=627

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+GVP+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGVPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP +YS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYDYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF +GLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAVGLFENPLADNSLVDQLGRQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|AEP33577.1| b-1,4-glucanase [Gossypium davidsonii]
 gb|AEP33578.1| b-1,4-glucanase [Gossypium klotzschianum]
Length=627

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIP+SRIDDAV RILRVKF +GLFENP AD SL   LG Q HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPVSRIDDAVKRILRVKFAVGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGV DVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILISGRPVVIEPDIDSMDALVAAWLPGSEGQGVTDVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|AEP33565.1| b-1,4-glucanase [Gossypium mustelinum]
 gb|AEP33573.1| b-1,4-glucanase [Gossypium barbadense var. peruvianum]
Length=627

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+GVP+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDMPAKSSKGVPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKF +GLFENP AD SL   LG + HR+LAREAVR+SLVL
Sbjct  354   VKNNFIPMSRIDDAVKRILRVKFAVGLFENPLADNSLVDQLGSEEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L+ I
Sbjct  414   LKNGHYADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ A+VVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAVVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + SMDALVAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKT DQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTADQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|AEP33574.1| b-1,4-glucanase [Gossypium hirsutum subsp. latifolium]
Length=627

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 367/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  354   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  414   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + S+DALVAAWLPGSEG GVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WF+TVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFRTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|KHN14336.1| Lysosomal beta glucosidase [Glycine soja]
Length=688

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/453 (70%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG +P N  +G PYVGGKTKVAACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DWHGL+SIHMP Y  SIIKGVSTVM SYSS NGV+MHANR L+T F
Sbjct  239   GGTTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDR+T    SNYTYSV  SI AG+DMVMVP  Y +FI     L
Sbjct  299   LKNTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYGKFIQDLTLL  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFENP AD SL + LG Q HRDLAREAVRKSLVL
Sbjct  359   VKSNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK+E   LLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTIL+ I
Sbjct  419   LKNGKNESASLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILNAI  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD +T++V+ ++ + EF+KSN+F YAIVVVGE PY+E  GD   LT+  +G + I N
Sbjct  479   KSAVDTSTEVVFRDNPDNEFVKSNNFEYAIVVVGEPPYAETAGDSTTLTMMESGPNVINN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP++ S+DALVAAWLPG+EGQG+ DVLFGDY FTGKL+RT
Sbjct  539   VCGT-VKCVVVIISGRPIVIEPYISSIDALVAAWLPGTEGQGMTDVLFGDYGFTGKLART  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+  +
Sbjct  598   WFKSVDQLPMNVGDPHYDPLFPFGFGLTTESVK  630



>gb|AAF79936.1| exoglucanase precursor [Zea mays]
Length=622

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/452 (71%), Positives = 369/452 (82%), Gaps = 3/452 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+S+T +I GLQGD P + S G PYVGG  KVAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKVVQSLTSLISGLQGDAPAD-SAGRPYVGGSKKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+SIHMPPY  SII+GVSTVM SYSS NGVKMHAN  L+TDF
Sbjct  233   GGTHNGINENNTIIDTHGLLSIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHFLVTDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YS+   + AGIDM+MVP  Y+ FI    + 
Sbjct  293   LKNKLKFRGFVISDWEGIDRITTPPHANYSYSIEAGVGAGIDMIMVPFRYTEFIDDLTTQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N+ IPMSRIDDAV RILRVKFTMGLFENP+ D SLA  LG Q HR+LAREAVRKSLVL
Sbjct  353   VQNKVIPMSRIDDAVYRILRVKFTMGLFENPYPDSSLAGELGKQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A +ILVAG+HAN+LG QCGGWTITW+G SG  TAGTTILSGI 
Sbjct  413   LKNGKSSYAPLLPLPKKAGKILVAGSHANDLGNQCGGWTITWQGSSGNTTAGTTILSGIE  472

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
               VDP+TQ+VY+ES +   + ++ + YAIVVVGE PY+E FGD+LNLTIPA G   I++V
Sbjct  473   ATVDPSTQVVYSESPDSGVL-ADKYDYAIVVVGEPPYAETFGDNLNLTIPAPGPSVIQSV  531

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A  KCVVVL+SGRPLV+EP+L  MDALVA WLPGSEGQGVADVLFGDY FTGKL RTW
Sbjct  532   CGA-AKCVVVLISGRPLVVEPYLGDMDALVATWLPGSEGQGVADVLFGDYGFTGKLPRTW  590

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLTTKG++
Sbjct  591   FKSVDQLPMNVGDAHYDPLFPFGFGLTTKGTK  622



>ref|XP_010653212.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Vitis 
vinifera]
Length=627

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/453 (70%), Positives = 373/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED ++V++MTEI+PGLQGD+P  + +G+PYV G  KVAACAKHYV D
Sbjct  175   RDPRWGRCFESYSEDPKVVRAMTEIVPGLQGDLPPGYQKGIPYVAGNKKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV   HGL+SIHM  Y  SIIKGVSTVM SYSS NG KMHAN+ L+T F
Sbjct  235   GGTTEGINENNTVISRHGLLSIHMGGYYTSIIKGVSTVMISYSSWNGKKMHANQELITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   I AGIDM+MVP NY+ FI      
Sbjct  295   LKNTLRFRGFVISDWQGIDRITSPPHANYSYSIEAGIKAGIDMIMVPYNYTEFIDGLTYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK++ IPMSRIDDAV RILRVKF MGLFE+P AD+SL H LG Q HR+LAREAVRKSLVL
Sbjct  355   VKSKIIPMSRIDDAVRRILRVKFVMGLFESPLADHSLVHELGSQVHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A +ILVAGTHA+NLG QCGGWTI W+GLSG  +T+GTTILS I
Sbjct  415   LKNGEPADKPLLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLSGNNLTSGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP T++VY E+ +  ++KS+ F+YAIVVVGE PY+E FGD+LNLTIP  G   I N
Sbjct  475   KKTVDPKTEVVYKENPDLSYVKSSKFSYAIVVVGEPPYAETFGDNLNLTIPDPGPSIITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRPLV++P++  +DALVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  535   VCGA-VKCVVIVISGRPLVIQPYVDQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WF+TV+QLPMNVGDRHYDPLFPFGFGLTT+ ++
Sbjct  594   WFRTVEQLPMNVGDRHYDPLFPFGFGLTTEPTK  626



>emb|CAA07070.1| beta-D-glucosidase [Tropaeolum majus]
Length=654

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/452 (70%), Positives = 371/452 (82%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQGDVP +  +GVP+VGGKTKVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDHTIVQAMTEIIPGLQGDVPPDVKKGVPFVGGKTKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG+DENNTV D  GL SIHMP Y  SI KGV+TVM SYSS NG++MHANR L+T +
Sbjct  236   GGTTKGIDENNTVIDSRGLFSIHMPAYHDSIKKGVATVMVSYSSWNGLRMHANRDLVTGY  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT     NY+YSV   + AGIDM+MVP ++++F++   S 
Sbjct  296   LKNKLKFRGFVISDWEGIDRITDPPGRNYSYSVEAGVGAGIDMIMVPEDFTKFLNELTSQ  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLFE+P ADYSLA+ LG Q HRDLAREAVRKSLVL
Sbjct  356   VKKNIIPMSRIDDAVKRILRVKFVMGLFESPLADYSLANQLGSQEHRDLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   +P +PLPKNA +ILVAG+HA+NLG QCGGWTI W+G++G  +T GTTIL+ I
Sbjct  416   LKNGESADKPFVPLPKNAKKILVAGSHADNLGRQCGGWTIEWQGVNGNDLTTGTTILNAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP TQ++YNE+ +  ++K+N F YAIVVVGE PY+E  GD  NLTIP  G  TI +
Sbjct  476   KKTVDPTTQVIYNENPDSNYVKTNSFDYAIVVVGEPPYAEMQGDSFNLTIPEPGPTTISS  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+VL+P++  MDALVAAWLPG+EGQGV DVLFGDY FTGKL+RT
Sbjct  536   VCGA-VKCVVVVISGRPVVLQPYVSYMDALVAAWLPGTEGQGVTDVLFGDYGFTGKLART  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFKTVDQLPMNVGD+HYDPLFPFGFGLTTK S
Sbjct  595   WFKTVDQLPMNVGDKHYDPLFPFGFGLTTKPS  626



>ref|XP_010097917.1| Periplasmic beta-glucosidase [Morus notabilis]
 gb|EXB73273.1| Periplasmic beta-glucosidase [Morus notabilis]
Length=620

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/450 (70%), Positives = 373/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGD+P N  +GVP+VGGKTKVAAC KH+V D
Sbjct  169   RDPRWGRCYESYSEDHKIVQMMTEIIPGLQGDLPANSRKGVPFVGGKTKVAACVKHFVGD  228

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+  W GL+ IHMP Y  SI KGV+TVM SYSS NG +MHANR L+T F
Sbjct  229   GGTNKGINENNTLISWKGLLDIHMPAYVDSIRKGVATVMVSYSSWNGKRMHANRDLVTGF  288

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    SNY+YSV   ++AGID++MVP N++ FI      
Sbjct  289   LKNKLKFRGFVISDWQGIDRITSPPGSNYSYSVQAGVSAGIDVIMVPYNFTDFIDKLTYQ  348

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP AD SL + LG + HR+LAREAVRKSLVL
Sbjct  349   VKNNIIPMSRIDDAVKRILRVKFIMGLFENPLADLSLVNQLGHKEHRELAREAVRKSLVL  408

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   +PLLPLPK A++ILVAG+HA+NLGYQCGGWTITW+G+ G  ITAGTTIL  +
Sbjct  409   LKNGKSADKPLLPLPKKATKILVAGSHADNLGYQCGGWTITWQGVGGNDITAGTTILKAV  468

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP TQ+VY+++ +  F+KSN+F+YAIVV+GE P+SE FGD LNLTI   G  TIKN
Sbjct  469   KNTVDPTTQVVYSQNPDANFVKSNNFSYAIVVIGEPPFSETFGDSLNLTIAEPGPSTIKN  528

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCV+++V+GRP+V++P++ +++ALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  529   VCGA-VKCVLIVVTGRPVVIQPYVSTVEALVAAWLPGTEGQGVADVLFGDYGFTGKLART  587

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+QLPMNVGD HYDPLFPFGFGLTT+
Sbjct  588   WFKTVNQLPMNVGDPHYDPLFPFGFGLTTE  617



>emb|CDP15624.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 370/453 (82%), Gaps = 3/453 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQGD P    +GVP+V GKTKVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDHRIVQAMTEIIPGLQGDAPAGTPKGVPFVAGKTKVAACAKHFVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG+DENNTV D+ GL+SIHMP Y  ++ KGV+TVM SYSS NG +MHAN  L+T F
Sbjct  238   GGTVKGIDENNTVIDYKGLLSIHMPAYFDAVRKGVATVMVSYSSWNGKRMHANHDLVTGF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    SNY YSV   + AGIDMVM+P N++ FI    SL
Sbjct  298   LKDKLKFRGFVISDWQGIDRITDPPHSNYVYSVQAGVLAGIDMVMLPENFTEFIDDLTSL  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKFTMGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  358   VKKNVIPMSRIDDAVKRILRVKFTMGLFENPLADLSLVNQLGSQEHRELAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG D  QPLLPLPK + +ILVAG+HANNLGYQCGGWTI W+G  G  +T GTTIL+ I
Sbjct  418   LKNGIDN-QPLLPLPKKSPKILVAGSHANNLGYQCGGWTIEWQGHGGNDLTVGTTILTAI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP+TQ++Y+E+ +  F+KSN F++AIVVVGE PY+E  GD LNLTIP  G  TIKN
Sbjct  477   KNTVDPSTQVIYDENPDANFVKSNSFSHAIVVVGETPYAEGAGDSLNLTIPEPGPSTIKN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV++SGRP+V+EP+L S+ ALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  537   VCGS-VKCVVVIISGRPVVVEPYLSSISALVAAWLPGTEGQGVADVLFGDYGFTGKLART  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGLTTK ++
Sbjct  596   WFKSVDQLPMNVGDPHYDPLFPFGFGLTTKPTK  628



>ref|XP_004228467.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
lycopersicum]
Length=634

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/450 (70%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             R+PRWGRCYES+SED+ IV+SMTEIIPGLQGD+P   S+G PYV GKTKVA CAKH+VAD
Sbjct  176   RNPRWGRCYESFSEDINIVRSMTEIIPGLQGDLPAGMSKGTPYVNGKTKVAGCAKHFVAD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNT+ D  GL SIHMP Y  S+IKGV+TVMASYSS+NG +MHAN HLLT F
Sbjct  236   GGTVNGLDENNTIVDSKGLFSIHMPAYYDSVIKGVATVMASYSSLNGDRMHANTHLLTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GI+RIT   +SNYTYSV  SINAGIDMVMVPNNY+ FI     L
Sbjct  296   LKKRLNFRGFVISDWEGINRITNPANSNYTYSVEASINAGIDMVMVPNNYTDFIGNLTML  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    +PMSRIDDAV RILRVKF MGLFE+P  D+SLA +LG   HR++AREAVRKSLVL
Sbjct  356   VNKNIVPMSRIDDAVKRILRVKFVMGLFEDPMGDHSLAKHLGSPEHREIAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGL-SGYITAGTTILSGI  577
             LKNGK  +QPLLPLPK A++ILVAGTHA+NLGYQCGGWTI W+G+    +T GTT+L  +
Sbjct  416   LKNGKTPQQPLLPLPKKAAKILVAGTHAHNLGYQCGGWTILWQGVPHNNLTIGTTVLDAV  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPATQ+V+NE  +  F++S+ F YA+VVVGE  Y+E +GD  NLTIP  G   I+N
Sbjct  476   KKTVDPATQVVFNEVPDSNFVQSSKFDYAVVVVGENTYAEMYGDSSNLTIPDPGPSIIQN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVV++SGRP+V+EP++  MDA+VAAWLPG+EGQG+ADVLFGDY FTGKL+RT
Sbjct  536   VCGA-MKCVVVIISGRPVVIEPYVEKMDAIVAAWLPGTEGQGIADVLFGDYGFTGKLART  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  595   WFKRVDQLPMNVGDPHYDPLFPFGFGLTTQ  624



>gb|AAZ15705.1| endo-alpha-1,4-glucanase [Gossypium hirsutum]
Length=627

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 367/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMV+VP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVVVPYNYSSFIHGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  354   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  414   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + S+DALVAAWLPGSEG GVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_011094173.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Sesamum 
indicum]
Length=552

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 369/452 (82%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP++ G+ KV A AKHYV D
Sbjct  100   RDPRWGRCYESYSEDPKIVRAMTEIIPGLQGDIPANSRKGVPFLAGQQKVLATAKHYVGD  159

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+ IHMP Y  SIIKGV T+M SYSS NGVKMHANR L+T F
Sbjct  160   GGTTKGINENNTVASRHDLLRIHMPAYYDSIIKGVGTIMISYSSWNGVKMHANRDLITGF  219

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW G+DRIT    +NYTYS++  + AGIDM+MVP NY+ FI    SL
Sbjct  220   LKNTLRFRGFVISDWQGLDRITSPPHANYTYSIIAGVGAGIDMIMVPYNYTEFIDGLTSL  279

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKFT+GLFE+P ADYS+  YLG Q HR+LAREAVRKSLVL
Sbjct  280   VKNNFIPMSRIDDAVKRILRVKFTIGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVL  339

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG+   +PL+PLPK AS+ILVAGTHA+N+G QCGGWTI  +G  G +T GTTIL+ I 
Sbjct  340   LKNGESANKPLIPLPKKASKILVAGTHADNIGNQCGGWTIQLQGQPGNVTVGTTILTAIR  399

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N V P T+IV+NE+ +  ++KSN+F+YAI+VVGE PYS  FGD+ NLTIP  G   I NV
Sbjct  400   NTVHPETKIVFNENPHPGYVKSNEFSYAIIVVGEPPYSLTFGDNTNLTIPDPGPSIITNV  459

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ VKCVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTG L RTW
Sbjct  460   CAS-VKCVVVLITGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGTLPRTW  518

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FKTVDQLPMNVGD+HYDPLFPFG+GL T+  R
Sbjct  519   FKTVDQLPMNVGDQHYDPLFPFGYGLITEPVR  550



>emb|CBI39076.3| unnamed protein product [Vitis vinifera]
Length=635

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/453 (70%), Positives = 373/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED ++V++MTEI+PGLQGD+P  + +G+PYV G  KVAACAKHYV D
Sbjct  183   RDPRWGRCFESYSEDPKVVRAMTEIVPGLQGDLPPGYQKGIPYVAGNKKVAACAKHYVGD  242

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV   HGL+SIHM  Y  SIIKGVSTVM SYSS NG KMHAN+ L+T F
Sbjct  243   GGTTEGINENNTVISRHGLLSIHMGGYYTSIIKGVSTVMISYSSWNGKKMHANQELITGF  302

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   I AGIDM+MVP NY+ FI      
Sbjct  303   LKNTLRFRGFVISDWQGIDRITSPPHANYSYSIEAGIKAGIDMIMVPYNYTEFIDGLTYQ  362

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK++ IPMSRIDDAV RILRVKF MGLFE+P AD+SL H LG Q HR+LAREAVRKSLVL
Sbjct  363   VKSKIIPMSRIDDAVRRILRVKFVMGLFESPLADHSLVHELGSQVHRELAREAVRKSLVL  422

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A +ILVAGTHA+NLG QCGGWTI W+GLSG  +T+GTTILS I
Sbjct  423   LKNGEPADKPLLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLSGNNLTSGTTILSAI  482

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP T++VY E+ +  ++KS+ F+YAIVVVGE PY+E FGD+LNLTIP  G   I N
Sbjct  483   KKTVDPKTEVVYKENPDLSYVKSSKFSYAIVVVGEPPYAETFGDNLNLTIPDPGPSIITN  542

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRPLV++P++  +DALVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  543   VCGA-VKCVVIVISGRPLVIQPYVDQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRT  601

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WF+TV+QLPMNVGDRHYDPLFPFGFGLTT+ ++
Sbjct  602   WFRTVEQLPMNVGDRHYDPLFPFGFGLTTEPTK  634



>ref|XP_008664722.1| PREDICTED: exoglucanase1 isoform X2 [Zea mays]
 tpg|DAA51348.1| TPA: exoglucanase Precursor [Zea mays]
Length=657

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/452 (72%), Positives = 370/452 (82%), Gaps = 3/452 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+S+T +I GLQGD P + S G PYVGG  KVAACAKHYV D
Sbjct  209   RDPRWGRCYESYSEDPKVVQSLTSLISGLQGDAPAD-SAGRPYVGGSKKVAACAKHYVGD  267

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+SIHMPPY  SII+GVSTVM SYSS NGVKMHAN  L+TDF
Sbjct  268   GGTHNGINENNTIIDTHGLLSIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHFLVTDF  327

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YS+   + AGIDM+MVP  Y+ FI    + 
Sbjct  328   LKNKLKFRGFVISDWEGIDRITTPPHANYSYSIEAGVGAGIDMIMVPFRYTEFIDDLTTQ  387

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N+ IPMSRIDDAV RILRVKFTMGLFENP+ D SLA  LG Q HR+LAREAVRKSLVL
Sbjct  388   VQNKVIPMSRIDDAVYRILRVKFTMGLFENPYPDSSLAGELGKQEHRELAREAVRKSLVL  447

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A +ILVAG+HAN+LG QCGGWTITW+G SG  TAGTTILSGI 
Sbjct  448   LKNGKSSYAPLLPLPKKAGKILVAGSHANDLGNQCGGWTITWQGSSGNTTAGTTILSGIE  507

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
               VDP+TQ+VY+ES +   + ++ + YAIVVVGE PY+E FGD+LNLTIPA G   I++V
Sbjct  508   ATVDPSTQVVYSESPDSGVL-ADKYDYAIVVVGEPPYAETFGDNLNLTIPAPGPSVIQSV  566

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A  KCVVVL+SGRPLV+EP+L  MDALVAAWLPGSEGQGVADVLFGDY FTGKL RTW
Sbjct  567   CGAA-KCVVVLISGRPLVVEPYLGDMDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTW  625

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLTTKG++
Sbjct  626   FKSVDQLPMNVGDAHYDPLFPFGFGLTTKGTK  657



>ref|XP_004141128.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN59734.1| hypothetical protein Csa_3G842070 [Cucumis sativus]
Length=628

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/449 (70%), Positives = 369/449 (82%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED ++V+ MTEII GLQG++P+N  +GVPYV G+ KVAACAKHYV D
Sbjct  175   RDPRWGRCFESYSEDPKVVQEMTEIISGLQGEIPSNSRKGVPYVAGREKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKGM+ENNT+   HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMH NR L+T F
Sbjct  235   GGTTKGMNENNTLASRHGLLSIHMPGYYNSIIKGVSTVMISYSSWNGKKMHENRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS++  I AGIDM+MVP NY+ FI     L
Sbjct  295   LKNTLRFRGFVISDWQGIDRITSPPHANYTYSIIAGITAGIDMIMVPFNYTEFIDGLTYL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IP+SRIDDAV RILRVKF MGLFENP AD S  + LG + HR+LAREAVRKSLVL
Sbjct  355   VKTNVIPISRIDDAVKRILRVKFVMGLFENPLADSSFVNELGKKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +P+LPLPK   +ILVAG+HANNLG+QCGGWTI W+GL G  +T+GTTILS I
Sbjct  415   LKNGESADKPILPLPKKVPKILVAGSHANNLGFQCGGWTIEWQGLGGNNLTSGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T++V+ E+ + EF+KSN F+YAIVVVGE PY+E FGD LNLTIP  G  TI N
Sbjct  475   KDTVDPKTKVVFKENPDMEFVKSNKFSYAIVVVGEYPYAETFGDSLNLTIPEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRP+VL+P++ S+DALVAAWLPG+EG+G++DVLFGDY F+GKLSRT
Sbjct  535   VCGA-VKCVVIVISGRPVVLQPYISSIDALVAAWLPGTEGKGISDVLFGDYGFSGKLSRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  594   WFKTVDQLPMNVGDAHYDPLFPFGFGLTT  622



>ref|XP_007015579.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 ref|XP_007015580.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY33198.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY33199.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=628

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/454 (70%), Positives = 372/454 (82%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHY+ D
Sbjct  175   RDPRWGRCYESYSEDHKIVQLMTEIIPGLQGDLPANAKKGVPFVAGKKKVAACAKHYLGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   +GL+SIHMP Y  SI KGV+TVM SYSS NG KMHANR L+T F
Sbjct  235   GGTTKGINENNTVISLNGLLSIHMPAYINSIRKGVATVMVSYSSWNGKKMHANRDLVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW G+DRIT    +NY+YSV   ++AGIDM+MVP N++ FI      
Sbjct  295   LKNKLKFRGFVISDWQGLDRITSPPHANYSYSVEAGVSAGIDMIMVPYNFTEFIDDLTYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPMSRIDDAV RILRVKF MGLFENP ADYSL + LG Q HR+LAREAVRK+LVL
Sbjct  355   VKHNIIPMSRIDDAVKRILRVKFVMGLFENPIADYSLVNQLGSQEHRELAREAVRKTLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   + LLPLPK  ++IL+AG+HA+NLG QCGGWTITW+GL G  +T+GTTIL  I
Sbjct  415   LKNGESADEALLPLPKKTTKILIAGSHADNLGCQCGGWTITWQGLGGNDLTSGTTILQAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP TQ+VY+E+ +  F+KSN+F+YAIVVVGE PY+E FGD LNLTI   G  TI N
Sbjct  475   KKTVDPTTQVVYSENPDAVFVKSNEFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIYN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P+L S+DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-VKCVVVVISGRPVVMQPYLSSIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTK ++ 
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTKQ  627



>ref|XP_006361125.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=628

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 368/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED+ IV++MTEIIPGLQGDVP N S+GVP+VGGK+KVAACAKHYVAD
Sbjct  175   RDPRWGRCYESYSEDINIVRTMTEIIPGLQGDVPTNSSKGVPFVGGKSKVAACAKHYVAD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G+DENNTV +   L  IHMP Y  SIIKGVSTVM SYSS+NG KMH NR L+T F
Sbjct  235   GGTERGIDENNTVINRTSLYGIHMPAYYDSIIKGVSTVMISYSSLNGEKMHTNRDLVTRF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK +L+FRGF+ISD  G+DRIT   D+NYTYSV   I AGIDMVM+PNNY+ FI     L
Sbjct  295   LKDNLKFRGFIISDSEGLDRITSPPDANYTYSVQAGILAGIDMVMIPNNYAEFIGNLTLL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPMSRIDDAV RILRVKF + LFE+P AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKDNIIPMSRIDDAVERILRVKFILDLFEDPLADLSLVNQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILVAGTHA+NLGYQCGGWT  W+G+SG     GTTILS I
Sbjct  415   LKNGKITSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTNQWQGVSGNNFIVGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP+TQ+VY ++ +  F+KSN F YAIVVVGE PY+E FGD  NLTIP  G  TI N
Sbjct  475   KKTVDPSTQVVYQQNPDANFVKSNKFDYAIVVVGEVPYAEMFGDSSNLTIPEPGPSTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+VLEP++  +DALVAAWLPG+EGQGVADVLFG+Y FTGKL+RT
Sbjct  535   VCGA-VKCVVVVISGRPVVLEPYVDKIDALVAAWLPGTEGQGVADVLFGEYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WF++VDQLPMNVGD HY+PLFPFGFGLTT+
Sbjct  594   WFRSVDQLPMNVGDPHYNPLFPFGFGLTTQ  623



>emb|CDP15622.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/451 (71%), Positives = 371/451 (82%), Gaps = 3/451 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEII GLQG++P    +GVPYVGG  KVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDPQIVKEMTEIIKGLQGEIPPGGRKGVPYVGGPDKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVTDWH LMSIHMP Y  SIIKGVSTVM SYSS NG+KMHANR+L+TDF
Sbjct  237   GGTTKGINENNTVTDWHRLMSIHMPGYDASIIKGVSTVMVSYSSYNGLKMHANRNLVTDF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG +RFRGFVISDW GID+IT    +NYT SVL+ I+AGIDM+MVP+N++ FI +   L
Sbjct  297   LKGRMRFRGFVISDWQGIDKITTPAHANYTLSVLDGISAGIDMIMVPDNHTDFIDSLTYL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN +IP+SRIDDAV RILRVKFT+GLFE P+ADY+    LG QAHRDLAREAVRKSLVL
Sbjct  357   VKNNYIPVSRIDDAVRRILRVKFTLGLFEKPYADYTYIDQLGSQAHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG +  +P +PL K A +ILV GTHA+NLGYQCGGWTI W+GLSG   T GTTIL+GI
Sbjct  417   LKNGNNADEPFIPLSKKARKILVTGTHAHNLGYQCGGWTIAWQGLSGNNHTTGTTILNGI  476

Query  576   ANAVDPATQIVYNESAN-KEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
               AVD  T++VY ES +  +F+  N+F YAIVVVGE PY+E  GD+ NLTIP  G  TI 
Sbjct  477   IAAVDHGTEVVYKESIDGSDFVTDNNFDYAIVVVGEPPYAETAGDNANLTIPEPGPSTIT  536

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC++ VKC VV+VSGRPLV+EP+L S+DALVAAWLPG+EGQGVADVLFGDY FTGK SR
Sbjct  537   NVCSS-VKCAVVVVSGRPLVVEPYLSSIDALVAAWLPGTEGQGVADVLFGDYGFTGKTSR  595

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             TWFKTV+QLPMN GD HYDPLFP G GL T+
Sbjct  596   TWFKTVEQLPMNYGDEHYDPLFPLGHGLATE  626



>ref|XP_006367581.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=629

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/453 (69%), Positives = 366/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             R+PRWGRCYES+SED+ IV+SMTEIIPGLQGD+P N S+G PYV GKTKVA CAKH+VAD
Sbjct  176   RNPRWGRCYESFSEDINIVRSMTEIIPGLQGDLPANMSKGTPYVNGKTKVAGCAKHFVAD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNT+ D  GL SIHMP Y  S+IKGV+TVMASYSS+NG +MHAN HLLT F
Sbjct  236   GGTVNGLDENNTIVDSKGLFSIHMPAYYDSVIKGVATVMASYSSLNGERMHANTHLLTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GI+RIT   ++NYTYSV  SI AGIDMVMVPNNY+ FI     L
Sbjct  296   LKKRLNFRGFVISDWEGINRITNPANANYTYSVEASIMAGIDMVMVPNNYTDFIGNLTML  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    +PMSRIDDAV RILRVKF MGLFE+P  D SLA +LG   HR++AREAVRKSLVL
Sbjct  356   VNKNVVPMSRIDDAVKRILRVKFVMGLFEDPLGDLSLAKHLGSPEHREIAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGL-SGYITAGTTILSGI  577
             LKNGK  +QPL+PLPK A++ILVAGTHA+NLGYQCGGWTITW+G+    +T GTT+L  I
Sbjct  416   LKNGKTAEQPLVPLPKKAAKILVAGTHADNLGYQCGGWTITWQGVPHSNLTVGTTVLDAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPATQ+V+NE  +  F++S+ F YA+VVVGE  Y+E  GD  NLTIP  G   I+N
Sbjct  476   KKTVDPATQVVFNEEPDTNFVQSSKFDYAVVVVGENTYAEVNGDSSNLTIPDPGPSIIQN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V+EP++  MD +VAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  536   VCGA-VKCVVVIISGRPVVIEPYVEKMDVIVAAWLPGTEGQGVADVLFGDYGFTGKLART  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK VDQLPMNVGD HYDPLFPFGFG+TT+  +
Sbjct  595   WFKRVDQLPMNVGDPHYDPLFPFGFGITTQAVK  627



>ref|XP_007030059.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY10561.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=1220

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/453 (73%), Positives = 373/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P+N  +GVP+V GK  VAACAKHYV D
Sbjct  768   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDIPSNSRKGVPFVAGKKNVAACAKHYVGD  827

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+SIHMP Y  SIIKGVSTVM SYSS NGVK HAN  ++T+F
Sbjct  828   GGTTRGINENNTVIDRHGLLSIHMPAYYNSIIKGVSTVMTSYSSWNGVKNHANHEMVTNF  887

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+L SINAG+DM+MVPNNY  FI     L
Sbjct  888   LKKTLRFRGFVISDWEGIDRITSPPHANYTYSILASINAGLDMIMVPNNYKEFIDGLTYL  947

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPMSRIDDAV RILRVKF MGLFE+P AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  948   VKNKFIPMSRIDDAVKRILRVKFVMGLFEDPLADDSLVDQLGSQEHRELAREAVRKSLVL  1007

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG     PLLPLPK A +ILVAG+HANNLGYQCGGWTI W+G  G  IT GTTIL+ I
Sbjct  1008  LKNGDSADAPLLPLPKKAPKILVAGSHANNLGYQCGGWTIEWQGQGGNNITDGTTILTAI  1067

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP T++VY E  + EF+KSNDF+YAIVVVGE PY+E  GD LNLTIP  G  TI N
Sbjct  1068  KKTVDPKTKVVYKEKPDAEFVKSNDFSYAIVVVGEHPYAETNGDSLNLTIPEPGPSTIGN  1127

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P++  +DA+VAAWLPGSEGQGVADVLFGDY FTGKLS T
Sbjct  1128  VCGA-VKCVVVVISGRPVVIQPYVRYIDAIVAAWLPGSEGQGVADVLFGDYGFTGKLSFT  1186

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPM+VGD HYDPLFPFGFGLTTK ++
Sbjct  1187  WFKTVDQLPMHVGDSHYDPLFPFGFGLTTKPTK  1219


 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/419 (69%), Positives = 340/419 (81%), Gaps = 2/419 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED E+V++MTEI+PGLQGD+P N  +GVP+V G+  VAACAKHYV D
Sbjct  192   RDPRWGRCYESYSEDPEVVEAMTEIVPGLQGDIPANSPKGVPFVAGQKNVAACAKHYVGD  251

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS NG+KMHANR L+TDF
Sbjct  252   GGTTQGINENNTVIDRHGLVSIHMPGYYTSIIKGVSTIMVSYSSWNGIKMHANRDLITDF  311

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVI+DW G+DRIT    +NY+YS+   I AGIDMVMVP NY+ FI      
Sbjct  312   LKNTLRFRGFVITDWEGLDRITSPPHANYSYSIQVGIKAGIDMVMVPFNYTEFIDGLTFQ  371

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP ADYSL   LG Q HR+LAREAVR+SLVL
Sbjct  372   VKNNIIPMSRIDDAVMRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRRSLVL  431

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+    PLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+GLSG  +T+GTTIL+ +
Sbjct  432   LKNGQSTDHPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTSGTTILTAV  491

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T++VY ++ + EF+KSNDF+YAIVVVGE PY+E  GD +NLTI   G  TI N
Sbjct  492   KNTVDSSTKVVYKKNPDAEFVKSNDFSYAIVVVGEHPYAETQGDSMNLTIADPGPSTITN  551

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             VC A VKCVV+++SGRP+V++P L S+DALVAAWLPG+EGQGVADVLFGDY FT K  R
Sbjct  552   VCGA-VKCVVIIISGRPVVIQPFLNSIDALVAAWLPGTEGQGVADVLFGDYGFTDKCYR  609



>ref|XP_002266470.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Vitis 
vinifera]
Length=676

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/453 (70%), Positives = 373/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED ++V++MTEI+PGLQGD+P  + +G+PYV G  KVAACAKHYV D
Sbjct  224   RDPRWGRCFESYSEDPKVVRAMTEIVPGLQGDLPPGYQKGIPYVAGNKKVAACAKHYVGD  283

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV   HGL+SIHM  Y  SIIKGVSTVM SYSS NG KMHAN+ L+T F
Sbjct  284   GGTTEGINENNTVISRHGLLSIHMGGYYTSIIKGVSTVMISYSSWNGKKMHANQELITGF  343

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YS+   I AGIDM+MVP NY+ FI      
Sbjct  344   LKNTLRFRGFVISDWQGIDRITSPPHANYSYSIEAGIKAGIDMIMVPYNYTEFIDGLTYQ  403

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK++ IPMSRIDDAV RILRVKF MGLFE+P AD+SL H LG Q HR+LAREAVRKSLVL
Sbjct  404   VKSKIIPMSRIDDAVRRILRVKFVMGLFESPLADHSLVHELGSQVHRELAREAVRKSLVL  463

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A +ILVAGTHA+NLG QCGGWTI W+GLSG  +T+GTTILS I
Sbjct  464   LKNGEPADKPLLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLSGNNLTSGTTILSAI  523

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP T++VY E+ +  ++KS+ F+YAIVVVGE PY+E FGD+LNLTIP  G   I N
Sbjct  524   KKTVDPKTEVVYKENPDLSYVKSSKFSYAIVVVGEPPYAETFGDNLNLTIPDPGPSIITN  583

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRPLV++P++  +DALVAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  584   VCGA-VKCVVIVISGRPLVIQPYVDQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRT  642

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WF+TV+QLPMNVGDRHYDPLFPFGFGLTT+ ++
Sbjct  643   WFRTVEQLPMNVGDRHYDPLFPFGFGLTTEPTK  675



>ref|XP_008464959.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/449 (70%), Positives = 368/449 (82%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEII GLQG++P+N  +GVPYV G+ KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKIVQEMTEIISGLQGEIPSNSRKGVPYVAGREKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT+   HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMH NR L+T F
Sbjct  235   GGTTKGINENNTLASRHGLLSIHMPGYYNSIIKGVSTVMISYSSWNGKKMHENRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS++  I AGIDM+MVP NY+ FI     L
Sbjct  295   LKNTLRFRGFVISDWQGIDRITSPPHANYTYSIIAGITAGIDMIMVPYNYTEFIDGLTYL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IP+SRIDDAV RILRVKF MGLFENP AD S  + LG + HR+LAREAVRKSLVL
Sbjct  355   VKTNVIPISRIDDAVKRILRVKFIMGLFENPLADSSFVNELGKKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +P+LPLPK   +ILVAG+HANNLG+QCGGWTI W+GL G  +T+GTTILS I
Sbjct  415   LKNGESADKPILPLPKKVPKILVAGSHANNLGFQCGGWTIEWQGLGGNNLTSGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T++V+ E+ + EF+KSN F+YAIVVVGE PY+E FGD LNLTIP  G  TI N
Sbjct  475   KDTVDPKTKVVFKENPDIEFVKSNKFSYAIVVVGEHPYAETFGDSLNLTIPDPGSSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVV+++SGRP+VL+P++ S+DALVAAWLPG+EG+G++DVLFGDY F+GKLSRT
Sbjct  535   VCGV-VKCVVIVISGRPVVLQPYISSIDALVAAWLPGTEGKGISDVLFGDYGFSGKLSRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  594   WFKTVDQLPMNVGDAHYDPLFPFGFGLTT  622



>gb|AEP33566.1| b-1,4-glucanase [Gossypium darwinii]
Length=627

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 366/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  354   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  414   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + S+DALVAAWLPGSEG GVA VLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSVDALVAAWLPGSEGHGVAYVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>gb|KEH25594.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=631

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/453 (70%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQGD+P N+S GVPYV G  KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHKVVQAMTEIIPGLQGDLPANWSNGVPYVAGNKKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++E+NTV + H L SIHMP Y  SIIKGV TVM SYSS NG KMHANR L+T F
Sbjct  235   GGTTKGINEDNTVANRHELFSIHMPAYYNSIIKGVLTVMVSYSSWNGEKMHANRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRF+GFVISDW GIDRIT    +NYT+S+   +NAGIDM+M+P+NY+ FI     L
Sbjct  295   LKNTLRFKGFVISDWEGIDRITSPPHANYTFSIEAGVNAGIDMIMIPHNYTEFIDGLTLL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLFENP ADYSLA  LG Q HR+LAREAVRKSLVL
Sbjct  355   VKKNVIPMSRIDDAVKRILRVKFVMGLFENPLADYSLADQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +P+LPLPK AS+ILVAG+HA+NLGYQCGGWTI W+G SG  IT GT ILS I
Sbjct  415   LKNGENVDKPILPLPKKASKILVAGSHADNLGYQCGGWTIQWQGQSGNNITTGTPILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              NAVD  T++ Y E+ + +++KSNDF+YAIV+VGE PY+E  GD LNLTI   G +TI N
Sbjct  475   KNAVDKETKVFYEENPSLDYVKSNDFSYAIVIVGETPYAETNGDSLNLTISGHGYETIDN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +GVKCVVVL++GRP+V++P+L  ++ LV  WLPGSEG GVADVLFGDY FTGKL RT
Sbjct  535   VC-SGVKCVVVLITGRPIVIQPYLEKIEGLVDDWLPGSEGSGVADVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+  +
Sbjct  594   WFKTVDQLPMNVGDSHYDPLFPFGFGLTTEAHK  626



>ref|XP_011094172.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Sesamum 
indicum]
Length=627

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 369/452 (82%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP++ G+ KV A AKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKIVRAMTEIIPGLQGDIPANSRKGVPFLAGQQKVLATAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+ IHMP Y  SIIKGV T+M SYSS NGVKMHANR L+T F
Sbjct  235   GGTTKGINENNTVASRHDLLRIHMPAYYDSIIKGVGTIMISYSSWNGVKMHANRDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW G+DRIT    +NYTYS++  + AGIDM+MVP NY+ FI    SL
Sbjct  295   LKNTLRFRGFVISDWQGLDRITSPPHANYTYSIIAGVGAGIDMIMVPYNYTEFIDGLTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPMSRIDDAV RILRVKFT+GLFE+P ADYS+  YLG Q HR+LAREAVRKSLVL
Sbjct  355   VKNNFIPMSRIDDAVKRILRVKFTIGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG+   +PL+PLPK AS+ILVAGTHA+N+G QCGGWTI  +G  G +T GTTIL+ I 
Sbjct  415   LKNGESANKPLIPLPKKASKILVAGTHADNIGNQCGGWTIQLQGQPGNVTVGTTILTAIR  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N V P T+IV+NE+ +  ++KSN+F+YAI+VVGE PYS  FGD+ NLTIP  G   I NV
Sbjct  475   NTVHPETKIVFNENPHPGYVKSNEFSYAIIVVGEPPYSLTFGDNTNLTIPDPGPSIITNV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CA+ VKCVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTG L RTW
Sbjct  535   CAS-VKCVVVLITGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGTLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FKTVDQLPMNVGD+HYDPLFPFG+GL T+  R
Sbjct  594   FKTVDQLPMNVGDQHYDPLFPFGYGLITEPVR  625



>gb|AEP33568.1| b-1,4-glucanase [Gossypium tomentosum]
Length=627

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/453 (71%), Positives = 366/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V +MTEI+PGLQGD+P   S+G+P+V G   VAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV +WH L+SIHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  234   GGTTKGINENNTVINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I +GIDMVMVP NYS FI     L
Sbjct  294   LKNKLRFRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FIPMSRIDDAV RILRVKF MGLFENP AD SL    G Q HR+LAREAVR+SLVL
Sbjct  354   VKSNFIPMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQPGSQEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG    QPLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G SG  +T GTT+L  I
Sbjct  414   LKNGHSADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAI  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +T +VY E+ + +F+KSN+F+ AIVVVGE PY E  GD +NLTIP  G  TI+N
Sbjct  474   KNTVDSSTNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+L+SGRP+V+EP + S+DALVAAWLPGSEG GVADVLFGDY F+GKL RT
Sbjct  534   VCGA-LKCVVILMSGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+ ++
Sbjct  593   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTK  625



>ref|XP_007145577.1| hypothetical protein PHAVU_007G250300g [Phaseolus vulgaris]
 gb|ESW17571.1| hypothetical protein PHAVU_007G250300g [Phaseolus vulgaris]
Length=627

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 377/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKIVRNMTEIIPGLQGDIPANSVKGVPFVAGKNKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+  ++GL+ IHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+TD+
Sbjct  235   GGTNKGINENNTLISYNGLLGIHMPAYYNSIIKGVSTVMISYSSWNGVKMHANRKLITDY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP NY+ FI      
Sbjct  295   LKNKLRFRGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP  D SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKNNIIPMSRIDDAVARILRVKFVMGLFENPLPDSSLVNQLGKQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  K+PLLPLPK +++ILVAGTHA+NLGYQCGGWTITW+GL    +T+GTTILS +
Sbjct  415   LKNGKSYKKPLLPLPKKSAKILVAGTHADNLGYQCGGWTITWQGLDAKNLTSGTTILSAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPAT++V+NE+ +  F+KSN F+YAIVVVGE  Y+E FGD LNLTIP  G  TI N
Sbjct  475   KQTVDPATEVVFNENPDVNFLKSNKFSYAIVVVGEHTYAETFGDSLNLTIPEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A ++CVVV++SGRP+V++P+LP +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCGA-IRCVVVVISGRPVVIQPYLPKIDALVAAWLPGTEGQGVADVLFGDYEFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFK VDQLPMNVGD+HYDPLFPFGFGLTT  +++
Sbjct  594   WFKRVDQLPMNVGDKHYDPLFPFGFGLTTNPTKY  627



>ref|XP_009412936.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=584

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MTEII GLQG +P N  +GVP++ G+  VAACAKHYV D
Sbjct  130   RDPRWGRCYESYSEDPKVVEQMTEIIDGLQGTIPANSRKGVPFLAGRKNVAACAKHYVGD  189

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTV D HGL+SIHMPPY  +II+GVSTVM SYSS NGVKMHANR L+TDF
Sbjct  190   GGTYKGINENNTVIDLHGLLSIHMPPYYHAIIRGVSTVMVSYSSWNGVKMHANRRLVTDF  249

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GID+IT    +NY+YSV   I+AGIDM+M+PNNY+ FI      
Sbjct  250   LKNTLRFRGFVISDWQGIDKITTPPHANYSYSVTAGISAGIDMIMIPNNYTEFIDDLTDQ  309

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+++ IPMSRIDDAV RILRVKFTMGLFENPF D SL   +G Q HR+LAR+AVR+SLVL
Sbjct  310   VESKIIPMSRIDDAVRRILRVKFTMGLFENPFPDPSLVDQVGKQEHRELARDAVRRSLVL  369

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    P+LPLPK    ILV G+HA+NLGYQCGGWTITW+GL G  +T GTTI   I
Sbjct  370   LKNGKSADAPVLPLPKKTGSILVTGSHADNLGYQCGGWTITWQGLGGNNLTIGTTIFEAI  429

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP TQIV++E  +  F++ N F+YA+VVVGE+PY+E FGD+LNLTIP  G   I+ 
Sbjct  430   KATVDPTTQIVFSEDPDAGFIERNHFSYAVVVVGEQPYAETFGDNLNLTIPEPGPSLIQK  489

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVV+VSGRPLV+EP++  MDA+VAAWLPGSEGQGVADVLFGDY F+GKL RT
Sbjct  490   VCGS-IKCVVVVVSGRPLVIEPYVGVMDAVVAAWLPGSEGQGVADVLFGDYGFSGKLPRT  548

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WF++V+QLPMNVGDRHYDPLFP+GFGLTTK +R
Sbjct  549   WFRSVEQLPMNVGDRHYDPLFPYGFGLTTKPAR  581



>ref|XP_008385601.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
 ref|XP_008359191.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 369/455 (81%), Gaps = 3/455 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P    +G PYV   K KVAACAKHY+ 
Sbjct  179   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDMPPTAQKGAPYVSTAKGKVAACAKHYLG  238

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG++ENNTV D +GL+ IHMP Y  SI+KGV+TVM SYSS NG KMHAN+ L+T 
Sbjct  239   DGGTTKGINENNTVIDLNGLLRIHMPAYLNSILKGVATVMVSYSSWNGKKMHANKELVTG  298

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             +LK  LRFRGFVISDW GIDRIT    +NY+YSV   + AGIDM+MVP N++ FI     
Sbjct  299   YLKDKLRFRGFVISDWEGIDRITSPPKANYSYSVQAGVXAGIDMIMVPYNFTDFIDDLTY  358

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRIDDAV RILRVKF MGLFENP AD SLA  LG + HR+LAREAVRKSLV
Sbjct  359   QVKNNIIPMSRIDDAVKRILRVKFVMGLFENPLADLSLASQLGSKEHRELAREAVRKSLV  418

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSG  580
             LLKNGK   +PLLPLPK A +ILVAG+HA+NLG QCGGWTITW+GL G   T GTTILS 
Sbjct  419   LLKNGKSAYKPLLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGLEGNNNTMGTTILSA  478

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             I + VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PY+E FGD+LNLTIP  G  TI 
Sbjct  479   IKSTVDPTTQVVYNENPDANFVKSNKFSYAIVVVGEPPYAETFGDNLNLTIPQPGPSTIA  538

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+R
Sbjct  539   NVCGA-VKCVVVVISGRPVVIQPYLAGIDALVAAWLPGTEGQGVTDALFGDYGFTGKLAR  597

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             TWFKTVDQLPMNVGD HYDPLFPFGFGLTTK +++
Sbjct  598   TWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTKN  632



>ref|XP_003519468.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=627

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/454 (68%), Positives = 373/454 (82%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED +I ++MTEIIPGLQGD+ +N  +GVPYV GK KVAACAKHYV D
Sbjct  175   RDPRWGRCFESYSEDPKIAQAMTEIIPGLQGDISSNSRKGVPYVSGKNKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV  +  L+ IHMPPY  SI+KGVSTVM SYSS NG KMHAN  L+T++
Sbjct  235   GGTTKGINENNTVISYSELLRIHMPPYYDSIVKGVSTVMVSYSSWNGQKMHANHFLVTNY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDWLGID+IT    SNY+YS+   + AGIDM+MVP N++ FI      
Sbjct  295   LKNKLKFRGFVISDWLGIDKITSPPHSNYSYSIQVGVGAGIDMIMVPFNFTEFIDVLTYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP AD SL + LG + HR +AREAVRKSLVL
Sbjct  355   VKNNIIPVSRIDDAVKRILRVKFVMGLFENPLADLSLVNQLGSEEHRQIAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  ++PLLPLPK A++ILVAG+HA+NLGYQCGGWTITW+GL G  +T GTTIL  +
Sbjct  415   LKNGKSAEKPLLPLPKKAAKILVAGSHADNLGYQCGGWTITWQGLGGNNLTVGTTILEAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                +DPAT++V+NE+ +  F+KSN+F+ AIVVVGE PY+  FGD LNLTIP  G  TI N
Sbjct  475   KQTIDPATKVVFNENPDSNFVKSNNFSCAIVVVGEHPYATTFGDSLNLTIPEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + ++CVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVAD+LFGDY FTGKL+RT
Sbjct  535   VCGS-IQCVVVLITGRPVVIQPYLSKVDALVAAWLPGTEGQGVADLLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD++YDPLFPFGFGL+T  +++
Sbjct  594   WFKTVDQLPMNVGDKYYDPLFPFGFGLSTNPTKY  627



>ref|XP_009368634.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/455 (70%), Positives = 367/455 (81%), Gaps = 3/455 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P    +G PYV   K KVAACAKHY+ 
Sbjct  179   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDMPPTAQKGAPYVSTAKGKVAACAKHYLG  238

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTT G++ENNTV D +GL+ IHMP Y  SI+KGV+TVM SYSS NG KMHAN+ L+T 
Sbjct  239   DGGTTNGINENNTVIDLNGLLRIHMPAYLNSILKGVATVMVSYSSWNGKKMHANKELVTG  298

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             +LK  LRFRGFVISDW GIDRIT    +NY+YSV   + AGIDM+MVP N++ FI     
Sbjct  299   YLKDKLRFRGFVISDWEGIDRITSPPKANYSYSVQAGVGAGIDMIMVPYNFTDFIDELTY  358

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRIDDAV RILRVKF MGLFENP AD SLA  LG + HR+LAREAVRKSLV
Sbjct  359   QVKNNIIPMSRIDDAVKRILRVKFVMGLFENPLADLSLASQLGSKEHRELAREAVRKSLV  418

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSG  580
             LLKNGK   +PLLPLPK A +ILVAG+HANNLG QCGGWTITW+GL G   T GTTILS 
Sbjct  419   LLKNGKSAYKPLLPLPKKAGKILVAGSHANNLGNQCGGWTITWQGLEGNNNTMGTTILSA  478

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             I + VDP TQ+VYNE+ +  F+KSN F+YAIV VGE PY+E FGD+LNLTIP  G  TI 
Sbjct  479   IKSTVDPTTQVVYNENPDANFVKSNKFSYAIVAVGEPPYAETFGDNLNLTIPQPGPSTIA  538

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+R
Sbjct  539   NVCGA-VKCVVVVISGRPVVIQPYLAGIDALVAAWLPGTEGQGVTDALFGDYGFTGKLAR  597

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             TWFKTVDQLPMNVGD HYDPLFPFGFGLTTK +++
Sbjct  598   TWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTKN  632



>ref|XP_007151483.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris]
 gb|ESW23477.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris]
Length=628

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/450 (70%), Positives = 369/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQG++P N ++GVP+V GK KV A AKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKVVQAMTEIIPGLQGEIPTNSTKGVPFVAGKRKVIASAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNTV   HGL+SIHMP Y  +IIKGVSTVM SYSS NG KMHAN +L+TDF
Sbjct  235   GGTKNGINENNTVISRHGLLSIHMPAYYDAIIKGVSTVMVSYSSWNGEKMHANHNLITDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYS+  +I AGIDMVMVP NY+ FI    SL
Sbjct  295   LKNSLRFRGFVISDWEGIDRITTPPHANYTYSIYAAITAGIDMVMVPLNYTEFIDGLTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRI+DAV RILRVKF MGLFENP AD+SL H LG + HR LAREAVRKSLVL
Sbjct  355   VKVNAIPMSRINDAVRRILRVKFIMGLFENPLADHSLVHELGRKKHRKLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  QPLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+G++G  +T GTTILS I
Sbjct  415   LKNGENPNQPLLPLPKRASKILVAGSHADNLGYQCGGWTIEWQGVTGNNVTKGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N V   T++VY E+ + +F+KSN+F+Y IVVVGEKPY+E  GD LNLTI A G +TIKN
Sbjct  475   KNTVHKDTEVVYKENPDLDFIKSNNFSYGIVVVGEKPYAETNGDSLNLTISAPGPETIKN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GVKCV V++SGRP+V++P++  ++ALVAAWLPG+EG+GV DVLFGDY F GKL RT
Sbjct  535   VC-GGVKCVTVIISGRPVVIQPYVDKIEALVAAWLPGTEGKGVTDVLFGDYGFRGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPFGFGL TK
Sbjct  594   WFKTVDQLPMNVGDSHYDPLFPFGFGLKTK  623



>ref|XP_009417082.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417083.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=656

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/449 (70%), Positives = 365/449 (81%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ MTEIIPGLQGDVP  + +GVPYV GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHNIVQQMTEIIPGLQGDVPAKYRKGVPYVSGKEKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ +   L+SIHMP Y  SIIKGVST+M SYSS NGVKMHANR L+T +
Sbjct  235   GGTHNGINENNTIVNRADLLSIHMPAYLNSIIKGVSTIMVSYSSWNGVKMHANRDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NYTYSV   I+AGIDMVMVP NYS FI+   SL
Sbjct  295   LKNTLRFRGFVISDWQGIDRITSSPGANYTYSVQAGISAGIDMVMVPYNYSEFINDLTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IP+SRIDDAV RILRVKFT+GLFENP AD SL   LG + HRDLAREAVRKSLVL
Sbjct  355   VKKNVIPLSRIDDAVGRILRVKFTIGLFENPLADLSLVDQLGKKEHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK      LPLPK A++IL+AG+HA+NLGYQCGGWTI W+G SG IT GTTIL  + 
Sbjct  415   LKNGKSTNDSFLPLPKKAAKILIAGSHASNLGYQCGGWTIEWQGDSGNITVGTTILDAVR  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             +A+DP+T++VY+E+ +   +K NDF+YAIVVVGE PY+E  GD+LNL +P      I+ V
Sbjct  475   SAIDPSTEVVYSENPDSNIVKGNDFSYAIVVVGEPPYTETAGDNLNLELPDPAPSIIQTV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C   +KCVVV++SGRP+V+EP++P +DALVAAWLPGSEGQG+ DVL+GDY FTGKLSRTW
Sbjct  535   CGT-IKCVVVIISGRPVVIEPYVPLVDALVAAWLPGSEGQGLTDVLYGDYGFTGKLSRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  594   FKSVDQLPMNVGDKHYDPLFPFGFGLTTK  622



>ref|XP_009342674.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342678.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342686.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/455 (71%), Positives = 366/455 (80%), Gaps = 3/455 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P    RG PYV   K KVAACAKHYV 
Sbjct  179   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDMPPTARRGAPYVSTAKGKVAACAKHYVG  238

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG++ENNTV D  GL+SIHMP Y  SI KGV+TVM SYSS NG KMHAN+ L+T 
Sbjct  239   DGGTTKGINENNTVIDLDGLLSIHMPAYLNSIRKGVATVMVSYSSWNGNKMHANKELVTG  298

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             +LK  LRFRGFVISDW GIDRIT    +NY+YSV   + AGIDM+MVP N++ FI     
Sbjct  299   YLKDKLRFRGFVISDWEGIDRITSPPKANYSYSVQAGVGAGIDMIMVPYNFTDFIDDLTY  358

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRIDDAV RILRVKF MGLFENP AD SLA  LG + HRDLAREAVRKSLV
Sbjct  359   QVKNNIIPMSRIDDAVQRILRVKFVMGLFENPLADLSLASQLGNKVHRDLAREAVRKSLV  418

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSG  580
             LLKNGK   +P+LPLPK A +ILVAG+HA+NLG QCGGWTITW+GL G   T GTTILS 
Sbjct  419   LLKNGKSAYKPVLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGLEGNDHTMGTTILSA  478

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             + + VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PYSE FGD LNLTIP  G  TI 
Sbjct  479   VKSTVDPTTQVVYNENPDANFVKSNKFSYAIVVVGEPPYSETFGDSLNLTIPQPGPSTIA  538

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC A VKCVVV++SGRP+VL+P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+ 
Sbjct  539   NVCGA-VKCVVVVISGRPVVLQPYLAGIDALVAAWLPGTEGQGVTDALFGDYGFTGKLAH  597

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             TWFKTVDQLPMNVGD HYDPLFPFGFGLTTK +++
Sbjct  598   TWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTKN  632



>ref|XP_008443733.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=627

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/450 (69%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESY ED ++V+ MTEIIPGLQG++P N  +GVPYV GK KV ACAKHYV D
Sbjct  175   RDPRWGRCYESYGEDPKLVQEMTEIIPGLQGEIPPNSRKGVPYVAGKEKVVACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG+DENNTV D HGL+SIHMP Y  SIIKGV+TVM SYSS NGVKMHAN+ L+TDF
Sbjct  235   GGTTKGIDENNTVIDRHGLLSIHMPGYYHSIIKGVATVMVSYSSWNGVKMHANKELVTDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW  IDRIT    +NYTYS+L S+ AG+DM+MVP NY+ FI     L
Sbjct  295   LKNTLHFQGFVISDWQAIDRITDPPHANYTYSILASVTAGLDMIMVPYNYTEFIDGLTYL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N FIP++RIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VNNNFIPITRIDDAVKRILRVKFIMGLFENPIADLSLVNELGKQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   +PLLPL K   +ILVAG+HA+NLGYQCGGWTI W+GLSG  +T+GTT+L  I
Sbjct  415   LKNGKSADKPLLPLEKKTQKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTSGTTVLDAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++++NE+ +K F++S  F+YAIVVVGE PY+E  GD LNLTIP  G  TI N
Sbjct  475   KDTVDPSTEVIFNENPDKGFLQSGTFSYAIVVVGEHPYAEMMGDSLNLTIPDPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   +KCVVV++SGRP+V++P++ S+DALVAAWLPG+EG+G+ DVLFGDY FTGKLS+T
Sbjct  535   VCGV-IKCVVVIISGRPVVIQPYVDSVDALVAAWLPGTEGKGITDVLFGDYGFTGKLSQT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD HYDPLFP G GLTT+
Sbjct  594   WFKTVDQLPMNFGDSHYDPLFPLGHGLTTQ  623



>gb|KHG30203.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=630

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/450 (70%), Positives = 373/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED +IVK MTEII GLQG++P +  +GVPYV GK KV ACAKH+V D
Sbjct  176   RDPRWGRCFESYSEDPDIVKEMTEIINGLQGEIPKDSRKGVPYVSGKDKVVACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+SIHMP Y  +IIKGV TVM SYSS NGVKMHAN  L+T+F
Sbjct  236   GGTTRGINENNTVIDKHGLLSIHMPGYNAAIIKGVGTVMVSYSSWNGVKMHANHDLVTNF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRFRGFVISDW  IDR+T    +NYTYSVL  + AG+DM+MVP NY+ FI T   L
Sbjct  296   LKGALRFRGFVISDWQAIDRMTYPVHANYTYSVLTGVQAGLDMIMVPYNYTEFIDTLTGL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPM+RIDDAV RILRVKF +GLFENP +D S    LG QAHRDLAREAVRKSLVL
Sbjct  356   VKNKFIPMNRIDDAVRRILRVKFQLGLFENPLSDESFIDQLGHQAHRDLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +P+LPLPK +S+ILVAG+HA++LG QCGGWTI W+G SG  +T+GTTIL GI
Sbjct  416   LKNGENADEPMLPLPKKSSKILVAGSHADDLGNQCGGWTINWQGGSGNNLTSGTTILKGI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             A AVDP+T+IVY E+   +++KSN+F+Y IVVVGE PY+E  GD+LNLTIP  G  T+ N
Sbjct  476   AEAVDPSTEIVYEENPEFDYVKSNNFSYGIVVVGEPPYAETNGDNLNLTIPLQGQYTLYN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVVL+SGRPLV+ PHL  +DALVAAWLPG+EG+GVADVLFGDY F+GKL RT
Sbjct  536   VC-ANIKCVVVLISGRPLVIMPHLEQVDALVAAWLPGTEGKGVADVLFGDYGFSGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKT +QLPMNVGD +YDPL+PFG+GLTT+
Sbjct  595   WFKTAEQLPMNVGDLNYDPLYPFGYGLTTQ  624



>ref|XP_002311926.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE89293.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=622

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/452 (70%), Positives = 368/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGDVP NF RG P+V GK KVAACAKH+V D
Sbjct  171   RDPRWGRCYESYSEDHKIVQMMTEIIPGLQGDVPANFQRGTPFVSGKDKVAACAKHFVGD  230

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+   + L SIHMP Y  S+ KGV+TVM SYSS+NG+KMHANR L+T F
Sbjct  231   GGTVKGINENNTIVTHNELYSIHMPAYLNSLDKGVATVMVSYSSINGLKMHANRGLVTGF  290

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT     NY+YS+L+S+NAG+DMVMVP NY+ FI+    L
Sbjct  291   LKRKLKFRGFVISDWEGIDRITYPPHKNYSYSILKSVNAGVDMVMVPYNYTEFINGLTDL  350

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V  + I + RIDDAV RILRVKF MGLFENP ADYS    LG + HR+LAREAVRKSLVL
Sbjct  351   VNKKAIRIQRIDDAVRRILRVKFAMGLFENPLADYSFVDKLGSKEHRELAREAVRKSLVL  410

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  K P++PLPK AS+ILVAGTHA+NLG QCGGWTI W+G  G  +TAGTTIL GI
Sbjct  411   LKNGKSAKSPVVPLPKKASKILVAGTHADNLGNQCGGWTIKWQGQEGNNLTAGTTILKGI  470

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T++V+ E+ N +++KS  F++AIVVVGE PY+E  GD+LNLT+P  G   I N
Sbjct  471   QAAVDPSTKVVFKENPNAKYVKSQGFSHAIVVVGEPPYAETAGDNLNLTLPNPGPKIINN  530

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV+VSGRPLV+E ++P +DALVAAWLPGSEGQGVADVLFGDY FTGKL+RT
Sbjct  531   VCGA-VKCVVVIVSGRPLVIESYVPKIDALVAAWLPGSEGQGVADVLFGDYGFTGKLART  589

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFK VDQLPMNVGD+HYDPLFPFGFGL TK S
Sbjct  590   WFKRVDQLPMNVGDKHYDPLFPFGFGLETKPS  621



>ref|XP_007141605.1| hypothetical protein PHAVU_008G210100g [Phaseolus vulgaris]
 gb|ESW13599.1| hypothetical protein PHAVU_008G210100g [Phaseolus vulgaris]
Length=627

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/454 (68%), Positives = 369/454 (81%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIVK+MTEII GLQGD+  N  +GVPYV GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPEIVKAMTEIILGLQGDISGNSRKGVPYVAGKNKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT+KG++ENNT+  + GL++IHMP Y  SI+KGVSTVM SYSS NG KMHAN  L+TD+
Sbjct  235   GGTSKGINENNTLISYRGLLNIHMPAYHDSILKGVSTVMVSYSSWNGKKMHANHFLVTDY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDWLGIDRIT    SNY+YS+   + AGIDM+MVP N++ FI   +  
Sbjct  295   LKNKLKFRGFVISDWLGIDRITSPPHSNYSYSIQAGVGAGIDMIMVPFNFTEFIDVLVYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP SRIDDAV RILRVKF MGLFENP AD SL + LG + HR LAREAVRKSLVL
Sbjct  355   VKNNIIPESRIDDAVERILRVKFVMGLFENPLADPSLVNQLGSEEHRQLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  ++PLLPLPK A+ ILVAG+HA+NLGYQCGGWTITW+GL G   T GTTIL  +
Sbjct  415   LKNGKSAEKPLLPLPKKAANILVAGSHADNLGYQCGGWTITWQGLGGNNHTVGTTILDAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                +DPAT++ Y ES +  F+KSN+F+YAIV+VGE PY+E  GD LNLTI   G  TI N
Sbjct  475   KQTIDPATKVFYKESPDSTFVKSNNFSYAIVIVGEPPYAETLGDSLNLTIAEPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + ++CVVVL++GRP++++P+L  +DALVAAWLPG+EGQGVAD+LFGDY FTGKL+RT
Sbjct  535   VCES-IQCVVVLITGRPVMIQPYLSKIDALVAAWLPGTEGQGVADLLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTV+QLPMNVGD++YDPLFPFGFGL+T  ++H
Sbjct  594   WFKTVNQLPMNVGDKYYDPLFPFGFGLSTNPTKH  627



>ref|XP_011077752.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=633

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 372/449 (83%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++MTEIIPGLQGD P N  +GVPYV G   V ACAKHYV D
Sbjct  181   RDPRWGRCYESYSEDPNVVRAMTEIIPGLQGDTPANGRKGVPYVAGPRNVMACAKHYVGD  240

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV   H L+SIHMP Y  SIIKGVSTVM SYSS NG+KMHANR L+T F
Sbjct  241   GGTTKGINENNTVATRHALLSIHMPAYYDSIIKGVSTVMISYSSWNGIKMHANRDLITGF  300

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK   RFRGFVISDW GIDRIT    +NYTYS+L  +NAGIDM+MVP NY+ FI    SL
Sbjct  301   LKTIQRFRGFVISDWQGIDRITSPPHANYTYSILAGVNAGIDMIMVPYNYTEFIDGLTSL  360

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ FI MSRIDDAV RILRVKFTMGLFE+P ADYS+  YLG Q HR+LAREAVRKSLVL
Sbjct  361   VKSNFISMSRIDDAVKRILRVKFTMGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVL  420

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PLLPLPK AS+ILVAGTHA+N+G QCGGWTI W+G SG IT GTTIL+ + 
Sbjct  421   LKNGKSADKPLLPLPKKASKILVAGTHADNIGNQCGGWTIQWQGQSGNITDGTTILTAVK  480

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++V++E+ +  ++KSN F+YAIVVVGE PY+E FGD+LNLT+P  G   I NV
Sbjct  481   NTVDPKTEVVFSENPDSGYVKSNKFSYAIVVVGEPPYAETFGDNLNLTLPDPGPSIITNV  540

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C++ VKCVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVADVL+GDY FTGKLSRTW
Sbjct  541   CSS-VKCVVVLITGRPVVIQPYLKQIDALVAAWLPGTEGQGVADVLYGDYGFTGKLSRTW  599

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK VDQLPMNVGDRHYDPLFPFG+GLTT+
Sbjct  600   FKNVDQLPMNVGDRHYDPLFPFGYGLTTE  628



>ref|XP_011032946.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=627

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/452 (70%), Positives = 368/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGDVP NF RG P+V GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDHKIVQMMTEIIPGLQGDVPANFQRGTPFVSGKDKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+   + L +IHMP Y  S+ KGV+TVM SYSS+NG+KMHANR L+T F
Sbjct  236   GGTVKGINENNTIVTHNELYNIHMPAYLNSLDKGVATVMVSYSSINGLKMHANRGLVTRF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT     NY+YS+L+S+NAG+DMVMVP NY  FI+    L
Sbjct  296   LKRKLKFRGFVISDWEGIDRITYPPHKNYSYSILKSVNAGVDMVMVPYNYIEFINGLTDL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V  + I + RIDDAV RILRVKF MGLFENP ADYS    LG + HR+LAREAVRKSLVL
Sbjct  356   VNKKAIRIQRIDDAVKRILRVKFAMGLFENPLADYSFVDKLGSKEHRELAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  K P++PLPK AS+ILVAGTHA+NLGYQCGGWTI W+G  G  +TAGTTIL GI
Sbjct  416   LKNGKFAKSPVVPLPKKASKILVAGTHADNLGYQCGGWTIKWQGQEGNNLTAGTTILKGI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T+IV+ E+   +++KS  F++AIVVVGE PY+E  GD+LNLT+P  G + I N
Sbjct  476   QAAVDPSTKIVFKENPKAKYVKSQGFSHAIVVVGEPPYAETAGDNLNLTLPNPGPEIINN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV+VSGRPLV+E ++P +DALVAAWLPGSEGQGVADVLFGDY FTGKL+RT
Sbjct  536   VCGA-VKCVVVIVSGRPLVIESYVPKIDALVAAWLPGSEGQGVADVLFGDYGFTGKLART  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFK VDQLPMNVGD+HYDPLFPFGFGL TK S
Sbjct  595   WFKRVDQLPMNVGDKHYDPLFPFGFGLETKPS  626



>ref|XP_010088030.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB31249.1| Lysosomal beta glucosidase [Morus notabilis]
Length=634

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/453 (69%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEI+  LQG++P N  +GVPYV G   VAACAKH+V D
Sbjct  181   RDPRWGRCYESYSEDPKIVRAMTEIVSALQGELPANSRKGVPYVAGNKNVAACAKHFVGD  240

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV + HGL+SIHM  Y  +IIKGVST+M SYSS NG KMHANR L+T F
Sbjct  241   GGTTKGINENNTVINRHGLLSIHMGGYYNAIIKGVSTIMVSYSSWNGEKMHANRQLITGF  300

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT     NY+YS+   ++AGIDM+M+P NY+ FI      
Sbjct  301   LKNTLRFRGFVISDWQGIDRITSPPHLNYSYSIQAGVSAGIDMIMIPYNYTEFIDGLTYQ  360

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IP+SRIDDAV RILRVKF MGLFE P ADYSL H LG Q HR+LAREAVRKSLVL
Sbjct  361   VKNKIIPISRIDDAVRRILRVKFIMGLFEKPLADYSLVHELGSQEHRELAREAVRKSLVL  420

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+    P+LPLPK A +ILVAGTHA+NLG QCGGWTI W+GL+G  +T+GTTIL+ I
Sbjct  421   LKNGEHADNPVLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLTGNNLTSGTTILTAI  480

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T++VY E+ +  F+KSN+F+YAIVVVGE PY+E FGD LNLTIP  G  TI N
Sbjct  481   KNTVDPKTEVVYLENPDANFVKSNEFSYAIVVVGEPPYAETFGDSLNLTIPEPGPSTITN  540

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKC+V+++SGRP+V++P++  +DALVAAWLPG+EGQGVADVLFGDY FTGKL RT
Sbjct  541   VCGA-VKCIVIVISGRPVVIQPYVAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRT  599

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN GD HYDPLFPFGFGLTT+ ++
Sbjct  600   WFKTVDQLPMNFGDLHYDPLFPFGFGLTTEPTK  632



>ref|XP_008230878.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=630

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/454 (70%), Positives = 371/454 (82%), Gaps = 3/454 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV++MTE+IPGLQGD+P +  +G P+V   K KVAACAKHYV 
Sbjct  176   RDPRWGRCYESYSEDHKIVQAMTELIPGLQGDMPPSAQKGAPFVSIAKGKVAACAKHYVG  235

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG++ENNTV D +GL+SIHMP Y  SI+KGV+TVM SYSS NG KMHAN+ L+T 
Sbjct  236   DGGTTKGINENNTVIDLNGLLSIHMPAYLDSILKGVATVMVSYSSWNGKKMHANQELVTG  295

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  LRFRGFVISDW GIDR+T    +NY+YSV   ++AGIDM+MVP N++ FI     
Sbjct  296   FLKNKLRFRGFVISDWEGIDRLTSPPKANYSYSVQAGVSAGIDMIMVPYNFTDFIDDLTY  355

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRIDDAV RILRVKF MGLFE PFAD SL + LG + HR+LAREAVRKSLV
Sbjct  356   QVKNNIIPMSRIDDAVKRILRVKFVMGLFEEPFADLSLVNELGKKEHRELAREAVRKSLV  415

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSG  580
             LLKNGK   +P LPLPK A +IL+AG+HA+NLG QCGGWTITW+GL G  +T GTTIL+ 
Sbjct  416   LLKNGKSADKPSLPLPKKAGKILIAGSHADNLGNQCGGWTITWQGLGGNDLTVGTTILNA  475

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             + +AVDP TQ+VYNE+ +  F+KSN F YA+VVVGE PY+E FGD LNLTI   G  TI 
Sbjct  476   VKSAVDPTTQVVYNENPDANFVKSNKFDYAVVVVGEPPYAETFGDSLNLTISEPGPSTIA  535

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGV DVLFGDY FTGKL+R
Sbjct  536   NVCGA-VKCVVVVISGRPVVIQPYLAKVDALVAAWLPGTEGQGVTDVLFGDYGFTGKLAR  594

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             TWFKTVDQLPMNVGD+HYDPLFPFGFGLTTK ++
Sbjct  595   TWFKTVDQLPMNVGDQHYDPLFPFGFGLTTKPTK  628



>ref|XP_006379440.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
 gb|ERP57237.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
Length=654

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/452 (70%), Positives = 367/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             +DPRWGRCYESYSED ++V++MTEIIPGLQGD+P N  +GVPYVGGK KVAACAKH+V D
Sbjct  171   KDPRWGRCYESYSEDHKVVQAMTEIIPGLQGDIPVNSRKGVPYVGGKKKVAACAKHFVGD  230

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS NG KMHANR L+T F
Sbjct  231   GGTTKGINENNTVIDKHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELITGF  290

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    +NY+YSV  +I AGIDMVM+P N++ FI     L
Sbjct  291   LKNTLKFKGFVISDWQGIDRITSPPRANYSYSVQAAIQAGIDMVMLPFNHTEFIDDLTYL  350

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IP+ RIDDAV RIL VKFT+GLFENP AD SL + LG QAHRDLAREAVRKSLVL
Sbjct  351   VKTNVIPVDRIDDAVGRILLVKFTLGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVL  410

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK+E  PLLPLP+  S+ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL  I
Sbjct  411   LKNGKNETDPLLPLPRKVSKILVAGTHADNLGYQCGGWTIQWQGFSGNGYTRGTTILGAI  470

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E+ + +F+K N+FAYAI+VVGE PY+E  GD ++LT+   G   I N
Sbjct  471   KSTVDPSTEVVFQENPDSKFIKDNNFAYAIIVVGEAPYAETAGDSMDLTMIDPGPSVISN  530

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP+L S+DALVAAWLPG+EGQGVAD LFGDY FTGKL RT
Sbjct  531   VCET-VKCVVVVISGRPIVIEPYLSSIDALVAAWLPGTEGQGVADALFGDYGFTGKLPRT  589

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFK VDQLPMNVGD HYDPLFPF FGL TK +
Sbjct  590   WFKNVDQLPMNVGDPHYDPLFPFDFGLKTKSA  621



>ref|XP_004242118.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=628

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/450 (71%), Positives = 364/450 (81%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED+ +V++MTEIIPGLQGDVP N S+GVP+V GK+KVAACAKHYVAD
Sbjct  175   RDPRWGRCYESYSEDINVVRTMTEIIPGLQGDVPANSSKGVPFVAGKSKVAACAKHYVAD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G+DENNTV +   L SIHMP Y  SIIKGVSTVM SYSS+NG KMH NR L+T F
Sbjct  235   GGTERGIDENNTVINRTSLYSIHMPAYYDSIIKGVSTVMISYSSLNGEKMHTNRDLVTHF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK +L+FRGF+ISD  G+DRIT   D+NYTYSV   I AGIDMVM+PNNY+ FI     L
Sbjct  295   LKDNLKFRGFIISDSEGLDRITSPPDANYTYSVQAGILAGIDMVMIPNNYAEFIGNLTLL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPMSRIDDAV RILRVKF + LFE+P AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKDNIIPMSRIDDAVERILRVKFILDLFEDPLADLSLVNQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILVAGTHA+NLGYQCGGWT  W+G+SG     GTTILS I
Sbjct  415   LKNGKITSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTNQWQGVSGNNFIVGTTILSAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                V+P+TQ+VY  + +  F+KSN F YAIVVVGE PY+E  GD  NLTIP  G  TI N
Sbjct  475   KKTVNPSTQVVYQLNPDANFVKSNKFDYAIVVVGEVPYAEMLGDSSNLTIPEPGSSTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A V CVVV++SGRP+VLEP++  +D LVAAWLPG+EGQGVADVLFG+Y FTGKL+RT
Sbjct  535   VCGA-VTCVVVIISGRPVVLEPYVDKIDGLVAAWLPGTEGQGVADVLFGNYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  594   WFKSVDQLPMNVGDPHYDPLFPFGFGLTTQ  623



>gb|KDP39683.1| hypothetical protein JCGZ_02703 [Jatropha curcas]
Length=625

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/453 (69%), Positives = 372/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED +IV++MTEI+PGLQGD+P+   +GVP+V GKTKVAACAKHYV D
Sbjct  173   RDPRWGRCFESYSEDPKIVQAMTEIVPGLQGDIPSGSRKGVPFVAGKTKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ NNTV   HGL+SIHMP Y  SIIKGVST+M S S++NG+KMHANR+ +  +
Sbjct  233   GGTKDGLNANNTVVSRHGLLSIHMPGYYSSIIKGVSTIMVSQSTLNGIKMHANRNWIIGY  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  +RFRGFVISDW GID IT    +NYTYS+   I+AGIDM+MVP NY+ FI      
Sbjct  293   LKNTIRFRGFVISDWQGIDWITTPLHANYTYSIQTGISAGIDMIMVPYNYTEFIDGLTDQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IP+SRIDDAV RILRVKF MGLFENP+AD SL H LG + HR+LAREAVRKSLVL
Sbjct  353   VKKNIIPISRIDDAVKRILRVKFVMGLFENPYADESLVHQLGSEEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   +PLLPLP   S+ILVAG+HA+NLGYQCGGWTI W+GLSG  +T GTTIL+ I
Sbjct  413   LKNGKYAGKPLLPLPNKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTTGTTILTAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T++VY+E+ + +F+KSN F+YAIVVVGE PY+E  GD  NLTIP  G +TIKN
Sbjct  473   KKAVDPSTKVVYSENPDADFVKSNKFSYAIVVVGEHPYAETQGDSRNLTIPYPGPNTIKN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+LVSGRP+V++P++  +DALVAAWLPG+EGQGVADVLFGDY FTGKLS T
Sbjct  533   VCEA-VKCVVILVSGRPVVMQPYMNLIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSFT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPM VGD+HYDPLFPFGFGLTT+ ++
Sbjct  592   WFKTVDQLPMIVGDQHYDPLFPFGFGLTTEPAK  624



>ref|XP_009418960.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418961.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418962.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418963.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418964.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418966.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=670

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/448 (70%), Positives = 364/448 (81%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ MTEIIPGLQGDVP N+ +GVPY+ GK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHNIVQEMTEIIPGLQGDVPANYHKGVPYISGKVKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ +  GL+SIHMP Y  SI+KGV+TVM SYSS NGVKMHAN  L+T +
Sbjct  235   GGTHNGINENNTIVNRDGLLSIHMPAYYNSIMKGVATVMVSYSSWNGVKMHANHDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVI+DW GIDRIT    +NYTYSV   INAGIDMVMVP +YS +I+   SL
Sbjct  295   LKNTLHFRGFVITDWQGIDRITSPPGANYTYSVQAGINAGIDMVMVPYDYSEYINALTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAV RILRVKFTMGLFENP AD SL   LG + HR+LAREAVRKSLVL
Sbjct  355   VNKHVIPMSRIDDAVRRILRVKFTMGLFENPLADLSLVDQLGKKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK      LPLPK A++ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  415   LKNGKSRNDSFLPLPKKAAKILVAGSHADNLGYQCGGWTIEWQGASGNITVGTTILGAIK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
               VD +T++VY+E+ +++F+K N F+YAIVVVGE PY+E  GD+LNLT+P  G  TI+ V
Sbjct  475   TTVDHSTEVVYSENPDEKFVKDNGFSYAIVVVGEPPYTETAGDNLNLTLPDPGPSTIRTV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A +KCVV+++SGRP+V+EP++  MDAL+AAWLPGSEGQGV DVLFGDY FTGKLSRTW
Sbjct  535   CGA-IKCVVIIISGRPVVIEPYVHLMDALIAAWLPGSEGQGVTDVLFGDYGFTGKLSRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  594   FKSVDQLPMNVGDMHYDPLFPFGFGLTT  621



>gb|AAQ17461.1| beta-D-glucosidase [Gossypium hirsutum]
Length=628

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/450 (70%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEII GLQG +P +  +GVP+V GK KVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQMMTEIITGLQGGLPVHSKKGVPFVAGKNKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV  W+GL+ IHMP Y  SI KGV+T+M SYSS NG KMHAN  L+TDF
Sbjct  235   GGTTKGINENNTVISWNGLLGIHMPAYFNSIAKGVATIMTSYSSWNGKKMHANHDLVTDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW G+DRIT    +NY+YSV   + AGIDMVMVP N++ FI      
Sbjct  295   LKNKLKFRGFVISDWQGLDRITSPPHANYSYSVEAGVGAGIDMVMVPYNFTEFIDDLTYQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKNNIIPMSRIDDAVKRILRVKFVMGLFENPMADNSLVNQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+   +PLLPLPK A++ILVAGTHA+NLGYQCGGWTITW+GL G  +T GTTIL  +
Sbjct  415   LKNGESADKPLLPLPKKATKILVAGTHADNLGYQCGGWTITWQGLGGNDLTTGTTILQAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VD +TQ+VY+E+ +  F+KS +F+YAIVVVGE PY+E +GD LNLTI   G  TI N
Sbjct  475   KNTVDSSTQVVYSENPDAGFVKSGEFSYAIVVVGEPPYAETYGDSLNLTISEPGPMTIYN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV++SGRP+V++P + S+DALVAAWLPG+EGQGV+DVLFGDY FTGKL+RT
Sbjct  535   VCGS-VKCVVVVISGRPVVVQPFVSSVDALVAAWLPGTEGQGVSDVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTK
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTK  623



>gb|KGN59736.1| hypothetical protein Csa_3G842090 [Cucumis sativus]
Length=629

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/450 (71%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESY ED  IV++MTEIIPGLQGDVP N  +GVPYV GK  VAACAKH+V D
Sbjct  177   RDPRWGRCYESYGEDHTIVQAMTEIIPGLQGDVPANIRKGVPYVAGKNNVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D HGL SIHMP Y  SIIKGV+TVM SYSS+NG KMHAN+ L+TDF
Sbjct  237   GGTTKGINENNTVVDGHGLFSIHMPAYYNSIIKGVATVMVSYSSINGEKMHANKKLVTDF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GID+IT    +NYTYS+L S+NAG+DM+MVP NY+ FI     L
Sbjct  297   LKNTLHFKGFVISDWQGIDKITTPPHANYTYSILASVNAGVDMIMVPYNYTEFIDGLTYL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  357   VKNNAIPISRIDDAVKRILRVKFVMGLFENPLADLSLINELGKQEHRELAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILVAGTHAN+LG QCGGWT+ W+GL+G  +T+GTTIL+ I
Sbjct  417   LKNGKLPNQPLLPLPKKAPKILVAGTHANDLGNQCGGWTMEWQGLTGNNLTSGTTILTAI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T++V++++ N EF++++ F+YAIVVVGE PY+E  GD LNLTIP  G +TIKN
Sbjct  477   KDTVDPETEVVFHDNPNAEFLQTHQFSYAIVVVGEHPYAETNGDSLNLTIPEPGPETIKN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+VL+P++ S+DA+VAAWLPG+EG+G++DVLFGDY FTGKLS+T
Sbjct  537   VCGA-VKCVVVVISGRPVVLQPYIDSIDAVVAAWLPGTEGKGISDVLFGDYGFTGKLSQT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMN GD HYDPLFPFGFGLTT+
Sbjct  596   WFKSVDQLPMNFGDAHYDPLFPFGFGLTTQ  625



>dbj|BAD13764.1| exo-1,3-beta-glucanase [Lilium longiflorum]
Length=626

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/448 (72%), Positives = 362/448 (81%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGD+P N+ +G PYVGGK KV ACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDHTIVQAMTELIPGLQGDLPANYRKGTPYVGGKDKVVACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G++ENNT+ + HGL SIHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T F
Sbjct  234   GGTYEGINENNTIINSHGLFSIHMPAYYNSIIKGVSTVMVSYSSWNGKKMHANRALITGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT   D+NYTYSV  SI+AG+DMVMVPNNY+ FI     L
Sbjct  294   LKNTLKFRGFVISDWQGIDRITSPPDANYTYSVQASIHAGLDMVMVPNNYTEFIDDLTLL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF  GLFENP ADYSL   LG + HR+LAREAVR+SLVL
Sbjct  354   VKKNVIPMSRIDDAVKRILRVKFVSGLFENPLADYSLTDQLGNKEHRELAREAVRRSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   QPLLPLPKNA +ILVAG HAN++G QCGGWTI W+G  G ITAGTTIL  I 
Sbjct  414   LKNGKPANQPLLPLPKNAPKILVAGRHANDIGLQCGGWTIKWQGEIGNITAGTTILEAIK  473

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
               VDP T +VY E  +  F+K+NDF+YAIVVVGE PY+E  GD+LNLT+PA G   IK+V
Sbjct  474   ATVDPTTDVVYKEKPDATFVKNNDFSYAIVVVGETPYAETAGDNLNLTLPAPGPSMIKHV  533

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C      VV+ +SGRPLV+EP L SMDA+VAAWLPGSEGQGV+DVLFGDY FTGKL RTW
Sbjct  534   CGVVKCVVVI-ISGRPLVIEPFLGSMDAVVAAWLPGSEGQGVSDVLFGDYGFTGKLPRTW  592

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FK+VDQLPMNVGDRHYDPLFPFGFGLTT
Sbjct  593   FKSVDQLPMNVGDRHYDPLFPFGFGLTT  620



>ref|XP_003548716.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=636

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/453 (69%), Positives = 370/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED E+V++MTEIIPGLQGD+PN+  +GVP++ GK KV  CAKHYV D
Sbjct  180   RDPRWGRCYESYSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFIAGKEKVIGCAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE+NTV D  GLM IHMP Y  SI KGV+T+MASYSS NGVKMHA+  L+T +
Sbjct  240   GGTTNGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGY  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N TYS+   ++AGIDM MVP +Y+ FI     L
Sbjct  300   LKNTLHFKGFVISDFEGIDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTML  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RIL VKF MG+FENPFADYSLA YLG Q HR+LAREAVRKS+VL
Sbjct  360   VKNKHIPMSRIDDAVRRILWVKFMMGIFENPFADYSLAKYLGIQEHRNLAREAVRKSMVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  420   LKNGESADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILAAV  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T +VY E+ + EF+KSN+F+YAIVVVGE PY+E  GD +NLTIP  G + I N
Sbjct  480   KDTVDPETTVVYKENPDVEFVKSNEFSYAIVVVGEHPYAEMHGDSMNLTIPEPGPEIITN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  540   VCGA-IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN GD HYDPLFPFGFGL+TK S+
Sbjct  599   WFKTVDQLPMNAGDPHYDPLFPFGFGLSTKPSK  631



>ref|XP_004981774.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Setaria 
italica]
 ref|XP_004981775.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Setaria 
italica]
 ref|XP_004981776.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Setaria 
italica]
Length=622

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/453 (70%), Positives = 369/453 (81%), Gaps = 4/453 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+SMT +I GLQG+VP N   G PYV G   VAACAKHYV D
Sbjct  173   RDPRWGRCYESYSEDPKVVQSMTSLISGLQGEVPAN-DVGRPYVAGSKNVAACAKHYVGD  231

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G++ENNT+ D HGL+SIHMPPY  SII+GVSTVM SYSS NGVKMHAN  L+TDF
Sbjct  232   GGTHQGINENNTIIDTHGLLSIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHFLVTDF  291

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NY+YS+   + AGIDM+MVP  Y+ FI    + 
Sbjct  292   LKNKLKFRGFVISDWEGIDRITSPPHANYSYSIEAGVGAGIDMIMVPFRYTEFIDDLTAQ  351

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N+ IPMSRIDDAV RILRVKF+MGLFENP+ D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  352   VQNKVIPMSRIDDAVYRILRVKFSMGLFENPYPDTSLAGELGKQEHRDLAREAVRKSLVL  411

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    PLLPLPK A +ILVAG+HA+NLG QCGGWTITW+G  G  ITAGTTIL GI
Sbjct  412   LKNGKSSYSPLLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGQPGNNITAGTTILEGI  471

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                +DP+TQ+VY+E+ +   + ++ + YA+VVVGE PY+E FGD+LNLTIPA G   I++
Sbjct  472   KATIDPSTQVVYSENPDSTVL-ADKYDYAVVVVGEPPYAETFGDNLNLTIPAPGPSVIQS  530

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A  KCVVVL+SGRPLV+EP+L  MDA VAAWLPGSEGQGVADVLFGDY FTGKLSRT
Sbjct  531   VCKA-TKCVVVLISGRPLVVEPYLGDMDAFVAAWLPGSEGQGVADVLFGDYGFTGKLSRT  589

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPM+VGD+HYDPLFPFGFGLTTKG++
Sbjct  590   WFKSVDQLPMSVGDKHYDPLFPFGFGLTTKGTK  622



>ref|XP_010103976.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB97679.1| Lysosomal beta glucosidase [Morus notabilis]
Length=669

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/450 (70%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGD+P N  +GVPYVGGKTKVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDHKIVQEMTEIIPGLQGDIPANSRKGVPYVGGKTKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGL+SIHMP Y  +IIKGVSTVMASYSS NG KMHANR L+T F
Sbjct  237   GGTVKGINENNTLLDMHGLLSIHMPAYSDAIIKGVSTVMASYSSWNGEKMHANRELITGF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    SNY+YSV  ++ AGIDMVMVP NYS FI+   +L
Sbjct  297   LKDTLKFKGFVISDWEGIDRITSPPHSNYSYSVQAAVEAGIDMVMVPFNYSEFINDLTNL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+ RI+DAV RIL VKFT+GLFENP AD+SL + LG QAHRDLAREAVRKSLVL
Sbjct  357   VKNNVIPIDRINDAVGRILLVKFTLGLFENPLADFSLVNELGSQAHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+E  PLLPL K A +ILVAG+HANNLGYQCGGWTI+W+G SG   T GTTIL  I
Sbjct  417   LKNGKNETTPLLPLYKKAHKILVAGSHANNLGYQCGGWTISWEGFSGNNSTRGTTILDAI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T+ VYNE+ + +F+KSN+FAYA++VVGE  Y E  GD + LT+   G   I N
Sbjct  477   KSTVDPSTETVYNENPDADFVKSNNFAYAVIVVGEHTYVETLGDSITLTMEDPGPTVISN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV++SGRP+V+EP+L  +DALVAAWLPG+EGQG+ADVLFGDY FTGKL  T
Sbjct  537   VCQS-VKCVVVIISGRPIVIEPYLSPVDALVAAWLPGTEGQGIADVLFGDYGFTGKLPMT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WF+TVDQLPMN GD HYDPLF  GFGL T+
Sbjct  596   WFRTVDQLPMNYGDPHYDPLFTLGFGLKTE  625



>ref|XP_008375543.1| PREDICTED: lysosomal beta glucosidase [Malus domestica]
Length=658

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/456 (69%), Positives = 370/456 (81%), Gaps = 4/456 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGD+P N  +GVPYVGGK KVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDHKIVEEMTEIIPGLQGDIPANSRKGVPYVGGKKKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT++G++ENNTVTD H L+SIHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T+F
Sbjct  237   GGTSRGINENNTVTDRHELLSIHMPAYSDSIIKGVSTVMISYSSWNGDKMHANRDLITNF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    SNYTYSV  S+ AGIDMVMVP NY  FI+  ++L
Sbjct  297   LKGTLKFKGFVISDWEGIDRITSPPHSNYTYSVQASVLAGIDMVMVPFNYKEFINDLINL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   +PM RIDDAV RIL VKFTMGLFENP AD SL + LG QAHRDLAREAVRKSLVL
Sbjct  357   VKTNVVPMDRIDDAVGRILLVKFTMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQ--PLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILS  583
             LKNGK +    P++PLPK  S+ILVAG+HA+NLGYQCGGWT+ W+G SG   T+GTTIL 
Sbjct  417   LKNGKSKNNTDPVIPLPKKVSKILVAGSHADNLGYQCGGWTMAWQGFSGNNYTSGTTILG  476

Query  582   GIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTI  403
              I + VD +T++VY E+ +  F+KSN+FAYAIVVVGE PY+E  GD  NLT+   G   I
Sbjct  477   AINSTVDSSTEVVYRENPDGNFVKSNNFAYAIVVVGEHPYAETLGDSTNLTMAEXGPSVI  536

Query  402   KNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLS  223
              NVC + VKC+V+L++GRP+V+EP++ S+DALVAAWLPGSEGQG+ DVLFGD+ F+GKL+
Sbjct  537   SNVCES-VKCIVILITGRPIVIEPYISSIDALVAAWLPGSEGQGITDVLFGDHGFSGKLA  595

Query  222   RTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             RTWF+TVDQLPMNVGD HYDPLFP G GL T+  + 
Sbjct  596   RTWFRTVDQLPMNVGDSHYDPLFPLGHGLATESVKQ  631



>ref|XP_004981771.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Setaria 
italica]
 ref|XP_004981772.1| PREDICTED: lysosomal beta glucosidase-like isoform X5 [Setaria 
italica]
 ref|XP_004981773.1| PREDICTED: lysosomal beta glucosidase-like isoform X6 [Setaria 
italica]
Length=626

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/453 (69%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+PYV GK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDPGIVQAMTELIPGLQGDVPQNFTSGMPYVAGKNKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  S+ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  235   GGTQNGINENNTIIDRQGLMSIHMPAYLDSLRKGVSTVMISYSSWNGIKMHANHDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GF ISDW GIDRIT    +NY+YSV   I AGIDM+MVPNNY  FIS     
Sbjct  295   LKGRLKFKGFTISDWEGIDRITSPAGANYSYSVQAGILAGIDMIMVPNNYQSFISILTGH  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D +LA  LG Q HRDLAREAVRKSLVL
Sbjct  355   VNSGVIPMSRIDDAVTRILRVKFTMGLFENPMPDTTLADQLGKQEHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             L+NGK    PLLPLPK A++ILVAG+HANNLGYQCGGWTI W+G +G IT GTTIL  + 
Sbjct  415   LQNGKPGDAPLLPLPKKAAKILVAGSHANNLGYQCGGWTIEWQGDTGNITVGTTILDAVK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ + EF+K+  F+YAIV VGE PY+E  GD +NLTIP  G  TI+ V
Sbjct  475   AAVDPSTTVVFVENPDAEFVKNGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTIQTV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V+C  VL+SGRP+V++P L + DALVAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  535   CGA-VRCATVLISGRPVVIQPFLGATDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             FK+VDQLPMNVGD+HYDPLF  GFGLTTKG  +
Sbjct  594   FKSVDQLPMNVGDKHYDPLFRLGFGLTTKGKAY  626



>ref|XP_004981770.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Setaria 
italica]
Length=649

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/453 (69%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+PYV GK KVAACAKH+V D
Sbjct  198   RDPRWGRCYESYSEDPGIVQAMTELIPGLQGDVPQNFTSGMPYVAGKNKVAACAKHFVGD  257

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  S+ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  258   GGTQNGINENNTIIDRQGLMSIHMPAYLDSLRKGVSTVMISYSSWNGIKMHANHDLITGF  317

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GF ISDW GIDRIT    +NY+YSV   I AGIDM+MVPNNY  FIS     
Sbjct  318   LKGRLKFKGFTISDWEGIDRITSPAGANYSYSVQAGILAGIDMIMVPNNYQSFISILTGH  377

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D +LA  LG Q HRDLAREAVRKSLVL
Sbjct  378   VNSGVIPMSRIDDAVTRILRVKFTMGLFENPMPDTTLADQLGKQEHRDLAREAVRKSLVL  437

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             L+NGK    PLLPLPK A++ILVAG+HANNLGYQCGGWTI W+G +G IT GTTIL  + 
Sbjct  438   LQNGKPGDAPLLPLPKKAAKILVAGSHANNLGYQCGGWTIEWQGDTGNITVGTTILDAVK  497

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ + EF+K+  F+YAIV VGE PY+E  GD +NLTIP  G  TI+ V
Sbjct  498   AAVDPSTTVVFVENPDAEFVKNGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTIQTV  557

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V+C  VL+SGRP+V++P L + DALVAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  558   CGA-VRCATVLISGRPVVIQPFLGATDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  616

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             FK+VDQLPMNVGD+HYDPLF  GFGLTTKG  +
Sbjct  617   FKSVDQLPMNVGDKHYDPLFRLGFGLTTKGKAY  649



>gb|EYU38727.1| hypothetical protein MIMGU_mgv1a003439mg [Erythranthe guttata]
Length=585

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/448 (70%), Positives = 363/448 (81%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+SMTEII GLQGDVP N  +GVPY+GG+ KV   AKHYV D
Sbjct  133   RDPRWGRCYESYSEDPMVVRSMTEIISGLQGDVPANSRKGVPYLGGQHKVIVSAKHYVGD  192

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV   H L+SIHMP Y  SIIKGVST+M SYSS NG KMHANR L+T F
Sbjct  193   GGTTHGINENNTVASMHELLSIHMPAYYDSIIKGVSTIMISYSSFNGKKMHANRDLITGF  252

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK   RFRGFVISDW GIDRIT    +NYTYS+L ++NAGIDMVMVP NY+ FI     L
Sbjct  253   LKKTQRFRGFVISDWQGIDRITSPPHANYTYSILAAVNAGIDMVMVPYNYTEFIDGLTFL  312

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN F+PM+RI+DAV RILRVKFTMG+FENP ADYS+A YLG Q HR+LAREAVRKSLVL
Sbjct  313   VKNNFVPMTRINDAVRRILRVKFTMGVFENPLADYSMAKYLGTQEHRELAREAVRKSLVL  372

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PLLPL K A +ILVAGTHA+++G QCGGWTI W+G SG  TAGTTIL+ + 
Sbjct  373   LKNGKSADKPLLPLSKTAPKILVAGTHADDIGNQCGGWTIEWQGKSGNTTAGTTILTAVR  432

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++V++++ +  ++K N+F+YAIVVVGE PYSE  GD LNLT+       IKNV
Sbjct  433   NTVDPKTEVVFSQNPDSGYVKQNNFSYAIVVVGELPYSETMGDSLNLTLAEPAPTIIKNV  492

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVVLV+GRP+V++P +  +DALVAAWLPGSEGQGVADVLFGDY F+GKL  TW
Sbjct  493   CGS-VKCVVVLVTGRPVVIQPLVDQIDALVAAWLPGSEGQGVADVLFGDYGFSGKLPHTW  551

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FKTVDQLPMNVGDR YDPL+PFG+GLTT
Sbjct  552   FKTVDQLPMNVGDRVYDPLYPFGYGLTT  579



>ref|XP_006598973.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=671

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/453 (69%), Positives = 370/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED E+V++MTEIIPGLQGD+PN+  +GVP++ GK KV  CAKHYV D
Sbjct  215   RDPRWGRCYESYSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFIAGKEKVIGCAKHYVGD  274

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE+NTV D  GLM IHMP Y  SI KGV+T+MASYSS NGVKMHA+  L+T +
Sbjct  275   GGTTNGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGY  334

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N TYS+   ++AGIDM MVP +Y+ FI     L
Sbjct  335   LKNTLHFKGFVISDFEGIDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTML  394

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RIL VKF MG+FENPFADYSLA YLG Q HR+LAREAVRKS+VL
Sbjct  395   VKNKHIPMSRIDDAVRRILWVKFMMGIFENPFADYSLAKYLGIQEHRNLAREAVRKSMVL  454

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  455   LKNGESADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILAAV  514

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T +VY E+ + EF+KSN+F+YAIVVVGE PY+E  GD +NLTIP  G + I N
Sbjct  515   KDTVDPETTVVYKENPDVEFVKSNEFSYAIVVVGEHPYAEMHGDSMNLTIPEPGPEIITN  574

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  575   VCGA-IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  633

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN GD HYDPLFPFGFGL+TK S+
Sbjct  634   WFKTVDQLPMNAGDPHYDPLFPFGFGLSTKPSK  666



>ref|NP_001051275.1| Os03g0749300 [Oryza sativa Japonica Group]
 gb|AAL58966.1|AC091811_15 putative exoglucanase precursor [Oryza sativa Japonica Group]
 gb|ABF98882.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98883.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98884.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13189.1| Os03g0749300 [Oryza sativa Japonica Group]
 gb|EAY91868.1| hypothetical protein OsI_13515 [Oryza sativa Indica Group]
 gb|EAZ28591.1| hypothetical protein OsJ_12577 [Oryza sativa Japonica Group]
 dbj|BAG89337.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/450 (70%), Positives = 364/450 (81%), Gaps = 3/450 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+S+T +I GLQGDVP+N   G PYVGG  KVAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKVVQSLTTLISGLQGDVPSN-DVGRPYVGGSKKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGL++IHMPPY  SII+GVSTVM SYSS NGVKMHAN HL+TDF
Sbjct  233   GGTVKGINENNTIIDTHGLLTIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHHLITDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT     NY+YS+   I AGIDM+MVP  Y+ FI      
Sbjct  293   LKNKLRFRGFVISDWQGIDRITSPPHKNYSYSIEAGIGAGIDMIMVPYTYTEFIDDLTEQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+ IPMSRIDDAV RILRVKFTMGLFE+PFAD SLA  LG Q HR+LAREAVRKSLVL
Sbjct  353   VNNKIIPMSRIDDAVYRILRVKFTMGLFESPFADSSLADELGKQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    P+LPLPK A +ILVAG+HA++LG QCGGWTITW+G  G  ITAGTTILS I
Sbjct  413   LKNGKSSYSPVLPLPKKAGKILVAGSHADDLGRQCGGWTITWQGQPGNNITAGTTILSAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP+T +VY+E+ +   +  + + YAIVVVGE PY+E FGD+LNLTIP  G   I+ 
Sbjct  473   KATVDPSTTVVYSENPDSSVVTGDKYDYAIVVVGEPPYAEGFGDNLNLTIPEPGPTVIQT  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + +KCVVVL+SGRPLV+EP++  +DA VAAWLPG+EGQGVADVLFGDY FTGKLSRT
Sbjct  533   VCKS-IKCVVVLISGRPLVVEPYIGGIDAFVAAWLPGTEGQGVADVLFGDYGFTGKLSRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGD HYDPLFPFG+GLTT+
Sbjct  592   WFKSVDQLPMNVGDAHYDPLFPFGYGLTTQ  621



>ref|XP_008230855.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/454 (69%), Positives = 366/454 (81%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V  MT++I GLQG++P    +GVPYVGGK KVAACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDPAVVIQMTDVILGLQGEIPAGSRKGVPYVGGKDKVAACAKHFVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS+NG KMHA+  L+T F
Sbjct  239   GGTTRGINENNTVIDRHGLLSIHMPAYYHSIIKGVSTIMVSYSSLNGKKMHAHHELVTKF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW G+D+I     SNY  +VL  + AGIDMVMVP N++ FI      
Sbjct  299   LKDTLKFRGFVISDWQGVDKINYPLHSNYPEAVLAGVQAGIDMVMVPFNHTEFIGIVTDH  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+ IPMSRIDDAV RILRVKF MGLFENP AD S    LG QAHRDLAREAVRKSLVL
Sbjct  359   VNNKRIPMSRIDDAVRRILRVKFVMGLFENPLADESFVDKLGSQAHRDLAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   P+LPLPK   RILVAGTHANNLGYQCGGW++TW+G+SG   TAGTTILS I
Sbjct  419   LKNGENADTPVLPLPKKTKRILVAGTHANNLGYQCGGWSLTWQGVSGNNYTAGTTILSAI  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T+IV++E+ + +F+KSN+F+YAIVVVGE+PY+E  GD LNLTI   G  TI N
Sbjct  479   TAAVDPSTEIVFSENPDADFLKSNNFSYAIVVVGEQPYAETKGDSLNLTIAEPGPQTITN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRPLV+EP++ SMDALVAAWLPG+EGQGV+DVLFGDY F+GKL RT
Sbjct  539   VCGE-VKCVVVVISGRPLVIEPYVSSMDALVAAWLPGTEGQGVSDVLFGDYGFSGKLPRT  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD HYDPLFPF FGLTT   + 
Sbjct  598   WFKTVDQLPMNVGDAHYDPLFPFDFGLTTDSVKQ  631



>ref|XP_008464960.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/450 (70%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESY ED +IV++MTEIIPGLQGD+P+N  +GVPYV GK  VAACAKH+V D
Sbjct  176   RDPRWGRCYESYGEDHKIVQAMTEIIPGLQGDLPSNIRKGVPYVAGKNNVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D HGL SIHMP Y  SIIKGV+T+M SYSSVNG KMHAN+ L+TDF
Sbjct  236   GGTTKGINENNTVIDGHGLFSIHMPAYYNSIIKGVATIMVSYSSVNGEKMHANKKLVTDF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GID+IT    +NYTYS+L S+NAG+DM+MVP NY+ FI     L
Sbjct  296   LKNTLHFKGFVISDWQGIDKITSPPHANYTYSILASVNAGVDMIMVPYNYTEFIDALTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP AD SL + +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNAIPISRIDDAVKRILRVKFVMGLFENPLADLSLVNEIGKQEHRELAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILVAGTHAN+LG QCGGWTI W+GL+G  +T+GTT+L+ I
Sbjct  416   LKNGKLPNQPLLPLPKKAPKILVAGTHANDLGNQCGGWTIEWQGLTGNNLTSGTTVLTAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T++V++ + N EF+K++ F+YAIVVVGE PY+E  GD LNLTIP  G +TIKN
Sbjct  476   KDTVDPETEVVFDNNPNAEFLKTHQFSYAIVVVGEHPYAETNGDSLNLTIPEPGPETIKN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V++P++ S+DALVAAWLPG+EG+G++DVLFGDY FTGKLS+T
Sbjct  536   VCGA-VKCVVVVISGRPVVIQPYIDSIDALVAAWLPGTEGKGISDVLFGDYGFTGKLSQT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMN GD HYDPLFP GFGLTT+
Sbjct  595   WFKSVDQLPMNFGDAHYDPLFPLGFGLTTQ  624



>gb|AFS50097.1| beta-D-glucan exohydolase [Elaeis guineensis]
Length=629

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/451 (69%), Positives = 367/451 (81%), Gaps = 3/451 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGG-KTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG++P N  +GVP+V G K  VAACAKHYV 
Sbjct  175   RDPRWGRCYESYSEDPKIVQEMTEIIPGLQGEIPANSRKGVPFVAGLKRNVAACAKHYVG  234

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGT KG++ENNT+   HGL+SIHMPPY  +IIKGVSTVM SYSS NGVKMHAN +L+TD
Sbjct  235   DGGTYKGINENNTIIGLHGLLSIHMPPYYDAIIKGVSTVMISYSSWNGVKMHANHYLVTD  294

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  L FRGFVISDW GIDRIT    +NY+YS+   ++AGIDMVM+P +Y  FI     
Sbjct  295   FLKNKLHFRGFVISDWQGIDRITSPPHANYSYSIQVGVHAGIDMVMIPYDYPEFIDDLTY  354

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRIDDAV RILRVKFTMGLFE P+AD SLA  LG + HR+LAREAVRKSLV
Sbjct  355   QVKNNIIPMSRIDDAVRRILRVKFTMGLFEKPYADLSLAGELGKKEHRELAREAVRKSLV  414

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSG  580
             LLKNGK    PLLPLPK A +ILVAG+HA+NLG QCGGWTITW+GLSG  +T GTTIL  
Sbjct  415   LLKNGKSTNDPLLPLPKKAKKILVAGSHADNLGCQCGGWTITWQGLSGNNLTTGTTILDA  474

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             + N V+P T++VY+E+   +F+    F+YAIV VGE+PY+E FGD+L LTIP  G   I+
Sbjct  475   VKNTVEPTTEVVYSENPASDFVNHGQFSYAIVAVGEQPYAETFGDNLELTIPDPGPSVIQ  534

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC + ++CVV+++SGRPLV+EP++  +DALVAAWLPG+EGQGVADVLFGDY F+GKLSR
Sbjct  535   NVCKS-IRCVVIIISGRPLVIEPYVHMIDALVAAWLPGTEGQGVADVLFGDYGFSGKLSR  593

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             TWFK+VDQLPMNVGD HYDPLFPFGFGLTTK
Sbjct  594   TWFKSVDQLPMNVGDPHYDPLFPFGFGLTTK  624



>gb|KHN46760.1| Lysosomal beta glucosidase [Glycine soja]
Length=636

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 369/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED E+V++MTEIIPGLQGD+PN+  +GVP++ GK KV  CAKHYV D
Sbjct  180   RDPRWGRCYESYSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFIAGKEKVIGCAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DE+NTV D  GLM IHMP Y  SI KGV+T+MASYSS NGVKMHA+  L+T +
Sbjct  240   GGTINGIDEHNTVIDRDGLMKIHMPGYLSSISKGVATIMASYSSWNGVKMHAHHDLITGY  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N TYS+   ++AGIDM MVP +Y+ FI     L
Sbjct  300   LKNTLHFKGFVISDFEGIDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTML  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RIL VKF MG+FENPFADYSLA YLG Q HR+LAREAVRKS+VL
Sbjct  360   VKNKHIPMSRIDDAVRRILWVKFMMGIFENPFADYSLAKYLGIQEHRNLAREAVRKSMVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  420   LKNGESADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILAAV  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T +VY E+ + EF+KSN+F+YAIVVVGE PY+E  GD +NLTIP  G + I N
Sbjct  480   KDTVDPETTVVYKENPDVEFVKSNEFSYAIVVVGEHPYAEMHGDSMNLTIPEPGPEIITN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  540   VCGA-IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMN GD HYDPLFPFGFGL+TK S+
Sbjct  599   WFKTVDQLPMNAGDPHYDPLFPFGFGLSTKPSK  631



>ref|XP_010031608.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 ref|XP_010031610.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW50976.1| hypothetical protein EUGRSUZ_J00605 [Eucalyptus grandis]
Length=637

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/454 (69%), Positives = 372/454 (82%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ +TEIIPGLQGD+P N  +GVP+V GK KVAACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDHRIVRMLTEIIPGLQGDLPANSPKGVPFVAGKNKVAACAKHFVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D++GL+SIHMP Y  +I KGV+TVM SYSS NG KMHAN  L+T F
Sbjct  239   GGTTKGINENNTVIDYNGLLSIHMPAYLDAIRKGVATVMVSYSSWNGKKMHANGDLVTGF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    +NY+YSV   + AGIDMVMVP   + F+      
Sbjct  299   LKNKLKFKGFVISDWEGIDRITSPPHANYSYSVQAGVGAGIDMVMVPYKVTEFLDDLTKQ  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N  IPMSRIDDAV RILRVKF MGLF+NP AD SLA+ +G   HR+LAREAVRKSLVL
Sbjct  359   VQNNVIPMSRIDDAVKRILRVKFVMGLFDNPLADNSLANQVGSPEHRELAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   +PL+PLPK A +ILVAG+HA+NLG QCGGWTI W+GL+G  +T GTTIL+ +
Sbjct  419   LKNGKSSGKPLIPLPKKAQKILVAGSHADNLGNQCGGWTIAWQGLNGNDLTTGTTILNAV  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + V P TQ+VYNE+ +  F+KSN+FAYAIVVVGE PY+E FGD LNLTIP  G  TI+N
Sbjct  479   KSTVHPDTQVVYNENPDANFVKSNNFAYAIVVVGEPPYAETFGDSLNLTIPEPGPSTIRN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV++SGRP+V+EP++ ++DALVAAWLPG+EGQGVAD+LFGDY FTGKL+RT
Sbjct  539   VCGS-VKCVVVVISGRPVVIEPYVSNIDALVAAWLPGTEGQGVADLLFGDYGFTGKLART  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WF++VDQLPMNVGD HYDPL+PFGFGLTTKG++ 
Sbjct  598   WFRSVDQLPMNVGDPHYDPLYPFGFGLTTKGTKE  631



>ref|NP_001044387.1| Os01g0771900 [Oryza sativa Japonica Group]
 dbj|BAB56084.2| putative exo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAB89846.1| putative exo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAF06301.1| Os01g0771900 [Oryza sativa Japonica Group]
Length=663

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/452 (70%), Positives = 362/452 (80%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+ MT+II GLQGD+P N ++GVPY+ GK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHRVVQQMTDIILGLQGDIPINHTKGVPYIAGKDKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+TD HGL+ IHMPPY  SIIKGV+TVM SYSS+NGVKMHAN  L+T +
Sbjct  235   GGTHNGINENNTITDEHGLLGIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDWLGIDRIT   D+NYTYSV   INAGIDMVMVP NY+++I    SL
Sbjct  295   LKSKLHFRGFVISDWLGIDRITSPPDANYTYSVQAGINAGIDMVMVPFNYTQYIDDVTSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   I MSRIDDAV RILRVKF MGLFENP AD S A  LG + HRDLAREAVRKSLVL
Sbjct  355   VKKGIINMSRIDDAVRRILRVKFIMGLFENPLADLSFADQLGKKEHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG    Q  LPLPK A  ILVAG+HA+NLGYQCGGW+I W G SG IT GTTIL  I 
Sbjct  415   LKNGNSPNQQFLPLPKKARSILVAGSHASNLGYQCGGWSIEWIGGSGDITVGTTILEAIK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V  +T +VY+E+ ++ FMK+NDF++AIVVVGE+ Y+E  GDD  LTI   G DTI+ V
Sbjct  475   STVADSTHVVYSENPDESFMKNNDFSFAIVVVGERTYAETTGDDPELTILDPGTDTIRTV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+   KC VV++SGRP+V+EP+LP M+ALVAAWLPG+EGQGVADVLFGDY FTGKL RTW
Sbjct  535   CSTA-KCAVVIISGRPVVIEPYLPMMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLT   S+
Sbjct  594   FKSVDQLPMNVGDLHYDPLFPFGFGLTINSSQ  625



>ref|XP_006826367.1| hypothetical protein AMTR_s00004p00129620 [Amborella trichopoda]
 gb|ERM93604.1| hypothetical protein AMTR_s00004p00129620 [Amborella trichopoda]
Length=605

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/449 (70%), Positives = 363/449 (81%), Gaps = 4/449 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIV++MTEIIPGLQGD P    +GVP+V GKTKVAACAKH+V D
Sbjct  157   RDPRWGRCYESYSEDPEIVEAMTEIIPGLQGDAPK---KGVPFVAGKTKVAACAKHFVGD  213

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL++IHM  Y  +IIKGVSTVM SYSS NG KMHANR L+T+F
Sbjct  214   GGTHNGINENNTIIDRHGLLAIHMAGYYHAIIKGVSTVMVSYSSWNGEKMHANRDLVTNF  273

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    SNY YSV   +NAGIDM+MVP N++ FI+     
Sbjct  274   LKKTLHFRGFVISDWQGIDRITSPAGSNYPYSVHAGVNAGIDMIMVPYNFTEFINDLTEQ  333

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V ++ IPMSRIDDAV RILRVKF MGLFENP AD SLA  LG Q HR+LAREAVRKSLVL
Sbjct  334   VNSKSIPMSRIDDAVRRILRVKFQMGLFENPLADLSLADQLGSQEHRELAREAVRKSLVL  393

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK+  +PLLPL K A +ILVAGTHA+NLGYQCGGWTI W+G SG  T GTTIL+ I 
Sbjct  394   LKNGKEGDKPLLPLDKKAPKILVAGTHADNLGYQCGGWTIQWQGQSGNTTKGTTILTAIK  453

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V P+TQ+V+ E+ +   +K  D+ YA+VVVGE PY+E  GD +NLT+P  G   IKNV
Sbjct  454   STVSPSTQVVFEENPSASSLKGQDYDYAVVVVGETPYAETNGDSMNLTMPEPGPTIIKNV  513

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVV++SGRP+VL+P L  +DALVAAWLPG+EGQGVAD LFGDYPFTGKL+RTW
Sbjct  514   CGS-VKCVVVVISGRPIVLQPFLQYIDALVAAWLPGTEGQGVADNLFGDYPFTGKLARTW  572

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMNVGD+HYDPLFPFGFGLTT+
Sbjct  573   FKSVDQLPMNVGDKHYDPLFPFGFGLTTE  601



>ref|XP_008344965.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=607

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/454 (70%), Positives = 364/454 (80%), Gaps = 3/454 (1%)
 Frame = -2

Query  1470  DPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVAD  1294
             DPRWGRCYESYSED +IV++MTEIIPGLQGD+P    +G PYV   K KVAACAKHYV D
Sbjct  155   DPRWGRCYESYSEDHKIVQAMTEIIPGLQGDMPPTARKGAPYVSTAKGKVAACAKHYVGD  214

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT  D +GL+SIHMP Y  SI KGV+TVM SYSS NG KMHAN+ L+T +
Sbjct  215   GGTTKGINENNTXIDLNGLLSIHMPAYLNSIRKGVATVMVSYSSWNGNKMHANKELVTGY  274

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   + AGIDM+MVP N++ FI      
Sbjct  275   LKDKLRFRGFVISDWEGIDRITSPPKANYSYSVQAGVGAGIDMIMVPYNFTDFIDDLTYQ  334

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRI+DAV RILRVKF MGLFENP AD SLA  LG + HR+LAREAVRKSLVL
Sbjct  335   VKNNIIPMSRINDAVQRILRVKFVMGLFENPLADLSLASQLGNKVHRELAREAVRKSLVL  394

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK   +P+LPLPK A +ILVAG+HA+NLG QCGGWTITW+GL G   T G TILS +
Sbjct  395   LKNGKSAYKPVLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGLEGNDHTMGXTILSAV  454

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PY+E FGD LNLTIP  G  TI N
Sbjct  455   KSTVDPTTQVVYNENPDANFVKSNKFSYAIVVVGEPPYAETFGDSLNLTIPQPGPSTIAN  514

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRPLVL+P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+ T
Sbjct  515   VCGA-VKCVVVVISGRPLVLQPYLAGIDALVAAWLPGTEGQGVTDALFGDYGFTGKLAHT  573

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTK +++
Sbjct  574   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTKN  607



>ref|XP_004981768.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Setaria 
italica]
Length=674

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/453 (69%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+PYV GK KVAACAKH+V D
Sbjct  223   RDPRWGRCYESYSEDPGIVQAMTELIPGLQGDVPQNFTSGMPYVAGKNKVAACAKHFVGD  282

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  S+ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  283   GGTQNGINENNTIIDRQGLMSIHMPAYLDSLRKGVSTVMISYSSWNGIKMHANHDLITGF  342

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GF ISDW GIDRIT    +NY+YSV   I AGIDM+MVPNNY  FIS     
Sbjct  343   LKGRLKFKGFTISDWEGIDRITSPAGANYSYSVQAGILAGIDMIMVPNNYQSFISILTGH  402

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D +LA  LG Q HRDLAREAVRKSLVL
Sbjct  403   VNSGVIPMSRIDDAVTRILRVKFTMGLFENPMPDTTLADQLGKQEHRDLAREAVRKSLVL  462

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             L+NGK    PLLPLPK A++ILVAG+HANNLGYQCGGWTI W+G +G IT GTTIL  + 
Sbjct  463   LQNGKPGDAPLLPLPKKAAKILVAGSHANNLGYQCGGWTIEWQGDTGNITVGTTILDAVK  522

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ + EF+K+  F+YAIV VGE PY+E  GD +NLTIP  G  TI+ V
Sbjct  523   AAVDPSTTVVFVENPDAEFVKNGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTIQTV  582

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V+C  VL+SGRP+V++P L + DALVAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  583   CGA-VRCATVLISGRPVVIQPFLGATDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  641

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             FK+VDQLPMNVGD+HYDPLF  GFGLTTKG  +
Sbjct  642   FKSVDQLPMNVGDKHYDPLFRLGFGLTTKGKAY  674



>ref|XP_004981769.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Setaria 
italica]
Length=669

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/453 (69%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+PYV GK KVAACAKH+V D
Sbjct  218   RDPRWGRCYESYSEDPGIVQAMTELIPGLQGDVPQNFTSGMPYVAGKNKVAACAKHFVGD  277

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  S+ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  278   GGTQNGINENNTIIDRQGLMSIHMPAYLDSLRKGVSTVMISYSSWNGIKMHANHDLITGF  337

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GF ISDW GIDRIT    +NY+YSV   I AGIDM+MVPNNY  FIS     
Sbjct  338   LKGRLKFKGFTISDWEGIDRITSPAGANYSYSVQAGILAGIDMIMVPNNYQSFISILTGH  397

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D +LA  LG Q HRDLAREAVRKSLVL
Sbjct  398   VNSGVIPMSRIDDAVTRILRVKFTMGLFENPMPDTTLADQLGKQEHRDLAREAVRKSLVL  457

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             L+NGK    PLLPLPK A++ILVAG+HANNLGYQCGGWTI W+G +G IT GTTIL  + 
Sbjct  458   LQNGKPGDAPLLPLPKKAAKILVAGSHANNLGYQCGGWTIEWQGDTGNITVGTTILDAVK  517

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ + EF+K+  F+YAIV VGE PY+E  GD +NLTIP  G  TI+ V
Sbjct  518   AAVDPSTTVVFVENPDAEFVKNGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTIQTV  577

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V+C  VL+SGRP+V++P L + DALVAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  578   CGA-VRCATVLISGRPVVIQPFLGATDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  636

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             FK+VDQLPMNVGD+HYDPLF  GFGLTTKG  +
Sbjct  637   FKSVDQLPMNVGDKHYDPLFRLGFGLTTKGKAY  669



>ref|XP_009588263.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=627

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/450 (69%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P N  +GVP+V GKTKVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHKIVRAMTEIIPGLQGDIPANSRKGVPFVAGKTKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG+DENNTV + +GL++IHMP Y  SI+KGVST+M SYSS NG+KMHANR L+T F
Sbjct  235   GGTVKGIDENNTVINVNGLINIHMPAYIDSIVKGVSTIMVSYSSWNGMKMHANRGLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+FRGFVISDW  ID+IT    +NY+YS+   + AGIDM+M   N + F+      
Sbjct  295   LKGKLKFRGFVISDWEAIDKITDPPRANYSYSIQAGVLAGIDMIMGQENLTEFLDDLAFQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N  IPMSRIDDAV RILRVKF MGLFENP AD SLA+ LG Q HR+LAREAVRKSLVL
Sbjct  355   VRNNIIPMSRIDDAVKRILRVKFVMGLFENPLADLSLANQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   QPLLPLPK  ++ILVAG+HA+NLGYQCGGWTI W+G+ G  +T GTTILS +
Sbjct  415   LKNGKVTSQPLLPLPKKVAKILVAGSHADNLGYQCGGWTIGWQGIGGNDLTTGTTILSAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N V P+TQ+VY ++ +  F+K+N F+YAIVVVGE PY+E FGD   LTI   G  TI N
Sbjct  475   KNTVHPSTQVVYRDNPDANFVKANHFSYAIVVVGETPYAEMFGDSAKLTIAEPGPSTINN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             +C   VKCVVV++SGRP+V+EP+L +++ALVAAWLPGSEGQGVADVLFGDY FTGKL+RT
Sbjct  535   ICGF-VKCVVVVMSGRPVVIEPYLANIEALVAAWLPGSEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  594   WFKSVDQLPMNVGDPHYDPLFPFGFGLTTE  623



>emb|CDM84404.1| unnamed protein product [Triticum aestivum]
Length=656

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/452 (71%), Positives = 364/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++P N ++GVPYV  K KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHKIVQQMTDIILGLQGEIPVNHTKGVPYVA-KNKVAACAKHFVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+ IHMPPY  SIIKGV+TVM SYSSVNG KMHAN  L+T +
Sbjct  234   GGTHNGINENNTIIDEHGLLGIHMPPYYDSIIKGVATVMVSYSSVNGEKMHANHDLVTGY  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDWLGIDRIT    +NYTYSV   INAGIDMVMVP NY+ FI  A SL
Sbjct  294   LKSKLHFRGFVISDWLGIDRITSPAGANYTYSVQAGINAGIDMVMVPFNYTEFIEDATSL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V  R I MSRIDDAV+RILRVKFTMGLFENP AD S A  LG + HR+LAREAVRKSLVL
Sbjct  354   VNKRIISMSRIDDAVSRILRVKFTMGLFENPLADLSFADQLGKKEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG    Q  LPLPK AS+ILVAG+HA+NLGYQCGGW+I W G SG ITAGTTIL  I 
Sbjct  414   LKNGNTPNQQFLPLPKKASKILVAGSHASNLGYQCGGWSIQWMGGSGDITAGTTILDAIK  473

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V  AT +VY+E+ +  FMK NDF++AIVVVGE PY+E  GD+ +LTI   G DTI+ V
Sbjct  474   STVGDATPVVYSENPDDSFMKKNDFSFAIVVVGESPYAETVGDNTDLTILDPGPDTIRTV  533

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+A VKC VV+VSGRP+++EP+LP M+ALVAAWLPG+EGQGVADVLFGDY FTGKLSRTW
Sbjct  534   CSA-VKCAVVVVSGRPVIIEPYLPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTW  592

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMN GD HYDPLFPFGFGL    S+
Sbjct  593   FKSVDQLPMNFGDPHYDPLFPFGFGLAVNPSQ  624



>ref|XP_011087395.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=700

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/450 (70%), Positives = 365/450 (81%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MT+II GLQG++PN   +GVPYV GK KVAACAKH+V D
Sbjct  180   RDPRWGRCYESYSEDPKVVREMTDIILGLQGEIPNGLRKGVPYVAGKNKVAACAKHFVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT+T  HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T F
Sbjct  240   GGTTKGINENNTLTSMHGLLSIHMPAYYDSIIKGVSTVMVSYSSWNGQKMHANRELITGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    SNYTYSVL  + AGIDM+MVP N++ FI+    L
Sbjct  300   LKGTLKFKGFVISDWQGLDRITSPPHSNYTYSVLAGVLAGIDMIMVPYNFTEFINDLTYL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKNRFI M RIDDAV RIL VKF +GLFENP AD SL + +G QAHRDLAREAVRKSLVL
Sbjct  360   VKNRFISMDRIDDAVQRILLVKFNLGLFENPLADLSLVNEVGSQAHRDLAREAVRKSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK     LLPLPK AS+ILVAGTHA+NLGYQCGGWTI W+G SG   T+GTTIL  I
Sbjct  420   LKNGKTANDSLLPLPKKASKILVAGTHADNLGYQCGGWTIAWQGFSGNNDTSGTTILGAI  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VD  T +VY E+ + E++KSNDF+YAIVVVGE PY+E  GD   LT+   G D I N
Sbjct  480   NSTVDKDTDVVYLENPDSEYVKSNDFSYAIVVVGEPPYTETAGDSQTLTMVDPGPDVINN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRP+V+EP++ ++DALVAAWLPG+EG GV DVLFGDY FTGKL RT
Sbjct  540   VCGA-VKCVVIMISGRPVVMEPYMSTIDALVAAWLPGTEGLGVTDVLFGDYGFTGKLPRT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTV+QLPMNVGD HYDPLFPFGFGLTTK
Sbjct  599   WFKTVNQLPMNVGDSHYDPLFPFGFGLTTK  628



>ref|XP_010031611.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW50980.1| hypothetical protein EUGRSUZ_J00609 [Eucalyptus grandis]
Length=634

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 363/449 (81%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IVK+MTEIIPGLQGD+P    +GVP+V GK  VA+CAKHYV D
Sbjct  181   RDPRWGRCYESYSEDPAIVKTMTEIIPGLQGDIPPGSRKGVPFVAGKNNVASCAKHYVGD  240

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D+HGL+SIHM  Y  ++IKGVST+M SYSS NGVKMHAN  L+T  
Sbjct  241   GGTTNGINENNTVIDFHGLLSIHMQGYFSAVIKGVSTIMISYSSWNGVKMHANHDLITGL  300

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDR+T    SNYTYSV   + AGIDM+MVP NY+ FI     L
Sbjct  301   LKNKLRFRGFVISDWQGIDRMTPIAGSNYTYSVQTGVLAGIDMIMVPYNYTDFIGNLTML  360

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V   FIPMSRIDDAV RILRVKFTMGLFENP AD SL+H LG Q HR+LAREAVRKSLVL
Sbjct  361   VNKNFIPMSRIDDAVKRILRVKFTMGLFENPIADLSLSHQLGSQEHRELAREAVRKSLVL  420

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK  ++P+LPLPK A +ILVAGTHA+NLGYQCGGWTITW+G SG   + GTTIL  +
Sbjct  421   LKNGKPGQEPVLPLPKKAPKILVAGTHADNLGYQCGGWTITWQGTSGNNNSVGTTILDAV  480

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                V+P+T++VYNE  +  F+ S+ F+YAIVVVGE  Y+E +GD +N++IP  G   IKN
Sbjct  481   RKTVNPSTEVVYNEEPDAGFVASSKFSYAIVVVGEHSYAESYGDSMNMSIPDPGPSIIKN  540

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV++SGRP+V+EP++  MDALVAAWLPG+EG G+ DVLFGDY FTGKL+RT
Sbjct  541   VCGS-VKCVVVIISGRPVVIEPYVAQMDALVAAWLPGTEGLGITDVLFGDYGFTGKLART  599

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WF+TVDQLPMNVGD HYDPL+PFGFGLTT
Sbjct  600   WFRTVDQLPMNVGDPHYDPLYPFGFGLTT  628



>gb|KHN34680.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/453 (68%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQGD+P+N  +GVP++ GK KV ACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKLVQAMTEIIPGLQGDIPDNLPKGVPFMTGKEKVLACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV D  GLM IHMP Y  SI KGV+++M SYSS NGVKMHAN  L+T +
Sbjct  235   GGTVNGIDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGVKMHANNDLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT+   +N+TYS+   ++AGIDM M P  Y  FI   + L
Sbjct  295   LKNTLHFKGFVISDFEGIDRITLPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLIML  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPMSRIDDAV RIL VKF MG+FE PFADYSL  YLG Q HR LAREAVRKS+VL
Sbjct  355   VKNKFIPMSRIDDAVRRILWVKFMMGIFETPFADYSLVGYLGIQKHRQLAREAVRKSMVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK   +IL+AG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  415   LKNGESADKPLLPLPKKVPKILLAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T +VY E+ + EF+KSN+F+Y IVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  475   KNTVDPETTVVYKENPDAEFVKSNEFSYGIVVVGENPYAEMHGDNMNLTIPDHGPETIAN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  535   VCGA-IKCVVIVISGRPVVIEPYVDSVDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGL+TK ++
Sbjct  594   WFKTVDQLPMNVGDLHYDPLFPFGFGLSTKPTK  626



>gb|AAR14129.1| exo-beta-glucanase [Lilium longiflorum]
Length=626

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/448 (71%), Positives = 360/448 (80%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++M EIIPGLQGDVP    +G PYVGGK KVAAC+KH+V D
Sbjct  174   RDPRWGRCYESYSEDHTVVQAMIEIIPGLQGDVPAKHKKGNPYVGGKDKVAACSKHFVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+    GL SIHMP Y  SI KGVSTVM SYSS NG KMHAN  L+T F
Sbjct  234   GGTHDGINENNTIISAKGLFSIHMPAYYNSIDKGVSTVMISYSSWNGKKMHANHELITGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV  SI+AG+DM+MVPNNY  FI     L
Sbjct  294   LKKKLKFRGFVISDWEGIDRITSPPGANYTYSVQASISAGLDMIMVPNNYQDFIGNLTYL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRI+DAV RILRVKF  GLFENP ADYSLA  LG + HR+LAREAVRKSLVL
Sbjct  354   VKKNVIPMSRINDAVRRILRVKFVAGLFENPLADYSLADQLGNKEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   QPLLPLPK A +ILVAG+HA+++G QCGGWT+ W+G  G IT GTTIL GI 
Sbjct  414   LKNGKSINQPLLPLPKKAPKILVAGSHAHDIGLQCGGWTMEWQGKIGNITVGTTILDGIK  473

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
               VDP T ++Y E+ +  F+++N+F+YAIVVVGE PY+E  GD+LNLT+PA G   IK+V
Sbjct  474   ATVDPTTNVIYEENPDATFVENNNFSYAIVVVGEIPYAETAGDNLNLTLPAPGPSMIKDV  533

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A VKCVVV+VSGRPLV+EP L SMDA+VAAWLPGSEGQGV+DVLFGDY FTGKL RTW
Sbjct  534   CGA-VKCVVVIVSGRPLVIEPFLGSMDAVVAAWLPGSEGQGVSDVLFGDYGFTGKLPRTW  592

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FK+VDQLPMNVGD+HYDPLFPFGFGLTT
Sbjct  593   FKSVDQLPMNVGDKHYDPLFPFGFGLTT  620



>gb|KHN38459.1| Lysosomal beta glucosidase [Glycine soja]
Length=644

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/467 (66%), Positives = 373/467 (80%), Gaps = 15/467 (3%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGK-------------  1333
             RDPRWGRC+ESYSED +I ++MTEIIPGLQGD+ +N  +GVPYV GK             
Sbjct  179   RDPRWGRCFESYSEDPKIAQAMTEIIPGLQGDISSNSRKGVPYVSGKHAIPSTFELLYHR  238

Query  1332  TKVAACAKHYVADGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNG  1153
              KVAACAKHYV DGGTTKG++ENNTV  +  L+ IHMPPY  SI+KGVSTVM SYSS NG
Sbjct  239   NKVAACAKHYVGDGGTTKGINENNTVISYSELLRIHMPPYYDSIVKGVSTVMVSYSSWNG  298

Query  1152  VKMHANRHLLTDFLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVP  973
              KMHAN  L+T++LK  L+FRGFVISDWLGID+IT    SNY+YS+   + AGIDM+MVP
Sbjct  299   QKMHANHFLVTNYLKNKLKFRGFVISDWLGIDKITSPPHSNYSYSIQVGVGAGIDMIMVP  358

Query  972   NNYSRFISTALSLVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHR  793
              N++ FI      VKN  IP+SRIDDAV RILRVKF MGLFENP AD SL + LG + HR
Sbjct  359   FNFTEFIDVLTYQVKNNIIPVSRIDDAVKRILRVKFVMGLFENPLADLSLVNQLGSEEHR  418

Query  792   DLAREAVRKSLVLLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG  613
              +AREAVRKSLVLLKNGK  ++PLLPLPK A++ILVAG+HA+NLGYQCGGWTITW+GL G
Sbjct  419   QIAREAVRKSLVLLKNGKSAEKPLLPLPKKAAKILVAGSHADNLGYQCGGWTITWQGLGG  478

Query  612   -YITAGTTILSGIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLN  436
               +T GTTIL  +   +DPAT++V+NE+ +  F+KSN+F+ AIVVVGE PY+  FGD LN
Sbjct  479   NNLTVGTTILEAVKQTIDPATKVVFNENPDSNFVKSNNFSCAIVVVGEHPYATTFGDSLN  538

Query  435   LTIPAAGLDTIKNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVL  256
             LTIP  G  TI NVC + ++CVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVAD+L
Sbjct  539   LTIPEPGPSTITNVCGS-IQCVVVLITGRPVVIQPYLSKVDALVAAWLPGTEGQGVADLL  597

Query  255   FGDYPFTGKLSRTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             FGDY FTGKL+RTWFKTVDQLPMNVGD++YDPLFPFGFGL+T  +++
Sbjct  598   FGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNPTKY  644



>ref|XP_010086714.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB23130.1| Lysosomal beta glucosidase [Morus notabilis]
Length=619

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/450 (70%), Positives = 367/450 (82%), Gaps = 3/450 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V  MT+II GLQG+ P N  +GVPY+GG+ KVAACAKH+V D
Sbjct  163   RDPRWGRCYESYSEDPNVVIEMTDIILGLQGEPPANARKGVPYLGGRDKVAACAKHFVGD  222

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DWHGL+SIHMP Y  +IIKGV+TVM SYSS+NG KMHANR L+T F
Sbjct  223   GGTTKGINENNTVIDWHGLLSIHMPAYYHAIIKGVNTVMVSYSSLNGKKMHANRDLVTGF  282

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW G+D+IT    SNY+ S+L +I AGIDMVM+P+N++ FI      
Sbjct  283   LKNTLKFRGFVISDWQGVDKITDLPHSNYSDSLLAAIQAGIDMVMIPHNHTEFIDILTDH  342

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N  IP+SRIDDAV RILRVKF MGLFE P AD +  + LG Q HRDLAREAVRKSLVL
Sbjct  343   VNNNRIPVSRIDDAVQRILRVKFVMGLFEEPLADQTFVNQLGSQEHRDLAREAVRKSLVL  402

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +P++PLPK ASRILVAGTHANNLGYQCGGW++TW+G SG   T G+TILSGI
Sbjct  403   LKNGETSDRPIIPLPKKASRILVAGTHANNLGYQCGGWSLTWQGFSGDNQTIGSTILSGI  462

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T+I+Y+E+ +  F+KS++F+YAIVVVGE PY+E  GD LNLTI   G   I +
Sbjct  463   EEAVDPSTEILYSENPDPAFVKSSNFSYAIVVVGEPPYAETNGDSLNLTIAEPGPSVIAD  522

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSE-GQGVADVLFGDYPFTGKLSR  220
             VC   VKCVVVLVSGRPLV+EP+LPS+DA VAAWLPGSE G GVADVLFGDY FTGKLS 
Sbjct  523   VCGQ-VKCVVVLVSGRPLVIEPYLPSVDAFVAAWLPGSEAGHGVADVLFGDYGFTGKLSM  581

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             TWF+TVDQLPMNVGD HYDPLFPFGFGL+T
Sbjct  582   TWFRTVDQLPMNVGDAHYDPLFPFGFGLST  611



>ref|XP_003569924.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
 ref|XP_010232399.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
Length=661

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/452 (70%), Positives = 363/452 (80%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++P N ++GVPY+ GK KV ACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHKIVQEMTDIIIGLQGEIPENHTKGVPYIAGKDKVVACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+ IHMPPY  SIIKGV+TVM SYSS+NG KMHAN  L+T +
Sbjct  235   GGTHNGVNENNTIVDEHGLLGIHMPPYYDSIIKGVATVMVSYSSLNGAKMHANHDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDWLGIDRIT    +NYTYSV   INAGIDMVMVP NY+ +I  A SL
Sbjct  295   LKSKLHFRGFVISDWLGIDRITSPPGANYTYSVQAGINAGIDMVMVPYNYTEYIDDATSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    I MSRIDDAV+RILRVKFTMGLFENP AD S A  LG + HR+LAREAVRKSLVL
Sbjct  355   VNKHIISMSRIDDAVSRILRVKFTMGLFENPLADLSFADQLGKKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG    Q  LPLPK A RILVAG+HA+NLGYQCGGW+I W G SG ITAGTT+L  I 
Sbjct  415   LKNGNTPNQQFLPLPKKARRILVAGSHASNLGYQCGGWSIQWMGGSGDITAGTTVLDAIK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V   T +VY+E+ +  FMK+NDF++AIVVVGE PY+E  GDD +LTI   G DTI+ V
Sbjct  475   STVG-DTPVVYSENPDNSFMKTNDFSFAIVVVGETPYAETVGDDTDLTILDPGPDTIRTV  533

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+  VKC VV++SGRP+V+EP+LP M+ALVAAWLPG+EGQGVADVLFGDY FTGKLSRTW
Sbjct  534   CST-VKCAVVIISGRPVVIEPYLPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTW  592

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPFGFGLT   S+
Sbjct  593   FKSVDQLPMNVGDPHYDPLFPFGFGLTINSSQ  624



>ref|XP_008355265.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/454 (70%), Positives = 364/454 (80%), Gaps = 3/454 (1%)
 Frame = -2

Query  1470  DPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVAD  1294
             DPRWGRCYESYSED +IV++MTEIIPGLQGD+P    +G PYV   K KVAACAKHYV D
Sbjct  180   DPRWGRCYESYSEDHKIVQAMTEIIPGLQGDMPPTARKGAPYVSTAKGKVAACAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT  D +GL+SIHMP Y  SI KGV+TVM SYSS NG KMHAN+ L+T +
Sbjct  240   GGTTKGINENNTXIDLNGLLSIHMPAYLNSIRKGVATVMVSYSSWNGNKMHANKELVTGY  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   + AGIDM+MVP N++ FI      
Sbjct  300   LKDKLRFRGFVISDWEGIDRITSPPKANYSYSVQAGVGAGIDMIMVPYNFTDFIDDLTYQ  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRI+DAV RILRVKF MGLFENP AD SLA  LG + HR+LAREAVRKSLVL
Sbjct  360   VKNNIIPMSRINDAVQRILRVKFVMGLFENPLADLSLASQLGNKVHRELAREAVRKSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK   +P+LPLPK A +ILVAG+HA+NLG QCGGWTITW+GL G   T G TILS +
Sbjct  420   LKNGKSAYKPVLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGLEGNDHTMGXTILSAV  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PY+E FGD LNLTIP  G  TI N
Sbjct  480   KSTVDPTTQVVYNENPDANFVKSNKFSYAIVVVGEPPYAETFGDSLNLTIPQPGPSTIAN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRPLVL+P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+ T
Sbjct  540   VCGA-VKCVVVVISGRPLVLQPYLAGIDALVAAWLPGTEGQGVTDALFGDYGFTGKLAHT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD HYDPLFPFGFGLTTK +++
Sbjct  599   WFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPTKN  632



>ref|XP_006604247.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006604248.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_006604249.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
Length=631

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/453 (68%), Positives = 368/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQGD+P+N  +GVP++ GK KV ACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKLVQAMTEIIPGLQGDIPDNLPKGVPFMTGKEKVLACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV D  GLM IHMP Y  SI KGV+++M SYSS NGVKMHAN  L+T +
Sbjct  235   GGTINGIDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGVKMHANNDLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT+   +N+TYS+   ++AGIDM M P  Y  FI   + L
Sbjct  295   LKNTLHFKGFVISDFEGIDRITLPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLIML  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPMSRIDDAV RIL VKF MG+FE PFADYSL  YLG Q HR LAREAVRKS+VL
Sbjct  355   VKNKFIPMSRIDDAVRRILWVKFMMGIFETPFADYSLVGYLGIQKHRQLAREAVRKSMVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK   +IL+AG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  415   LKNGESADKPLLPLPKKVPKILLAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T +VY E+ + EF+KSN+F+Y IVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  475   KNTVDPETTVVYKENPDAEFVKSNEFSYGIVVVGENPYAEMHGDNMNLTIPDHGPETIAN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  535   VCGA-IKCVVIVISGRPVVIEPYVDSVDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGL+TK ++
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLSTKPTK  626



>ref|XP_009400035.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400036.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400037.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400039.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400040.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400041.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=630

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/453 (68%), Positives = 371/453 (82%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++VK MTEIIPGLQGD+P N  +GVP+V GK  VAACAKHYV D
Sbjct  177   RDPRWGRCYESYSEDPKLVKEMTEIIPGLQGDIPANSRKGVPFVAGKRNVAACAKHYVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+   HGL+SIHMPPY  ++IKGVSTVM S+SS NGVKMHAN +L+TDF
Sbjct  237   GGTYKGINENNTIISQHGLLSIHMPPYYSAVIKGVSTVMVSFSSWNGVKMHANHYLVTDF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NY+YS+   I+AGIDMVM+P  Y+ FI      
Sbjct  297   LKNKLHFRGFVISDWQGIDRITSPPHANYSYSIQAGIHAGIDMVMIPFAYTEFIKDLTYQ  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+N  IPMSRI+DAV RILRVKFT+GLFENP+AD SLA  LG + HRDLAREAVRKSLVL
Sbjct  357   VQNNVIPMSRINDAVRRILRVKFTVGLFENPYADPSLADQLGKKEHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    P+LPLPK A +ILVAG+HA+NLGYQCGGWTITW+GLSG   T GTT+L  +
Sbjct  417   LKNGKSANDPMLPLPKKAKKILVAGSHADNLGYQCGGWTITWQGLSGNNNTIGTTVLDAV  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T+++++E+ + EF+K + F+YAIVVVGE PY+E  GD+LNLTIP  G   I+N
Sbjct  477   KSTVDPSTEVIFSENPDPEFVKQSMFSYAIVVVGEHPYAETDGDNLNLTIPYPGPSVIQN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC+  +KCVV+++SGRP+V+EP++  +D+LVAAWLPG+EGQGVADVLFGDY F+GKLSRT
Sbjct  537   VCSC-IKCVVIIISGRPIVIEPYIGMIDSLVAAWLPGTEGQGVADVLFGDYGFSGKLSRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+V+QLPMN  D HYDPLFP+GFGLTT  S+
Sbjct  596   WFKSVEQLPMNFDDPHYDPLFPYGFGLTTMPSK  628



>ref|XP_009394272.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=629

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/449 (69%), Positives = 361/449 (80%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++MTE+IPGLQGDVP N+++  P+V GK  VAAC+KH+V D
Sbjct  175   RDPRWGRCYESYSEDHGVVQAMTELIPGLQGDVPPNYAKDFPFVAGKNNVAACSKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG+DENNT+ D H L  IHMP Y  SI KGVSTVM SYSS NGVKMHANR L+T  
Sbjct  235   GGTQKGIDENNTIIDAHELFGIHMPAYIDSIAKGVSTVMVSYSSWNGVKMHANRRLVTGH  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GIDRIT    +NYTYSV  SI AG+DMVMVP +Y  FI T  +L
Sbjct  295   LKKKLGFKGFVISDWQGIDRITTPPGANYTYSVQASITAGLDMVMVPYDYPAFIGTLTNL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V  + IPM RI+DAV RILRVKF +GLFENP  D SLA  +G Q HR+LAREAVRKSLVL
Sbjct  355   VNQKVIPMKRINDAVRRILRVKFVLGLFENPLPDPSLADQIGKQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PLLPLPK A +ILVAG+HA+N+GYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  415   LKNGKSSNEPLLPLPKKADKILVAGSHADNIGYQCGGWTIEWQGGSGNITGGTTILDAIR  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDPAT +V++E  + + ++SN F+YAIVVVGE PY+E  GD LNLTIP  G  TI+ V
Sbjct  475   STVDPATNVVFSEKPDADLVQSNHFSYAIVVVGEPPYAETAGDSLNLTIPEPGPSTIQTV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V+CVVVL+SGRP+V++P+LP MDALVAAWLPGSEGQGVADVLFGD+ F GKL RTW
Sbjct  535   CGA-VRCVVVLISGRPVVIQPYLPVMDALVAAWLPGSEGQGVADVLFGDFGFAGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+V+QLPMNVGD++YDPLFPFGFGLTTK
Sbjct  594   FKSVEQLPMNVGDKNYDPLFPFGFGLTTK  622



>ref|XP_011101353.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=643

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/450 (71%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MT+II GLQG++P N  + VPYVGGK KV ACAKH+V D
Sbjct  190   RDPRWGRCYESYSEDHKVVEQMTDIILGLQGEIPPNSRKSVPYVGGKDKVVACAKHFVGD  249

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTVTDWHGL+SIHMP Y  S+IKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  250   GGTVKGINENNTVTDWHGLLSIHMPGYYHSVIKGVSTVMVSYSSWNGVKMHANRTLITGF  309

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+FRGFVISD+ GIDR+T    SNY+ S+ ++INAG+DMVM P+N + F+    S 
Sbjct  310   LKGTLKFRGFVISDYQGIDRMTYPWGSNYSTSLQKAINAGVDMVMAPHNITEFVQIMTSH  369

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RILRVKF+ GLF+NP +DYSL   +  QAHR+LAREAVRKSLVL
Sbjct  370   VKNKLIPMSRIDDAVRRILRVKFSSGLFDNPLSDYSLIDKIRTQAHRNLAREAVRKSLVL  429

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGKD   PL+PLPKN S+ILVAGTHANNLG QCGGWTI+W+G +G+ +T GTTILS I
Sbjct  430   LKNGKDASNPLIPLPKNTSKILVAGTHANNLGLQCGGWTISWQGQNGHNLTTGTTILSAI  489

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVD +T+IVY+E+ + E +K N ++YA+VVVGE  Y+E  GD+LNLTIP  GL T+KN
Sbjct  490   SEAVDASTEIVYSENPDVESLKDNKYSYAVVVVGEHTYAETAGDNLNLTIPEPGLSTMKN  549

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC+  VKCVVVL+SGRPLV+EP+LP MDALVAAWLPG EGQGVADVLFGDY FTGKL RT
Sbjct  550   VCSK-VKCVVVLISGRPLVVEPYLPMMDALVAAWLPGGEGQGVADVLFGDYGFTGKLPRT  608

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK VDQLPMNVGD HYDPLFP+GFG+TT+
Sbjct  609   WFKRVDQLPMNVGDEHYDPLFPYGFGITTQ  638



>ref|XP_008245228.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/454 (69%), Positives = 366/454 (81%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V  MT++I GLQG++P    +GVPYVGGK KVAACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDPAVVIQMTDVILGLQGEIPAGSRKGVPYVGGKDKVAACAKHFVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS+NG KMHA+  L+T F
Sbjct  239   GGTTRGINENNTVIDRHGLLSIHMPAYYHSIIKGVSTIMVSYSSLNGKKMHAHHELVTKF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW G+D+I     SNY  +VL  + AGIDMVMVP N++ FI      
Sbjct  299   LKDTLKFRGFVISDWQGVDKINYPLHSNYPEAVLAGVQAGIDMVMVPFNHTEFIGIVTDH  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+ IPMSRIDDAV RILRVKF MGLFENP AD S    LG QAHRDLAREAVRKSLVL
Sbjct  359   VNNKRIPMSRIDDAVRRILRVKFVMGLFENPLADESFVDKLGSQAHRDLAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   P+LPLPK   RILVAGTHANNLGYQCGGW++TW+G+SG   TAGTTILS I
Sbjct  419   LKNGENADTPVLPLPKKTKRILVAGTHANNLGYQCGGWSLTWQGVSGNNYTAGTTILSAI  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T+IV++E+ + +F+KSN+F+YAI+VVGE+PY+E  G  LNLTI   G  TI N
Sbjct  479   TAAVDPSTEIVFSENPDPDFLKSNNFSYAIIVVGEQPYAETKGYSLNLTIAEPGPQTITN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V+EP++ SMDALVAAWLPG+EGQGV+DVLFGDY F+GKL RT
Sbjct  539   VCGA-VKCVVVVISGRPVVIEPYVSSMDALVAAWLPGTEGQGVSDVLFGDYGFSGKLPRT  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD HYDPLFPF FGLTT   + 
Sbjct  598   WFKTVDQLPMNVGDAHYDPLFPFDFGLTTDSVKQ  631



>gb|KGN66708.1| hypothetical protein Csa_1G661750 [Cucumis sativus]
Length=627

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/450 (68%), Positives = 368/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESY ED +IV+ MTEIIPGLQG++P N  +GVPYV GK  V ACAKHYV D
Sbjct  175   RDPRWGRCYESYGEDPKIVQEMTEIIPGLQGEIPPNSRKGVPYVAGKENVVACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG+DENNTV D HGL+SIHMP Y  SIIKGV+T+M SYSS NG KMHAN++L+TDF
Sbjct  235   GGTTKGIDENNTVIDRHGLLSIHMPGYYHSIIKGVATIMVSYSSWNGEKMHANKNLVTDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW  IDRIT    +NYTYS+L SI AG+DM+M+P NY  FI    +L
Sbjct  295   LKNTLHFQGFVISDWEAIDRITDPPHANYTYSILASITAGLDMIMIPYNYPEFIDGLTNL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ +IP+SRIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKSNYIPISRIDDAVKRILRVKFVMGLFENPIADLSLVNELGKQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   +PLLPL K   +ILVAG+HANNLGYQCGGWTI W+GLSG  +T+GTT+L  I
Sbjct  415   LKNGKSADKPLLPLEKKTQKILVAGSHANNLGYQCGGWTIEWQGLSGNNLTSGTTVLDAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T++++NE+ +K+ ++S+ F+YAIVVVGE PY+E  GD LNLTIP  G +TI N
Sbjct  475   KDTVDPTTEVIFNENPDKKSLQSDTFSYAIVVVGEHPYAELNGDSLNLTIPDPGPNTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   +KC VV++SGRP+V++P++ S+DALVAAWLPG+EG+G+ DVLFGDY FTGKLS+T
Sbjct  535   VCGV-IKCAVVIISGRPVVIQPYVDSIDALVAAWLPGTEGKGITDVLFGDYGFTGKLSQT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN G+ +YDPLFPFG GLTT+
Sbjct  594   WFKTVDQLPMNFGNPNYDPLFPFGHGLTTQ  623



>ref|XP_004230073.1| PREDICTED: lysosomal beta glucosidase [Solanum lycopersicum]
Length=662

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 367/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++PN   +G+PY+ GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKIVQEMTDIIIGLQGEIPNGSRKGIPYIAGKKKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVTD H L+SIHMP Y  SIIKGV+TVMASYSS NG KMHA+  L+T F
Sbjct  236   GGTTKGVNENNTVTDKHELLSIHMPAYDDSIIKGVATVMASYSSWNGRKMHADHDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG LRF+GFVISDW GIDR+T    +NYTYSV  SI AG+DMVMVP N++ FI+    L
Sbjct  296   LKGTLRFKGFVISDWQGIDRLTSPPHANYTYSVETSILAGVDMVMVPYNFTEFINDLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIP  RIDDAV RIL VKFTMGLFENP+ D+SL + +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNFIPTDRIDDAVERILSVKFTMGLFENPYTDFSLINEVGSQEHRNLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK    PLLPLPK  SRILVAG+HA+NLGYQCGGWTITW+G SG   T+GTTIL  I
Sbjct  416   LKNGKTANNPLLPLPKKVSRILVAGSHADNLGYQCGGWTITWQGFSGNDATSGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVDP T+++Y E+ + ++  S+ F YAIVVVGE PY+E  GD   LT+   G D I N
Sbjct  476   KSAVDPRTEVIYFENPDSKYATSSGFDYAIVVVGEHPYAESAGDSPTLTVADPGPDVINN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRPLVLEP+LPS+DALVAAWLPG+EGQG+ D+LFGDY FTGKL RT
Sbjct  536   VCQS-VKCVVIVISGRPLVLEPYLPSIDALVAAWLPGTEGQGITDLLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WF+TV+QLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  595   WFRTVNQLPMNVGDPHYDPLFPFGFGLTTSKS  626



>ref|XP_004171886.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Cucumis sativus]
Length=628

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/450 (68%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESY ED +IV+ MTEIIPGLQG++P N  +GVPYV GK  V ACAKHYV D
Sbjct  176   RDPRWGRCYESYGEDPKIVQEMTEIIPGLQGEIPPNSRKGVPYVAGKENVVACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG+DENNTV D HGL+SIHMP Y  SIIKGV+T+M SYSS NG KMHAN++L+TDF
Sbjct  236   GGTTKGIDENNTVIDRHGLLSIHMPGYYHSIIKGVATIMVSYSSWNGEKMHANKNLVTDF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F GFVISDW  IDRIT    +NYTYS+L SI AG+DM+M+P NY  FI    +L
Sbjct  296   LKNTLHFSGFVISDWEAIDRITDPPHANYTYSILASITAGLDMIMIPYNYPEFIDGLTNL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ +IP+SRIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  356   VKSNYIPISRIDDAVKRILRVKFVMGLFENPIADLSLVNELGKQEHRELAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK   +PLLPL K   +ILVAG+HANNLGYQCGGWTI W+GLSG  +T+GTT+L  I
Sbjct  416   LKNGKSADKPLLPLEKKTQKILVAGSHANNLGYQCGGWTIEWQGLSGNNLTSGTTVLDAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP T++++NE+ +K+ ++S+ F+YAIVVVGE PY+E  GD LNLTIP  G +TI N
Sbjct  476   KDTVDPTTEVIFNENPDKKSLQSDTFSYAIVVVGEHPYAELNGDSLNLTIPDPGPNTITN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   +KC VV++SGRP+V++P++ S+DALVAAWLPG+EG+G+ DVLFGDY FTGKLS+T
Sbjct  536   VCGV-IKCAVVIISGRPVVIQPYVDSIDALVAAWLPGTEGKGITDVLFGDYGFTGKLSQT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN G+ +YDPLFPFG GLTT+
Sbjct  595   WFKTVDQLPMNFGNPNYDPLFPFGHGLTTQ  624



>ref|XP_004300933.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=632

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/450 (68%), Positives = 366/450 (81%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++MTEIIPGLQG++P N  +GVPYV G  KVAACAKHYV D
Sbjct  179   RDPRWGRCYESYSEDPRLVQAMTEIIPGLQGEIPANSRKGVPYVSGNDKVAACAKHYVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENN V D HGL+SIHMPPYP +IIKGV++VM SYSS NGVKMHANR L+T F
Sbjct  239   GGTAMGINENNAVIDRHGLLSIHMPPYPSAIIKGVASVMISYSSWNGVKMHANRELITGF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L F+GFVISDW GID IT    SNY+YS+++ I+AGIDM+MVP NY+ FI      
Sbjct  299   LKGTLGFKGFVISDWQGIDMITSPSHSNYSYSIMKGISAGIDMIMVPYNYTEFIEGLTFR  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RILRVKFTMG FE P AD  L   LG Q HR+LAREAVR+SLVL
Sbjct  359   VKNKIIPMSRIDDAVKRILRVKFTMGQFEKPLADLRLVSQLGSQEHRELAREAVRRSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+  ++P+LPLPK  S+ILVAGTHA++LGYQCGGWTI W+G SG  +T GTT+LS I
Sbjct  419   LKNGECAEKPILPLPKKTSKILVAGTHADDLGYQCGGWTIEWQGHSGNNLTQGTTVLSAI  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N V P T++VY ++ + +FMKSN+F++AIV+VGE PY+E  GD+LNLTIP +G   I+N
Sbjct  479   RNTVAPETRVVYKKNPDAKFMKSNNFSHAIVIVGEPPYAEGAGDNLNLTIPKSGRRVIRN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A  KCVV L++GRP+V+EP+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL RT
Sbjct  539   VCGAS-KCVVCLITGRPVVIEPYLSIIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRT  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+V QLPMNVGD  YDPLF +G+GLTT+
Sbjct  598   WFKSVHQLPMNVGDPDYDPLFAYGYGLTTQ  627



>ref|XP_006347720.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Solanum 
tuberosum]
Length=630

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 365/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++PN   +G+PY+ GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKIVQEMTDIIIGLQGEIPNGSRKGIPYIAGKKKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVTD H L+SIHMP Y  SIIKGV+TVMASYSS NG KMHA+  L+T F
Sbjct  236   GGTTKGVNENNTVTDKHELLSIHMPAYDDSIIKGVATVMASYSSWNGRKMHADHDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDR+T    +NYTYSV  SI AG+DMVMVP N++ FI+    L
Sbjct  296   LKGTLKFKGFVISDWQGIDRLTSPPHANYTYSVETSILAGVDMVMVPYNFTEFINDLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIP  RIDDAV RIL VKFTMGLFENP+ D+SL + +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNFIPTDRIDDAVERILSVKFTMGLFENPYTDFSLINEVGSQEHRNLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK    PLLPLPK  SRILVAG HA+NLGYQCGGWTITW+G SG   T+GTTIL  I
Sbjct  416   LKNGKTANNPLLPLPKKVSRILVAGGHADNLGYQCGGWTITWQGFSGNDATSGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVDP T+++Y E+ + ++  S+ F YAIVVVGE PY+E  GD   LT+   G D I N
Sbjct  476   KSAVDPGTEVIYFENPDSKYATSSRFDYAIVVVGEHPYAESAGDSPTLTVADPGPDVINN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRPLVLEP LPS+DALVAAWLPG+EGQG+ D+LFGDY FTGKL RT
Sbjct  536   VCQS-VKCVVIVISGRPLVLEPFLPSIDALVAAWLPGTEGQGITDLLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WF+TVDQLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  595   WFRTVDQLPMNVGDPHYDPLFPFGFGLTTSKS  626



>ref|XP_007205098.1| hypothetical protein PRUPE_ppa014607mg [Prunus persica]
 gb|EMJ06297.1| hypothetical protein PRUPE_ppa014607mg [Prunus persica]
Length=602

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/449 (71%), Positives = 362/449 (81%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED EIVK MT+II GLQGD+P    +GVPYVGGK KV ACAKH+V D
Sbjct  150   RDPRWGRCYESYSEDPEIVKQMTDIILGLQGDIPAGSRKGVPYVGGKDKVVACAKHFVGD  209

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTV D HGLMSIHMP Y  SIIKGVST+M SYSS NG KMHAN  L+T F
Sbjct  210   GGTIKGINENNTVIDMHGLMSIHMPAYYHSIIKGVSTIMVSYSSWNGKKMHANHELVTRF  269

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GID+I+    S+Y  SVL  I AGIDMVMVP NY+ FI      
Sbjct  270   LKDTLKFKGFVISDWQGIDKISYPLHSDYPNSVLVGIQAGIDMVMVPYNYTEFIGIVTDH  329

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+ IP+SRIDDAV RILRVKF MGLFENP AD S    LG QAHRDLAREAVRKSLVL
Sbjct  330   VNNKRIPISRIDDAVRRILRVKFMMGLFENPLADQSFVDQLGSQAHRDLAREAVRKSLVL  389

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   P+LPLPK ASRILVAGTHANNLGYQCGGW++TW+G+SG   TAGTTIL  I
Sbjct  390   LKNGENADTPVLPLPKKASRILVAGTHANNLGYQCGGWSLTWQGVSGNNYTAGTTILGAI  449

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             A+AV+  T IV++ + +  F+ +++F YA+V VGE PY+E  GD LNLTIP  G   I N
Sbjct  450   ASAVNETTDIVFSINPDPNFVTASNFDYAVVAVGEVPYAETRGDSLNLTIPEPGPSIITN  509

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV++VSGRP+V+EP+L S+DALVAAWLPG+EGQG++DVLFGDY F+GKL RT
Sbjct  510   VCGA-VKCVVIVVSGRPVVIEPYLSSIDALVAAWLPGTEGQGISDVLFGDYGFSGKLPRT  568

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGDRHYDPLFPFGFGLTT
Sbjct  569   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  597



>ref|XP_006479136.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
Length=635

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/463 (69%), Positives = 366/463 (79%), Gaps = 12/463 (3%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTE+IPGLQGD+P    +GVPYV GKTKVAACAKH+V D
Sbjct  172   RDPRWGRCYESYSEDPKIVQAMTELIPGLQGDIPAGSPKGVPYVAGKTKVAACAKHFVGD  231

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL++IHMP Y  SIIKGVSTVM SYSS NG+KMHAN+ L+T F
Sbjct  232   GGTINGVNENNTIIDRHGLLAIHMPAYYNSIIKGVSTVMVSYSSWNGIKMHANQELVTGF  291

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVI+DW G+DRIT    +NY+YSV   I AGIDMVMVP NY  FI      
Sbjct  292   LKNTLQFRGFVITDWEGLDRITSPPHANYSYSVEVGIKAGIDMVMVPYNYIEFIDDLTFQ  351

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  352   VKNNIIPMSRIDDAVRRILRVKFVMGLFENPLADDSLVDQLGSQEHRELAREAVRKSLVL  411

Query  753   LKNGKDEKQPL----------LPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-I  607
             LKNG   + PL          LPLPK  S+ILVAG+HA+NLGYQCGGWTI W+GLSG  +
Sbjct  412   LKNGDSTEVPLLPLPKKTSKILPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNDL  471

Query  606   TAGTTILSGIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTI  427
             T GTTIL+ I N VD  T++VY E+ +  F+KSN+F+YAIVVVGE PY+E  GD +NL I
Sbjct  472   TRGTTILNAIKNTVDQQTEVVYQENPDANFVKSNNFSYAIVVVGEHPYAETNGDSMNLNI  531

Query  426   PAAGLDTIKNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGD  247
                G +TI NVC A V+CVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGD
Sbjct  532   ADPGPNTITNVCGA-VECVVVVISGRPVVIQPYLSYIDALVAAWLPGTEGQGVADVLFGD  590

Query  246   YPFTGKLSRTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             Y FTGKL RTWFKTVDQLPMNVGD HYDPLFPFGFGLTTK  +
Sbjct  591   YDFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKSRQ  633



>ref|XP_006443452.1| hypothetical protein CICLE_v10019305mg [Citrus clementina]
 gb|ESR56692.1| hypothetical protein CICLE_v10019305mg [Citrus clementina]
Length=627

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/463 (69%), Positives = 366/463 (79%), Gaps = 12/463 (3%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTE+IPGLQGD+P    +GVPYV GKTKVAACAKH+V D
Sbjct  164   RDPRWGRCYESYSEDPKIVQAMTELIPGLQGDIPAGSPKGVPYVAGKTKVAACAKHFVGD  223

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL++IHMP Y  SIIKGVSTVM SYSS NG+KMHAN+ L+T F
Sbjct  224   GGTINGVNENNTIIDRHGLLAIHMPAYYNSIIKGVSTVMVSYSSWNGIKMHANQELVTGF  283

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVI+DW G+DRIT    +NY+YSV   I AGIDMVMVP NY  FI      
Sbjct  284   LKNTLQFRGFVITDWEGLDRITSPPHANYSYSVEVGIKAGIDMVMVPYNYIEFIDDLTFQ  343

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  344   VKNNIIPMSRIDDAVRRILRVKFVMGLFENPLADDSLVDQLGSQEHRELAREAVRKSLVL  403

Query  753   LKNGKDEKQPL----------LPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-I  607
             LKNG   + PL          LPLPK  S+ILVAG+HA+NLGYQCGGWTI W+GLSG  +
Sbjct  404   LKNGDSTEVPLLPLPKKTSKILPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNDL  463

Query  606   TAGTTILSGIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTI  427
             T GTTIL+ I N VD  T++VY E+ +  F+KSN+F+YAIVVVGE PY+E  GD +NL I
Sbjct  464   TRGTTILNAIKNTVDQQTEVVYQENPDANFVKSNNFSYAIVVVGEHPYAETNGDSMNLNI  523

Query  426   PAAGLDTIKNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGD  247
                G +TI NVC A V+CVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGD
Sbjct  524   ADPGPNTITNVCGA-VECVVVVISGRPVVIQPYLSYIDALVAAWLPGTEGQGVADVLFGD  582

Query  246   YPFTGKLSRTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             Y FTGKL RTWFKTVDQLPMNVGD HYDPLFPFGFGLTTK  +
Sbjct  583   YDFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKSRQ  625



>ref|XP_006644778.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=663

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/452 (69%), Positives = 361/452 (80%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+ MT+II GLQG++P N ++GVP++GGK KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHRVVQQMTDIILGLQGEIPINHTKGVPFIGGKDKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+ IHMPPY  SIIKGV+TVM SYSS+NGVKMHAN  L+T +
Sbjct  235   GGTHNGINENNTIIDEHGLLGIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHDLVTGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT   D+NYTYSV  SINAGIDMVMVP NY+ +I    SL
Sbjct  295   LKSKLHFRGFVISDWQGIDRITSPRDANYTYSVQASINAGIDMVMVPFNYTYYIDVITSL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    I MSRIDDAV RILRVKFTMGLFENP AD S +  LG + HR+LAREAVRKSLVL
Sbjct  355   VNKGIINMSRIDDAVRRILRVKFTMGLFENPLADLSFSDQLGKKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG    Q  LPLPK A  ILVAG+HA+NLGYQCGGW+I W G SG IT GTTIL  I 
Sbjct  415   LKNGNSPNQQFLPLPKKAKSILVAGSHASNLGYQCGGWSIQWNGGSGDITVGTTILDAIN  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V  +T +VY+E+ ++ FMK NDF++AIVVVGE  Y+E  GD+  LTI   G DTI+NV
Sbjct  475   STVADSTHVVYSENPDESFMKGNDFSFAIVVVGELTYAETLGDNAELTIEDPGTDTIRNV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+  VKCVVV++SGRP+V+EP+LP M+ALVAAWLPG+EGQGVADVLFGDY FTGKL RTW
Sbjct  535   CST-VKCVVVIISGRPVVIEPYLPVMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMNVGD HYDPLFPF FGLT   S+
Sbjct  594   FKSVDQLPMNVGDLHYDPLFPFDFGLTINSSQ  625



>gb|AIO11756.1| beta-glucosidase [Glycine max]
Length=627

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/454 (70%), Positives = 378/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK+MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHY+ D
Sbjct  175   RDPRWGRCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACAKHYLGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+  ++GL+SIHMP Y  SIIKGVSTVM SYSS NG+KMHAN+ L+T +
Sbjct  235   GGTNKGINENNTLISYNGLLSIHMPAYYDSIIKGVSTVMISYSSWNGMKMHANKKLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP NY+ FI      
Sbjct  295   LKNKLHFKGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP+AD SLA+ LG + HR++AREAVRKSLVL
Sbjct  355   VKNNIIPISRIDDAVARILRVKFVMGLFENPYADPSLANQLGSKEHREIAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  K+PLLPLPK +++ILVAG+HANNLGYQCGGWTITW+GL G  +T+GTTIL  +
Sbjct  415   LKNGKSYKKPLLPLPKKSTKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSGTTILDAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPAT++V+NE+ +K F+KS  F YAIVVVGE  Y+E FGD LNLT+   G  TI N
Sbjct  475   KQTVDPATEVVFNENPDKNFVKSYKFDYAIVVVGEHTYAETFGDSLNLTMADPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A ++CVVVLV+GRP+V++P+LP +DALVAAWLPG+EGQGVADVL+GDY FTGKL+RT
Sbjct  535   VCGA-IRCVVVLVTGRPVVIKPYLPKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD+HYDPLFPFG+GLTT  +++
Sbjct  594   WFKTVDQLPMNVGDKHYDPLFPFGYGLTTNITKY  627



>ref|XP_003535890.1| PREDICTED: lysosomal beta glucosidase [Glycine max]
Length=627

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/454 (70%), Positives = 378/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK+MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHY+ D
Sbjct  175   RDPRWGRCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACAKHYLGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+  ++GL+SIHMP Y  SIIKGVSTVM SYSS NG+KMHAN+ L+T +
Sbjct  235   GGTNKGINENNTLISYNGLLSIHMPAYYDSIIKGVSTVMISYSSWNGMKMHANKKLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP NY+ FI      
Sbjct  295   LKNKLHFKGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP+AD SLA+ LG + HR++AREAVRKSLVL
Sbjct  355   VKNNIIPISRIDDAVARILRVKFVMGLFENPYADPSLANQLGSKEHREIAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  K+PLLPLPK +++ILVAG+HANNLGYQCGGWTITW+GL G  +T+GTTIL  +
Sbjct  415   LKNGKSYKKPLLPLPKKSTKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSGTTILDAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPAT++V+NE+ +K F+KS  F YAIVVVGE  Y+E FGD LNLT+   G  TI N
Sbjct  475   KQTVDPATEVVFNENPDKNFVKSYKFDYAIVVVGEHTYAETFGDSLNLTMADPGPSTITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A ++CVVVLV+GRP+V++P+LP +DALVAAWLPG+EGQGVADVL+GDY FTGKL+RT
Sbjct  535   VCGA-IRCVVVLVTGRPVVIKPYLPKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD+HYDPLFPFG+GLTT  +++
Sbjct  594   WFKTVDQLPMNVGDKHYDPLFPFGYGLTTNITKY  627



>gb|KHN45535.1| Lysosomal beta glucosidase [Glycine soja]
Length=628

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/454 (70%), Positives = 378/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK+MTEIIPGLQGD+P N  +GVP+V GK KVAACAKHY+ D
Sbjct  176   RDPRWGRCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACAKHYLGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+  ++GL+SIHMP Y  SIIKGVSTVM SYSS NG+KMHAN+ L+T +
Sbjct  236   GGTNKGINENNTLISYNGLLSIHMPAYYDSIIKGVSTVMISYSSWNGMKMHANKKLITGY  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GIDRIT    +NY+YSV   ++AGIDM+MVP NY+ FI      
Sbjct  296   LKNKLHFKGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQ  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IP+SRIDDAV RILRVKF MGLFENP+AD SLA+ LG + HR++AREAVRKSLVL
Sbjct  356   VKNNIIPISRIDDAVARILRVKFVMGLFENPYADPSLANQLGSKEHREIAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  K+PLLPLPK +++ILVAG+HANNLGYQCGGWTITW+GL G  +T+GTTIL  +
Sbjct  416   LKNGKSYKKPLLPLPKKSTKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSGTTILDAV  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDPAT++V+NE+ +K F+KS  F YAIVVVGE  Y+E FGD LNLT+   G  TI N
Sbjct  476   KQTVDPATEVVFNENPDKNFVKSYKFDYAIVVVGEHTYAETFGDSLNLTMADPGPSTITN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A ++CVVVLV+GRP+V++P+LP +DALVAAWLPG+EGQGVADVL+GDY FTGKL+RT
Sbjct  536   VCGA-IRCVVVLVTGRPVVIKPYLPKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLART  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMNVGD+HYDPLFPFG+GLTT  +++
Sbjct  595   WFKTVDQLPMNVGDKHYDPLFPFGYGLTTNITKY  628



>ref|XP_007206306.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
 gb|EMJ07505.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
Length=647

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/454 (69%), Positives = 368/454 (81%), Gaps = 3/454 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV++MTE+IPGLQGD+P +  +G P+V   K KVAACAKHYV 
Sbjct  193   RDPRWGRCYESYSEDHKIVQAMTELIPGLQGDMPPSAQKGAPFVSTAKGKVAACAKHYVG  252

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG++ENNTV D +GL+SIHMP Y  SI+KGV+TVM SYSS NG KMHAN+ L++ 
Sbjct  253   DGGTTKGINENNTVIDLNGLLSIHMPAYFDSILKGVATVMVSYSSWNGKKMHANQELVSG  312

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  LRFRGFVISDW GIDR+T    +NY+YSV   ++AGIDM+MVP N++ FI     
Sbjct  313   FLKNKLRFRGFVISDWEGIDRLTSPPKANYSYSVQAGVSAGIDMIMVPYNFTEFIDDLTY  372

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRIDDAV RILRVKF MGLFE P AD SL + LG + HR+LAREAVRKSLV
Sbjct  373   QVKNNIIPMSRIDDAVRRILRVKFVMGLFEEPLADLSLVNELGKKEHRELAREAVRKSLV  432

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSG  580
             LLKNGK   +P LPLPK A +ILVAG+HA+NLG QCGGWTITW+GL G  +T GTTIL+ 
Sbjct  433   LLKNGKSADKPSLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGLGGNDLTVGTTILNA  492

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             + +AVDP TQ+VYNE+ +  F+KSN   YA+VVVGE PY+E FGD LNLTI   G  TI 
Sbjct  493   VKSAVDPTTQVVYNENPDANFVKSNKVDYAVVVVGEPPYAETFGDSLNLTISEPGPSTIA  552

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGV DVLFGDY FTGKL+ 
Sbjct  553   NVCGA-VKCVVVVISGRPVVIQPYLAKVDALVAAWLPGTEGQGVTDVLFGDYGFTGKLAH  611

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             TWFKTVDQLPMNVGD+HYDPLFPFGFGLTTK ++
Sbjct  612   TWFKTVDQLPMNVGDQHYDPLFPFGFGLTTKPTK  645



>ref|XP_010088029.1| Periplasmic beta-glucosidase [Morus notabilis]
 gb|EXB31248.1| Periplasmic beta-glucosidase [Morus notabilis]
Length=653

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/450 (69%), Positives = 361/450 (80%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED +IV+ MTE+IPGLQGD+P N   G P+V G+ KVAACAKHYV D
Sbjct  185   RDPRWGRCYESFSEDTKIVQEMTEMIPGLQGDIPANSPTGFPFVAGEKKVAACAKHYVGD  244

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G DE +TV    GL SIHMPP+  SI KGV T+M SYSS NG KMH +R L+TD+
Sbjct  245   GGTTNGTDEGDTVISKEGLFSIHMPPFHDSIKKGVMTIMVSYSSWNGKKMHTHRELITDY  304

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISD  GIDRIT    +NY+YS+  SINAG+DM+M+P  Y  FI      
Sbjct  305   LKNTLQFKGFVISDCEGIDRITSPPRANYSYSIQASINAGLDMIMLPQKYMEFIDGLTLE  364

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAVTRILRVKF MGLFE PFAD+S  H LG + HR+LAREAVRKSLVL
Sbjct  365   VKNKIIPMSRIDDAVTRILRVKFLMGLFEKPFADFSQVHELGKKEHRELAREAVRKSLVL  424

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG+ + +PLLPLPK   +ILVAG+HA+NLGYQCGGWTI W GL G  +T G+TILS I
Sbjct  425   LKNGEADNKPLLPLPKKTPKILVAGSHAHNLGYQCGGWTIGWNGLGGNDLTTGSTILSAI  484

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVDP+T++VYNE  +  F+ SN+F+YAIVVVGE PY+E  GD+ NLT+P  G DTI N
Sbjct  485   KDAVDPSTEVVYNEKPDANFVASNEFSYAIVVVGEYPYAETVGDNKNLTLPYPGPDTITN  544

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVVL++GRPLV++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL RT
Sbjct  545   VCGA-VKCVVVLITGRPLVIQPYLSQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRT  603

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD HYDPLFPFGFGLTTK
Sbjct  604   WFKTVDQLPMNAGDLHYDPLFPFGFGLTTK  633



>ref|XP_006388312.1| hypothetical protein POPTR_0231s00220g [Populus trichocarpa]
 gb|ERP47226.1| hypothetical protein POPTR_0231s00220g [Populus trichocarpa]
Length=620

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/450 (71%), Positives = 366/450 (81%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESY+E+ ++V+ MTEIIPGLQGDVP +  +GVP VGGK KVAACAKH+V+D
Sbjct  167   RDPRWGRCYESYNENPKVVEMMTEIIPGLQGDVPPDSRKGVPCVGGKDKVAACAKHFVSD  226

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++EN TV  +HGLMSIHMP Y  SIIKGVSTVM SYSS NG KMHANR+L+   
Sbjct  227   GGTTKGINENITVIGYHGLMSIHMPGYFHSIIKGVSTVMVSYSSWNGQKMHANRYLVKTV  286

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    SNYT SVL+ I+AGIDM+MVP N++ FI+    L
Sbjct  287   LKDILKFRGFVISDWEGIDRITYPPHSNYTESVLKGISAGIDMIMVPYNHTEFINIVTDL  346

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N +I M RIDDAV RIL+VK T+GLFE P AD +L   LG QAHRDLAREAVRKSLVL
Sbjct  347   VNNNYISMDRIDDAVRRILQVKLTLGLFETPLADETLVDQLGSQAHRDLAREAVRKSLVL  406

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   P+LPLPK ASRILVAG+HANNLGYQCGGWT TW+G+ G   TAGTTILSGI
Sbjct  407   LKNGENADAPVLPLPKKASRILVAGSHANNLGYQCGGWTATWQGVDGNNYTAGTTILSGI  466

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVDP+T+IVYN + + +F+KSN+F+Y IVVVGE PY+E  GD LNLTI   G  TI N
Sbjct  467   SAAVDPSTEIVYNNNPDADFIKSNNFSYDIVVVGETPYAETAGDSLNLTIAEPGPSTILN  526

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV VSGRP+V+EP+   +DALVA WLPG+EGQGVADVLF DY FTGKL RT
Sbjct  527   VC-GNVKCVVVTVSGRPVVIEPYESQIDALVATWLPGTEGQGVADVLFRDYGFTGKLPRT  585

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFP+ FGLTTK
Sbjct  586   WFKTVDQLPMNVGDSHYDPLFPYDFGLTTK  615



>ref|XP_002514453.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF47949.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=648

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/452 (69%), Positives = 362/452 (80%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+ MTEI+ GLQGD+P    +GVPYVGGK KVAACAKH+V D
Sbjct  173   RDPRWGRCYESYSEDHNVVEEMTEIVLGLQGDIPAKSRKGVPYVGGKKKVAACAKHFVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D HGL+S+HMP Y  SIIKGVST+M SYSS NG KMH NR L+T F
Sbjct  233   GGTTKGINENNTVIDMHGLLSMHMPAYSDSIIKGVSTIMVSYSSWNGEKMHGNRELITGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    +NY+YSV  +I AGIDMVMVP NY+ F    + L
Sbjct  293   LKDTLKFKGFVISDWQGIDRITSPPHANYSYSVQAAIQAGIDMVMVPFNYTEFSDDLIYL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPM RIDDAV RIL VKF+MGLFENP AD SL + LG Q HRDLAREAVRKSLVL
Sbjct  353   VKNKVIPMDRIDDAVGRILLVKFSMGLFENPLADLSLVNELGSQEHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+   PLLPLPK AS++LVAGTHA+NLGYQCGGWTI W+G +G   T GTTIL+ I
Sbjct  413   LKNGKNGTDPLLPLPKKASKVLVAGTHADNLGYQCGGWTIEWQGFNGNNYTRGTTILAAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +A+DP T++V+ E+ +  F+KSN F YAIVVVGE PY+E  GD L+LT+   G   I N
Sbjct  473   KSAIDPDTEVVFQENPDSSFVKSNKFDYAIVVVGEPPYAETAGDSLDLTMMDPGPTVISN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVV++VSGRPLV+EP++ SMDALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  533   VCET-VKCVVIIVSGRPLVIEPYVFSMDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFK V+QLPMN+GD HYDPLFPF FG+ TK +
Sbjct  592   WFKNVEQLPMNIGDSHYDPLFPFDFGIRTKSA  623



>ref|XP_006445670.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
 gb|ESR58910.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
Length=563

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/450 (69%), Positives = 361/450 (80%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT++I GLQGD P+N  +GVPYVGGK KVAACAKH+V D
Sbjct  80    RDPRWGRCYESYSEDHKIVQEMTDVILGLQGDPPSNLRKGVPYVGGKDKVAACAKHFVGD  139

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS NG KMHANR L+T F
Sbjct  140   GGTTNGINENNTVIDMHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELVTGF  199

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    SNYTYSV   I AGIDMVM+P N + FI     L
Sbjct  200   LKGTLKFKGFVISDWQGIDRITSPPHSNYTYSVQAGIQAGIDMVMIPFNLTEFIDDLTDL  259

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  I M RIDDAV RIL VKF+MGLFENP AD SL + LG QAHRDLAREAVRKSLVL
Sbjct  260   VKNNVITMDRIDDAVGRILLVKFSMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVL  319

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+E  PL+PLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTIL  I
Sbjct  320   LKNGKNESHPLIPLPKKAPKILVAGSHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAI  379

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD +T++VY ++ + +F+KSN+F YAIV VGE PY+E  GD + LT+       I N
Sbjct  380   RSAVDSSTEVVYRDNPDSDFVKSNNFDYAIVAVGEAPYAESAGDSMTLTMLDPDPSVITN  439

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRP+V+EP++ S+DALVAAWLPG+EGQGV DVLFGDY F+GKL R+
Sbjct  440   VCEA-VKCVVIIISGRPIVIEPYISSVDALVAAWLPGTEGQGVTDVLFGDYGFSGKLPRS  498

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPF FGL T+
Sbjct  499   WFKTVDQLPMNVGDPHYDPLFPFDFGLKTE  528



>ref|XP_009395659.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395660.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395661.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=624

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/448 (71%), Positives = 375/448 (84%), Gaps = 1/448 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++MT+II GLQGD+P N+++  PYV GK  VAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHRVVQAMTQIILGLQGDIPANYTKNFPYVSGKKHVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D+HGL+SIHMP Y  S+ KGVST+MASYSS NG+KMHANR+L+TDF
Sbjct  235   GGTQKGINENNTIIDFHGLLSIHMPAYYDSVAKGVSTIMASYSSWNGIKMHANRYLITDF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW GIDRIT   D+NYTYSV  S+NAGIDMVMVP++Y  F +T  +L
Sbjct  295   LKKKLGFKGFVISDWQGIDRITTPPDANYTYSVQVSVNAGIDMVMVPDDYPGFFNTLTTL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V  + IPMSRIDDAV RILRVKF MGLF+NP ADY+L   LG + HR+LAREAVRKSLVL
Sbjct  355   VNAKVIPMSRIDDAVRRILRVKFVMGLFDNPLADYNLVDQLGKKEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK  K+PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG IT GTTIL  I 
Sbjct  415   LKNGKSSKKPLLPLPKKAGKILVAGSHADNLGYQCGGWTIEWQGSSGRITGGTTILEAIK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + VDP+T + ++E+ +  F+KSN+F+YAIVVVGE PYSE  GD LNLTIP  G  TI++V
Sbjct  475   STVDPSTNVAFSENPDAGFVKSNNFSYAIVVVGEPPYSETAGDSLNLTIPEPGPSTIQSV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A VKCVVV++SGRP+V+E ++P MDALVAAWLPGSEGQGVADVLFGD+ FTGKL RTW
Sbjct  535   CGA-VKCVVVIISGRPVVVESYVPLMDALVAAWLPGSEGQGVADVLFGDFGFTGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             FK+VDQLPMNVGD++YDPLFPFGFGLTT
Sbjct  594   FKSVDQLPMNVGDKNYDPLFPFGFGLTT  621



>ref|XP_006347719.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
tuberosum]
Length=662

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 365/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++PN   +G+PY+ GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKIVQEMTDIIIGLQGEIPNGSRKGIPYIAGKKKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVTD H L+SIHMP Y  SIIKGV+TVMASYSS NG KMHA+  L+T F
Sbjct  236   GGTTKGVNENNTVTDKHELLSIHMPAYDDSIIKGVATVMASYSSWNGRKMHADHDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDR+T    +NYTYSV  SI AG+DMVMVP N++ FI+    L
Sbjct  296   LKGTLKFKGFVISDWQGIDRLTSPPHANYTYSVETSILAGVDMVMVPYNFTEFINDLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIP  RIDDAV RIL VKFTMGLFENP+ D+SL + +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNFIPTDRIDDAVERILSVKFTMGLFENPYTDFSLINEVGSQEHRNLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK    PLLPLPK  SRILVAG HA+NLGYQCGGWTITW+G SG   T+GTTIL  I
Sbjct  416   LKNGKTANNPLLPLPKKVSRILVAGGHADNLGYQCGGWTITWQGFSGNDATSGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVDP T+++Y E+ + ++  S+ F YAIVVVGE PY+E  GD   LT+   G D I N
Sbjct  476   KSAVDPGTEVIYFENPDSKYATSSRFDYAIVVVGEHPYAESAGDSPTLTVADPGPDVINN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRPLVLEP LPS+DALVAAWLPG+EGQG+ D+LFGDY FTGKL RT
Sbjct  536   VCQS-VKCVVIVISGRPLVLEPFLPSIDALVAAWLPGTEGQGITDLLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WF+TVDQLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  595   WFRTVDQLPMNVGDPHYDPLFPFGFGLTTSKS  626



>ref|XP_004301060.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=496

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 370/454 (81%), Gaps = 3/454 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV++MT+IIPGLQGD+P N  +GVP+V  G  KVAACAKHYV 
Sbjct  42    RDPRWGRCYESYSEDHKIVQAMTQIIPGLQGDMPPNSRKGVPFVAPGNKKVAACAKHYVG  101

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG++ENNTV D HG +SIHMP Y  SII+GV+T+M SYSS NGVKMHANR ++T 
Sbjct  102   DGGTTKGINENNTVIDRHGFLSIHMPAYYNSIIEGVATIMVSYSSWNGVKMHANRDMVTG  161

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  LRFRGFVISDW GIDRIT    +NY+YS+   INAGIDM+MVPNNY+ FI     
Sbjct  162   FLKNTLRFRGFVISDWEGIDRITSPPHANYSYSITAGINAGIDMIMVPNNYTEFIDGLTF  221

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN+ IPMSRIDDAV RILRVKFTMGLFEN  AD SL + LG Q HRDLAREAVR+SLV
Sbjct  222   QVKNKIIPMSRIDDAVRRILRVKFTMGLFENRLADLSLVNQLGSQEHRDLAREAVRRSLV  281

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSG  580
             LL NG+   +PLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G+SG  +T GTTIL+G
Sbjct  282   LLTNGESADEPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGMSGNNLTHGTTILTG  341

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             I N VDP T++VY E+ + E++KSN F+YAIVVVGE PY+E FGD LNLT+P AGL TI 
Sbjct  342   IKNTVDPETKVVYKENPDAEYVKSNGFSYAIVVVGEPPYAETFGDSLNLTLPDAGLKTIT  401

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC A    VVV+     +V++P++  +DALVAAWLPGSEGQGVADVLFGDY FTGKLSR
Sbjct  402   NVCGAVKCVVVVVSGRP-VVMQPYVSLLDALVAAWLPGSEGQGVADVLFGDYGFTGKLSR  460

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  ++
Sbjct  461   TWFKTVDQLPMNVGDPHYDPLFPFGFGLTTAPTK  494



>ref|XP_006445671.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
 ref|XP_006485522.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
 gb|ESR58911.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
Length=659

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/450 (69%), Positives = 361/450 (80%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT++I GLQGD P+N  +GVPYVGGK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDHKIVQEMTDVILGLQGDPPSNLRKGVPYVGGKDKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSS NG KMHANR L+T F
Sbjct  236   GGTTNGINENNTVIDMHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    SNYTYSV   I AGIDMVM+P N + FI     L
Sbjct  296   LKGTLKFKGFVISDWQGIDRITSPPHSNYTYSVQAGIQAGIDMVMIPFNLTEFIDDLTDL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  I M RIDDAV RIL VKF+MGLFENP AD SL + LG QAHRDLAREAVRKSLVL
Sbjct  356   VKNNVITMDRIDDAVGRILLVKFSMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+E  PL+PLPK A +ILVAG+HA+NLGYQCGGWTI W+G SG   T GTTIL  I
Sbjct  416   LKNGKNESHPLIPLPKKAPKILVAGSHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD +T++VY ++ + +F+KSN+F YAIV VGE PY+E  GD + LT+       I N
Sbjct  476   RSAVDSSTEVVYRDNPDSDFVKSNNFDYAIVAVGEAPYAESAGDSMTLTMLDPDPSVITN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVV+++SGRP+V+EP++ S+DALVAAWLPG+EGQGV DVLFGDY F+GKL R+
Sbjct  536   VCEA-VKCVVIIISGRPIVIEPYISSVDALVAAWLPGTEGQGVTDVLFGDYGFSGKLPRS  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFPF FGL T+
Sbjct  595   WFKTVDQLPMNVGDPHYDPLFPFDFGLKTE  624



>ref|XP_009799725.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009799726.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=661

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/452 (69%), Positives = 364/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++P    +G+PYV GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKIVQEMTDIIIGLQGEIPYESRKGIPYVAGKNKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVT+ H L+SIHMP Y  +IIKGV+TVMASYSS NG KMHAN  L+T F
Sbjct  236   GGTTKGINENNTVTNMHELLSIHMPAYDDAIIKGVATVMASYSSWNGQKMHANHDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    +NYTYSV  SI AGIDMVMVP N++ FI+    L
Sbjct  296   LKGTLKFKGFVISDWEGIDRITSPPHANYTYSVESSILAGIDMVMVPYNFTEFINDLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPM+RIDDAV RIL VKFTMGLFENP+ D+SL   +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNFIPMARIDDAVERILLVKFTMGLFENPYTDFSLIKEVGSQEHRNLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK    PLLPLPK  S+ILVAG+HA+NLG+QCGGWTI W+G SG   T GTTIL  I
Sbjct  416   LKNGKTANDPLLPLPKKVSKILVAGSHADNLGFQCGGWTIAWQGFSGNDDTGGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVDP T++ Y E+ + ++  S  F YAIVVVGE+PY+E  GD   LTI  +G D I +
Sbjct  476   KSAVDPGTEVTYVENPDSKYASSGGFDYAIVVVGERPYAETAGDSPTLTIADSGPDVINH  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRPLV+EP+LPS+DALVAAWLPGSEGQG+ D+LFGDY FTGKL RT
Sbjct  536   VCPS-VKCVVIIISGRPLVIEPYLPSIDALVAAWLPGSEGQGITDILFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFKTVDQLPMNVGD HYDPLFPFGFGL T  S
Sbjct  595   WFKTVDQLPMNVGDPHYDPLFPFGFGLNTSKS  626



>ref|XP_004135054.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN52155.1| hypothetical protein Csa_5G612840 [Cucumis sativus]
Length=658

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 366/449 (82%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEII GLQG+ P N+ +G PYVGG  KV ACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV + HGL+SIHMP Y  SIIKGVS+VMASYSS NGVKMHANR L+TDF
Sbjct  237   GGTTHGINENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    SNYTYSV  SI AGIDMVM+P  Y+ FI     L
Sbjct  297   LKGALKFKGFVISDWEGLDRITSTPHSNYTYSVQASILAGIDMVMIPYKYAEFIDDVKFL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPM RIDDAV RIL VKFTMGLFE+P  DYSL + LG QAHRDLAR+AVR+SLVL
Sbjct  357   VKNNAIPMDRIDDAVRRILTVKFTMGLFESPMGDYSLVNELGSQAHRDLARDAVRQSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK++ +PLLPL K + +ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL+ I
Sbjct  417   LKNGKNDSKPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNATRGTTILASI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E  + +F+KS+DF+YAIVV+GE PY+E  GD   LT+   G  TIKN
Sbjct  477   KSTVDPSTEVVFREDPDSDFVKSSDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPSTIKN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   V+CVV+++SGRP+V+EP++ S+DALVAAWLPG+EGQGV D L+GD+ F+GKL RT
Sbjct  537   VCDY-VECVVIVISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  596   WFKSVDQLPMNVGDPHYDPLFPFGFGLTT  624



>ref|XP_002278363.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
 ref|XP_010651642.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
 ref|XP_010651643.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=628

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/454 (70%), Positives = 369/454 (81%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEIIPGLQGD+P    +GVP+VGGKTKVAACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDHKIVQAMTEIIPGLQGDLPAGSKKGVPFVGGKTKVAACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT+ D++GL++IHMP Y  SI KGV+TVM SYSS NG KMHAN  L+  F
Sbjct  235   GGTTKGINENNTIIDFNGLLNIHMPAYRNSISKGVATVMVSYSSWNGKKMHANHDLIIGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT    +NY+YSV   + AGIDMVMVP N++ F+      
Sbjct  295   LKNKLRFRGFVISDWQGIDRITSPPHANYSYSVEAGVGAGIDMVMVPYNFTEFLDDLTFQ  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPM+RIDDAV RILRVKF MGLFENP AD SL + LG Q HR+LAREAVRKSLVL
Sbjct  355   VKNGIIPMARIDDAVKRILRVKFVMGLFENPMADLSLVNQLGSQEHRELAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  K PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+GL G  +T+GTTIL+ +
Sbjct  415   LKNGKSAKNPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGLGGNDLTSGTTILTAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N V+  TQIVYNE+ + E++KSN F+YAIVVVGE PY+E  GD ++LTI   G  TI N
Sbjct  475   KNTVESGTQIVYNENPDLEYVKSNKFSYAIVVVGEPPYAETAGDSMSLTIAEPGASTISN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VCAA    VV+ VSGRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  535   VCAAVKCVVVI-VSGRPVVIQPYLAKIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTV+QLPMNVGD HYDPLFPFGFGLTTK ++ 
Sbjct  594   WFKTVEQLPMNVGDPHYDPLFPFGFGLTTKPTKQ  627



>ref|XP_010553801.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=643

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/450 (68%), Positives = 364/450 (81%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ MTEIIPGLQG++P+N   G P++  KTKV ACAKHYV D
Sbjct  179   RDPRWGRCYESYSEDPRIVEEMTEIIPGLQGELPSNLPPGTPFMADKTKVVACAKHYVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G++ENNT+ D  GL+ IHMP Y  ++ KGVSTVMASYSS NG+KMHAN  L+T F
Sbjct  239   GGTVRGINENNTIIDKKGLLDIHMPGYHRALAKGVSTVMASYSSWNGLKMHANYDLITSF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRF+GFVISDW GIDRIT    +NYTYS+ E+INAGIDMVM+P NY+ FI     L
Sbjct  299   LKKKLRFQGFVISDWEGIDRITYPPHANYTYSIQEAINAGIDMVMIPYNYTEFIDILNFL  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+ +IPMSRIDDAVTRILRVKFTMGLFE PFAD S  H LGCQ HR+LAREAVRKSLVL
Sbjct  359   VKHEYIPMSRIDDAVTRILRVKFTMGLFEEPFADTSFVHKLGCQDHRELAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+    PLLPLPK A +ILVAG+HA+NLGYQCGGWTITW+G +G   T GTTIL  +
Sbjct  419   LKNGESADTPLLPLPKKARKILVAGSHADNLGYQCGGWTITWQGHNGNNFTEGTTILKAV  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T+++Y+E+ + +F+KSN+F++AIVVVGE PY+E  GD  +LTI   G  TI N
Sbjct  479   KNTVDPETRVIYSENPSADFVKSNEFSHAIVVVGEHPYAESDGDSTSLTIADPGPRTIMN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   +KCVV+++SGRP+VL+P++ +MD++VAAWLPGSEGQG+ADVLFGDY F GK  RT
Sbjct  539   VCGV-MKCVVIVISGRPVVLQPYISTMDSVVAAWLPGSEGQGIADVLFGDYGFKGKSPRT  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK VDQLPMN+GD HYDPLFPFG GLTT+
Sbjct  598   WFKNVDQLPMNIGDSHYDPLFPFGHGLTTE  627



>ref|XP_009595457.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=630

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 362/452 (80%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++PN   +G+PYV GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKIVQEMTDIIIGLQGEIPNESRKGIPYVAGKNKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVT+ H L+SIHMP Y  SIIKGV+TVMASYSS NG KMHAN  L+T F
Sbjct  236   GGTTKGINENNTVTNMHELLSIHMPAYDDSIIKGVATVMASYSSWNGQKMHANHELVTTF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    +NYTYSV  SI AGIDMVMVP N++ FI+    L
Sbjct  296   LKGTLKFKGFVISDWEGIDRITSPPHANYTYSVESSILAGIDMVMVPYNFTEFINDLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPM+RIDDAV RIL VKFTMGLFENP+ D+SL   +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNFIPMARIDDAVERILLVKFTMGLFENPYTDFSLIKEVGSQEHRNLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK     LLPLPK AS+ILVAG+HA+NLG+QCGGWTI W+G SG   T GTTIL  I
Sbjct  416   LKNGKTANDSLLPLPKKASKILVAGSHADNLGFQCGGWTIAWQGFSGNDDTGGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD  T++ Y E+ + ++  S  F YAIVVVGE PY+E  GD   LTI   G D I +
Sbjct  476   KSAVDAGTEVTYVENPDSKYASSGGFDYAIVVVGEHPYAETAGDSPTLTIADPGPDVINH  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRPLV+EP+LPS+DALVAAWLPGSEGQG+ D+LFGDY FTGKL RT
Sbjct  536   VCPS-VKCVVIIISGRPLVIEPYLPSIDALVAAWLPGSEGQGITDLLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFKTVDQLPMNVGD HYDPLFPFGFGL T  S
Sbjct  595   WFKTVDQLPMNVGDPHYDPLFPFGFGLNTSKS  626



>ref|XP_002456420.1| hypothetical protein SORBIDRAFT_03g035970 [Sorghum bicolor]
 gb|EES01540.1| hypothetical protein SORBIDRAFT_03g035970 [Sorghum bicolor]
Length=675

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/451 (69%), Positives = 363/451 (80%), Gaps = 1/451 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MT+II GLQG++P N ++GVPYV GK KVAACAKHYV D
Sbjct  194   RDPRWGRCYESYSEDHKVVQQMTDIILGLQGEIPVNHTKGVPYVAGKDKVAACAKHYVGD  253

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+SIHMPPY  SIIKGV+TVM SYSS+NGVKMHAN HL+T +
Sbjct  254   GGTHNGINENNTIIDEHGLLSIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHHLITGY  313

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDWLG+DRIT    +NYTYSV   INAGIDMVMVP NY+ +I+   SL
Sbjct  314   LKSKLHFRGFVISDWLGVDRITSPPGANYTYSVQAGINAGIDMVMVPYNYTDYINDLTSL  373

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    I MSRIDDAV RILRVKFTMGLFENP AD S A  LG + HR+LAREAVRKSLVL
Sbjct  374   VHKGVINMSRIDDAVRRILRVKFTMGLFENPLADLSFAEQLGKKEHRELAREAVRKSLVL  433

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG   +Q  LPLPK A  ILVAG+HA+NLGYQCGGW+I W G SG IT GTTIL  I 
Sbjct  434   LKNGNPPEQQFLPLPKRARSILVAGSHASNLGYQCGGWSIKWMGGSGDITTGTTILGAIK  493

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V  +T +VY+E+ +  FMK NDF++AI++VGE PY+E  GD  +LT+   G DTI+ V
Sbjct  494   STVADSTSVVYSENPDDSFMKHNDFSFAIIIVGEPPYAETVGDSTDLTMLDPGPDTIRTV  553

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+A VKC VV++SGRP+V+EP++P M+ALVAAWLPG+EGQGVADVLFGDY FTGKL +TW
Sbjct  554   CSA-VKCAVVIISGRPIVIEPYVPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPQTW  612

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             FK+VDQLPMNVGD HYDPL+PFGFGLT   S
Sbjct  613   FKSVDQLPMNVGDPHYDPLYPFGFGLTINSS  643



>ref|XP_008446717.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Cucumis melo]
Length=658

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 367/449 (82%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEII GLQG+ P N+ +G PYVGG  KV ACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV + HGL+SIHMP Y  SIIKGVS+VMASYSS NGVKMHANR L+TDF
Sbjct  237   GGTTHGINENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    SNYTYSV  +I AGIDMVM+P  Y+ FI     L
Sbjct  297   LKGALKFKGFVISDWEGLDRITSTPHSNYTYSVQAAILAGIDMVMIPYKYAEFIDDLKFL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFE+P ADYSL + LG QAHRDLAR+AVR+SLVL
Sbjct  357   VKSNVIPMDRIDDAVGRILTVKFTMGLFESPMADYSLVNELGSQAHRDLARDAVRQSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK++ +PLLPL K + +ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL+ I
Sbjct  417   LKNGKNDSKPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNGTRGTTILAAI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E  + +F+KSNDF+YAIVV+GE PY+E  GD   LT+   G + IKN
Sbjct  477   KSTVDPSTEVVFREDPDSDFVKSNDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPNIIKN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   V+CVV+L+SGRP+V+EP++ S+DALVAAWLPG+EGQGV D L+GD+ F+GKL RT
Sbjct  537   VCDH-VECVVILISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  596   WFKSVDQLPMNVGDPHYDPLFPFGFGLTT  624



>ref|XP_004970125.1| PREDICTED: lysosomal beta glucosidase-like [Setaria italica]
Length=669

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/451 (69%), Positives = 360/451 (80%), Gaps = 1/451 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+ MT+II GLQG++P N ++GVPYV GK KVAACAKH+V D
Sbjct  174   RDPRWGRCYESYSEDHTVVQQMTDIILGLQGEIPVNHTKGVPYVAGKDKVAACAKHFVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D HGL+SIHMPPY  SIIKGV+T+M SYSS+NGVKMHAN  L+T +
Sbjct  234   GGTHNGINENNTIIDEHGLLSIHMPPYYDSIIKGVATIMVSYSSLNGVKMHANHDLVTGY  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDWLGIDRIT     NYTYSV   INAGIDMVMVP NY+ +I    SL
Sbjct  294   LKSKLHFRGFVISDWLGIDRITSPPGENYTYSVQAGINAGIDMVMVPYNYTDYIDDLTSL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    + M+RIDDAV RILRVKFTMGLFENP AD S A  LG + HR+LAREAVRKSLVL
Sbjct  354   VHKGIVNMNRIDDAVRRILRVKFTMGLFENPLADLSFADQLGKKEHRELAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNG    Q  LPLPK A RILVAG+HA+NLGYQCGGW+I W G SG IT GTTIL  I 
Sbjct  414   LKNGNPPNQQFLPLPKKARRILVAGSHASNLGYQCGGWSIQWMGSSGDITTGTTILDAIK  473

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             + V  +T +VY+E+ ++ FMK NDF++AIVVVGE PYSE  GD  +LTI   G DTI+ V
Sbjct  474   STVADSTPVVYSENPDESFMKHNDFSFAIVVVGEPPYSETVGDSTDLTILDPGPDTIRTV  533

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C+A VKCVVV+VSGRP+V+EP++P M+ALVAAWLPG+EGQGVADVLFGDY FTGKL RTW
Sbjct  534   CSA-VKCVVVIVSGRPVVIEPYVPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTW  592

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             FK+VDQLPMNVGD HYDPL+PFGFGL    S
Sbjct  593   FKSVDQLPMNVGDPHYDPLYPFGFGLAINSS  623



>ref|XP_011004424.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=614

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/452 (69%), Positives = 365/452 (81%), Gaps = 4/452 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED  IV+ MTEIIPGLQG++P N  +GVP+V  G TKVAACAKH+V 
Sbjct  160   RDPRWGRCYESYSEDHRIVQLMTEIIPGLQGELPANSKKGVPFVAPGNTKVAACAKHFVG  219

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG+DENNTV   +GL++IHMP Y  +I KGV+TVM SYSS NG +MH NR L+T 
Sbjct  220   DGGTTKGIDENNTVISMNGLLNIHMPAYYNAISKGVATVMVSYSSWNGKRMHINRDLVTG  279

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  ++FRGFVISDW GIDR+T    +NY+ SV   ++AGIDM+MVP N++ FI     
Sbjct  280   FLKNKMKFRGFVISDWQGIDRVTSPPHANYSSSVQAGVDAGIDMIMVPFNFTEFIDELTY  339

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRI+DAV RILRVKF MGLFE P AD S+A+ LG Q HR+LAREAVRKSLV
Sbjct  340   QVKNNIIPMSRINDAVQRILRVKFVMGLFEKPLADLSMANQLGSQEHRELAREAVRKSLV  399

Query  756   LLKNGK-DEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILS  583
             LLKNGK    +PLLPLPK A +ILVAG+HA+NLGYQCGGWTITW+GL G  +T GTTIL+
Sbjct  400   LLKNGKYTTAKPLLPLPKKAPKILVAGSHADNLGYQCGGWTITWQGLGGNDLTTGTTILN  459

Query  582   GIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTI  403
              + N VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PY+E +GD  NLTI   G  TI
Sbjct  460   AVKNTVDPTTQVVYNENPDSNFVKSNKFSYAIVVVGEPPYAEMYGDSSNLTISEPGPSTI  519

Query  402   KNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLS  223
              +VC A VKCVVV++SGRP+V++P+L  +DALVAAWLPG+EGQGVAD LFGDY FTGKL+
Sbjct  520   NSVCGA-VKCVVVVISGRPVVIQPYLEKIDALVAAWLPGTEGQGVADNLFGDYGFTGKLA  578

Query  222   RTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             RTWFKTVDQLPMNVGD HYDPLFPFGFG+TTK
Sbjct  579   RTWFKTVDQLPMNVGDPHYDPLFPFGFGITTK  610



>emb|CDP10537.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/452 (67%), Positives = 363/452 (80%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED ++V++MT+II GLQGDVP ++ +GVPY+ G+  V ACAKHYV D
Sbjct  37    RDPRWGRCFESYSEDPQVVQAMTDIILGLQGDVPPDYPKGVPYISGQNNVLACAKHYVGD  96

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G++E +TV +W  L+ IHMP Y  SIIKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  97    GGTIRGINEYDTVANWDDLLRIHMPAYNDSIIKGVSTVMISYSSWNGVKMHANRDLITGF  156

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F GFVISD  GI ++T  E  N TYS+L  +NAGIDM+M+P NY+ FI     L
Sbjct  157   LKNTLHFEGFVISDSQGIYKMTSPEHVNSTYSILVGVNAGIDMIMIPYNYTEFIDGLTYL  216

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N FI MSRIDDAV RILRVKF MGLFE PF DYS+  YLG Q HR+LAREAVR+SLVL
Sbjct  217   VNNSFISMSRIDDAVRRILRVKFMMGLFEYPFPDYSMIKYLGSQEHRELAREAVRRSLVL  276

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKN + E +PLLPLPK+ASRILVAG+HAN++G QCGGWT++W GLSG  T GTT+L+ I 
Sbjct  277   LKNVRFEDEPLLPLPKHASRILVAGSHANDIGNQCGGWTVSWHGLSGNTTIGTTVLTAIR  336

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N + P T++++ E+    F+KS+ F+YAIVVVGE PYSE +GD LNLTIP  G  TI+NV
Sbjct  337   NTIHPKTEVIFEENPGSAFVKSSKFSYAIVVVGEVPYSETYGDSLNLTIPEPGPSTIRNV  396

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C + VKCVVVL++GRP+V++P+L  +DALVAAWLPG+EGQGVADVLFGDY F+GKL RTW
Sbjct  397   CGS-VKCVVVLITGRPVVIQPYLDQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPRTW  455

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FKTVDQLPMNVGD HYDPLFPFGFGLTTK S 
Sbjct  456   FKTVDQLPMNVGDPHYDPLFPFGFGLTTKPSE  487



>gb|KEH23536.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=607

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 366/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPG+QGDVP+N   GVP++ G  KV ACAKHYV D
Sbjct  151   RDPRWGRCYESYSEDPKVVQAMTEIIPGMQGDVPDNMPMGVPFIAGNEKVIACAKHYVGD  210

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE++TV D  GLM IHMP Y  SI KGV+T+M SYSS NG KMHA+  L+T F
Sbjct  211   GGTTNGIDESDTVIDRDGLMEIHMPGYLSSISKGVATIMVSYSSWNGDKMHAHHDLITGF  270

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N TYSV   ++AGIDM MVP  Y+ FI    +L
Sbjct  271   LKNTLHFQGFVISDFEGIDRITSPFRANCTYSVQAGVSAGIDMFMVPKFYTEFIDDLTTL  330

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKF MG+FENPFADYSL  YLG + H++LAREAVRKS+VL
Sbjct  331   VNNKFIPMSRIDDAVRRILRVKFMMGIFENPFADYSLVKYLGIKEHKELAREAVRKSMVL  390

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  ++PLLPLPK   +ILVAG+HANNLGYQCGGWTI W+G++G     GTTIL+ +
Sbjct  391   LKNGKSAEKPLLPLPKKVPKILVAGSHANNLGYQCGGWTIEWQGVNGNDDIKGTTILNAV  450

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T ++Y E+ +KEF++SN+F YAIVVVGE PY+E  GD++NLTIP  G + I N
Sbjct  451   KNTVDPETTVIYKENPDKEFLESNEFCYAIVVVGEHPYAEMHGDNMNLTIPNPGPEIITN  510

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRPLV+EP++  +DA+VA WLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  511   VCGA-MKCVVIIISGRPLVIEPYVGLIDAVVAGWLPGSEGQGVADVLFGDYGFTGKLPRT  569

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDP+FPFGFGLTTK ++
Sbjct  570   WFKSVDQLPMNVGDPHYDPVFPFGFGLTTKPTK  602



>ref|XP_009595456.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=661

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 362/452 (80%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++PN   +G+PYV GK KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDPKIVQEMTDIIIGLQGEIPNESRKGIPYVAGKNKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTVT+ H L+SIHMP Y  SIIKGV+TVMASYSS NG KMHAN  L+T F
Sbjct  236   GGTTKGINENNTVTNMHELLSIHMPAYDDSIIKGVATVMASYSSWNGQKMHANHELVTTF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW GIDRIT    +NYTYSV  SI AGIDMVMVP N++ FI+    L
Sbjct  296   LKGTLKFKGFVISDWEGIDRITSPPHANYTYSVESSILAGIDMVMVPYNFTEFINDLTYL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN FIPM+RIDDAV RIL VKFTMGLFENP+ D+SL   +G Q HR+LAREAVRKSLVL
Sbjct  356   VKNNFIPMARIDDAVERILLVKFTMGLFENPYTDFSLIKEVGSQEHRNLAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK     LLPLPK AS+ILVAG+HA+NLG+QCGGWTI W+G SG   T GTTIL  I
Sbjct  416   LKNGKTANDSLLPLPKKASKILVAGSHADNLGFQCGGWTIAWQGFSGNDDTGGTTILGAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD  T++ Y E+ + ++  S  F YAIVVVGE PY+E  GD   LTI   G D I +
Sbjct  476   KSAVDAGTEVTYVENPDSKYASSGGFDYAIVVVGEHPYAETAGDSPTLTIADPGPDVINH  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVV+++SGRPLV+EP+LPS+DALVAAWLPGSEGQG+ D+LFGDY FTGKL RT
Sbjct  536   VCPS-VKCVVIIISGRPLVIEPYLPSIDALVAAWLPGSEGQGITDLLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WFKTVDQLPMNVGD HYDPLFPFGFGL T  S
Sbjct  595   WFKTVDQLPMNVGDPHYDPLFPFGFGLNTSKS  626



>ref|XP_008385616.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=633

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/449 (70%), Positives = 358/449 (80%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ MT+II GLQG+ P    +GVPYVGGK KVAACAKH+V D
Sbjct  179   RDPRWGRCYESYSEDPAIVEQMTDIILGLQGEPPAGLRKGVPYVGGKDKVAACAKHFVGD  238

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTV D HGL+SIHMP Y  SIIKGVST+M SYSSVNG KMHAN   +T F
Sbjct  239   GGTVKGINENNTVIDRHGLLSIHMPGYYHSIIKGVSTIMVSYSSVNGKKMHANHEXVTKF  298

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+FRGFVISDW G+D+IT    S+Y  SVL  I AGIDMVMVP N++ FI    + 
Sbjct  299   LKGTLKFRGFVISDWQGVDKITYPPHSDYPNSVLAGIQAGIDMVMVPFNHTEFIDIVTTH  358

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V  + IPMSRIDDAV RILRVKF MGLFENP AD S    LG Q HRDLAREAVRKSLVL
Sbjct  359   VNXKLIPMSRIDDAVKRILRVKFVMGLFENPLADQSFVDKLGSQTHRDLAREAVRKSLVL  418

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   P+LPL K A  ILVAGTHANNLG QCG W++TW+GL+G   TAGTTILS I
Sbjct  419   LKNGENADSPVLPLSKKAKXILVAGTHANNLGXQCGXWSLTWQGLTGNNNTAGTTILSAI  478

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T+I+++E+ + +F+KSN+F+YAIV VGE PY+E  GD LNLTI   G  TI N
Sbjct  479   TAAVDPSTEIMFSENPDADFVKSNNFSYAIVAVGEPPYAETNGDSLNLTIAEPGPSTITN  538

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GVKCVV++VSGRP+V+EP + S+DALVAAWLPG+EG GV+DVLFGDY FTGKL RT
Sbjct  539   VC-GGVKCVVIVVSGRPVVIEPXVSSIDALVAAWLPGTEGXGVSDVLFGDYGFTGKLPRT  597

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNVGD HYDPLFPFGFG TT
Sbjct  598   WFKTVDQLPMNVGDAHYDPLFPFGFGJTT  626



>gb|EYU38726.1| hypothetical protein MIMGU_mgv1a002845mg [Erythranthe guttata]
Length=631

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/449 (71%), Positives = 365/449 (81%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+SMTEIIPGLQGDVP  F +GVPYVGG  KV ACAKHYV D
Sbjct  180   RDPRWGRCYESYSEDPKIVRSMTEIIPGLQGDVPAGFPKGVPYVGGPDKVMACAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTV  WH L+ IHMP Y  S+IKGVSTVMASYSS NGVKMHANR L+T F
Sbjct  240   GGTVKGINENNTVATWHELLGIHMPAYYDSVIKGVSTVMASYSSWNGVKMHANRDLITGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK    FRGFVI+DW  ID++T    +NYTYS+  SINAGID+VMVP NY+ FI     L
Sbjct  300   LKKAQGFRGFVITDWQAIDKMTTPPHANYTYSIEASINAGIDVVMVPYNYTEFIDGLTYL  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N F+ MSRIDDAV RILRVKFTMGLFENP ADYS+A +LG Q +R++AREAVRKSLVL
Sbjct  360   VNNNFVSMSRIDDAVKRILRVKFTMGLFENPMADYSMAKHLGSQENREVAREAVRKSLVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PLLPLPK AS+ILVAGTHA+++G QCGGWTI W G SG  TAGTTILS + 
Sbjct  420   LKNGKAGDKPLLPLPKKASKILVAGTHADDIGNQCGGWTIEWHGKSGNTTAGTTILSAVR  479

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             N VDP T++ + +  + EF+KS  F YA+VVVGE PYSE +GD+LNLT+P  G   IKNV
Sbjct  480   NTVDPETEVSFRQEPDAEFVKSGKFEYAVVVVGEVPYSETYGDNLNLTLPDPGYSIIKNV  539

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C++ VKCVVVLV+GRP+V+EP+L  MDA+VAAWLPGSEGQGVADVLFGDY FTGKL  TW
Sbjct  540   CSS-VKCVVVLVTGRPVVIEPYLAGMDAVVAAWLPGSEGQGVADVLFGDYGFTGKLPITW  598

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK VDQLPMN GD HYDPLFPFG+GLTT+
Sbjct  599   FKNVDQLPMNFGDPHYDPLFPFGYGLTTE  627



>gb|AAC49170.1| beta-D-glucan exohydrolase, isoenzyme ExoII [Hordeum vulgare 
subsp. vulgare]
 prf||2208395A beta-D-glucan exohydrolase
Length=624

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/453 (69%), Positives = 364/453 (80%), Gaps = 3/453 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+SMT +I GLQGDVP   S G PYVGG  KVAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKVVQSMTTLISGLQGDVPAG-SEGRPYVGGSKKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++EN+T+ D HGLM+IHMP Y  SII+GVSTVM SYSS NG KMHAN  L+TDF
Sbjct  233   GGTFMGINENDTIIDAHGLMTIHMPAYYNSIIRGVSTVMTSYSSWNGKKMHANHFLVTDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT     NY+YSV   + AGIDM+MVP  Y+ FI      
Sbjct  293   LKNKLKFRGFVISDWQGIDRITSPPGVNYSYSVEAGVGAGIDMIMVPFAYTEFIDDLTYQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRI+DAV RILRVKFTMGLFE+P+AD SL   LG Q HRDLAREAVRKSLVL
Sbjct  353   VKNNIIPMSRINDAVYRILRVKFTMGLFESPYADPSLVGELGKQEHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK    PLLPLPK A +ILVAG+HA++LG QCGGWTITW+G +G   TAGTTILS I
Sbjct  413   LKNGKSASTPLLPLPKKAGKILVAGSHADDLGNQCGGWTITWQGQTGNDKTAGTTILSAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V++E+ +   + S  + YAIVVVGE PY+E FGD+LNLTIPA G   I+N
Sbjct  473   KSTVDPSTEVVFSENPDSAAVDSGKYDYAIVVVGEPPYAETFGDNLNLTIPAPGPSVIQN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + V+CVVVL+SGRPLV+EP++ +MDA VAAWLPGSEGQGVADVLFGDY F+GKL+RT
Sbjct  533   VCKS-VRCVVVLISGRPLVVEPYISAMDAFVAAWLPGSEGQGVADVLFGDYGFSGKLART  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+ DQLPMNVGD+HYDPLFPFGFGLTT+  +
Sbjct  592   WFKSADQLPMNVGDKHYDPLFPFGFGLTTEAKK  624



>gb|KCW50975.1| hypothetical protein EUGRSUZ_J00604 [Eucalyptus grandis]
Length=626

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/452 (68%), Positives = 365/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+++T IIPGLQG++P    +GVPY+GG  KV ACAKHYV D
Sbjct  173   RDPRWGRCYESYSEDTSVVQALTSIIPGLQGEIPAGGRKGVPYLGGNDKVLACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV DWHGL+SIHMP Y  +II+GVST+M SYSS NGVKMHA+R L+TDF
Sbjct  233   GGTTRGINENNTVIDWHGLLSIHMPGYYKAIIEGVSTIMVSYSSWNGVKMHADRFLVTDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GID+IT     NYTYSV +SI AG+DMVMVP NY+ FI     L
Sbjct  293   LKNTLKFKGFVISDWQGIDKITSPPTVNYTYSVEKSIEAGVDMVMVPYNYTVFIDALTRL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IP+SRIDDAV RILRVKF MGLFENP  D +    LG Q HR+LAREAVRKSLVL
Sbjct  353   VNANVIPVSRIDDAVQRILRVKFMMGLFENPLGDRTYLSQLGSQEHRNLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++ + P+LPL KNAS+ILVAGTHANNLGYQCGGWTITW+G SG  IT+GTTIL  I
Sbjct  413   LKNGQNAEPPVLPLAKNASKILVAGTHANNLGYQCGGWTITWQGQSGNNITSGTTILGAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVD  T++V++++ + +F+KS +F+YAIVVVGE PY+E  GD  NLT+   G + I N
Sbjct  473   SKAVDVDTEVVFSKNPDADFVKSQNFSYAIVVVGELPYAETAGDSTNLTLAVPGENIISN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC++ VKCVV++VSGRPL + P +  +DALVAAWLPGSEG GVADVLFGDY FTGKL RT
Sbjct  533   VCSS-VKCVVIVVSGRPLSIRPLVAHIDALVAAWLPGSEGDGVADVLFGDYGFTGKLPRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WF TVDQLPMNVGD HYDPLFPFGFGLTT+ S
Sbjct  592   WFMTVDQLPMNVGDPHYDPLFPFGFGLTTQPS  623



>ref|XP_010917869.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917870.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917871.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917872.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=629

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/451 (68%), Positives = 363/451 (80%), Gaps = 3/451 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGG-KTKVAACAKHYVA  1297
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG++P N  +GVP+V G K  VAACAKHYV 
Sbjct  175   RDPRWGRCYESYSEDPKIVQEMTEIIPGLQGEIPKNSRKGVPFVTGLKRNVAACAKHYVG  234

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGT KG++ NNT+   HGL+SIHMPPY  +IIKGVSTVM SYSS NGVKMHAN +L+TD
Sbjct  235   DGGTYKGINANNTIISLHGLLSIHMPPYYDAIIKGVSTVMVSYSSWNGVKMHANHYLVTD  294

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  L FRGFVISDW GID IT  + +NY+YS+   ++AGIDMVM+P++Y  FI     
Sbjct  295   FLKNKLHFRGFVISDWQGIDSITTPQHANYSYSIQAGVHAGIDMVMIPHDYPEFIDDLTY  354

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VK+  IPMSRI+DAV RILRVKFTMGLFE P+AD SLA  LG + HR+LAREAVRKSLV
Sbjct  355   QVKHNIIPMSRINDAVRRILRVKFTMGLFEKPYADLSLADELGKKEHRELAREAVRKSLV  414

Query  756   LLKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSG  580
             LLKNGK     LLPLPK A +ILV G+HA+NLGYQCGGWTITW+GLSG  +T GTTIL  
Sbjct  415   LLKNGKSINDTLLPLPKKAKKILVGGSHADNLGYQCGGWTITWQGLSGNNLTTGTTILDA  474

Query  579   IANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIK  400
             +   VDP T++VY+E+ + +F+    F+YAIV VGE+PY+E  GD+L LTIP  G   I+
Sbjct  475   VKATVDPTTEVVYSENPDSDFVNHGHFSYAIVAVGEQPYAEMIGDNLQLTIPDPGPSVIQ  534

Query  399   NVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSR  220
             NVC   +KCVV+++SGRPLV+EP++  +DALVAAWLPG+EGQGVAD+LFGDY F+GKLSR
Sbjct  535   NVCRT-IKCVVIIISGRPLVIEPYMHMIDALVAAWLPGTEGQGVADMLFGDYGFSGKLSR  593

Query  219   TWFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             TWFK VDQLPMNVGD HYDPLFPFGFGLTTK
Sbjct  594   TWFKFVDQLPMNVGDPHYDPLFPFGFGLTTK  624



>ref|XP_003624652.1| Periplasmic beta-glucosidase [Medicago truncatula]
 gb|ABD28427.1| Glycoside hydrolase, family 3, N-terminal; Glycoside hydrolase, 
family 3, C-terminal [Medicago truncatula]
 gb|AES80870.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=632

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 366/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPG+QGDVP+N   GVP++ G  KV ACAKHYV D
Sbjct  176   RDPRWGRCYESYSEDPKVVQAMTEIIPGMQGDVPDNMPMGVPFIAGNEKVIACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE++TV D  GLM IHMP Y  SI KGV+T+M SYSS NG KMHA+  L+T F
Sbjct  236   GGTTNGIDESDTVIDRDGLMEIHMPGYLSSISKGVATIMVSYSSWNGDKMHAHHDLITGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N TYSV   ++AGIDM MVP  Y+ FI    +L
Sbjct  296   LKNTLHFQGFVISDFEGIDRITSPFRANCTYSVQAGVSAGIDMFMVPKFYTEFIDDLTTL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKF MG+FENPFADYSL  YLG + H++LAREAVRKS+VL
Sbjct  356   VNNKFIPMSRIDDAVRRILRVKFMMGIFENPFADYSLVKYLGIKEHKELAREAVRKSMVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  ++PLLPLPK   +ILVAG+HANNLGYQCGGWTI W+G++G     GTTIL+ +
Sbjct  416   LKNGKSAEKPLLPLPKKVPKILVAGSHANNLGYQCGGWTIEWQGVNGNDDIKGTTILNAV  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T ++Y E+ +KEF++SN+F YAIVVVGE PY+E  GD++NLTIP  G + I N
Sbjct  476   KNTVDPETTVIYKENPDKEFLESNEFCYAIVVVGEHPYAEMHGDNMNLTIPNPGPEIITN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRPLV+EP++  +DA+VA WLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  536   VCGA-MKCVVIIISGRPLVIEPYVGLIDAVVAGWLPGSEGQGVADVLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDP+FPFGFGLTTK ++
Sbjct  595   WFKSVDQLPMNVGDPHYDPVFPFGFGLTTKPTK  627



>gb|KHN46759.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 365/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQG++P+N  +GVP++ GK KV ACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKLVQAMTEIIPGLQGEIPDNLPKGVPFITGKEKVLACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV D  GLM IHMP Y  SI KGV+++M SYSS NG KMHAN+ L+T +
Sbjct  235   GGTINGIDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGEKMHANQDLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N+TYS+   ++AGIDM M P  Y  FI     L
Sbjct  295   LKNTLHFKGFVISDFEGIDRITSPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLTML  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPMSRIDDAV RIL VKF MG+FE PFADYSL  YLG Q HR LAREAVRKS+VL
Sbjct  355   VKNKFIPMSRIDDAVRRILWVKFMMGIFETPFADYSLVRYLGIQKHRQLAREAVRKSMVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  415   LKNGESADKPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGVSGNNLLKGTTILAAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T +VY ++ + EF+KSN F+YAIVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  475   KNTVDPDTTVVYKDNPDAEFVKSNGFSYAIVVVGEHPYAEMHGDNMNLTIPDHGPETITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  535   VCGA-IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNV D HYDPLFPFGFGL+TK ++
Sbjct  594   WFKTVDQLPMNVEDPHYDPLFPFGFGLSTKPTK  626



>gb|AAM13694.1| beta-D-glucan exohydrolase [Triticum aestivum]
Length=624

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/453 (69%), Positives = 364/453 (80%), Gaps = 3/453 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+SMT +I GLQGDVP   S G PYVGG  KVAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKVVQSMTTLISGLQGDVPAG-SEGRPYVGGSKKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++EN+T+ D HGLM+IHMP Y  SII+GVSTVM SYSS NG KMHAN  L+TDF
Sbjct  233   GGTFMGINENDTIIDAHGLMTIHMPAYYNSIIRGVSTVMTSYSSWNGKKMHANHFLVTDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT     NY+YSV   + AGIDM+MVP  Y+ FI      
Sbjct  293   LKNKLKFRGFVISDWQGIDRITSPPGVNYSYSVEAGVGAGIDMIMVPYAYTEFIDDLTYQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKFTMGLFE+P+AD SL   LG Q HRDLAREAVRKSLVL
Sbjct  353   VKNNIIPMSRIDDAVYRILRVKFTMGLFESPYADPSLVGELGKQEHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK    PLLPLPK A +ILVAG+HA++LG QCGGWTITW+G +G   TAGTTILS I
Sbjct  413   LKNGKSASSPLLPLPKKAGKILVAGSHADDLGLQCGGWTITWQGQTGNDKTAGTTILSAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V++E+ +   + S  + YAIVVVGE+PY+E FGD+LNLTIPA G   I++
Sbjct  473   KSTVDPSTEVVFSENPDSAAVDSGKYDYAIVVVGEQPYAETFGDNLNLTIPAPGPSVIQS  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +   CVVVL+SGRPLV+EP++ +MDA VAAWLPGSEGQGVAD LFGDY F+GKL+RT
Sbjct  533   VCKS-ANCVVVLISGRPLVVEPYIGAMDAFVAAWLPGSEGQGVADALFGDYGFSGKLART  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD+HYDPLFPFGFGLTT+ ++
Sbjct  592   WFKSVDQLPMNVGDKHYDPLFPFGFGLTTEANK  624



>ref|XP_002523937.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF38424.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=625

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/454 (72%), Positives = 373/454 (82%), Gaps = 5/454 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSE+  +VKSMTEIIPGLQGD PN   +GVPYVGG  KVAACAKH+V D
Sbjct  175   RDPRWGRCFESYSENPSVVKSMTEIIPGLQGDSPN---KGVPYVGGNDKVAACAKHFVGD  231

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV D+HGL+SIHMP Y  S+IKGVSTVM SYSS NG+KMHANR L+T F
Sbjct  232   GGTTKGINENNTVIDYHGLLSIHMPGYLHSVIKGVSTVMVSYSSWNGIKMHANRDLVTGF  291

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NY+YSVL+ ++AGIDMVMVP N++ FI      
Sbjct  292   LKETLNFRGFVISDWQGIDRITSPAHANYSYSVLKGVSAGIDMVMVPFNHTDFIDILTGF  351

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRI+DAV RILRVKF MGLFEN  AD S  H+LG QAHRDLAREAVRKSLVL
Sbjct  352   VKNNVIPMSRINDAVRRILRVKFAMGLFENSLADQSFVHHLGSQAHRDLAREAVRKSLVL  411

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++   PLLPL K A RILVAGTHANNLGYQCGGWT+TW+GL G   T GTTIL+ I
Sbjct  412   LKNGQNADTPLLPLSKKAGRILVAGTHANNLGYQCGGWTLTWQGLGGNNNTVGTTILNAI  471

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVD +T+IVY+E  + +F+K+N+F+YAIVVVGE PY+E FGD LNLTI   G   I N
Sbjct  472   STAVDTSTEIVYSEDPDADFVKANNFSYAIVVVGELPYAETFGDRLNLTIAEPGPTVITN  531

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV+VSGRPLV+EPH+  +DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  532   VCGS-VKCVVVVVSGRPLVIEPHISPIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  590

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFK VDQLPMNVGD HYDPLFP+GFGLTT+ ++ 
Sbjct  591   WFKYVDQLPMNVGDAHYDPLFPYGFGLTTEPTKQ  624



>gb|KHN34681.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 365/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED E+V++MTEIIPGLQGD+PN+  +GVP++ GK KV  CAKHYV D
Sbjct  175   RDPRWGRCYESFSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFITGKEKVIGCAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DE+NTV D  GLM IHMP Y  SI KGV+T+MASYSS NGVKMHA+  L+T F
Sbjct  235   GGTINGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ G+DRIT    +N TYS+   ++AGIDM MVP +Y+ FI     L
Sbjct  295   LKNTLHFKGFVISDFEGLDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTML  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RIL VK  MG+FENPFADYSL  YLG Q HR+LAREAVRKS+VL
Sbjct  355   VKNKHIPMSRIDDAVGRILWVKLMMGIFENPFADYSLVKYLGIQEHRNLAREAVRKSMVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK + +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  415   LKNGESADKPLLPLPKKSPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T +VY E+ + EF+KSN F+YAIV+VGE PY+E +GD +NLTIP  G   I N
Sbjct  475   KNTVDPETTVVYKENPDVEFVKSNGFSYAIVIVGEHPYAEMYGDSMNLTIPEPGPKIITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++  +DALVAAWLPGSEGQGVADVL+G Y FTGKL RT
Sbjct  535   VCGA-IKCVVIIISGRPVVIEPYVGLIDALVAAWLPGSEGQGVADVLYGGYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGL+TK S+
Sbjct  594   WFKTVDQLPMNVGDPHYDPLFPFGFGLSTKPSK  626



>ref|XP_010034246.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
Length=634

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/452 (68%), Positives = 365/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V+++T IIPGLQG++P    +GVPY+GG  KV ACAKHYV D
Sbjct  181   RDPRWGRCYESYSEDTSVVQALTSIIPGLQGEIPAGGRKGVPYLGGNDKVLACAKHYVGD  240

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV DWHGL+SIHMP Y  +II+GVST+M SYSS NGVKMHA+R L+TDF
Sbjct  241   GGTTRGINENNTVIDWHGLLSIHMPGYYKAIIEGVSTIMVSYSSWNGVKMHADRFLVTDF  300

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GID+IT     NYTYSV +SI AG+DMVMVP NY+ FI     L
Sbjct  301   LKNTLKFKGFVISDWQGIDKITSPPTVNYTYSVEKSIEAGVDMVMVPYNYTVFIDALTRL  360

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IP+SRIDDAV RILRVKF MGLFENP  D +    LG Q HR+LAREAVRKSLVL
Sbjct  361   VNANVIPVSRIDDAVQRILRVKFMMGLFENPLGDRTYLSQLGSQEHRNLAREAVRKSLVL  420

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++ + P+LPL KNAS+ILVAGTHANNLGYQCGGWTITW+G SG  IT+GTTIL  I
Sbjct  421   LKNGQNAEPPVLPLAKNASKILVAGTHANNLGYQCGGWTITWQGQSGNNITSGTTILGAI  480

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             + AVD  T++V++++ + +F+KS +F+YAIVVVGE PY+E  GD  NLT+   G + I N
Sbjct  481   SKAVDVDTEVVFSKNPDADFVKSQNFSYAIVVVGELPYAETAGDSTNLTLAVPGENIISN  540

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC++ VKCVV++VSGRPL + P +  +DALVAAWLPGSEG GVADVLFGDY FTGKL RT
Sbjct  541   VCSS-VKCVVIVVSGRPLSIRPLVAHIDALVAAWLPGSEGDGVADVLFGDYGFTGKLPRT  599

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WF TVDQLPMNVGD HYDPLFPFGFGLTT+ S
Sbjct  600   WFMTVDQLPMNVGDPHYDPLFPFGFGLTTQPS  631



>gb|KHG09998.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=686

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/450 (69%), Positives = 361/450 (80%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MT+II GLQGD P+ + +GVPYVGGK KVAACAKH+V D
Sbjct  173   RDPRWGRCYESYSEDHKVVEQMTDIILGLQGDPPSTWRKGVPYVGGKAKVAACAKHFVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+S++MP Y  SIIKGVSTVM SYSS NG KMHANR L++ F
Sbjct  233   GGTTRGINENNTVIDMHGLLSMYMPAYSQSIIKGVSTVMVSYSSWNGQKMHANRELISGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    +NYTYSV  +I AGIDMVMVP N + F+     L
Sbjct  293   LKNTLKFKGFVISDWQGIDRITSPPHANYTYSVQAAIQAGIDMVMVPFNLTEFVDDLTYL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V ++ IPM RIDDAV RIL+VKFTMGLFE P AD+SL + LG QAHRDLAREAVRKSLVL
Sbjct  353   VDSKVIPMDRIDDAVQRILQVKFTMGLFETPMADFSLVNELGSQAHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    PLLPLPK AS+ILVAGTHA+NLGYQCGGWTI W+G +G   T GTTIL  I
Sbjct  413   LKNGKPGSTPLLPLPKKASKILVAGTHADNLGYQCGGWTINWQGFNGNNSTRGTTILGAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VD +T+IV+ ES +  F+KSN F YAIVVVGE PY+E  GD  NLT+   G   I N
Sbjct  473   KSTVDQSTEIVFRESPDANFVKSNKFDYAIVVVGEPPYAETAGDSTNLTMIDPGPSAINN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   VKCVVV++SGRP+V+EP++ ++DALVAAWLPG+EGQGV DVL+GDY F+GKL RT
Sbjct  533   VCGT-VKCVVVIISGRPIVIEPYVSAIDALVAAWLPGTEGQGVTDVLYGDYRFSGKLPRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPLFP GFGL T+
Sbjct  592   WFKTVDQLPMNVGDSHYDPLFPLGFGLKTE  621



>ref|XP_007218946.1| hypothetical protein PRUPE_ppa002559mg [Prunus persica]
 gb|EMJ20145.1| hypothetical protein PRUPE_ppa002559mg [Prunus persica]
Length=658

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/452 (68%), Positives = 365/452 (81%), Gaps = 4/452 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQGD+P N  +GVPYVGG  KVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDHKIVQEMTEIIPGLQGDIPANSRKGVPYVGGNKKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D H L+SIHMP Y  SIIKGV+TVM SYSS NG KMHANR L+T F
Sbjct  237   GGTTRGINENNTVVDRHELLSIHMPAYSDSIIKGVATVMISYSSWNGEKMHANRDLVTGF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    +NY+YSV  SI AG+DM+M+P  Y  FI   +SL
Sbjct  297   LKGTLKFKGFVISDWEGVDRITSPPHANYSYSVQASILAGLDMIMIPFKYIEFIDDLISL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  +PM RIDDAV RIL VKFTMGLFENP AD SL + LG QAHRDLAREAVRKSLVL
Sbjct  357   VKNNVVPMDRIDDAVGRILLVKFTMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVL  416

Query  753   LKNGKD--EKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILS  583
             LKNGK+     P++PLPK  S+ILVAG+HA+NLGYQCGGWT+ W+G SG   T GTTILS
Sbjct  417   LKNGKNGTNPNPVIPLPKKVSKILVAGSHADNLGYQCGGWTMEWQGFSGNNYTRGTTILS  476

Query  582   GIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTI  403
              I + VD +T+I+Y E+ +  F+KSN+FAYAIVVVGE PY+E  GD +NLT+   G   I
Sbjct  477   AIKSTVDSSTEIIYRENPDGNFVKSNNFAYAIVVVGEHPYAETSGDSMNLTMAEPGPSVI  536

Query  402   KNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLS  223
              NVC + VKC+V+++SGRP+V+EP++ S+DALVAAWLPG+EGQG+ DVLFGD+ F+GKL 
Sbjct  537   SNVCES-VKCIVIIISGRPIVIEPYISSIDALVAAWLPGTEGQGITDVLFGDHGFSGKLP  595

Query  222   RTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             RTWF+TVDQLPMN GD HYDPLFP GFG+ T+
Sbjct  596   RTWFRTVDQLPMNFGDTHYDPLFPLGFGIETE  627



>ref|XP_006604246.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_003554030.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=636

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 365/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYES+SED E+V++MTEIIPGLQGD+PN+  +GVP++ GK KV  CAKHYV D
Sbjct  180   RDPRWGRCYESFSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFITGKEKVIGCAKHYVGD  239

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DE+NTV D  GLM IHMP Y  SI KGV+T+MASYSS NGVKMHA+  L+T F
Sbjct  240   GGTINGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGF  299

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ G+DRIT    +N TYS+   ++AGIDM MVP +Y+ FI     L
Sbjct  300   LKNTLHFKGFVISDFEGLDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTML  359

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IPMSRIDDAV RIL VK  MG+FENPFADYSL  YLG Q HR+LAREAVRKS+VL
Sbjct  360   VKNKHIPMSRIDDAVGRILWVKLMMGIFENPFADYSLVKYLGIQEHRNLAREAVRKSMVL  419

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK + +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  420   LKNGESADKPLLPLPKKSPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAV  479

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T +VY E+ + EF+KSN F+YAIV+VGE PY+E +GD +NLTIP  G   I N
Sbjct  480   KNTVDPETTVVYKENPDVEFVKSNGFSYAIVIVGEHPYAEMYGDSMNLTIPEPGPKIITN  539

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++  +DALVAAWLPGSEGQGVADVL+G Y FTGKL RT
Sbjct  540   VCGA-IKCVVIIISGRPVVIEPYVGLIDALVAAWLPGSEGQGVADVLYGGYGFTGKLPRT  598

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGL+TK S+
Sbjct  599   WFKTVDQLPMNVGDPHYDPLFPFGFGLSTKPSK  631



>ref|XP_003548467.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006598970.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_006598971.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
 ref|XP_006598972.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Glycine 
max]
Length=631

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 365/453 (81%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V++MTEIIPGLQG++P+N  +GVP++ GK KV ACAKHYV D
Sbjct  175   RDPRWGRCYESYSEDPKLVQAMTEIIPGLQGEIPDNLPKGVPFITGKEKVLACAKHYVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV D  GLM IHMP Y  SI KGV+++M SYSS NG KMHAN+ L+T +
Sbjct  235   GGTINGIDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGEKMHANQDLITGY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISD+ GIDRIT    +N+TYS+   ++AGIDM M P  Y  FI     L
Sbjct  295   LKNTLHFKGFVISDFEGIDRITSPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLTML  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPMSRIDDAV RIL VKF MG+FE PFADYSL  YLG Q HR LAREAVRKS+VL
Sbjct  355   VKNKFIPMSRIDDAVRRILWVKFMMGIFETPFADYSLVRYLGIQKHRQLAREAVRKSMVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK   +ILVAG+HA+NLGYQCGGWTI W+G+SG  +  GTTIL+ +
Sbjct  415   LKNGESADKPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGVSGNNLLKGTTILAAV  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T +VY ++ + EF+KSN F+YAIVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  475   KNTVDPDTTVVYKDNPDAEFVKSNGFSYAIVVVGEHPYAEMHGDNMNLTIPDHGPETITN  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP++ S+DALVAAWLPGSEGQGVADVLFGDY FTGKL RT
Sbjct  535   VCGA-IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNV D HYDPLFPFGFGL+TK ++
Sbjct  594   WFKTVDQLPMNVEDPHYDPLFPFGFGLSTKPTK  626



>ref|XP_006651822.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=647

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/475 (67%), Positives = 364/475 (77%), Gaps = 25/475 (5%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+S T +I GLQGDVP+N   G PYVGG  KVAACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKVVQSFTTLISGLQGDVPSN-DVGRPYVGGSKKVAACAKHYVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+ D HGLM+IHMPPY  S+I+GVSTVM SYSS NGVKMHAN HL+TDF
Sbjct  233   GGTVKGINENNTIIDTHGLMTIHMPPYYNSVIRGVSTVMVSYSSWNGVKMHANHHLITDF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  LRFRGFVISDW GIDRIT     NY+YS+   I AGIDM+MVP  Y+ FI      
Sbjct  293   LKNKLRFRGFVISDWQGIDRITSPPHKNYSYSIEAGIGAGIDMIMVPYTYTEFIDDLTEQ  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+ IPMSRIDDAV RILRVKFTMGLFE+PF+D SLA+ LG Q HR+LAREAVRKSLVL
Sbjct  353   VNNKIIPMSRIDDAVYRILRVKFTMGLFESPFSDSSLANELGKQEHRELAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    P+LPLPK A +ILVAG+HA++LG QCGGWTITW+G  G  ITAGTTILSGI
Sbjct  413   LKNGKSSYSPVLPLPKKAGKILVAGSHADDLGRQCGGWTITWQGQPGNNITAGTTILSGI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
                VDP+T +VY+E+ +   +  + + YAIVVVGE PY+E FGD+LNLTIP  G   I+ 
Sbjct  473   KATVDPSTTVVYSENPDSSVVAGDKYDYAIVVVGEPPYAEGFGDNLNLTIPEPGPSVIQT  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPH----------------------LPSMDALVAAWLPGS  283
             VC + VKCVVVLVSGRPLV+EP+                      L S DA VAAWLPG+
Sbjct  533   VCGS-VKCVVVLVSGRPLVVEPYIGGMDAFVAAWLGGRPVVVQPFLDSTDAFVAAWLPGT  591

Query  282   EGQGVADVLFGDYPFTGKLSRTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             EGQGVADVLFGDY FTGKLSRTWF++ DQLPMNVGD HYDPLFPFG+GLTT  + 
Sbjct  592   EGQGVADVLFGDYGFTGKLSRTWFRSADQLPMNVGDAHYDPLFPFGYGLTTAAAH  646



>ref|XP_004493185.1| PREDICTED: lysosomal beta glucosidase-like isoform X5 [Cicer 
arietinum]
Length=555

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 363/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEII GLQG++P N  +GVP++ GK KV ACAKHYV D
Sbjct  99    RDPRWGRCYESYSEDPKIVQAMTEIISGLQGEIPPNMPKGVPFIAGKEKVIACAKHYVGD  158

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE+NTV D   LM IHMP Y  SI KGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  159   GGTTNGIDESNTVIDRDELMGIHMPGYFSSIDKGVATIMVSYSSWNGVKMHANHDLITGF  218

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+G VI+D+ GIDRIT    +N TYSV   ++AG+DM MVP  Y  FI     L
Sbjct  219   LKNTLHFQGLVITDFEGIDRITDPPRANCTYSVQAGVSAGMDMFMVPKFYREFIDDLTIL  278

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKF MG+FENPFADYSL +YLG + HR+LAREAVRKS+VL
Sbjct  279   VNNKFIPMSRIDDAVKRILRVKFMMGIFENPFADYSLVNYLGIKEHRELAREAVRKSMVL  338

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  + PLLPLPK   +ILVAG+HANNLGYQCGGWTI W+G+SG  I  GTTIL+ +
Sbjct  339   LKNGKSAEMPLLPLPKKVPKILVAGSHANNLGYQCGGWTIKWQGISGNDILKGTTILNAV  398

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T ++Y E+ +KEF++SN F+YAIVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  399   KNTVDPETIVIYKENPDKEFVESNGFSYAIVVVGEHPYAEMHGDNMNLTIPNPGPETITN  458

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVV++SGRPLV+ P++  +D LVA WLPGSEGQGVADVL+GDY FTGKL RT
Sbjct  459   VCGA-IKCVVVIISGRPLVITPYVDLIDGLVAGWLPGSEGQGVADVLYGDYGFTGKLPRT  517

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGL+T+ ++
Sbjct  518   WFKSVDQLPMNVGDPHYDPLFPFGFGLSTEPTK  550



>ref|XP_008446716.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Cucumis melo]
Length=777

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 367/449 (82%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEII GLQG+ P N+ +G PYVGG  KV ACAKH+V D
Sbjct  296   RDPRWGRCYESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGD  355

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV + HGL+SIHMP Y  SIIKGVS+VMASYSS NGVKMHANR L+TDF
Sbjct  356   GGTTHGINENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDF  415

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    SNYTYSV  +I AGIDMVM+P  Y+ FI     L
Sbjct  416   LKGALKFKGFVISDWEGLDRITSTPHSNYTYSVQAAILAGIDMVMIPYKYAEFIDDLKFL  475

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM RIDDAV RIL VKFTMGLFE+P ADYSL + LG QAHRDLAR+AVR+SLVL
Sbjct  476   VKSNVIPMDRIDDAVGRILTVKFTMGLFESPMADYSLVNELGSQAHRDLARDAVRQSLVL  535

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYI-TAGTTILSGI  577
             LKNGK++ +PLLPL K + +ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL+ I
Sbjct  536   LKNGKNDSKPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNGTRGTTILAAI  595

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E  + +F+KSNDF+YAIVV+GE PY+E  GD   LT+   G + IKN
Sbjct  596   KSTVDPSTEVVFREDPDSDFVKSNDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPNIIKN  655

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   V+CVV+L+SGRP+V+EP++ S+DALVAAWLPG+EGQGV D L+GD+ F+GKL RT
Sbjct  656   VCDH-VECVVILISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRT  714

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  715   WFKSVDQLPMNVGDPHYDPLFPFGFGLTT  743



>tpg|DAA51355.1| TPA: hypothetical protein ZEAMMB73_928187 [Zea mays]
Length=618

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 362/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+P+  GK KVAACAKH+V D
Sbjct  165   RDPRWGRCYESYSEDHRIVQAMTELIPGLQGDVPQNFTSGMPFAAGKDKVAACAKHFVGD  224

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  ++ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  225   GGTQNGINENNTIIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGF  284

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L F+GF ISDW GIDRIT    +NY+YSV  SI AGIDM+MVPNNY  FI+     
Sbjct  285   LKGRLNFQGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQNFITILTGH  344

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  345   VNSGLIPMSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVL  404

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A+RILVAG+HA+NLGYQCGGWTI W+G +G  T GTT+L  + 
Sbjct  405   LKNGKPGDAPLLPLPKKAARILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTVLDAVK  464

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T++V+ ES + EF++S  F+YAIV VGE PY+E  GD +NLTIP  G  T++ V
Sbjct  465   AAVDPSTEVVFAESPDAEFVRSGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTVQTV  524

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CAA V+CV VL+SGRP+V++P L +MDA+VAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  525   CAA-VRCVTVLISGRPVVIQPFLGAMDAVVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  583

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             F++VDQLPMN GD HYDPLFP GFGLTT+G  +
Sbjct  584   FRSVDQLPMNYGDAHYDPLFPLGFGLTTQGKMY  616



>ref|XP_002313632.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE87587.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/456 (68%), Positives = 366/456 (80%), Gaps = 4/456 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED  IV+ MTEIIPGLQG++P N  +GVP+V  G TKVAACAKH+V 
Sbjct  173   RDPRWGRCYESYSEDHRIVQLMTEIIPGLQGELPANSKKGVPFVAPGNTKVAACAKHFVG  232

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG+DENNTV   +GL++IHMP Y  +I KGV+TVM SYSS NG +MH NR L+T 
Sbjct  233   DGGTTKGIDENNTVISMNGLLNIHMPAYYNAISKGVATVMVSYSSWNGKRMHINRDLVTG  292

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  ++FRGFVISDW GIDR+T    +NY+ SV   ++AGIDM+MVP N++ FI     
Sbjct  293   FLKNKMKFRGFVISDWQGIDRVTSPPHANYSSSVHAGVDAGIDMIMVPFNFTEFIDDLTY  352

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRI+DAV RILRVKF MGLFE P AD S+A+ LG Q HR+LAREAVRKSLV
Sbjct  353   QVKNNIIPMSRINDAVQRILRVKFVMGLFEKPLADLSMANQLGSQEHRELAREAVRKSLV  412

Query  756   LLKNGK-DEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILS  583
             LLKNGK    +P LPLPK A +IL+AG+HA+NLGYQCGGWTITW+GL G  +T GTTIL+
Sbjct  413   LLKNGKYSTAKPFLPLPKKAPKILIAGSHADNLGYQCGGWTITWQGLGGNDLTTGTTILN  472

Query  582   GIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTI  403
              + N VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PY+E +GD  NLTI   G  TI
Sbjct  473   AVKNTVDPTTQVVYNENPDSNFVKSNKFSYAIVVVGEPPYAEMYGDSSNLTISEPGPSTI  532

Query  402   KNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLS  223
              NVC A VKCVV+++SGRP+V++P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+
Sbjct  533   NNVCGA-VKCVVIVISGRPVVIQPYLEKIDALVAAWLPGTEGQGVVDNLFGDYGFTGKLA  591

Query  222   RTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             RTWFKTVDQLPMNVGD HYDPLFPFGFG+TTK +++
Sbjct  592   RTWFKTVDQLPMNVGDPHYDPLFPFGFGITTKPAKN  627



>gb|EYU25636.1| hypothetical protein MIMGU_mgv1a002814mg [Erythranthe guttata]
Length=635

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/449 (71%), Positives = 362/449 (81%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+SMTEIIPGLQGD+P    +GVPYVGG  KV ACAKHYV D
Sbjct  183   RDPRWGRCYESYSEDPKVVRSMTEIIPGLQGDIPAGSPKGVPYVGGPDKVMACAKHYVGD  242

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNT+  WH L+ IHMP Y  S+IKGVSTVM SYSS NGVKMHANR L+T F
Sbjct  243   GGTVKGINENNTIASWHELLGIHMPAYYDSVIKGVSTVMVSYSSWNGVKMHANRDLITGF  302

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK   RFRGFVI+DW  ID++T    +NYTYS+  SINAGIDMVMVP NY+ FI     L
Sbjct  303   LKKAQRFRGFVITDWQAIDKMTTPPHANYTYSIETSINAGIDMVMVPYNYTEFIDGLTYL  362

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N F+ MSRIDDAV RILRVKFTMGLFENP ADYS+A +LG Q +R++AREAVRKSLVL
Sbjct  363   VNNNFVSMSRIDDAVKRILRVKFTMGLFENPMADYSMAKHLGSQENREVAREAVRKSLVL  422

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +PLLPLPK ASRILVAGTHAN++G QCGGWTI W G SG  TAGTTILS + 
Sbjct  423   LKNGKSGDKPLLPLPKKASRILVAGTHANDIGNQCGGWTIEWHGKSGNTTAGTTILSAVR  482

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
             NAVDP T + +    + EF+KS  F YA+VVVGE PYSE +GD+LNLT+P  G   I NV
Sbjct  483   NAVDPETTVSFRVDPDPEFVKSGKFEYAVVVVGEVPYSETYGDNLNLTLPDPGYGIINNV  542

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C++ VKCVVVLV+GRP+V+EP+L  MDA+VAAWLPGSEGQGVADVLFGDY FTGKL  TW
Sbjct  543   CSS-VKCVVVLVTGRPVVIEPYLGGMDAVVAAWLPGSEGQGVADVLFGDYGFTGKLPITW  601

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK VDQLPMN GD HYDPLFPFG+GLTT+
Sbjct  602   FKNVDQLPMNFGDPHYDPLFPFGYGLTTE  630



>ref|XP_006487879.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
Length=631

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/450 (71%), Positives = 372/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED +IVK MTEIIPGLQGD+P++  +G+PYV G+ KVAACAKHYV D
Sbjct  178   RDPRWGRCFESYSEDPKIVKLMTEIIPGLQGDIPSDLPKGIPYVAGRDKVAACAKHYVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGLMSIHMP Y  +IIKGVSTVM SYSS NG+KMHANR L+T+F
Sbjct  238   GGTTRGINENNTVIDRHGLMSIHMPAYNDAIIKGVSTVMVSYSSWNGLKMHANRDLVTNF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+FRGFVISDW GIDRIT  E +NY+YSVL  +NAGIDM M+P N++ FI      
Sbjct  298   LKGTLKFRGFVISDWQGIDRITTPEHANYSYSVLAGVNAGIDMFMLPFNHTDFIDILTDF  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+ + +PMSRIDDAV RILRVKFTMGLFE P AD +    LG QAHRDLAREAVRKSLVL
Sbjct  358   VERKIVPMSRIDDAVRRILRVKFTMGLFEKPMADQTFIDQLGSQAHRDLAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++     LPLPKNA+RILVAGTHANNLGYQCGGWTI W+GLSG   T GTTIL+GI
Sbjct  418   LKNGENADGAALPLPKNAARILVAGTHANNLGYQCGGWTIAWQGLSGNNNTVGTTILNGI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +  VD  T+I+++E+ + +++K+++ +YAIVVVGE+PY+E  GD LNLTI   G  TI N
Sbjct  478   SATVDSDTEIIFSENPSMDYVKASNVSYAIVVVGEQPYAETQGDSLNLTISEPGPSTITN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VCAA VKCVVVLVSGRP+ + P+LP +DALVAAWLPG+EGQGVADVLFGDY FTG+L RT
Sbjct  538   VCAA-VKCVVVLVSGRPVTVGPYLPQVDALVAAWLPGTEGQGVADVLFGDYGFTGRLPRT  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD  YDPLFP GFGLTT+
Sbjct  597   WFKTVDQLPMNFGDEQYDPLFPLGFGLTTE  626



>ref|XP_011100592.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011100593.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=644

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/450 (70%), Positives = 374/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQG++P N  +GVPY+ GK  VAACAKH+V D
Sbjct  186   RDPRWGRCYESYSEDHKIVEQMTDIIYGLQGEIPPNSPKGVPYIAGKNNVAACAKHFVGD  245

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT KG++ENNTVTDWHGL+SIHMP Y  SIIKGVST+M SYSS NG KMHAN+ L+T F
Sbjct  246   GGTAKGINENNTVTDWHGLLSIHMPGYFHSIIKGVSTIMVSYSSWNGQKMHANKTLVTHF  305

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW G+DRIT    SNY+ S+L +INAGIDMVMVP N + ++    S 
Sbjct  306   LKNTLKFKGFVISDWQGVDRITYPSGSNYSTSLLRAINAGIDMVMVPPNITEYVKIITSH  365

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+ IP++RIDDAV RILRVK T+GLFENP +DYSL   +  QAHR LAREAVRKSLVL
Sbjct  366   VKNKLIPINRIDDAVKRILRVKITLGLFENPLSDYSLVGEIRTQAHRHLAREAVRKSLVL  425

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGKD K+PL+PLPK  S+ILVAGTHANNLG QCG WTITW+G +G+ +T GTTIL+ I
Sbjct  426   LKNGKDAKKPLIPLPKKTSKILVAGTHANNLGLQCGAWTITWQGQNGHNLTTGTTILNAI  485

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +  VDP+T IVY+E+ +   +K++ ++YA+VVVGE  Y+E  GD+LNLTIP  GL T+ N
Sbjct  486   SATVDPSTDIVYSENPDVMSLKASKYSYAVVVVGEPTYAESAGDNLNLTIPEPGLSTMIN  545

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC+  VKCVVVL+SGRPLV+EP+LP +DALVAAWLPGSEG+GVADVLFGDY FTGKL RT
Sbjct  546   VCSK-VKCVVVLISGRPLVVEPYLPMLDALVAAWLPGSEGEGVADVLFGDYGFTGKLPRT  604

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WF+TVDQLPMNVGD+HYDPLFPFGFGLTTK
Sbjct  605   WFRTVDQLPMNVGDKHYDPLFPFGFGLTTK  634



>ref|XP_006379343.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
 gb|ERP57140.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
Length=629

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/456 (68%), Positives = 366/456 (80%), Gaps = 4/456 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVG-GKTKVAACAKHYVA  1297
             RDPRWGRCYESYSED  IV+ MTEIIPGLQG++P N  +GVP+V  G TKVAACAKH+V 
Sbjct  175   RDPRWGRCYESYSEDHRIVQLMTEIIPGLQGELPANSKKGVPFVAPGNTKVAACAKHFVG  234

Query  1296  DGGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTD  1117
             DGGTTKG+DENNTV   +GL++IHMP Y  +I KGV+TVM SYSS NG +MH NR L+T 
Sbjct  235   DGGTTKGIDENNTVISMNGLLNIHMPAYYNAISKGVATVMVSYSSWNGKRMHINRDLVTG  294

Query  1116  FLKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALS  937
             FLK  ++FRGFVISDW GIDR+T    +NY+ SV   ++AGIDM+MVP N++ FI     
Sbjct  295   FLKNKMKFRGFVISDWQGIDRVTSPPHANYSSSVHAGVDAGIDMIMVPFNFTEFIDDLTY  354

Query  936   LVKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLV  757
              VKN  IPMSRI+DAV RILRVKF MGLFE P AD S+A+ LG Q HR+LAREAVRKSLV
Sbjct  355   QVKNNIIPMSRINDAVQRILRVKFVMGLFEKPLADLSMANQLGSQEHRELAREAVRKSLV  414

Query  756   LLKNGK-DEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILS  583
             LLKNGK    +P LPLPK A +IL+AG+HA+NLGYQCGGWTITW+GL G  +T GTTIL+
Sbjct  415   LLKNGKYSTAKPFLPLPKKAPKILIAGSHADNLGYQCGGWTITWQGLGGNDLTTGTTILN  474

Query  582   GIANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTI  403
              + N VDP TQ+VYNE+ +  F+KSN F+YAIVVVGE PY+E +GD  NLTI   G  TI
Sbjct  475   AVKNTVDPTTQVVYNENPDSNFVKSNKFSYAIVVVGEPPYAEMYGDSSNLTISEPGPSTI  534

Query  402   KNVCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLS  223
              NVC A VKCVV+++SGRP+V++P+L  +DALVAAWLPG+EGQGV D LFGDY FTGKL+
Sbjct  535   NNVCGA-VKCVVIVISGRPVVIQPYLEKIDALVAAWLPGTEGQGVVDNLFGDYGFTGKLA  593

Query  222   RTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             RTWFKTVDQLPMNVGD HYDPLFPFGFG+TTK +++
Sbjct  594   RTWFKTVDQLPMNVGDPHYDPLFPFGFGITTKPAKN  629



>gb|KDO54374.1| hypothetical protein CISIN_1g038523mg [Citrus sinensis]
Length=631

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/450 (71%), Positives = 372/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED +IVK MTEIIPGLQGD+P++  +G+PYV G+ KVAACAKHYV D
Sbjct  178   RDPRWGRCFESYSEDPKIVKLMTEIIPGLQGDIPSDLPKGIPYVAGRDKVAACAKHYVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGLMSIHMP Y  +IIKGVSTVM SYSS NG+KMHANR L+T+F
Sbjct  238   GGTTRGINENNTVIDRHGLMSIHMPAYNDAIIKGVSTVMVSYSSWNGLKMHANRDLVTNF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+FRGFVISDW GIDRIT  E +NY+YSVL  +NAGIDM M+P N++ FI      
Sbjct  298   LKGTLKFRGFVISDWQGIDRITTPEHANYSYSVLAGVNAGIDMFMLPFNHTDFIDILTDF  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+ + +PMSRIDDAV RILRVKFTMGLFE P AD +    LG QAHRDLAREAVRKSLVL
Sbjct  358   VERKIVPMSRIDDAVRRILRVKFTMGLFEKPMADQTFIDQLGSQAHRDLAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++     LPLPKNA+RILVAGTHANNLGYQCGGWTI W+GLSG   T GTTIL+GI
Sbjct  418   LKNGENADGAALPLPKNAARILVAGTHANNLGYQCGGWTIAWQGLSGNNNTVGTTILNGI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +  VD  T+I+++E+ + +++K+++ +YAIVVVGE+PY+E  GD LNLTI   G  TI N
Sbjct  478   SATVDSDTEIIFSENPSMDYVKASNVSYAIVVVGEQPYAETQGDSLNLTISEPGPSTITN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VCAA VKCVVVLVSGRP+ + P+LP +DALVAAWLPG+EGQGVADVLFGDY FTG+L RT
Sbjct  538   VCAA-VKCVVVLVSGRPVTVGPYLPQVDALVAAWLPGTEGQGVADVLFGDYGFTGRLPRT  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD  YDPLFP GFGLTT+
Sbjct  597   WFKTVDQLPMNFGDEQYDPLFPLGFGLTTE  626



>gb|EYU26866.1| hypothetical protein MIMGU_mgv1a002476mg [Erythranthe guttata]
Length=668

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/450 (67%), Positives = 365/450 (81%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED ++V+ MT+II GLQGD+P+   +GVPYV GK KVAACAKH+V D
Sbjct  185   RDPRWGRCYESYSEDPKVVQEMTDIILGLQGDIPSGSRKGVPYVIGKNKVAACAKHFVGD  244

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNT+TD HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMH NR ++T F
Sbjct  245   GGTTRGINENNTLTDVHGLLSIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHENREMITGF  304

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    +NYTYSVL  + AGIDM+M+P N + F++    L
Sbjct  305   LKGTLKFKGFVISDWAGLDRITSPPHANYTYSVLAGVQAGIDMIMLPYNVTEFVNDLTYL  364

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FI M RIDDAV RIL +KF +GLFENP AD SL + +G QAHR++AREAVRKSLVL
Sbjct  365   VKNKFISMDRIDDAVERILLIKFNLGLFENPMADLSLVNEIGSQAHRNIAREAVRKSLVL  424

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK E +PLLPLPK AS+ILVAG+HA+NLGYQCGGWTI W+G  G   T+GTTIL  I
Sbjct  425   LKNGKRESEPLLPLPKKASKILVAGSHADNLGYQCGGWTIAWQGFRGNNETSGTTILDAI  484

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              ++VD  T+++Y+E+ + +++KSN F YAIV VGE PY+E  GD   LT+   G D I N
Sbjct  485   KSSVDKKTEVIYSENPDTQYLKSNHFDYAIVAVGEHPYTETVGDSQTLTMADPGPDVINN  544

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +  KCVVV++SGRP+V+EP++  +DALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  545   VCGS-FKCVVVVISGRPIVIEPYMSVIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRT  603

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WF++VDQLPMNVGD HYDPLFPFGFGLTTK
Sbjct  604   WFRSVDQLPMNVGDSHYDPLFPFGFGLTTK  633



>ref|XP_008648090.1| PREDICTED: LOC541703 isoform X1 [Zea mays]
 tpg|DAA51358.1| TPA: exhydrolase II isoform 1 [Zea mays]
 tpg|DAA51359.1| TPA: exhydrolase II isoform 2 [Zea mays]
 tpg|DAA51360.1| TPA: exhydrolase II isoform 3 [Zea mays]
 tpg|DAA51361.1| TPA: exhydrolase II isoform 4 [Zea mays]
 tpg|DAA51362.1| TPA: exhydrolase II isoform 5 [Zea mays]
 tpg|DAA51363.1| TPA: exhydrolase II isoform 6 [Zea mays]
Length=634

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 362/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+P+  GK KVAACAKH+V D
Sbjct  181   RDPRWGRCYESYSEDHRIVQAMTELIPGLQGDVPQNFTSGMPFAAGKDKVAACAKHFVGD  240

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  ++ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  241   GGTQNGINENNTIIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGF  300

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L F+GF ISDW GIDRIT    +NY+YSV  SI AGIDM+MVPNNY  FI+     
Sbjct  301   LKGRLNFQGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQNFITILTGH  360

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  361   VNSGLIPMSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVL  420

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A+RILVAG+HA+NLGYQCGGWTI W+G +G  T GTT+L  + 
Sbjct  421   LKNGKPGDAPLLPLPKKAARILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTVLDAVK  480

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T++V+ ES + EF++S  F+YAIV VGE PY+E  GD +NLTIP  G  T++ V
Sbjct  481   AAVDPSTEVVFAESPDAEFVRSGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTVQTV  540

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CAA V+CV VL+SGRP+V++P L +MDA+VAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  541   CAA-VRCVTVLISGRPVVIQPFLGAMDAVVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  599

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             F++VDQLPMN GD HYDPLFP GFGLTT+G  +
Sbjct  600   FRSVDQLPMNYGDAHYDPLFPLGFGLTTQGKMY  632



>gb|KEH25595.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=641

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/453 (68%), Positives = 363/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTE+IPGLQGD+P N+S GVPYV G  KVAACAKH+V D
Sbjct  176   RDPRWGRCYESYSEDHKIVQAMTELIPGLQGDLPANWSNGVPYVVGNKKVAACAKHFVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++E+NTV   H L SIHM  Y  SI K V T+M SYSS NG KMH+NR L+T F
Sbjct  236   GGTTEGINEDNTVATRHELFSIHMQAYYNSITKVVLTIMVSYSSWNGEKMHSNRDLVTGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L FRGFVISDW GIDRIT    +NYT+S+   +NAGIDM+M+P NY+ FI     L
Sbjct  296   LKNTLHFRGFVISDWKGIDRITSPPHANYTFSIEAGVNAGIDMIMIPFNYTEFIDGLTLL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK   IPMSRIDDAV RILRVKF MGLFENP ADYSLA  +G   HR+LAREAVRKSLVL
Sbjct  356   VKKNVIPMSRIDDAVKRILRVKFVMGLFENPLADYSLADQIGSPEHRELAREAVRKSLVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++  +P+LPLPK +S+ILVAG+HA+NLGYQCGGWTI W+G SG  IT GT ILS I
Sbjct  416   LKNGENVDKPILPLPKKSSKILVAGSHADNLGYQCGGWTIQWQGQSGNNITTGTPILSAI  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              +AVD  T++VY E+ + +++K NDF+YAIVVVGE PY+E  GD LNLTI   G +TI N
Sbjct  476   KHAVDKETKVVYEENPSLDYVKFNDFSYAIVVVGETPYAETNGDSLNLTISGHGYETIDN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC +GVKCVVVL++GRP+V++P+L  ++ LV AWLPGSEG GVADVLFGDY FTGKL RT
Sbjct  536   VC-SGVKCVVVLITGRPIVIQPYLEKIEGLVVAWLPGSEGSGVADVLFGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPMNVGD HYDPLFPFGFGLTT+  +
Sbjct  595   WFKTVDQLPMNVGDSHYDPLFPFGFGLTTEAYK  627



>emb|CDP06849.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/452 (68%), Positives = 365/452 (81%), Gaps = 2/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +I++ MT+II GLQG++P+   +GVPYV GK KVAACAKH+V D
Sbjct  132   RDPRWGRCYESYSEDPKIIREMTDIILGLQGEIPSGSRKGVPYVAGKDKVAACAKHFVGD  191

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNT+ D HGL+SIHMP Y  SIIKGVSTVM SYSS NG KMHANR ++T F
Sbjct  192   GGTTKGINENNTLIDRHGLLSIHMPAYYDSIIKGVSTVMISYSSWNGEKMHANRDMITGF  251

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  ++F+GFVISDW GIDRIT    +NYTYSV  SI AG+DMVM+P NY+ FI     L
Sbjct  252   LKDKIKFKGFVISDWEGIDRITSPPHANYTYSVEASILAGVDMVMIPFNYTEFIDDLTHL  311

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN+FIPM RIDDAV RIL VKFT+GLFE+P AD SL + +G Q HR+LAREAVRKSLVL
Sbjct  312   VKNKFIPMDRIDDAVERILLVKFTLGLFEDPLADLSLTNEVGKQEHRNLAREAVRKSLVL  371

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+E  PL+PL K AS+ILVAG+HA+NLGYQCGGWTI+W+G SG   T GTTIL+ I
Sbjct  372   LKNGKNETDPLIPLAKKASKILVAGSHADNLGYQCGGWTISWQGFSGNNYTRGTTILAAI  431

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VD  T++ Y E+ + +++KSN+F YAIVVVGE PY+E  GD   LTI   G   I N
Sbjct  432   NSTVDKETELEYLENPDSQYVKSNNFDYAIVVVGEPPYTESAGDSQTLTILDPGPAVIIN  491

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC   +KCVV++VSGRP+V+EP++ S+DALVAAWLPG+EGQGV DVLFGDY FTGKL RT
Sbjct  492   VCGV-IKCVVIIVSGRPIVIEPYISSIDALVAAWLPGTEGQGVTDVLFGDYEFTGKLPRT  550

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGS  121
             WF+T+DQLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  551   WFRTIDQLPMNVGDSHYDPLFPFGFGLTTHQS  582



>ref|XP_004493183.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Cicer 
arietinum]
Length=630

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 363/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEII GLQG++P N  +GVP++ GK KV ACAKHYV D
Sbjct  174   RDPRWGRCYESYSEDPKIVQAMTEIISGLQGEIPPNMPKGVPFIAGKEKVIACAKHYVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE+NTV D   LM IHMP Y  SI KGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  234   GGTTNGIDESNTVIDRDELMGIHMPGYFSSIDKGVATIMVSYSSWNGVKMHANHDLITGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+G VI+D+ GIDRIT    +N TYSV   ++AG+DM MVP  Y  FI     L
Sbjct  294   LKNTLHFQGLVITDFEGIDRITDPPRANCTYSVQAGVSAGMDMFMVPKFYREFIDDLTIL  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKF MG+FENPFADYSL +YLG + HR+LAREAVRKS+VL
Sbjct  354   VNNKFIPMSRIDDAVKRILRVKFMMGIFENPFADYSLVNYLGIKEHRELAREAVRKSMVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  + PLLPLPK   +ILVAG+HANNLGYQCGGWTI W+G+SG  I  GTTIL+ +
Sbjct  414   LKNGKSAEMPLLPLPKKVPKILVAGSHANNLGYQCGGWTIKWQGISGNDILKGTTILNAV  473

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T ++Y E+ +KEF++SN F+YAIVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  474   KNTVDPETIVIYKENPDKEFVESNGFSYAIVVVGEHPYAEMHGDNMNLTIPNPGPETITN  533

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVV++SGRPLV+ P++  +D LVA WLPGSEGQGVADVL+GDY FTGKL RT
Sbjct  534   VCGA-IKCVVVIISGRPLVITPYVDLIDGLVAGWLPGSEGQGVADVLYGDYGFTGKLPRT  592

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGL+T+ ++
Sbjct  593   WFKSVDQLPMNVGDPHYDPLFPFGFGLSTEPTK  625



>ref|XP_006424026.1| hypothetical protein CICLE_v10030270mg [Citrus clementina]
 gb|ESR37266.1| hypothetical protein CICLE_v10030270mg [Citrus clementina]
Length=631

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/450 (70%), Positives = 372/450 (83%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRC+ESYSED +IVK MTEIIPGLQGD+P++  +G+PYV G+ KVAACAKHYV D
Sbjct  178   RDPRWGRCFESYSEDPKIVKLMTEIIPGLQGDIPSDLPKGIPYVAGRDKVAACAKHYVGD  237

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGLMSIHMP Y  +IIKGVSTVM SYSS NG+KMHANR L+T+F
Sbjct  238   GGTTRGINENNTVIDRHGLMSIHMPAYNDAIIKGVSTVMVSYSSWNGLKMHANRDLVTNF  297

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+FRGFVISDW GIDRIT  E +NY+YSVL  +NAGIDM M+P N++ FI      
Sbjct  298   LKGTLKFRGFVISDWQGIDRITTPEHANYSYSVLAGVNAGIDMFMLPFNHTDFIDILTDF  357

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V+ + +PMSRIDDAV RILRVKFTMGLFE P AD +    LG QAHRDLAREAVRKSLVL
Sbjct  358   VERKIVPMSRIDDAVRRILRVKFTMGLFEKPMADQTFIDKLGSQAHRDLAREAVRKSLVL  417

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG++     LPLPKNA+RILVAGTHANNLGYQCGGWTI W+GLSG   T GTTIL+GI
Sbjct  418   LKNGENADGAALPLPKNAARILVAGTHANNLGYQCGGWTIAWQGLSGNNNTVGTTILNGI  477

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
             +  VD  T+I+++E+ + +++K+++ +YAIVVVGE+PY+E  GD LNLTI   G  T+ N
Sbjct  478   SATVDSDTEIIFSENPSMDYVKASNVSYAIVVVGEQPYAETQGDSLNLTISEPGPSTLTN  537

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VCAA VKCVVVLVSGRP+ + P+LP +DALVAAWLPG+EGQGVADVLFGDY FTG+L RT
Sbjct  538   VCAA-VKCVVVLVSGRPVTVGPYLPQVDALVAAWLPGTEGQGVADVLFGDYGFTGRLPRT  596

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMN GD  YDPLFP GFGLTT+
Sbjct  597   WFKTVDQLPMNFGDEQYDPLFPLGFGLTTE  626



>dbj|BAK05680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=630

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 361/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SMTE+IPGLQGDVP +F+ G+P+V GK KVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ +  GLM+IHMP Y  ++ KGVSTVM SYSS NGVKMHAN+ L+T +
Sbjct  237   GGTVDGINENNTIINREGLMNIHMPAYKNAMDKGVSTVMISYSSWNGVKMHANQDLVTGY  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    S+Y+YSV  SI AG+DM+MVPNNY +FIS     
Sbjct  297   LKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNNYQQFISILTGH  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAVTRILRVKFTMGLFENP+AD ++A  LG Q HRDLAREA RKSLVL
Sbjct  357   VNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVL  416

Query  753   LKNGKDEKQ-PLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGI  577
             LKNGK     PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G +G  T GTTIL  +
Sbjct  417   LKNGKTSTDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAV  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T +V+ E+ + EF+KS  F+YAIV VGE PY+E  GD+LNLTIP  GL T++ 
Sbjct  477   KAAVDPSTVVVFAENPDAEFVKSGGFSYAIVAVGEHPYTETKGDNLNLTIPEPGLSTVQA  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GV+C  VL+SGRP+V++P L + DALVAAWLPGSEGQGV D LFGD+ FTG+L RT
Sbjct  537   VC-GGVRCAAVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGDFGFTGRLPRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLF  G+GLTT  ++
Sbjct  596   WFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATK  628



>dbj|BAJ97948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=638

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/453 (67%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SMTE+IPGLQGDVP NF+ G+P+V GK KV ACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDRRIVQSMTELIPGLQGDVPKNFTSGMPFVAGKNKVVACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++E NTV +  GLM+IHMP Y  ++ KGVSTVM SYSS NGVKMHAN+ L+T +
Sbjct  237   GGTVNGINEGNTVINREGLMNIHMPAYFDALAKGVSTVMISYSSWNGVKMHANQDLVTGY  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GID+IT    S+Y YSV  S+ AG+DM+MVP+NY++FIS   S 
Sbjct  297   LKDTLKFQGFVISDWKGIDKITSPGGSDYHYSVKASVLAGLDMIMVPSNYTQFISILTSY  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  +PMSRIDDAVTRILRVKF MGLFE+P+AD ++A  LG Q HRDLAREAVRKSLVL
Sbjct  357   VNSGVVPMSRIDDAVTRILRVKFAMGLFESPYADPAMAEQLGKQEHRDLAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    P+LPL K A +ILVAG HA+NLGYQCGGWTI W+G SG IT GTTIL  + 
Sbjct  417   LKNGKTSDGPMLPLSKKAPKILVAGRHADNLGYQCGGWTIEWQGNSGRITVGTTILDAVK  476

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ + EF+K+  F+YAIV VGE PY+E  GD+LNLTIP  GL T++ V
Sbjct  477   AAVDPSTTVVFAENPDAEFVKNGGFSYAIVAVGEHPYTETAGDNLNLTIPEPGLSTVEAV  536

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V+C  VL+SGRP+V +P L + DALVAAWLPGSEGQG+ D LFGDY FTGKL RTW
Sbjct  537   CGA-VQCATVLISGRPVVAQPLLAASDALVAAWLPGSEGQGITDALFGDYGFTGKLPRTW  595

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             FK+VDQLPMNVGD HYDPLFP G+GLTT+G+  
Sbjct  596   FKSVDQLPMNVGDAHYDPLFPLGYGLTTEGTSQ  628



>ref|XP_010535771.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=633

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/454 (67%), Positives = 367/454 (81%), Gaps = 3/454 (1%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+ MTEII GLQGD+P    +G+P+V GK KVAACAKH+V D
Sbjct  178   RDPRWGRCYESYSEDHRIVQQMTEIITGLQGDLPAK-QKGIPFVDGKRKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G++ENNTV D  GL +IHM  Y  ++ KGV+TVM SYSS+NGVKMHAN+ L+T F
Sbjct  237   GGTVRGINENNTVIDKKGLFNIHMAAYHDAVDKGVATVMISYSSLNGVKMHANKKLVTGF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GID+IT    SNY+YSV  S+ AGIDM+MVP NY+ FI    S 
Sbjct  297   LKNKLKFKGFVISDWQGIDKITYPPHSNYSYSVFASVTAGIDMIMVPYNYTEFIDEITSQ  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK + IPM RI+DAV RILRVKFTMGLFE+P  D+SLA++LG + HR+LAREAVRKSLVL
Sbjct  357   VKRKIIPMRRINDAVERILRVKFTMGLFEHPMGDHSLANHLGSKEHRELAREAVRKSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNG++   P+LPLPK A ++LVAGTHA+NLG QCGGWTITW+GL+   +T GTTIL+ +
Sbjct  417   LKNGENADSPILPLPKKAKKLLVAGTHADNLGNQCGGWTITWQGLNTTDLTIGTTILTAV  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP TQ+V+ E+ ++EF++SN F YAIVVVGE PY+E  GD  NLTIP  G  TI N
Sbjct  477   KNTVDPTTQVVHIENPDREFVESNGFDYAIVVVGEPPYAEGNGDSTNLTIPEPGPSTITN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC + VKCVVV+VSGRP++ +P++  +DALVAAWLPG+EGQGVADVLFGDY FTGKL+RT
Sbjct  537   VCGS-VKCVVVIVSGRPVITQPYISGIDALVAAWLPGTEGQGVADVLFGDYGFTGKLART  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WFKTVDQLPMN GD +YDPLFPFGFGLTT+G R 
Sbjct  596   WFKTVDQLPMNFGDPNYDPLFPFGFGLTTEGKRQ  629



>gb|AAD23382.1|AF102868_1 beta-D-glucan exohydrolase isoenzyme ExoI [Hordeum vulgare subsp. 
vulgare]
Length=630

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 361/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SMTE+IPGLQGDVP +F+ G+P+V GK KVAACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ +  GLM+IHMP Y  ++ KGVSTVM SYSS NGVKMHAN+ L+T +
Sbjct  237   GGTVDGINENNTIINREGLMNIHMPAYKNAMDKGVSTVMISYSSWNGVKMHANQDLVTGY  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    S+Y+YSV  SI AG+DM+MVPNNY +FIS     
Sbjct  297   LKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNNYQQFISILTGH  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAVTRILRVKFTMGLFENP+AD ++A  LG Q HRDLAREA RKSLVL
Sbjct  357   VNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVL  416

Query  753   LKNGKDEKQ-PLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGI  577
             LKNGK     PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G +G  T GTTIL  +
Sbjct  417   LKNGKTSTDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAV  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T +V+ E+ + EF+KS  F+YAIV VGE PY+E  GD+LNLTIP  GL T++ 
Sbjct  477   KAAVDPSTVVVFAENPDAEFVKSGGFSYAIVAVGEHPYTETKGDNLNLTIPEPGLSTVQA  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GV+C  VL+SGRP+V++P L + DALVAAWLPGSEGQGV D LFGD+ FTG+L RT
Sbjct  537   VC-GGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGDFGFTGRLPRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLF  G+GLTT  ++
Sbjct  596   WFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATK  628



>ref|XP_004493184.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Cicer 
arietinum]
Length=625

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 363/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEII GLQG++P N  +GVP++ GK KV ACAKHYV D
Sbjct  169   RDPRWGRCYESYSEDPKIVQAMTEIISGLQGEIPPNMPKGVPFIAGKEKVIACAKHYVGD  228

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE+NTV D   LM IHMP Y  SI KGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  229   GGTTNGIDESNTVIDRDELMGIHMPGYFSSIDKGVATIMVSYSSWNGVKMHANHDLITGF  288

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+G VI+D+ GIDRIT    +N TYSV   ++AG+DM MVP  Y  FI     L
Sbjct  289   LKNTLHFQGLVITDFEGIDRITDPPRANCTYSVQAGVSAGMDMFMVPKFYREFIDDLTIL  348

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKF MG+FENPFADYSL +YLG + HR+LAREAVRKS+VL
Sbjct  349   VNNKFIPMSRIDDAVKRILRVKFMMGIFENPFADYSLVNYLGIKEHRELAREAVRKSMVL  408

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  + PLLPLPK   +ILVAG+HANNLGYQCGGWTI W+G+SG  I  GTTIL+ +
Sbjct  409   LKNGKSAEMPLLPLPKKVPKILVAGSHANNLGYQCGGWTIKWQGISGNDILKGTTILNAV  468

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T ++Y E+ +KEF++SN F+YAIVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  469   KNTVDPETIVIYKENPDKEFVESNGFSYAIVVVGEHPYAEMHGDNMNLTIPNPGPETITN  528

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVV++SGRPLV+ P++  +D LVA WLPGSEGQGVADVL+GDY FTGKL RT
Sbjct  529   VCGA-IKCVVVIISGRPLVITPYVDLIDGLVAGWLPGSEGQGVADVLYGDYGFTGKLPRT  587

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGL+T+ ++
Sbjct  588   WFKSVDQLPMNVGDPHYDPLFPFGFGLSTEPTK  620



>ref|XP_007010542.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY19352.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=662

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/449 (69%), Positives = 359/449 (80%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQGD+P+   +GVPYVGGK KVAACAKH+V D
Sbjct  173   RDPRWGRCYESYSEDHKIVEEMTDIIFGLQGDIPSGSRKGVPYVGGKDKVAACAKHFVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+S++MP Y  S+IKGVST+M SYSS NG KMHAN  L+T F
Sbjct  233   GGTTRGINENNTVIDVHGLLSMYMPAYSYSVIKGVSTIMVSYSSWNGEKMHANHELITGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT     NYTYSV  +I AGIDMVMVP N++ F+     L
Sbjct  293   LKNTLKFKGFVISDWQGIDRITSPPHLNYTYSVQAAIQAGIDMVMVPFNHTEFVDDLTYL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V ++ IPM RIDDAV RIL VKFTMGLFENPFAD+SL H LG QAHRDLAREAVRKSLVL
Sbjct  353   VNSKVIPMDRIDDAVERILLVKFTMGLFENPFADFSLVHELGSQAHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    PLLPL K AS+ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL  I
Sbjct  413   LKNGKGGTTPLLPLSKKASKILVAGTHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T+IVY E+ + +F+KSN+F YAIV VGE PY+E  GD   LT+   G   I N
Sbjct  473   NSTVDPSTEIVYRENPDADFVKSNNFDYAIVAVGEPPYAETAGDSTTLTMMDPGPSVITN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V+EP++ ++DALVAAWLPG+EGQGV D L+GDY F+GKL RT
Sbjct  533   VCGA-VKCVVVIISGRPIVIEPYVSTIDALVAAWLPGTEGQGVIDALYGDYGFSGKLPRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNV D HYDPLFP GFGL T
Sbjct  592   WFKTVDQLPMNVEDSHYDPLFPLGFGLKT  620



>ref|XP_009609159.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=659

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/450 (70%), Positives = 362/450 (80%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MT+IIPGLQGD+P N  +GVP+V GK+KVAACAKH+V D
Sbjct  206   RDPRWGRCYESYSEDHKIVRAMTDIIPGLQGDLPANSRKGVPFVAGKSKVAACAKHFVGD  265

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV + +GL  IHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T F
Sbjct  266   GGTVNGIDENNTVINSNGLFGIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHANRDLVTGF  325

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV   ++AGIDM+MVP NY+ FI T   L
Sbjct  326   LKDKLKFRGFVISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYTEFIDTLTQL  385

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM+RIDDAV RILRVKFTMGLFENP AD S  + LG Q HR+LAREAVRKSLVL
Sbjct  386   VKDNIIPMNRIDDAVKRILRVKFTMGLFENPLADLSYVNQLGSQEHRELAREAVRKSLVL  445

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILV GTHA+NLGYQCGGWTI W+G++G  +T GTTILS I
Sbjct  446   LKNGKSTSQPLLPLPKKAPKILVTGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAI  505

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDPATQ+VY ++ +  F+KSN F+YAIV+VGE PY+E FGD  NLTI   G  TI N
Sbjct  506   KNTVDPATQVVYEQNPDSNFVKSNQFSYAIVIVGEVPYAEMFGDSTNLTITEPGPSTINN  565

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A    VVV+     +VLEP++  +DALVAAWLPGSEGQGVAD LFGDY FTGKL+RT
Sbjct  566   VCEAVKCVVVVVSGRP-VVLEPYVEKIDALVAAWLPGSEGQGVADALFGDYGFTGKLART  624

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGDRHYDPLFPFGFGLTT+
Sbjct  625   WFKSVDQLPMNVGDRHYDPLFPFGFGLTTQ  654



>ref|XP_008648088.1| PREDICTED: LOC541703 isoform X2 [Zea mays]
 tpg|DAA51352.1| TPA: exhydrolase II [Zea mays]
Length=657

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 362/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+P+  GK KVAACAKH+V D
Sbjct  204   RDPRWGRCYESYSEDHRIVQAMTELIPGLQGDVPQNFTSGMPFAAGKDKVAACAKHFVGD  263

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  ++ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  264   GGTQNGINENNTIIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGF  323

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L F+GF ISDW GIDRIT    +NY+YSV  SI AGIDM+MVPNNY  FI+     
Sbjct  324   LKGRLNFQGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQNFITILTGH  383

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  384   VNSGLIPMSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVL  443

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A+RILVAG+HA+NLGYQCGGWTI W+G +G  T GTT+L  + 
Sbjct  444   LKNGKPGDAPLLPLPKKAARILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTVLDAVK  503

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T++V+ ES + EF++S  F+YAIV VGE PY+E  GD +NLTIP  G  T++ V
Sbjct  504   AAVDPSTEVVFAESPDAEFVRSGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTVQTV  563

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CAA V+CV VL+SGRP+V++P L +MDA+VAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  564   CAA-VRCVTVLISGRPVVIQPFLGAMDAVVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  622

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             F++VDQLPMN GD HYDPLFP GFGLTT+G  +
Sbjct  623   FRSVDQLPMNYGDAHYDPLFPLGFGLTTQGKMY  655



>ref|NP_001051277.1| Os03g0749500 [Oryza sativa Japonica Group]
 gb|ABF98887.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98888.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13191.1| Os03g0749500 [Oryza sativa Japonica Group]
 dbj|BAG93291.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/449 (68%), Positives = 354/449 (79%), Gaps = 1/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+PYV GK  VAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHRIVQAMTELIPGLQGDVPANFTSGMPYVAGKNNVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++E+NT+ D  GLM+IHMP Y  ++ KGVSTVM SYSS NG+KMHAN  L+T +
Sbjct  235   GGTQNGVNEDNTIIDRRGLMTIHMPAYLNALQKGVSTVMISYSSWNGIKMHANHDLVTRY  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GF ISDW GIDRIT    SNY+YSV   + AGIDM+MVPNNY  FIS   S 
Sbjct  295   LKDRLNFKGFTISDWEGIDRITTPAGSNYSYSVQAGVLAGIDMIMVPNNYQSFISILTSH  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N  IPMSRIDDAVTRILRVKFTMGLFENP  D S+A  LG + HRDLAREAVRKSLVL
Sbjct  355   VNNGIIPMSRIDDAVTRILRVKFTMGLFENPMPDSSMADQLGKKEHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK   +P+LPL K A +ILVAG+HA+NLGYQCGGWTI W+G +G IT G TIL  + 
Sbjct  415   LKNGKTSDKPMLPLSKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRITVGMTILDAVK  474

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ + +F+K+  F+YAIVVVGE PY+E  GD LNLTIP  G  T+  V
Sbjct  475   AAVDPSTTVVFAENPDADFVKNGGFSYAIVVVGEHPYTETKGDSLNLTIPDPGPSTVATV  534

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A  +C  VL+SGRP+V++P L +MDALVAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  535   CGA-AQCATVLISGRPVVVQPFLGAMDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  593

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             FK+VDQLPMN GD HYDPLFP GFGLTT+
Sbjct  594   FKSVDQLPMNYGDAHYDPLFPLGFGLTTQ  622



>ref|XP_009609160.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=658

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/450 (70%), Positives = 362/450 (80%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MT+IIPGLQGD+P N  +GVP+V GK+KVAACAKH+V D
Sbjct  205   RDPRWGRCYESYSEDHKIVRAMTDIIPGLQGDLPANSRKGVPFVAGKSKVAACAKHFVGD  264

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G+DENNTV + +GL  IHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T F
Sbjct  265   GGTVNGIDENNTVINSNGLFGIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHANRDLVTGF  324

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+FRGFVISDW GIDRIT    +NYTYSV   ++AGIDM+MVP NY+ FI T   L
Sbjct  325   LKDKLKFRGFVISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYTEFIDTLTQL  384

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VK+  IPM+RIDDAV RILRVKFTMGLFENP AD S  + LG Q HR+LAREAVRKSLVL
Sbjct  385   VKDNIIPMNRIDDAVKRILRVKFTMGLFENPLADLSYVNQLGSQEHRELAREAVRKSLVL  444

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK   QPLLPLPK A +ILV GTHA+NLGYQCGGWTI W+G++G  +T GTTILS I
Sbjct  445   LKNGKSTSQPLLPLPKKAPKILVTGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAI  504

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDPATQ+VY ++ +  F+KSN F+YAIV+VGE PY+E FGD  NLTI   G  TI N
Sbjct  505   KNTVDPATQVVYEQNPDSNFVKSNQFSYAIVIVGEVPYAEMFGDSTNLTITEPGPSTINN  564

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A    VVV+     +VLEP++  +DALVAAWLPGSEGQGVAD LFGDY FTGKL+RT
Sbjct  565   VCEAVKCVVVVVSGRP-VVLEPYVEKIDALVAAWLPGSEGQGVADALFGDYGFTGKLART  623

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFK+VDQLPMNVGDRHYDPLFPFGFGLTT+
Sbjct  624   WFKSVDQLPMNVGDRHYDPLFPFGFGLTTQ  653



>ref|XP_007010543.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY19353.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=661

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/449 (69%), Positives = 359/449 (80%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MT+II GLQGD+P+   +GVPYVGGK KVAACAKH+V D
Sbjct  173   RDPRWGRCYESYSEDHKIVEEMTDIIFGLQGDIPSGSRKGVPYVGGKDKVAACAKHFVGD  232

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D HGL+S++MP Y  S+IKGVST+M SYSS NG KMHAN  L+T F
Sbjct  233   GGTTRGINENNTVIDVHGLLSMYMPAYSYSVIKGVSTIMVSYSSWNGEKMHANHELITGF  292

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT     NYTYSV  +I AGIDMVMVP N++ F+     L
Sbjct  293   LKNTLKFKGFVISDWQGIDRITSPPHLNYTYSVQAAIQAGIDMVMVPFNHTEFVDDLTYL  352

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V ++ IPM RIDDAV RIL VKFTMGLFENPFAD+SL H LG QAHRDLAREAVRKSLVL
Sbjct  353   VNSKVIPMDRIDDAVERILLVKFTMGLFENPFADFSLVHELGSQAHRDLAREAVRKSLVL  412

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    PLLPL K AS+ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL  I
Sbjct  413   LKNGKGGTTPLLPLSKKASKILVAGTHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAI  472

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T+IVY E+ + +F+KSN+F YAIV VGE PY+E  GD   LT+   G   I N
Sbjct  473   NSTVDPSTEIVYRENPDADFVKSNNFDYAIVAVGEPPYAETAGDSTTLTMMDPGPSVITN  532

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKCVVV++SGRP+V+EP++ ++DALVAAWLPG+EGQGV D L+GDY F+GKL RT
Sbjct  533   VCGA-VKCVVVIISGRPIVIEPYVSTIDALVAAWLPGTEGQGVIDALYGDYGFSGKLPRT  591

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFKTVDQLPMNV D HYDPLFP GFGL T
Sbjct  592   WFKTVDQLPMNVEDSHYDPLFPLGFGLKT  620



>tpg|DAA51354.1| TPA: exhydrolase II [Zea mays]
Length=682

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 362/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+P+  GK KVAACAKH+V D
Sbjct  229   RDPRWGRCYESYSEDHRIVQAMTELIPGLQGDVPQNFTSGMPFAAGKDKVAACAKHFVGD  288

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  ++ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  289   GGTQNGINENNTIIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGF  348

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L F+GF ISDW GIDRIT    +NY+YSV  SI AGIDM+MVPNNY  FI+     
Sbjct  349   LKGRLNFQGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQNFITILTGH  408

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  409   VNSGLIPMSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVL  468

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A+RILVAG+HA+NLGYQCGGWTI W+G +G  T GTT+L  + 
Sbjct  469   LKNGKPGDAPLLPLPKKAARILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTVLDAVK  528

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T++V+ ES + EF++S  F+YAIV VGE PY+E  GD +NLTIP  G  T++ V
Sbjct  529   AAVDPSTEVVFAESPDAEFVRSGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTVQTV  588

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CAA V+CV VL+SGRP+V++P L +MDA+VAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  589   CAA-VRCVTVLISGRPVVIQPFLGAMDAVVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  647

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             F++VDQLPMN GD HYDPLFP GFGLTT+G  +
Sbjct  648   FRSVDQLPMNYGDAHYDPLFPLGFGLTTQGKMY  680



>ref|XP_008644502.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Zea mays]
 ref|XP_008644503.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Zea mays]
 gb|AFW67619.1| hypothetical protein ZEAMMB73_549956 [Zea mays]
 gb|AFW67620.1| hypothetical protein ZEAMMB73_549956 [Zea mays]
Length=626

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/452 (67%), Positives = 357/452 (79%), Gaps = 1/452 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  +V++MTE+IPGLQGDVP NF+ G+P+  GK KVAACAKH+V D
Sbjct  174   RDPRWGRCYESYSEDRRLVQNMTELIPGLQGDVPQNFTSGMPFAAGKNKVAACAKHFVGD  233

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  ++ KGVSTVM SYSS NG+KMHAN +L+T F
Sbjct  234   GGTHDGINENNTIIDRKGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHNLITGF  293

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG  +F+GF ISDW GIDRIT    +NY+YSV  SI AGIDM+MVPNNY  FI+     
Sbjct  294   LKGEHKFQGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQDFITILTGH  353

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  354   VNSGLIPMSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVL  413

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A++ILVAG+HA+NLGYQCGGWTI W+G +G IT GTT+L  + 
Sbjct  414   LKNGKPGDAPLLPLPKKAAKILVAGSHADNLGYQCGGWTIEWQGDTGRITVGTTLLDAVK  473

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T +V+ E+ +  F+++  F+YAIV VGE PY+E  GD +NLTIP  G  TI+ V
Sbjct  474   AAVDPSTAVVFAENPDAGFVRNGGFSYAIVAVGEHPYTETKGDSMNLTIPEPGPSTIQTV  533

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             C A V C  VL+SGRP+V++P L ++ ALVAAWLPGSEGQG+ DVLFGDY FTG L RTW
Sbjct  534   CGA-VPCATVLISGRPVVIQPFLGTVHALVAAWLPGSEGQGITDVLFGDYGFTGTLPRTW  592

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             FK+VDQLPMN GD HYDPLFP GFGLTT+G +
Sbjct  593   FKSVDQLPMNYGDEHYDPLFPLGFGLTTQGKK  624



>ref|XP_004159282.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Cucumis sativus]
Length=658

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/449 (69%), Positives = 364/449 (81%), Gaps = 2/449 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MTEII GLQG+ P N+ +G PYVGG  KV ACAKH+V D
Sbjct  177   RDPRWGRCYESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGD  236

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G++ENNTV + HGL+SIHMP Y  SIIKGVS+VMASYSS NGVKMHANR L+TDF
Sbjct  237   GGTTHGINENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDF  296

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L+F+GFVISDW G+DRIT    SNYTYSV  SI AGIDMVM+P  Y+ FI     L
Sbjct  297   LKGALKFKGFVISDWEGLDRITSTPHSNYTYSVQASILAGIDMVMIPYKYAEFIDDVKFL  356

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPM RIDDAV RIL VKFTMGLFE+P  DYSL + LG QAHRDLAR+AVR+SLVL
Sbjct  357   VKNNAIPMDRIDDAVRRILTVKFTMGLFESPMGDYSLVNELGSQAHRDLARDAVRQSLVL  416

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK++ +PLLPL K + +ILVAGTHA+NLGYQCGGWTI W+G SG   T GTTIL+ I
Sbjct  417   LKNGKNDSKPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNATRGTTILASI  476

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VDP+T++V+ E  + +F+KS+DF+YAIVV+GE PY+E  GD   LT+   G  TIKN
Sbjct  477   KSTVDPSTEVVFREDPDSDFVKSSDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPSTIKN  536

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             V    V+CVV+++SGRP+V+EP++ S+DALVAAWLPG+EGQGV D L+GD+ F+GKL RT
Sbjct  537   V-GDYVECVVIVISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRT  595

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTT  130
             WFK+VDQLPMNVGD HYDPLF FGFGLTT
Sbjct  596   WFKSVDQLPMNVGDPHYDPLFXFGFGLTT  624



>gb|ADC55526.1| beta-D-glucan glucohydrolase precursor [synthetic construct]
Length=607

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/453 (67%), Positives = 360/453 (79%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SMTE+IPGLQGDVP +F+ G+P+V GK KVAACAKH+V D
Sbjct  154   RDPRWGRCYESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGD  213

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ +  GLM+IHMP Y  ++ KGVSTVM SYSS NGVKMHAN+ L+T +
Sbjct  214   GGTVDGINENNTIINREGLMNIHMPAYKNAMDKGVSTVMISYSSWNGVKMHANQDLVTGY  273

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    S+Y+YSV  SI AG+DM+MVPN Y +FIS     
Sbjct  274   LKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNKYQQFISILTGH  333

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAVTRILRVKFTMGLFENP+AD ++A  LG Q HRDLAREA RKSLVL
Sbjct  334   VNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVL  393

Query  753   LKNGKDEKQ-PLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGI  577
             LKNGK     PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G +G  T GTTIL  +
Sbjct  394   LKNGKTSTDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAV  453

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T +V+ E+ + EF+KS  F+YAIV VGE PY+E  GD+LNLTIP  GL T++ 
Sbjct  454   KAAVDPSTVVVFAENPDAEFVKSGGFSYAIVAVGEHPYTETKGDNLNLTIPEPGLSTVQA  513

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GV+C  VL+SGRP+V++P L + DALVAAWLPGSEGQGV D LFGD+ FTG+L RT
Sbjct  514   VC-GGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGDFGFTGRLPRT  572

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLF  G+GLTT  ++
Sbjct  573   WFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATK  605



>tpg|DAA51353.1| TPA: exhydrolase II [Zea mays]
Length=678

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 362/453 (80%), Gaps = 1/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTE+IPGLQGDVP NF+ G+P+  GK KVAACAKH+V D
Sbjct  225   RDPRWGRCYESYSEDHRIVQAMTELIPGLQGDVPQNFTSGMPFAAGKDKVAACAKHFVGD  284

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ D  GLMSIHMP Y  ++ KGVSTVM SYSS NG+KMHAN  L+T F
Sbjct  285   GGTQNGINENNTIIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGF  344

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LKG L F+GF ISDW GIDRIT    +NY+YSV  SI AGIDM+MVPNNY  FI+     
Sbjct  345   LKGRLNFQGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQNFITILTGH  404

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V +  IPMSRIDDAVTRILRVKFTMGLFENP  D SLA  LG Q HRDLAREAVRKSLVL
Sbjct  405   VNSGLIPMSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVL  464

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGIA  574
             LKNGK    PLLPLPK A+RILVAG+HA+NLGYQCGGWTI W+G +G  T GTT+L  + 
Sbjct  465   LKNGKPGDAPLLPLPKKAARILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTVLDAVK  524

Query  573   NAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKNV  394
              AVDP+T++V+ ES + EF++S  F+YAIV VGE PY+E  GD +NLTIP  G  T++ V
Sbjct  525   AAVDPSTEVVFAESPDAEFVRSGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTVQTV  584

Query  393   CAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRTW  214
             CAA V+CV VL+SGRP+V++P L +MDA+VAAWLPG+EGQGV DVLFGDY FTGKL RTW
Sbjct  585   CAA-VRCVTVLISGRPVVIQPFLGAMDAVVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTW  643

Query  213   FKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             F++VDQLPMN GD HYDPLFP GFGLTT+G  +
Sbjct  644   FRSVDQLPMNYGDAHYDPLFPLGFGLTTQGKMY  676



>ref|XP_004493181.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493182.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Cicer 
arietinum]
Length=632

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 363/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV++MTEII GLQG++P N  +GVP++ GK KV ACAKHYV D
Sbjct  176   RDPRWGRCYESYSEDPKIVQAMTEIISGLQGEIPPNMPKGVPFIAGKEKVIACAKHYVGD  235

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT G+DE+NTV D   LM IHMP Y  SI KGV+T+M SYSS NGVKMHAN  L+T F
Sbjct  236   GGTTNGIDESNTVIDRDELMGIHMPGYFSSIDKGVATIMVSYSSWNGVKMHANHDLITGF  295

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+G VI+D+ GIDRIT    +N TYSV   ++AG+DM MVP  Y  FI     L
Sbjct  296   LKNTLHFQGLVITDFEGIDRITDPPRANCTYSVQAGVSAGMDMFMVPKFYREFIDDLTIL  355

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V N+FIPMSRIDDAV RILRVKF MG+FENPFADYSL +YLG + HR+LAREAVRKS+VL
Sbjct  356   VNNKFIPMSRIDDAVKRILRVKFMMGIFENPFADYSLVNYLGIKEHRELAREAVRKSMVL  415

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGY-ITAGTTILSGI  577
             LKNGK  + PLLPLPK   +ILVAG+HANNLGYQCGGWTI W+G+SG  I  GTTIL+ +
Sbjct  416   LKNGKSAEMPLLPLPKKVPKILVAGSHANNLGYQCGGWTIKWQGISGNDILKGTTILNAV  475

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP T ++Y E+ +KEF++SN F+YAIVVVGE PY+E  GD++NLTIP  G +TI N
Sbjct  476   KNTVDPETIVIYKENPDKEFVESNGFSYAIVVVGEHPYAEMHGDNMNLTIPNPGPETITN  535

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVVV++SGRPLV+ P++  +D LVA WLPGSEGQGVADVL+GDY FTGKL RT
Sbjct  536   VCGA-IKCVVVIISGRPLVITPYVDLIDGLVAGWLPGSEGQGVADVLYGDYGFTGKLPRT  594

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLFPFGFGL+T+ ++
Sbjct  595   WFKSVDQLPMNVGDPHYDPLFPFGFGLSTEPTK  627



>gb|KHG23007.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=1245

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/450 (70%), Positives = 367/450 (82%), Gaps = 2/450 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IVK MT+IIPGLQG++P +  +GVP+V GK  V AC+KHYV D
Sbjct  184   RDPRWGRCYESYSEDPQIVKDMTDIIPGLQGNIPTDSPKGVPFVAGKNNVVACSKHYVGD  243

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTTKG++ENNTV DW GL+SIHMP Y  SI+KGVSTVM SYSS NG+KMHANR L+T F
Sbjct  244   GGTTKGINENNTVIDWQGLLSIHMPAYHTSIMKGVSTVMISYSSWNGIKMHANRELITGF  303

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L F+GFVISDW G+DRIT    +NY+YS+   I+AGIDMVMVP NY  FI      
Sbjct  304   LKNTLGFKGFVISDWEGLDRITYPPHANYSYSIQAGIHAGIDMVMVPYNYKEFIDGLTFH  363

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPMSRIDDAV RILRVKF MGLFENP AD SL   LG Q HR+LAREAVRKSLVL
Sbjct  364   VKNNVIPMSRIDDAVRRILRVKFVMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVL  423

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNG+   +PLLPLPK  S+ILVAG+HA+NLGYQCGGWTI W+G +G   T GTTI++ I
Sbjct  424   LKNGQSLNRPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFNGNNRTIGTTIVAAI  483

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N +DP+T +V+ E+ N EF+KSN+F+YAIVVVGE PY+E  GD +NLTI   G  TI+N
Sbjct  484   KNTIDPSTNVVFKENPNAEFVKSNNFSYAIVVVGEHPYAETDGDSMNLTIADPGPTTIRN  543

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A +KCVV+++SGRP+V+EP+L S+DALVAAWLPG+EGQGVADV+FGDY FTGKL RT
Sbjct  544   VCGA-MKCVVIIISGRPVVIEPYLASIDALVAAWLPGTEGQGVADVVFGDYGFTGKLPRT  602

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTK  127
             WFKTVDQLPMNVGD HYDPL+PFGFG+TT+
Sbjct  603   WFKTVDQLPMNVGDPHYDPLYPFGFGITTE  632


 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/453 (68%), Positives = 364/453 (80%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED +IV+ MTEIIPGLQG +P+++ +GVP+VGG   VAACAKHY+ D
Sbjct  792   RDPRWGRCYESYSEDPKIVQDMTEIIPGLQGQIPSSYPKGVPFVGGMESVAACAKHYIGD  851

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGTT+G++ENNTV D  GL+SI +P Y  SI KGV+TVM SYSS+NGVKMHAN  ++T+F
Sbjct  852   GGTTEGINENNTVIDNKGLLSILLPGYVSSIRKGVATVMISYSSLNGVKMHANYEMVTNF  911

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK +LRF+GFVISDW GIDRIT    +NYTYS+  S+NAG+DM+M+P NY+ FI     L
Sbjct  912   LKKNLRFKGFVISDWEGIDRITSPPHANYTYSIEASVNAGLDMIMLPYNYTEFIDGLTYL  971

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN F+PMSRIDDAV RIL VKFTMGLFENP AD      LGC+AHR+LAR+AVRKSLVL
Sbjct  972   VKNNFVPMSRIDDAVKRILLVKFTMGLFENPLADERFVKQLGCEAHRELARDAVRKSLVL  1031

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK    PLLPLPK AS ILVAG+HA+NLGYQCGGWTI W G SG  +T GTTIL+ I
Sbjct  1032  LKNGKSADAPLLPLPKKASNILVAGSHADNLGYQCGGWTIKWMGFSGNNLTTGTTILTAI  1091

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              N VDP +++VYNE+ + EF+KS  F+YAIVVVGE PY+E  GD+LNLTIP  G  TI N
Sbjct  1092  KNTVDPTSKVVYNENPDAEFVKSGGFSYAIVVVGEHPYAETKGDNLNLTIPEPGPSTITN  1151

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC      VVV+     +V++P++ S++ALVAAWLPGSEGQGVADVLFGD+ FTGKLS T
Sbjct  1152  VCGTVKCVVVVVSGRP-VVIQPYVASIEALVAAWLPGSEGQGVADVLFGDFGFTGKLSFT  1210

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFKTVDQLPM+VGD HYDPLFP GFGLTT+ ++
Sbjct  1211  WFKTVDQLPMHVGDPHYDPLFPLGFGLTTQPAK  1243



>pdb|1EX1|A Chain A, Beta-D-Glucan Exohydrolase From Barley
 pdb|1IEX|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With 4i,4iii,4v-S-Trithiocellohexaose
 pdb|1IEW|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With 2-Deoxy-2-Fluoro-Alpha-D-Glucoside
 pdb|1IEV|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With Cyclohexitol
 pdb|1IEQ|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1
 pdb|1J8V|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With 4'-Nitrophenyl 3i-Thiolaminaritrioside
Length=605

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/453 (67%), Positives = 360/453 (79%), Gaps = 2/453 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV+SMTE+IPGLQGDVP +F+ G+P+V GK KVAACAKH+V D
Sbjct  152   RDPRWGRCYESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGD  211

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT  G++ENNT+ +  GLM+IHMP Y  ++ KGVSTVM SYSS NGVKMHAN+ L+T +
Sbjct  212   GGTVDGINENNTIINREGLMNIHMPAYKNAMDKGVSTVMISYSSWNGVKMHANQDLVTGY  271

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    S+Y+YSV  SI AG+DM+MVPN Y +FIS     
Sbjct  272   LKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNKYQQFISILTGH  331

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             V    IPMSRIDDAVTRILRVKFTMGLFENP+AD ++A  LG Q HRDLAREA RKSLVL
Sbjct  332   VNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVL  391

Query  753   LKNGKDEKQ-PLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSGYITAGTTILSGI  577
             LKNGK     PLLPLPK A +ILVAG+HA+NLGYQCGGWTI W+G +G  T GTTIL  +
Sbjct  392   LKNGKTSTDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAV  451

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
               AVDP+T +V+ E+ + EF+KS  F+YAIV VGE PY+E  GD+LNLTIP  GL T++ 
Sbjct  452   KAAVDPSTVVVFAENPDAEFVKSGGFSYAIVAVGEHPYTETKGDNLNLTIPEPGLSTVQA  511

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC  GV+C  VL+SGRP+V++P L + DALVAAWLPGSEGQGV D LFGD+ FTG+L RT
Sbjct  512   VC-GGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGDFGFTGRLPRT  570

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSR  118
             WFK+VDQLPMNVGD HYDPLF  G+GLTT  ++
Sbjct  571   WFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATK  603



>ref|XP_004306422.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/454 (68%), Positives = 363/454 (80%), Gaps = 2/454 (0%)
 Frame = -2

Query  1473  RDPRWGRCYESYSEDVEIVKSMTEIIPGLQGDVPNNFSRGVPYVGGKTKVAACAKHYVAD  1294
             RDPRWGRCYESYSED  IV++MTEIIPGLQGD+P N  +G PYVGG  KVAACAKH+V D
Sbjct  175   RDPRWGRCYESYSEDHRIVQAMTEIIPGLQGDIPANSRKGFPYVGGNKKVAACAKHFVGD  234

Query  1293  GGTTKGMDENNTVTDWHGLMSIHMPPYPPSIIKGVSTVMASYSSVNGVKMHANRHLLTDF  1114
             GGT +G++ENNT+TD H L+SIHMP Y  SIIKGVSTVM SYSS NG KMHANR L+T F
Sbjct  235   GGTIRGINENNTITDRHDLLSIHMPAYSDSIIKGVSTVMISYSSWNGEKMHANRDLVTGF  294

Query  1113  LKGHLRFRGFVISDWLGIDRITVKEDSNYTYSVLESINAGIDMVMVPNNYSRFISTALSL  934
             LK  L+F+GFVISDW GIDRIT    SNYTYSV  SI AGIDMVMVP NY  FI+    L
Sbjct  295   LKDTLKFKGFVISDWEGIDRITSPPHSNYTYSVQASILAGIDMVMVPVNYKEFINDLTYL  354

Query  933   VKNRFIPMSRIDDAVTRILRVKFTMGLFENPFADYSLAHYLGCQAHRDLAREAVRKSLVL  754
             VKN  IPM RIDDAV RIL VKFTMGLFENPF D SL + LG QAHRDLAREAVRKSLVL
Sbjct  355   VKNNVIPMDRIDDAVGRILLVKFTMGLFENPFGDLSLVNELGSQAHRDLAREAVRKSLVL  414

Query  753   LKNGKDEKQPLLPLPKNASRILVAGTHANNLGYQCGGWTITWKGLSG-YITAGTTILSGI  577
             LKNGK+   P+LPLPK   +ILVAG+HA+NLGYQCGGWT+ W+G SG   T GTTIL  I
Sbjct  415   LKNGKNGTIPVLPLPKKVPKILVAGSHADNLGYQCGGWTMAWQGFSGNNKTRGTTILGAI  474

Query  576   ANAVDPATQIVYNESANKEFMKSNDFAYAIVVVGEKPYSEYFGDDLNLTIPAAGLDTIKN  397
              + VD +T++VY E+ + + +KSN+F YAIVVVGE PY+E  GD +NLT+   G   I +
Sbjct  475   KSTVDSSTEVVYLENPDSDSVKSNNFEYAIVVVGEHPYAETDGDSMNLTMADPGPSVITS  534

Query  396   VCAAGVKCVVVLVSGRPLVLEPHLPSMDALVAAWLPGSEGQGVADVLFGDYPFTGKLSRT  217
             VC A VKC+V+++SGRP+V+EP++ S+DALVAAWLPG+EGQG+ DVL+G++ F+GKL RT
Sbjct  535   VCEA-VKCIVIIISGRPVVIEPYVSSIDALVAAWLPGTEGQGITDVLYGEHGFSGKLPRT  593

Query  216   WFKTVDQLPMNVGDRHYDPLFPFGFGLTTKGSRH  115
             WF++VDQLPMN+GD HYDPLFPFGFGL T+  + 
Sbjct  594   WFRSVDQLPMNIGDPHYDPLFPFGFGLETESVKE  627



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4112808707462