BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85993_g1_i1 len=814 path=[792:0-813]

Length=814
                                                                      Score     E

dbj|BAF36289.1|  hypothetical protein                                 76.6    6e-14   Ipomoea trifida
dbj|BAF56262.1|  S-RNase                                              59.3    2e-07   Prunus speciosa [Oshima cherry]
gb|AGH17537.1|  S49-RNase                                             57.8    3e-07   
gb|ABG76219.1|  S-RNase                                               58.2    7e-07   Prunus spinosa [blackthorn]
gb|ADD20973.1|  S35-RNase                                             57.0    1e-06   Prunus armeniaca
dbj|BAJ13374.1|  St-RNase                                             57.0    1e-06   
gb|ABS30926.1|  Sc-RNase                                              57.4    1e-06   Prunus armeniaca
gb|ABS30928.1|  Sc-RNase                                              56.6    2e-06   Prunus armeniaca
gb|ABQ51153.1|  S13-RNase                                             57.0    2e-06   Prunus armeniaca
gb|ABO34168.1|  Sc-RNase                                              56.6    2e-06   Prunus armeniaca
gb|ABO34167.1|  S8-RNase                                              56.6    2e-06   Prunus armeniaca
gb|ABE27180.1|  S-locus S-RNase c                                     57.0    3e-06   Prunus armeniaca
dbj|BAF56258.1|  S-RNase                                              55.8    3e-06   Prunus speciosa [Oshima cherry]
gb|ABY19368.1|  S3-RNase                                              56.2    3e-06   Prunus webbii
dbj|BAA88126.1|  S1-RNase                                             55.1    3e-06   Prunus avium [gean]
dbj|BAF56272.1|  S-RNase                                              55.8    3e-06   Prunus speciosa [Oshima cherry]
gb|ABY65900.1|  S-RNase                                               56.2    4e-06   Prunus pseudocerasus [Chinese sour cherry]
gb|ACU25553.1|  self-incompatibility associated ribonuclease S2       56.2    4e-06   
gb|ABW04805.1|  S-RNase                                               55.1    4e-06   Prunus dulcis [sweet almond]
gb|AAT69244.1|  S1-RNase protein                                      56.2    5e-06   Prunus armeniaca
gb|ABS30927.1|  Sc-RNase                                              55.5    5e-06   Prunus armeniaca
gb|AAL27624.1|AF432851_1  S-RNase                                     53.9    5e-06   Prunus mume [ume]
dbj|BAF56259.1|  S-RNase                                              55.1    5e-06   Prunus speciosa [Oshima cherry]
gb|ABY19370.1|  S6-RNase                                              55.5    5e-06   Prunus webbii
dbj|BAC20942.1|  Se-RNase                                             54.3    5e-06   Prunus salicina [Japanese plum]
emb|CAQ51501.1|  self-incompatibility ribonuclease                    55.1    5e-06   Prunus cerasifera [myrobalan plum]
gb|AFI24534.1|  self-incompatibility associated ribonuclease S1       55.5    6e-06   
gb|ACU25555.1|  self-incompatibility associated ribonuclease S6       55.8    6e-06   
dbj|BAF91848.1|  Se-RNase                                             56.2    6e-06   Prunus salicina [Japanese plum]
emb|CAJ77735.1|  ribonuclease S24 precursor                           55.1    6e-06   Prunus dulcis [sweet almond]
emb|CAJ77742.1|  ribonuclease S11 precursor                           55.1    6e-06   Prunus dulcis [sweet almond]
gb|ABY78035.1|  S1-RNase                                              55.1    6e-06   Prunus simonii [apricot plum]
gb|AAM22180.1|AF490505_1  RNase                                       54.7    6e-06   Prunus dulcis [sweet almond]
dbj|BAF56247.1|  S-RNase                                              54.7    7e-06   Prunus speciosa [Oshima cherry]
gb|AAL27622.1|AF432849_1  S-RNase                                     53.5    7e-06   Prunus mume [ume]
gb|ACG50930.1|  S3-RNase                                              55.1    8e-06   Prunus simonii [apricot plum]
gb|ABL86027.1|  S-RNase                                               55.1    8e-06   Prunus tenella [dwarf Russian almond]
gb|AAZ57489.1|  Si-RNase                                              55.1    8e-06   Prunus dulcis [sweet almond]
dbj|BAJ41467.1|  S-ribonuclease 3                                     55.5    8e-06   
gb|ACG50928.1|  S1-RNase                                              54.7    9e-06   Prunus simonii [apricot plum]
gb|AEI69725.1|  ribonuclease S24 precursor                            54.7    9e-06   
gb|ADZ74126.1|  self-incompatibility associated ribonuclease S8       55.5    9e-06   
gb|ABW74347.1|  S34-RNase                                             55.5    9e-06   Prunus cerasus [pie cherry]
dbj|BAA83479.1|  S1-RNase                                             55.1    1e-05   Prunus avium [gean]
dbj|BAF91152.1|  S-ribonuclease                                       54.7    1e-05   Prunus mume [ume]
dbj|BAB55853.1|  S-RNase                                              54.3    1e-05   Prunus mume [ume]
gb|ADZ48268.1|  S-locus-associated ribonuclease                       55.1    1e-05   
emb|CAN90136.1|  self-incompatibility ribonuclease                    53.9    1e-05   Prunus domestica
gb|AAP92436.1|  S-RNase                                               55.1    1e-05   Prunus avium [gean]
gb|ABF61823.1|  Sh-RNase                                              54.7    1e-05   Prunus salicina [Japanese plum]
gb|ADD20975.1|  S36-RNase                                             53.5    2e-05   Prunus armeniaca
dbj|BAA88129.1|  S6-RNase                                             53.1    2e-05   Prunus avium [gean]
dbj|BAC56115.1|  S1-RNase                                             54.3    2e-05   Prunus mume [ume]
gb|AAL27620.1|AF432847_1  S-RNase                                     52.0    2e-05   Prunus mume [ume]
dbj|BAB55854.1|  S-RNase                                              53.5    2e-05   Prunus mume [ume]
dbj|BAF91150.1|  S-ribonuclease                                       53.5    2e-05   Prunus mume [ume]
gb|ABW88929.1|  S26-RNase                                             52.4    2e-05   Prunus salicina [Japanese plum]
gb|ABW71897.1|  ribonuclease S5                                       53.5    2e-05   Prunus avium [gean]
dbj|BAC20944.1|  Sh-RNase                                             53.5    2e-05   Prunus salicina [Japanese plum]
gb|AHJ59551.1|  S-RNase 53                                            54.3    2e-05   
emb|CAN90133.1|  self-incompatibility ribonuclease                    53.1    2e-05   Prunus cerasifera [myrobalan plum]
gb|AGH17538.1|  S50-RNase                                             52.4    2e-05   
gb|ABW04810.1|  S-RNase                                               53.1    3e-05   Prunus dulcis [sweet almond]
gb|ABW04811.1|  S-RNase                                               53.1    3e-05   Prunus dulcis [sweet almond]
gb|AAX38607.1|  ribonuclease S6                                       52.8    3e-05   Prunus avium [gean]
gb|ABF61822.1|  S8-RNase                                              53.5    3e-05   Prunus salicina [Japanese plum]
gb|ABV72000.1|  S12-RNase                                             52.4    3e-05   Prunus mume [ume]
ref|XP_008245498.1|  PREDICTED: ribonuclease MC-like                  53.9    3e-05   
gb|AAL59324.1|AF454003_1  RNase                                       52.8    3e-05   Prunus dulcis [sweet almond]
gb|AAK58577.1|  Sh-RNase                                              52.8    3e-05   Prunus dulcis [sweet almond]
gb|AIV99935.1|  S-RNase S51                                           52.8    3e-05   
dbj|BAF56273.1|  S-RNase                                              52.8    4e-05   Prunus speciosa [Oshima cherry]
gb|AFI24539.1|  self-incompatibility associated ribonuclease S6       53.1    4e-05   
dbj|BAA88128.1|  S4-RNase                                             52.0    4e-05   Prunus avium [gean]
gb|AAM22179.1|  RNase                                                 52.4    4e-05   Prunus dulcis [sweet almond]
emb|CAQ51506.1|  self-incompatibility ribonuclease                    52.4    4e-05   Prunus cerasifera [myrobalan plum]
gb|ABW71898.1|  ribonuclease S6                                       52.8    4e-05   Prunus avium [gean]
dbj|BAF56244.1|  S-RNase                                              52.4    4e-05   Prunus speciosa [Oshima cherry]
gb|AAL27625.1|AF432852_1  S-RNase                                     51.2    4e-05   Prunus mume [ume]
emb|CAC27788.1|  RNase S5                                             53.1    4e-05   Prunus avium [gean]
emb|CAJ77725.1|  ribonuclease S6 precursor                            52.8    4e-05   Prunus dulcis [sweet almond]
gb|ABV02077.1|  S-locus S-RNase S24                                   53.1    5e-05   Prunus spinosa [blackthorn]
gb|AAP92435.1|  S-RNase                                               53.1    5e-05   Prunus avium [gean]
gb|ABW04807.1|  S-RNase                                               52.4    5e-05   Prunus dulcis [sweet almond]
dbj|BAH22122.1|  S-RNase                                              53.1    5e-05   Prunus yedoensis [Cheju native flowering cherry]
dbj|BAA36388.1|  S6-RNase                                             53.1    5e-05   Prunus avium [gean]
gb|ABG76221.1|  S-RNase                                               53.1    5e-05   Prunus spinosa [blackthorn]
gb|AAG09286.1|AF177923_1  Se-RNase                                    52.0    5e-05   Prunus dulcis [sweet almond]
dbj|BAF56281.1|  S-RNase                                              52.0    5e-05   Prunus speciosa [Oshima cherry]
gb|AFI24537.1|  self-incompatibility associated ribonuclease S4       53.1    5e-05   
dbj|BAC75458.1|  Sk-RNase                                             52.4    5e-05   Prunus salicina [Japanese plum]
emb|CAQ51505.1|  self-incompatibility ribonuclease                    52.4    5e-05   Prunus cerasifera [myrobalan plum]
gb|AAZ67031.1|  Se-RNase                                              52.4    6e-05   Prunus dulcis [sweet almond]
dbj|BAF56282.1|  S-RNase                                              52.4    6e-05   Prunus speciosa [Oshima cherry]
dbj|BAF56242.1|  S-RNase                                              52.0    6e-05   Prunus speciosa [Oshima cherry]
dbj|BAF56283.1|  S-RNase                                              52.0    6e-05   Prunus speciosa [Oshima cherry]
emb|CAC27789.1|  RNase S6                                             52.8    6e-05   Prunus avium [gean]
gb|AAA33730.1|  Sx-protein                                            52.8    6e-05   Petunia x hybrida [garden petunia]
dbj|BAQ19086.1|  Sm-ribonuclease precursor                            52.4    6e-05   
gb|ABB92553.1|  SRNase precursor                                      52.0    7e-05   Prunus avium [gean]
gb|AAW58933.1|  ribonuclease S1                                       52.0    7e-05   Prunus pseudocerasus [Chinese sour cherry]
dbj|BAF91153.1|  S-ribonuclease                                       52.0    7e-05   Prunus mume [ume]
dbj|BAC75457.1|  Sj-RNase                                             52.0    7e-05   Prunus salicina [Japanese plum]
dbj|BAD11006.1|  non-S RNase                                          52.8    7e-05   Prunus avium [gean]
gb|AEI69728.1|  ribonuclease S6 precursor                             52.0    7e-05   
emb|CAN90138.1|  self-incompatibility ribonuclease                    52.0    7e-05   Prunus domestica
gb|AAF82612.2|AF157008_1  self-incompatibility associated ribonuc...  52.8    8e-05   Prunus dulcis [sweet almond]
dbj|BAF56279.1|  S-RNase                                              51.6    8e-05   Prunus speciosa [Oshima cherry]
gb|ABA26543.1|  S-RNase                                               52.4    8e-05   Prunus dulcis [sweet almond]
dbj|BAF56243.1|  S-RNase                                              51.6    8e-05   Prunus speciosa [Oshima cherry]
gb|ABL86026.1|  S-RNase                                               51.6    9e-05   Prunus tenella [dwarf Russian almond]
emb|CAQ51496.1|  self-incompatibility ribonuclease                    51.6    9e-05   Prunus cerasifera [myrobalan plum]
dbj|BAF56284.1|  S-RNase                                              51.6    9e-05   Prunus speciosa [Oshima cherry]
dbj|BAF91158.1|  S-ribonuclease                                       51.6    9e-05   Prunus mume [ume]
dbj|BAF56270.1|  S-RNase                                              51.6    1e-04   Prunus speciosa [Oshima cherry]
dbj|BAA36387.1|  S2-RNase                                             52.0    1e-04   Prunus avium [gean]
gb|ABV71998.1|  S10-RNase                                             52.4    1e-04   Prunus mume [ume]
gb|AAD51787.1|AF148466_1  Sb-S-RNase                                  51.2    1e-04   Prunus dulcis [sweet almond]
gb|ABQ51154.1|  S15-RNase                                             51.6    1e-04   Prunus armeniaca
emb|CAN90139.1|  self-incompatibility ribonuclease                    51.2    1e-04   Prunus dulcis [sweet almond]
dbj|BAF56280.1|  S-RNase                                              51.6    1e-04   Prunus speciosa [Oshima cherry]
emb|CAA65318.1|  S5-RNase                                             52.4    1e-04   Antirrhinum hispanicum
gb|AAT69245.1|  S2-RNase protein                                      52.4    1e-04   Prunus armeniaca
emb|CAJ77743.1|  ribonuclease S12 precursor                           51.6    1e-04   Prunus dulcis [sweet almond]
gb|ACT35737.1|  So-RNase                                              52.0    1e-04   
gb|ADG57010.1|  self-incompatibility RNase                            50.8    1e-04   
gb|ABW74346.1|  S33-RNase                                             52.4    1e-04   Prunus cerasus [pie cherry]
gb|ADZ74121.1|  self-incompatibility associated ribonuclease S1       52.0    1e-04   
emb|CAZ68890.1|  S-ribonuclease                                       51.6    1e-04   
emb|CAM84221.1|  ribonuclease                                         51.2    1e-04   Prunus webbii
gb|ABY65899.1|  S-RNase                                               52.0    1e-04   Prunus pseudocerasus [Chinese sour cherry]
gb|AFJ20699.1|  putative self-incompatibility S-RNase                 50.8    1e-04   
dbj|BAC75459.1|  Sl-RNase                                             51.2    1e-04   Prunus salicina [Japanese plum]
dbj|BAA83480.1|  S4-RNase                                             52.0    1e-04   Prunus avium [gean]
gb|ABY82412.1|  self-incompatibility associated ribonuclease          52.0    1e-04   Prunus pseudocerasus [Chinese sour cherry]
gb|ABR19609.1|  S22-RNase                                             52.0    1e-04   Prunus avium [gean]
ref|XP_002649213.1|  ribonuclease T2                                  52.0    1e-04   Dictyostelium discoideum AX4
emb|CAC27785.1|  RNase S2                                             52.0    1e-04   Prunus avium [gean]
emb|CAQ51504.1|  self-incompatibility ribonuclease                    50.8    1e-04   Prunus cerasifera [myrobalan plum]
gb|AFI24538.1|  self-incompatibility associated ribonuclease S5       51.6    1e-04   
gb|AAK58579.1|AF267512_1  Si-RNase                                    50.8    1e-04   Prunus dulcis [sweet almond]
gb|ABW04806.1|  S-RNase                                               50.8    1e-04   Prunus dulcis [sweet almond]
gb|AAZ67032.1|  Sf-RNase                                              51.6    1e-04   Prunus dulcis [sweet almond]
gb|AAK58578.1|  Sk-RNase                                              50.8    1e-04   Prunus dulcis [sweet almond]
emb|CAJ77729.1|  ribonuclease S16 precursor                           51.2    1e-04   Prunus dulcis [sweet almond]
dbj|BAF56286.1|  S-RNase                                              50.8    1e-04   Prunus speciosa [Oshima cherry]
emb|CAM84223.1|  ribonuclease                                         51.2    2e-04   Prunus dulcis [sweet almond]
gb|AAZ57490.1|  Si-RNase                                              51.2    2e-04   Prunus dulcis [sweet almond]
dbj|BAF56249.1|  S-RNase                                              50.8    2e-04   Prunus speciosa [Oshima cherry]
emb|CAJ77746.1|  ribonuclease S18 precursor                           51.2    2e-04   Prunus dulcis [sweet almond]
gb|AAZ67034.1|  Sg-RNase                                              51.2    2e-04   Prunus dulcis [sweet almond]
dbj|BAF56251.1|  S-RNase                                              50.8    2e-04   Prunus speciosa [Oshima cherry]
emb|CAJ77736.1|  ribonuclease S25 precursor                           51.2    2e-04   Prunus dulcis [sweet almond]
gb|ABL86035.1|  S-RNase                                               50.8    2e-04   Prunus tenella [dwarf Russian almond]
gb|AAF73756.1|AF149039_1  S1-RNase                                    50.8    2e-04   Prunus dulcis [sweet almond]
emb|CAN90134.1|  self-incompatibility ribonuclease                    50.4    2e-04   Prunus cerasifera [myrobalan plum]
dbj|BAA88127.1|  S3-RNase                                             50.1    2e-04   Prunus avium [gean]
ref|XP_003746238.1|  PREDICTED: ribonuclease DdI-like                 52.0    2e-04   
emb|CAN90135.1|  self-incompatibility ribonuclease                    50.4    2e-04   Prunus cerasifera [myrobalan plum]
dbj|BAA24018.1|  ribonuclease precursor                               51.2    2e-04   Nicotiana alata [flowering tobacco]
dbj|BAF56253.1|  S-RNase                                              50.4    2e-04   Prunus speciosa [Oshima cherry]
gb|AAT72309.1|  S63-RNase                                             50.4    2e-04   Prunus dulcis [sweet almond]
dbj|BAF56255.1|  S-RNase                                              50.4    2e-04   Prunus speciosa [Oshima cherry]
gb|ADZ48270.1|  S-locus-associated ribonuclease                       51.2    2e-04   
gb|AAK15435.1|AF239908_1  self-incompatibility ribonuclease           51.2    2e-04   Petunia axillaris [large white petunia]
dbj|BAI77869.1|  S23-RNase                                            51.2    2e-04   Prunus dulcis [sweet almond]
gb|ABA26546.1|  S-RNase                                               51.2    2e-04   Prunus dulcis [sweet almond]
ref|XP_004517056.1|  PREDICTED: ribonuclease S-1-like                 49.7    2e-04   
gb|ABY82414.1|  self-incompatibility associated ribonuclease          51.2    2e-04   Prunus pseudocerasus [Chinese sour cherry]
gb|ABW88928.1|  S25-RNase                                             49.7    2e-04   Prunus salicina [Japanese plum]
dbj|BAA34663.1|  Sb-RNase                                             51.2    2e-04   Prunus dulcis [sweet almond]
gb|ABY19371.1|  S7-RNase                                              50.1    2e-04   Prunus webbii
dbj|BAF56265.1|  S-RNase                                              50.1    2e-04   Prunus speciosa [Oshima cherry]
gb|ABW88927.1|  S24-RNase                                             49.3    2e-04   Prunus salicina [Japanese plum]
gb|ABV02075.1|  S-locus S-RNase S16                                   51.2    2e-04   Prunus spinosa [blackthorn]
dbj|BAF56276.1|  S-RNase                                              50.1    3e-04   Prunus speciosa [Oshima cherry]
dbj|BAJ24847.1|  Self-incompatibility ribonuclease precursor          51.2    3e-04   
gb|AAM22178.1|  RNase                                                 50.1    3e-04   Prunus dulcis [sweet almond]
dbj|BAF42762.1|  Sk-RNase                                             51.2    3e-04   Prunus dulcis [sweet almond]
gb|ABL86023.1|  S-RNase                                               50.1    3e-04   Prunus tenella [dwarf Russian almond]
dbj|BAF56285.1|  S-RNase                                              50.1    3e-04   Prunus speciosa [Oshima cherry]
gb|AAX38606.1|  ribonuclease S3                                       50.1    3e-04   Prunus avium [gean]
gb|AAL27623.1|AF432850_1  S-RNase                                     48.9    3e-04   Prunus mume [ume]
dbj|BAK19919.1|  self-incompatibility associated ribonuclease         50.1    3e-04   
dbj|BAF91159.1|  S-ribonuclease                                       50.4    3e-04   Prunus mume [ume]
dbj|BAF56246.1|  S-RNase                                              50.1    3e-04   Prunus speciosa [Oshima cherry]
gb|ABD49102.1|  S13m-RNase                                            49.7    3e-04   Prunus cerasus [pie cherry]
dbj|BAF56275.1|  S-RNase                                              50.1    3e-04   Prunus speciosa [Oshima cherry]
gb|ABQ51152.1|  S11-RNase                                             50.4    3e-04   Prunus armeniaca
gb|ABW88924.1|  S21-RNase                                             49.3    3e-04   Prunus salicina [Japanese plum]
gb|ABY82413.1|  self-incompatibility associated ribonuclease          50.8    3e-04   Prunus pseudocerasus [Chinese sour cherry]
ref|XP_004505385.1|  PREDICTED: ribonuclease S-7-like                 50.8    3e-04   
dbj|BAF56267.1|  S-RNase                                              50.1    4e-04   Prunus speciosa [Oshima cherry]
gb|ABV02074.1|  S-locus S-RNase S15                                   50.4    4e-04   Prunus spinosa [blackthorn]
gb|AAT69248.1|  S4-RNase protein                                      50.8    4e-04   Prunus armeniaca
emb|CAQ51499.1|  self-incompatibility ribonuclease                    49.7    4e-04   Prunus cerasifera [myrobalan plum]
gb|ABL86031.1|  S-RNase                                               49.7    4e-04   Prunus tenella [dwarf Russian almond]
gb|ABB85340.1|  S13-RNase protein                                     48.1    4e-04   Prunus armeniaca
dbj|BAF91156.1|  S-ribonuclease                                       49.7    4e-04   Prunus mume [ume]
emb|CAN90141.1|  self-incompatibility ribonuclease                    49.3    4e-04   Prunus mume [ume]
dbj|BAF56274.1|  S-RNase                                              49.7    5e-04   Prunus speciosa [Oshima cherry]
dbj|BAF56252.1|  S-RNase                                              49.3    5e-04   Prunus speciosa [Oshima cherry]
dbj|BAF56263.1|  S-RNase                                              49.3    5e-04   Prunus speciosa [Oshima cherry]
dbj|BAF56261.1|  S-RNase                                              49.7    5e-04   Prunus speciosa [Oshima cherry]
gb|ABB92551.1|  SRNase precursor                                      49.7    5e-04   Prunus avium [gean]
dbj|BAJ41469.1|  S-ribonuclease 4                                     50.4    5e-04   
gb|AAZ91363.1|  S4 S-RNase                                            50.1    5e-04   Prunus webbii
gb|ACG50929.1|  S2-RNase                                              49.7    5e-04   Prunus simonii [apricot plum]
ref|XP_004367303.1|  ribonuclease T2                                  50.1    6e-04   
dbj|BAC56116.1|  S7-RNase                                             50.1    6e-04   Prunus mume [ume]
gb|ABD98450.1|  self-incompatibility ribonuclease                     49.3    6e-04   Prunus dulcis [sweet almond]
gb|ABW04809.1|  S-RNase                                               49.3    6e-04   Prunus dulcis [sweet almond]
emb|CAJ77744.1|  ribonuclease S13 precursor                           48.9    6e-04   Prunus dulcis [sweet almond]
dbj|BAA36389.1|  S3-RNase                                             50.1    6e-04   Prunus avium [gean]
gb|ABW81472.1|  self-incompatibility S13-RNase                        48.9    6e-04   Prunus dulcis [sweet almond]
dbj|BAF56264.1|  S-RNase                                              49.3    6e-04   Prunus speciosa [Oshima cherry]
gb|ACU25554.1|  self-incompatibility associated ribonuclease S4       50.1    6e-04   
emb|CAM84220.1|  ribonuclease                                         49.3    7e-04   Prunus webbii
gb|AAZ91362.1|  S3 S-RNase                                            49.3    7e-04   Prunus webbii
gb|ABY19372.1|  S9-RNase                                              49.3    7e-04   Prunus webbii
gb|ABQ51155.1|  S16-RNase                                             49.3    7e-04   Prunus armeniaca
gb|ABY19369.1|  S5-RNase                                              49.3    7e-04   Prunus webbii
gb|AAL59323.2|  RNase                                                 48.9    7e-04   Prunus dulcis [sweet almond]
emb|CAJ77745.1|  ribonuclease S14 precursor                           49.3    8e-04   Prunus dulcis [sweet almond]
gb|ABD49101.1|  S13-RNase                                             49.7    8e-04   Prunus avium [gean]
gb|ABY82415.1|  self-incompatibility associated ribonuclease          49.7    8e-04   Prunus pseudocerasus [Chinese sour cherry]
gb|AAL59321.1|AF454000_1  RNase                                       48.9    9e-04   Prunus dulcis [sweet almond]
gb|AAZ91370.1|  S10 S-RNase                                           48.5    9e-04   Prunus webbii
gb|AAZ67033.1|  Sg-RNase                                              49.3    9e-04   Prunus dulcis [sweet almond]
gb|AAL35747.1|  RNase                                                 48.5    9e-04   Prunus dulcis [sweet almond]
ref|XP_640939.1|  ribonuclease T2                                     49.3    0.001   Dictyostelium discoideum AX4
gb|ADZ48267.1|  S-locus-associated ribonuclease                       49.3    0.001   
dbj|BAF56257.1|  S-RNase                                              48.5    0.001   Prunus speciosa [Oshima cherry]
gb|ABV02076.1|  S-locus S-RNase S19                                   48.9    0.001   Prunus spinosa [blackthorn]



>dbj|BAF36289.1| hypothetical protein [Ipomoea trifida]
Length=139

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  225  MVGYLPEFPSNCCSLDAISDQKS*LDGISHGGFSERSFWSVYWTETSFPTNISRFPSNIC  404
            MVGY  EFPSN   LD IS Q   LDGI+   FS  SFW+  W+ET  PTN   FPSN+ 
Sbjct  1    MVGYDSEFPSNFDLLDGISVQHKMLDGITDARFSGSSFWTECWSETHLPTNNPHFPSNMR  60

Query  405  WTENARFPAV  434
            WTE A FPAV
Sbjct  61   WTEIAGFPAV  70



>dbj|BAF56262.1| S-RNase [Prunus speciosa]
Length=179

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
             +F   WP   C+ + C   +++Q+FTIHGLWP + S  ++P        N++ +  KL 
Sbjct  2    FQFVQQWPPTNCRVRKCSKPRLLQNFTIHGLWPSNYSNPTVPSNCMGSQFNERNLSPKLL  61

Query  495  SQLVKDWPGLEQQDDSLFW  439
            ++L + WP +E  +D+ FW
Sbjct  62   NKLKRSWPDVESGNDTNFW  80



>gb|AGH17537.1| S49-RNase, partial [Prunus dulcis]
Length=110

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q+FTIHGLWP + S  ++P        +D+ +  +L
Sbjct  21   FQFVQQWPPTNCRVRTKCSKPRPLQYFTIHGLWPSNYSNPTMPSNCNGSKFDDRNVSPQL  80

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  81   RNKLKRSWPDVESGNDTKFW  100



>gb|ABG76219.1| S-RNase [Prunus spinosa]
Length=204

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        N+  +  +L
Sbjct  12   FQFVQQWPPTTCRVRGKCSNPRPIQIFTIHGLWPSNYSNPTMPSNCIGSQFNESRVSPRL  71

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L + WP +E  +D+ FWA
Sbjct  72   RSKLKRSWPNVEGSNDTRFWA  92



>gb|ADD20973.1| S35-RNase [Prunus armeniaca]
Length=167

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  672  KFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
            +F   WP   C   TK C  ++ +Q FTIHGLWP + S  ++P      P N+  +  +L
Sbjct  1    QFVQQWPPATCIRSTKPCSKHRPLQIFTIHGLWPSNYSNPTMPSNCVGSPFNESRLPPQL  60

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  61   RSKLKISWPDVESGNDTKFW  80



>dbj|BAJ13374.1| St-RNase [Prunus salicina]
Length=175

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        +D+ +  +L
Sbjct  13   FQFVQQWPPTNCRIRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSTCNGSKFDDRNVSPQL  72

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  73   RAKLKRSWPDVESGNDTRFW  92



>gb|ABS30926.1| Sc-RNase [Prunus armeniaca]
Length=186

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  ++P        ND+ +  +
Sbjct  22   FQFVQQWPPTTCRVRWKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCTGSQFNDRKVYPQ  81

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  82   LRSKLKRSWPNVESGNDTKFW  102



>gb|ABS30928.1| Sc-RNase [Prunus armeniaca]
Length=186

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C   + +Q FTIHGLWP + S  ++P        ND+ +  +
Sbjct  22   FQFVQQWPPTTCGVRWKPCSKPRPLQIFTIHGLWPSNYSNPTMPSYCTGSQFNDRKVYPQ  81

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  82   LRSKLKRSWPNVESGNDTKFW  102



>gb|ABQ51153.1| S13-RNase [Prunus armeniaca]
Length=201

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P         D+ +  +L
Sbjct  23   FQFVQQWPPTNCRVRTKCANPRPLQIFTIHGLWPSNYSNPTMPSNCNGSKFEDRKVSPQL  82

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  83   RSKLKRSWPDVESGNDTKFW  102



>gb|ABO34168.1| Sc-RNase [Prunus armeniaca]
Length=189

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C   + +Q FTIHGLWP + S  ++P        ND+ +  +
Sbjct  25   FQFVQQWPPTTCGVRWKPCSKPRPLQIFTIHGLWPSNYSNPTMPSYCTGSQFNDRKVYPQ  84

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  85   LRSKLKRSWPNVESGNDTKFW  105



>gb|ABO34167.1| S8-RNase, partial [Prunus armeniaca]
Length=190

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C   + +Q FTIHGLWP + S  ++P        ND+ +  +
Sbjct  22   FQFVQQWPPTTCGVRWKPCSKPRPLQIFTIHGLWPSNYSNPTMPSYCTGSQFNDRKVYPQ  81

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  82   LRSKLKRSWPNVESGNDTKFW  102



>gb|ABE27180.1| S-locus S-RNase c [Prunus armeniaca]
Length=226

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  ++P        ND+ +  +
Sbjct  31   FQFVQQWPPTTCRVRWKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCTGSQFNDRKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  91   LRSKLKRSWPNVESGNDTKFW  111



>dbj|BAF56258.1| S-RNase [Prunus speciosa]
Length=170

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEDRKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLR++L K WP +E  +D+ FW
Sbjct  62   KLRAKLKKSWPDVESGNDTRFW  83



>gb|ABY19368.1| S3-RNase [Prunus webbii]
Length=201

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P         D+ +  +L
Sbjct  23   FQFVQQWPPTNCRVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSNCNGSKFEDRKVSPQL  82

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  83   RSKLKRSWPDVESGNDTKFW  102



>dbj|BAA88126.1| S1-RNase [Prunus avium]
Length=132

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  13   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYP  72

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  73   KLRSKLKRSWPDVESGNDTRFW  94



>dbj|BAF56272.1| S-RNase [Prunus speciosa]
Length=174

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C   TK C  ++ +Q FTIHGLWP + S   +P        N+  +  +
Sbjct  2    FQFVQQWPPATCIRSTKPCSKHRPLQIFTIHGLWPSNYSNPKMPSNCVGSQFNESKLYPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  62   LRSRLKRSWPDVESGNDTKFW  82



>gb|ABY65900.1| S-RNase [Prunus pseudocerasus]
Length=208

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q+FTIHGLWP + S  ++P         D+ +  +
Sbjct  9    FQFVQQWPPTNCKVRGKPCSKPRPLQYFTIHGLWPSNYSNPTMPSNCNGLKFEDRKVYPQ  68

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  69   LRSKLKRSWPDVESGNDTKFW  89



>gb|ACU25553.1| self-incompatibility associated ribonuclease S2 [Prunus pseudocerasus]
Length=225

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q+FTIHGLWP + S  ++P         D+ +  +
Sbjct  31   FQFVQQWPPTNCKVRGKPCSKPRPLQYFTIHGLWPSNYSNPTMPSNCNGLKFEDRKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  91   LRSKLKRSWPDVESGNDTKFW  111



>gb|ABW04805.1| S-RNase [Prunus dulcis]
Length=170

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  62   KLRSKLKRSWPDVESGNDTRFW  83



>gb|AAT69244.1| S1-RNase protein [Prunus armeniaca]
Length=229

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        +D+ +  +L
Sbjct  31   FQFVQQWPPTNCRVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSNCNGSKFDDRNVSPQL  90

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  91   RAKLKRSWPDVESGNDTRFW  110



>gb|ABS30927.1| Sc-RNase [Prunus armeniaca]
Length=186

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FT HGLWP + S  ++P        ND+ +  +
Sbjct  22   FQFVQQWPPTTCRVRWKPCSKPRPLQIFTTHGLWPSNYSNPTMPSNCTGSQFNDRKVYPQ  81

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  82   LRSKLKRSWPNVESGNDTKFW  102



>gb|AAL27624.1|AF432851_1 S-RNase [Prunus mume]
Length=87

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 1/78 (1%)
 Frame = -2

Query  669  FALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRS  493
            F   WP   C+ +  C   + +Q FTIHGLWP + S  + P         + ++  +LRS
Sbjct  1    FVQQWPPTTCRVRGKCSNPRPIQIFTIHGLWPSNYSNPTTPSNCIGSQFKESMVSPRLRS  60

Query  492  QLVKDWPGLEQQDDSLFW  439
            +L + WP +E  +D+ FW
Sbjct  61   KLKRSWPNVEGSNDTRFW  78



>dbj|BAF56259.1| S-RNase [Prunus speciosa]
Length=167

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   +  Q FTIHGLWP + S   +P        N+  +  KL
Sbjct  2    FQFVQQWPPTNCKIRTKCSKPRPSQMFTIHGLWPSNYSNPKMPSNCMGSRFNESNLSPKL  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  62   RSKLKRSWPDVESGNDTKFW  81



>gb|ABY19370.1| S6-RNase [Prunus webbii]
Length=189

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S   +P        N+  +  KL
Sbjct  21   FQFVQQWPPTNCKIRTKCSKPRPLQMFTIHGLWPSNYSNPKMPSNCMGSRFNESNLSPKL  80

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  81   RSKLKRSWPDVESGNDTKFW  100



>dbj|BAC20942.1| Se-RNase [Prunus salicina]
Length=133

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S   +P         D+ +  +L
Sbjct  15   FQFVQQWPPTNCKVRTKCSNPRPLQIFTIHGLWPSNYSNPPMPSNCNGSKFEDRKVSPQL  74

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  75   RSKLKRXWPDVESGNDTKFW  94



>emb|CAQ51501.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=167

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  1    FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  61   KLRSKLKRSWPDVESGNDTRFW  82



>gb|AFI24534.1| self-incompatibility associated ribonuclease S1, partial [Prunus 
virginiana]
Length=194

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C     +Q FTIHGLWP + S  + P     P  +D+ +  
Sbjct  25   FQFVQQWPPTNCRVRIKQPCSKPLPLQRFTIHGLWPSNYSNPTTPSNCNGPKFDDRKVYP  84

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L + WP +E  +D+ FW
Sbjct  85   QLRSKLKRSWPDVESGNDTKFW  106



>gb|ACU25555.1| self-incompatibility associated ribonuclease S6 [Prunus pseudocerasus]
Length=228

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  ++P      P   KI+  
Sbjct  33   FQFVQQWPPTNCRVHIKQPCSNPRPLQYFTIHGLWPSNYSNPTIPS-NCTGPQFKKILSP  91

Query  504  KLRSQLVKDWPGLEQQDDSLFWA  436
            +LRS L++ WP +E  +D+ FWA
Sbjct  92   QLRSSLMRSWPDVESGNDTRFWA  114



>dbj|BAF91848.1| Se-RNase [Prunus salicina]
Length=239

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P         D+ +  +L
Sbjct  33   FQFVQQWPPTNCKVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSNCNGSKFEDRKVSPQL  92

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  93   RSKLKRSWPDVESGNDTKFW  112



>emb|CAJ77735.1| ribonuclease S24 precursor [Prunus dulcis]
Length=189

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  21   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVYP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  81   KLRSKLKRSWPDVESGNDTRFW  102



>emb|CAJ77742.1| ribonuclease S11 precursor [Prunus dulcis]
 emb|CAZ68887.1| S-ribonuclease, partial [Prunus dulcis]
Length=189

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  21   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  81   KLRSKLKRSWPDVESGNDTRFW  102



>gb|ABY78035.1| S1-RNase [Prunus simonii]
Length=176

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQ-TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q FTIHGLWP + S  + P        +D+ +  +L
Sbjct  5    FQFVQQWPPTNCKIRKKCSKPRPLQMFTIHGLWPSNHSNPTTPSNCNGAQFDDRKVYPRL  64

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  65   RSKLKISWPDVENGNDTKFW  84



>gb|AAM22180.1|AF490505_1 RNase [Prunus dulcis]
 gb|AAM76698.1| RNase [Prunus dulcis]
Length=161

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -2

Query  657  WPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQLVK  481
            WP   C+ +  C   + +Q+FTIHGLWP + S  ++P        +D+ +  +LR++L +
Sbjct  4    WPPTNCRVRTKCSKPRPLQYFTIHGLWPSNYSNPTMPSNCNGSKFDDRNVSPQLRNKLKR  63

Query  480  DWPGLEQQDDSLFW  439
             WP +E  +D+ FW
Sbjct  64   SWPDVESGNDTKFW  77



>dbj|BAF56247.1| S-RNase [Prunus speciosa]
Length=171

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P        + + +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTVPSNCNGSKFDARKVSP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS++ + WP +E  +D+ FW
Sbjct  62   RLRSKVTRSWPDVESGNDTRFW  83



>gb|AAL27622.1|AF432849_1 S-RNase [Prunus mume]
Length=89

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 3/81 (4%)
 Frame = -2

Query  669  FALTWPNGYCQTK---ACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
            F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  KL
Sbjct  1    FVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNFSNPTKPSNCNGSKYEDRKVYPKL  60

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L + WP +E  +D+ FW 
Sbjct  61   RSKLKRSWPDVESGNDTRFWE  81



>gb|ACG50930.1| S3-RNase [Prunus simonii]
Length=202

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P    +  +  + +  +L
Sbjct  24   FQFVQQWPPTNCKVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPRQYCMGRIGGRKVSPQL  83

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  84   RSKLKRSWPDVESGNDTKFW  103



>gb|ABL86027.1| S-RNase [Prunus tenella]
 gb|ABL86028.1| S8-RNase [Prunus tenella]
Length=208

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  13   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYP  72

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  73   KLRSKLKRSWPDVESGNDTRFW  94



>gb|AAZ57489.1| Si-RNase [Prunus dulcis]
 gb|AAZ94295.1| Si-RNase [Prunus dulcis]
Length=198

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  30   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVYP  89

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  90   KLRSKLKRSWPDVESGNDTRFW  111



>dbj|BAJ41467.1| S-ribonuclease 3 [Prunus persica]
Length=228

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  33   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEDRKVYP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLR++L K WP +E  +D+ FW
Sbjct  93   KLRAKLKKSWPDVESGNDTRFW  114



>gb|ACG50928.1| S1-RNase [Prunus simonii]
Length=191

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQ-TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q FTIHGLWP + S  + P        +D+ +  +L
Sbjct  20   FQFVQQWPPTNCKIRKKCSKPRPLQMFTIHGLWPSNHSNPTTPSNCNGAQFDDRKVYPRL  79

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  80   RSKLKISWPDVENGNDTKFW  99



>gb|AEI69725.1| ribonuclease S24 precursor [Prunus dulcis]
Length=189

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S    P         D+ +  
Sbjct  21   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPRKPSNCNGAKYEDRKVYP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  81   KLRSKLKRSWPDVESGNDTRFW  102



>gb|ADZ74126.1| self-incompatibility associated ribonuclease S8 [Prunus pseudocerasus]
Length=234

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C   TK C  ++ +Q FTIHGLWP + S   +P        N+  +  +
Sbjct  35   FQFVQQWPPATCIRSTKPCSKHRPLQIFTIHGLWPSNYSNPKMPSNCVGSQFNESKLYPQ  94

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  95   LRSRLKRSWPDVESGNDTKFW  115



>gb|ABW74347.1| S34-RNase [Prunus cerasus]
Length=226

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  91   KLRSKLKRSWPDVESGNDTRFW  112



>dbj|BAA83479.1| S1-RNase [Prunus avium]
 emb|CAC27784.1| RNase S1 [Prunus avium]
Length=226

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  91   KLRSKLKRSWPDVESGNDTRFW  112



>dbj|BAF91152.1| S-ribonuclease [Prunus mume]
Length=187

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  20   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNFSNPTKPSNCNGSKYEDRKVYP  79

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  80   KLRSKLKRSWPDVESGNDTRFW  101



>dbj|BAB55853.1| S-RNase [Prunus mume]
Length=183

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  + P         + ++  +L
Sbjct  20   FQFVQQWPPTTCRVRGKCSNPRPIQIFTIHGLWPSNYSNPTTPSNCIGSQFKESMVSPRL  79

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  80   RSKLKRSWPNVEGSNDTRFW  99



>gb|ADZ48268.1| S-locus-associated ribonuclease [Prunus pseudocerasus]
Length=223

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q+FTIHGLWP + S  + P        +D+ +  +
Sbjct  31   FQFVQQWPPTNCRVRKIPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKFDDRKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  91   LRSKLKRSWPDVESGNDTKFW  111



>emb|CAN90136.1| self-incompatibility ribonuclease [Prunus domestica]
Length=169

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  1    FQFVQQWPPTNCRVRLKRPCSKPRPLQNFTIHGLWPSNFSNPTKPSNCNGSKYEDRKVYP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  61   KLRSKLKRSWPDVESGNDTRFW  82



>gb|AAP92436.1| S-RNase [Prunus avium]
Length=236

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P         ++ +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSNPRPLQNFTIHGLWPSNYSNPTMPSNCAGSEFKERKLSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D  FW
Sbjct  91   KLRSKLKRSWPDVESGNDPRFW  112



>gb|ABF61823.1| Sh-RNase [Prunus salicina]
Length=218

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQ-TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q FTIHGLWP + S  + P        +D+ +  +L
Sbjct  20   FQFVQQWPPTNCKIRKKCSKPRPLQMFTIHGLWPSNHSNPTTPSNCNGAQFDDRKVYPRL  79

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  80   RSKLKISWPDVENGNDTKFW  99



>gb|ADD20975.1| S36-RNase [Prunus armeniaca]
Length=173

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 3/80 (4%)
 Frame = -2

Query  669  FALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
            F   WP   C+    K C   + +Q+FTIHGLWP + S  ++P         D+ +  +L
Sbjct  1    FVQQWPPINCRVRNKKPCSNPRPLQYFTIHGLWPSNYSNPTMPSNCNGSQFEDRKVYPQL  60

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L K WP +E  +D+ FW
Sbjct  61   RTKLKKSWPDVEDGNDTKFW  80



>dbj|BAA88129.1| S6-RNase [Prunus avium]
Length=131

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   + P     P   +I+  
Sbjct  13   FQFVQQWPPTNCRVRIKRPCSSPRPLQYFTIHGLWPSNYSNPRM-PSNCTGPQFKRILSP  71

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L   WP +E  +D+ FW
Sbjct  72   QLRSKLQTSWPDVESGNDTKFW  93



>dbj|BAC56115.1| S1-RNase [Prunus mume]
 dbj|BAF91149.1| S-ribonuclease [Prunus mume]
Length=224

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  + P         + ++  +L
Sbjct  33   FQFVQQWPPTTCRVRGKCSNPRPIQIFTIHGLWPSNYSNPTTPSNCIGSQFKESMVSPRL  92

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  93   RSKLKRSWPNVEGSNDTRFW  112



>gb|AAL27620.1|AF432847_1 S-RNase [Prunus mume]
Length=87

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (54%), Gaps = 1/78 (1%)
 Frame = -2

Query  669  FALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRS  493
            F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +LR+
Sbjct  1    FVQQWPPTNCRVRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQLRN  60

Query  492  QLVKDWPGLEQQDDSLFW  439
            +L + WP +E  +D+ FW
Sbjct  61   KLKRSWPDVESGNDTKFW  78



>dbj|BAB55854.1| S-RNase [Prunus mume]
Length=180

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +L
Sbjct  18   FQFVQQWPPTNCRVRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQL  77

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  78   RNKLKRSWPDVESGNDTKFW  97



>dbj|BAF91150.1| S-ribonuclease [Prunus mume]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +L
Sbjct  18   FQFVQQWPPTNCRVRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQL  77

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  78   RNKLKRSWPDVESGNDTKFW  97



>gb|ABW88929.1| S26-RNase [Prunus salicina]
Length=117

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C  + K C   +++Q+FTIHGLWP + S  ++P          + +  +
Sbjct  31   FQFVQQWPPTTCGVRGKPCSKPRLLQNFTIHGLWPSNYSNPTMPSNCNGSKFEARKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  91   LRSDLKISWPDVESGNDTKFW  111



>gb|ABW71897.1| ribonuclease S5 [Prunus avium]
Length=191

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q+FTIHGLWP + S   +P        N+  +  +L
Sbjct  21   FQFVQQWPPTNCRVRTKCSNPRPLQYFTIHGLWPSNYSNPKMPSNCIGSQFNESKVYPRL  80

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L   WP +E  +D+ FW 
Sbjct  81   RSKLRISWPDVESGNDTKFWG  101



>dbj|BAC20944.1| Sh-RNase [Prunus salicina]
Length=175

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQ-TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q F IHGLWP + S  + P        +D+ +  +L
Sbjct  13   FQFVQQWPPTNCKIRKKCSKPRPLQMFAIHGLWPSNHSNPTTPSNCNGAQFDDRKVYPRL  72

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  73   RSKLKISWPDVENGNDTKFW  92



>gb|AHJ59551.1| S-RNase 53 [Prunus armeniaca]
Length=242

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C   K C  +  +Q FTIHGLWP + S  +LP         D+ +  +L
Sbjct  31   FQFVQQWPPTTCNAPKKCSKSPPLQIFTIHGLWPSNYSNPTLPSNCNGSQFEDRKVYPEL  90

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS L + WP ++  +D+ FWA
Sbjct  91   RSDLKRSWPDVKNGNDTNFWA  111



>emb|CAN90133.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=171

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 43/83 (52%), Gaps = 3/83 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P          K +  
Sbjct  1    FQFVQQWPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEAKKLSP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFWA  436
            ++R++L K WP +E  +D+ FWA
Sbjct  61   EMRTKLKKSWPDVESGNDTKFWA  83



>gb|AGH17538.1| S50-RNase, partial [Prunus dulcis]
Length=110

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGL P + S  ++P        +D+ +  +L
Sbjct  21   FQFVQQWPPTNCRVRTKCSKPRPLQCFTIHGLRPSNYSNPTMPSNCNGSKFDDRNVSPQL  80

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  81   RNKLKRSWPDVESGNDTKFW  100



>gb|ABW04810.1| S-RNase [Prunus dulcis]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C  +  C   + +Q FTIHGLWP + S  ++P      P + + +  +L
Sbjct  2    FQFVQQWPPTNCIIRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGSPFDARKVYPQL  61

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            R++L   WP +E  +D+ FWA
Sbjct  62   RTKLKISWPDVESGNDTRFWA  82



>gb|ABW04811.1| S-RNase [Prunus dulcis]
 gb|AIV99936.1| S-RNase S35-1, partial [Prunus dulcis]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C  +  C   + +Q FTIHGLWP + S  ++P      P + + +  +L
Sbjct  2    FQFVQQWPPTNCIIRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGSPFDARKVYPQL  61

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            R++L   WP +E  +D+ FWA
Sbjct  62   RTKLKISWPDVESGNDTRFWA  82



>gb|AAX38607.1| ribonuclease S6 [Prunus avium]
Length=167

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   + P     P   +I+  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSSPRPLQYFTIHGLWPSNYSNPRM-PSNCTGPQFKRILSP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L   WP +E  +D+ FW
Sbjct  61   QLRSKLQTSWPDVESGNDTKFW  82



>gb|ABF61822.1| S8-RNase [Prunus salicina]
Length=213

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ K   I ++ +Q+FTIHGLWP + S  ++P        + + +  +L
Sbjct  22   FQFVQQWPPTTCRLKRPSIKHRPLQNFTIHGLWPSNYSNPTMPSNCRGSQFDARNLSPRL  81

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +S+L + WP +E  +D+ FW
Sbjct  82   QSKLKRSWPDVESSNDTRFW  101



>gb|ABV72000.1| S12-RNase [Prunus mume]
Length=146

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  + P        +D+ +  +
Sbjct  20   FQFVQQWPPTNCRVRNKPCSKPQPLQIFTIHGLWPSNYSNPTTPSNCNGSQFDDRKVYPQ  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L + WP +E  +D+ FW
Sbjct  80   LRTKLKRSWPDVEDGNDTKFW  100



>ref|XP_008245498.1| PREDICTED: ribonuclease MC-like [Prunus mume]
Length=233

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P        + + +  
Sbjct  33   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTVPSNCNGSKFDARKVSP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR++L K WP +E  +D+ FW
Sbjct  93   QLRNKLTKSWPDVESGNDTKFW  114



>gb|AAL59324.1|AF454003_1 RNase [Prunus dulcis]
Length=165

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 3/76 (4%)
 Frame = -2

Query  657  WPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQL  487
            WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  KLRS+L
Sbjct  4    WPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVYPKLRSKL  63

Query  486  VKDWPGLEQQDDSLFW  439
             + WP +E  +D+ FW
Sbjct  64   KRSWPDVESGNDTRFW  79



>gb|AAK58577.1| Sh-RNase [Prunus dulcis]
Length=178

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  672  KFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            +F   WP   C  +  C   + +Q FTIHGLWP + S  ++P      P + + +  +LR
Sbjct  1    QFVQQWPPTNCIIRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGSPFDARKVYPQLR  60

Query  495  SQLVKDWPGLEQQDDSLFWA  436
            ++L   WP +E  +D+ FWA
Sbjct  61   TKLKISWPDVESGNDTRFWA  80



>gb|AIV99935.1| S-RNase S51, partial [Prunus dulcis]
Length=174

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  ++P      P   K +  +
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCNGSPFEAKKVYPR  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L+S+L   WP +E  +D+ FW
Sbjct  62   LQSKLKISWPDVESGNDTNFW  82



>dbj|BAF56273.1| S-RNase [Prunus speciosa]
Length=170

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTRPSNCNGSQFDARKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L + WP +E  +D+ FW
Sbjct  62   RLRSRLNRSWPDVESGNDTKFW  83



>gb|AFI24539.1| self-incompatibility associated ribonuclease S6, partial [Prunus 
virginiana]
Length=195

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  ++P          +I+   
Sbjct  31   FQFVRQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNHSNPTMPSNCNGTQFK-RILSPD  89

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L + WP +E  DD+ FW
Sbjct  90   LRSDLTRSWPDVESGDDTKFW  110



>dbj|BAA88128.1| S4-RNase [Prunus avium]
Length=131

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S   +P        N + +  +
Sbjct  13   FQFVQQWPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQ  72

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  73   LRSDLKISWPDVESGNDTRFW  93



>gb|AAM22179.1| RNase [Prunus dulcis]
 gb|AAM76696.1| RNase [Prunus dulcis]
 gb|ABD98449.1| self-incompatibility ribonuclease, partial [Prunus dulcis]
Length=165

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 40/76 (53%), Gaps = 3/76 (4%)
 Frame = -2

Query  657  WPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQL  487
            WP   C+ +    C   + +Q FTIHGLWP + S  + P         D+ +  KLRS+L
Sbjct  4    WPPTNCRVRIKRPCSKPRPLQRFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYPKLRSKL  63

Query  486  VKDWPGLEQQDDSLFW  439
             + WP +E  +D+ FW
Sbjct  64   KRSWPDVESGNDTRFW  79



>emb|CAQ51506.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=173

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = -2

Query  672  KFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
            +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  +
Sbjct  6    QFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTRPSNCNGSQFDARKVYPR  65

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  66   LRSRLNRSWPDVESGNDTKFW  86



>gb|ABW71898.1| ribonuclease S6 [Prunus avium]
Length=188

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   +P      P   +I+  
Sbjct  21   FQFVQQWPPTNCRVRIKRPCSSPRPLQYFTIHGLWPSNYSNPRMPS-NCTGPQFKRILSP  79

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L   WP +E  +D+ FW
Sbjct  80   QLRSKLQTSWPDVESGNDTKFW  101



>dbj|BAF56244.1| S-RNase [Prunus speciosa]
Length=168

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  ++P          +I+   
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNHSNPTMPSNCNGTQFK-RILSPD  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L + WP +E  DD+ FW
Sbjct  61   LRSDLTRSWPDVESGDDTKFW  81



>gb|AAL27625.1|AF432852_1 S-RNase [Prunus mume]
Length=88

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = -2

Query  669  FALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            F   WP   C+  ++    ++ +Q FTIHGLWP + S  + P        ND  +  KLR
Sbjct  1    FVQQWPPTTCKLSSRPSCKHRPLQIFTIHGLWPSNYSNPTRPSNCIGSKYNDSKLYPKLR  60

Query  495  SQLVKDWPGLEQQDDSLFW  439
            S+L + WP +E  +D+ FW
Sbjct  61   SKLKRSWPNVETDNDTKFW  79



>emb|CAC27788.1| RNase S5 [Prunus avium]
Length=226

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q+FTIHGLWP + S   +P        N+  +  +L
Sbjct  31   FQFVQQWPPTNCRVRTKCSNPRPLQYFTIHGLWPSNYSNPKMPSNCIGSQFNESKVYPRL  90

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L   WP +E  +D+ FW 
Sbjct  91   RSKLRISWPDVESGNDTKFWG  111



>emb|CAJ77725.1| ribonuclease S6 precursor [Prunus dulcis]
Length=185

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +L
Sbjct  21   FQFVQQWPPTNCRVRTKCSNPRPLQVFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQL  80

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  81   RNKLKRSWPDVESGNDTKFW  100



>gb|ABV02077.1| S-locus S-RNase S24 [Prunus spinosa]
Length=208

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K+C  ++ +Q FTIHGLWP + S  + P         D+ +  +
Sbjct  12   FQFVQQWPPATCIRSKKSCSKHRPLQIFTIHGLWPSNYSQPTRPSNCAGSLYEDRKVYPQ  71

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L + WP +E  +D  FW
Sbjct  72   LRSDLKRSWPDVESGNDIQFW  92



>gb|AAP92435.1| S-RNase [Prunus avium]
Length=222

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C  ++ +Q FTIHGLWP + S   +P      P   +I+  +
Sbjct  31   FQFVQQWPPATCIRSNKPCSKHRPLQIFTIHGLWPSNYSNPRMPS-NCTGPQFKRILSPQ  89

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  90   LRSKLQTSWPDVESGNDTKFW  110



>gb|ABW04807.1| S-RNase [Prunus dulcis]
 gb|AIV99937.1| S-RNase S31-1, partial [Prunus dulcis]
Length=174

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        +D+ +  
Sbjct  1    FQFVQQWPPTNCRVRNKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQYDDRKVYP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             LRS L + WP +E  +D+ FW
Sbjct  61   DLRSDLKRSWPDVESGNDTKFW  82



>dbj|BAH22122.1| S-RNase [Prunus yedoensis]
 dbj|BAH22124.1| S-RNase [Prunus yedoensis]
Length=223

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ ++  C   + +Q+FTIHGLWP + S    P        ND  +  +
Sbjct  31   FQFVQQWPPTNCRVRSKPCSKPRPLQNFTIHGLWPSNYSNPRAPSNCNGSRFNDGKLSPE  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L   WP +E  +D+ FW
Sbjct  91   LRAKLKISWPDVENGNDTKFW  111



>dbj|BAA36388.1| S6-RNase [Prunus avium]
 gb|AAT72120.1| S6-RNase [Prunus avium]
Length=223

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   +P      P   +I+  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSSPRPLQYFTIHGLWPSNYSNPRMPS-NCTGPQFKRILSP  89

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L   WP +E  +D+ FW
Sbjct  90   QLRSKLQTSWPDVESGNDTKFW  111



>gb|ABG76221.1| S-RNase [Prunus spinosa]
Length=215

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P         ++ +  +L
Sbjct  10   FQFVQQWPPTNCKIRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGAHFENRKVYPQL  69

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  70   RSKLKRSWPDVESGNDTNFW  89



>gb|AAG09286.1|AF177923_1 Se-RNase [Prunus dulcis]
Length=162

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -2

Query  672  KFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            +F   WP   C+ +  C   + +Q+FTIHGLWP + S    P        +D+ +  +LR
Sbjct  1    QFVQQWPPTNCRVRTKCSKPRPLQYFTIHGLWPSNYS-NPTPSNCNGSKFDDRNVSPQLR  59

Query  495  SQLVKDWPGLEQQDDSLFW  439
            ++L + WP +E  +D+ FW
Sbjct  60   NKLKRSWPDVESGNDTKFW  78



>dbj|BAF56281.1| S-RNase [Prunus speciosa]
Length=168

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSSPTKPSNCNGSQFDTRKVSP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  62   KMRIKLKKSWPDVESGNDTRFW  83



>gb|AFI24537.1| self-incompatibility associated ribonuclease S4, partial [Prunus 
virginiana]
Length=217

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   +P      P   +I+  
Sbjct  25   FQFVQQWPPTNCRVRIKRPCSSPRPLQYFTIHGLWPSNYSNPRMPS-NCTGPQFKRILSP  83

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L   WP +E  +D+ FW
Sbjct  84   QLRSKLQTSWPDVESGNDTKFW  105



>dbj|BAC75458.1| Sk-RNase [Prunus salicina]
Length=187

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q FTIHGLWP + S  + P        +D+ +  +
Sbjct  15   FQFVQQWPPTNCRVRKQPCSKPRPLQIFTIHGLWPSNYSNPTKPSNCNGSQFDDRKVYPQ  74

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L + WP +E  +D+ FW
Sbjct  75   LRTKLKRSWPDVEDGNDTKFW  95



>emb|CAQ51505.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=179

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C  ++ +Q FTIHGLWP + S  ++P      P N+  +  ++
Sbjct  1    FQFVQQWPPTTCRIQKKCSNSQPLQIFTIHGLWPSNYSNPTMPSNCHGSPFNESNLSPEM  60

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            R +L + WP +   +D+ FW 
Sbjct  61   RLRLKRSWPDVVSGNDTEFWG  81



>gb|AAZ67031.1| Se-RNase [Prunus dulcis]
Length=195

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +L
Sbjct  31   FQFVQQWPPTNCRVRTKCSNPRPLQVFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQL  90

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  91   RNKLKRSWPDVESGNDTKFW  110



>dbj|BAF56282.1| S-RNase [Prunus speciosa]
Length=182

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C   T+ C  ++ +Q FTIHGLWP + S  ++P            +  K
Sbjct  2    FQFVQQWPPATCIRSTRPCSKHRPLQIFTIHGLWPSNYSKPTMPGNCVGSEFKMDNLSPK  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E+ +D+ FW
Sbjct  62   LRSKLKISWPDVERSNDTEFW  82



>dbj|BAF56242.1| S-RNase [Prunus speciosa]
Length=170

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P        N   +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTMPSKCTGSKFNFTKVFP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             LRS L K WP +E  +D+ FW
Sbjct  62   YLRSNLKKSWPDVESGNDTKFW  83



>dbj|BAF56283.1| S-RNase [Prunus speciosa]
Length=167

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S   +P        N + +  +
Sbjct  2    FQFVQQWPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  62   LRSDLKISWPDVESGNDTRFW  82



>emb|CAC27789.1| RNase S6 [Prunus avium]
Length=223

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   +P      P   +I+  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSSPRPLQYFTIHGLWPSNYSNPRMPS-NCTGPQFKRILSP  89

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L   WP +E  +D+ FW
Sbjct  90   QLRSKLQTSWPDVESGNDTKFW  111



>gb|AAA33730.1| Sx-protein [Petunia x hybrida]
 dbj|BAQ19087.1| S0m-ribonuclease precursor [Petunia x hybrida]
Length=222

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 8/72 (11%)
 Frame = -2

Query  672  KFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQS---WTSLPPVKGLPPLNDKIIDAK  502
            +  LTWP GYC+ K C    I  +FTIHGLWP   S   +   PP +      +KI +  
Sbjct  28   QLVLTWPAGYCKIKGCPRTVIPDNFTIHGLWPDSVSVMMYNCDPPTR-----FNKIRETN  82

Query  501  LRSQLVKDWPGL  466
            ++++L K WP L
Sbjct  83   IKNELEKRWPEL  94



>dbj|BAQ19086.1| Sm-ribonuclease precursor, partial [Petunia x hybrida]
Length=191

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 40/80 (50%), Gaps = 6/80 (8%)
 Frame = -2

Query  663  LTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWT--SLPPVKGLPPLNDKIIDAKLRSQ  490
            LTWP G+C+ K C    I  +FTIHGLWP + S       P K        IID +++++
Sbjct  1    LTWPAGFCKIKNCPIKPIPNNFTIHGLWPDNVSAVLYDCHPNKQF----TTIIDPRIKTE  56

Query  489  LVKDWPGLEQQDDSLFWAPL  430
            L K WP L     +L   P 
Sbjct  57   LEKRWPELTTSKSALHRQPF  76



>gb|ABB92553.1| SRNase precursor, partial [Prunus avium]
Length=179

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   W    C+    K C   + +Q+FTIHGLWP + S  ++P         D+ +  
Sbjct  13   FQFVQQWSPINCRVRIKKPCSNPRPLQYFTIHGLWPSNYSNPTMPSNCNGSQFEDRKVYP  72

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR++L K WP +E  +D+ FW
Sbjct  73   QLRTKLKKSWPDVEDGNDTKFW  94



>gb|AAW58933.1| ribonuclease S1 [Prunus pseudocerasus]
Length=168

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKVSP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  62   KMRIKLKKSWPDVESGNDTRFW  83



>dbj|BAF91153.1| S-ribonuclease [Prunus mume]
Length=186

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  ++    ++ +Q FTIHGLWP + S  + P        ND  +  K
Sbjct  20   FQFVQQWPPTTCKLSSRPSCKHRPLQIFTIHGLWPSNYSNPTRPSNCIGSKYNDSKLYPK  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D+ FW
Sbjct  80   LRSKLKRSWPNVETDNDTKFW  100



>dbj|BAC75457.1| Sj-RNase [Prunus salicina]
Length=173

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S   +P        + + +  
Sbjct  13   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPKMPSNCNGSQFDARKVYP  72

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             +RS+L + WP +E  +D+ FW
Sbjct  73   HMRSKLKRSWPDVESGNDTRFW  94



>dbj|BAD11006.1| non-S RNase [Prunus avium]
Length=224

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 52/116 (45%), Gaps = 15/116 (13%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKII--DAK  502
            L++ L WPN  C    CIP      FT HGLWP + S   +         +  ++  DA 
Sbjct  28   LQYVLQWPNTKCVKARCIPGIQKTEFTTHGLWPTNLS--KILTCNSASKFSSTMLQNDAT  85

Query  501  LRSQLVKDWPGLEQQ------DDSLFWAPLLE----ISRFPS-NKYWTENAIYWSE  367
            L S+L   WP LEQ+      +D  FWA   E     ++F S N Y ++    W E
Sbjct  86   LVSKLKTSWPNLEQRVAQGKDNDMWFWAMEYEKHGTCAKFSSQNTYLSKACDLWEE  141



>gb|AEI69728.1| ribonuclease S6 precursor [Prunus dulcis]
Length=185

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +L
Sbjct  21   FQFVQQWPPTNCRVRTKCSNPRPLQVFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQL  80

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  81   RNKLKRSWPDVEGGNDTKFW  100



>emb|CAN90138.1| self-incompatibility ribonuclease [Prunus domestica]
Length=186

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S   +P        N + +  +
Sbjct  21   FQFVQQWPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQ  80

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  81   LRSDLKISWPDVESGNDTRFW  101



>gb|AAF82612.2|AF157008_1 self-incompatibility associated ribonuclease [Prunus dulcis]
Length=221

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q+FTIHGLWP + S  +     G    +D+ +  +L
Sbjct  31   FQFVQQWPPTNCRVRTKCSKPRPLQYFTIHGLWPSNYSNPTPSNCNG-SKFDDRNVSPQL  89

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  90   RNKLKRSWPDVESGNDTKFW  109



>dbj|BAF56279.1| S-RNase [Prunus speciosa]
Length=173

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQ-TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C     +Q FTIHGLWP + S  + P        +D+ +  +L
Sbjct  2    FQFVQQWPPTNCKIRKKCSKPLPLQMFTIHGLWPSNHSNPTTPSNCSGAQSDDRKVYPRL  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  62   RSKLKISWPDVENGNDTKFW  81



>gb|ABA26543.1| S-RNase [Prunus dulcis]
Length=222

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +L
Sbjct  31   FQFVQQWPPTNCRVRTKCSNPRPLQVFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQL  90

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R++L + WP +E  +D+ FW
Sbjct  91   RNKLKRSWPDVESGNDTKFW  110



>dbj|BAF56243.1| S-RNase [Prunus speciosa]
Length=168

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    K C   + +Q+FTIHGLWP + S  + P        +D+ +  
Sbjct  2    FQFVQQWPVTNCRVRIKKPCSNPRPLQYFTIHGLWPSNYSNPTEPSNCNGTKFDDRKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             +RS+L   WP +E  +D+ FW
Sbjct  62   HMRSKLRISWPDVESGNDTNFW  83



>gb|ABL86026.1| S-RNase [Prunus tenella]
Length=172

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    K C   + +Q+FTIHGLWP + S  + P        +D+ +  
Sbjct  13   FQFVQQWPLTNCRVRIKKPCSNPRPLQYFTIHGLWPSNYSSPTKPSNCNGTKFDDRKVYP  72

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             +RS+L   WP +E  +D+ FW
Sbjct  73   HMRSKLKISWPDVESGNDTNFW  94



>emb|CAQ51496.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=183

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        N+  +   L
Sbjct  1    FQFVQQWPPTNCRVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSNCIGSQFNESKLYPHL  60

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L + WP +E  +D+ FW 
Sbjct  61   RSKLKRSWPDVESGNDTNFWG  81



>dbj|BAF56284.1| S-RNase [Prunus speciosa]
Length=175

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   W    C+    K C   + +Q+FTIHGLWP + S  ++P         D+ +  
Sbjct  2    FQFVQQWSPINCRVRIKKPCSNPRPLQYFTIHGLWPGNYSNPTMPSNCNGSQFEDRKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR++L K WP +E  +D+ FW
Sbjct  62   QLRTKLKKSWPDVEDGNDTKFW  83



>dbj|BAF91158.1| S-ribonuclease [Prunus mume]
Length=185

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  20   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDARKVSP  79

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  80   KMRIKLKKSWPDVESGNDTRFW  101



>dbj|BAF56270.1| S-RNase [Prunus speciosa]
Length=176

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        N+  +   L
Sbjct  2    FQFVQQWPPTNCRVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSNCIGSQFNESKLYPHL  61

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L + WP +E  +D+ FW 
Sbjct  62   RSKLKRSWPDVESGNDTDFWG  82



>dbj|BAA36387.1| S2-RNase [Prunus avium]
Length=208

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  15   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDGRKVSP  74

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR++L + WP +E  +D+ FW
Sbjct  75   QLRAKLKRSWPDVESGNDTRFW  96



>gb|ABV71998.1| S10-RNase [Prunus mume]
Length=227

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C   K C   + +Q FTIHGLWP + S  ++P        N   +  +L
Sbjct  22   FQFVQQWPPTTCTVRKKCSKARPLQIFTIHGLWPSNYSNPTMPSNCNGSQFNFTKVSPQL  81

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R+ L + WP +E  +D+ FW
Sbjct  82   RADLERSWPDVESGNDTRFW  101



>gb|AAD51787.1|AF148466_1 Sb-S-RNase [Prunus dulcis]
Length=175

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L + WP +E  +D+ FW
Sbjct  62   KMRVKLKRSWPDVESGNDTRFW  83



>gb|ABQ51154.1| S15-RNase [Prunus armeniaca]
Length=190

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  24   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDARKVSP  83

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  84   KMRIKLKKSWPDVESGNDTRFW  105



>emb|CAN90139.1| self-incompatibility ribonuclease [Prunus dulcis]
Length=171

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (51%), Gaps = 3/83 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P            +  
Sbjct  1    FQFVQQWPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEANKLSP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFWA  436
            ++R++L K WP +E  +D+ FWA
Sbjct  61   EMRTKLKKSWPDVESGNDTKFWA  83



>dbj|BAF56280.1| S-RNase [Prunus speciosa]
Length=180

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C  +  C   + +Q FTIHGLWP + S  ++P         ++ +  +L
Sbjct  2    FQFVQQWPPTNCIIRTKCSKPRPLQMFTIHGLWPSNYSNPTMPSNCNGAHFENRKVYPQL  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L + WP +E  +D+ FW
Sbjct  62   RSKLKRSWPDVESGNDTNFW  81



>emb|CAA65318.1| S5-RNase [Antirrhinum hispanicum]
Length=233

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 62/142 (44%), Gaps = 30/142 (21%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLND------  520
            LK  L WPN YC  +T  C  N +   FTIHGLWP + SW          PL+D      
Sbjct  37   LKLVLQWPNSYCSLKTSTCRRNPLPLKFTIHGLWPDNYSW----------PLSDCGYDFT  86

Query  519  --KIIDAKLRSQLVKDWPGLEQQD-----DSLFWAPLLEISRFPSNKYWTENAIYWSETM  361
               I D  L  +L ++WP L ++      D  FW    E     +   +T +  Y+ ET+
Sbjct  87   LPDITDKSLLKRLDRNWPDLTKRKNIRKPDKTFWLTQWEKHGTCALSVYTFDD-YFRETL  145

Query  360  FLSNIPTKMNVRKNL-RGKFRP  298
               N+  + N+   L R   RP
Sbjct  146  ---NMKRRFNILDMLQRKSMRP  164



>gb|AAT69245.1| S2-RNase protein [Prunus armeniaca]
Length=226

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C  + K C   +++Q+FTIHGLWP + S  ++P          + +  +
Sbjct  31   FQFVQQWPPTTCGVRGKPCSKPRLLQNFTIHGLWPSNYSNPTMPSNCNGSKFEARKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  91   LRSDLKISWPDVESGNDTKFW  111



>emb|CAJ77743.1| ribonuclease S12 precursor [Prunus dulcis]
Length=191

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (51%), Gaps = 3/83 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P            +  
Sbjct  21   FQFVQQWPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEANKLSP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFWA  436
            ++R++L K WP +E  +D+ FWA
Sbjct  81   EMRTKLKKSWPDVESGNDTKFWA  103



>gb|ACT35737.1| So-RNase [Petunia x hybrida]
Length=222

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 8/70 (11%)
 Frame = -2

Query  672  KFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQS---WTSLPPVKGLPPLNDKIIDAK  502
            +  LTWP GYC+ K C    I  +FTIHGLWP   S   +   PP +      +KI +  
Sbjct  28   QLVLTWPAGYCKIKGCPRTVIPDNFTIHGLWPDSVSVMMYNCDPPTRF-----NKIRETN  82

Query  501  LRSQLVKDWP  472
            ++++L K WP
Sbjct  83   IKNELEKRWP  92



>gb|ADG57010.1| self-incompatibility RNase [Nicotiana alata]
Length=156

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 59/141 (42%), Gaps = 21/141 (15%)
 Frame = -2

Query  657  WPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQLVKD  478
            WP  +C T+ C   +I  +FTIHGLWP DQ+ T L   +      D I D ++R QL   
Sbjct  1    WPTTFCHTRQCPRQQIPNNFTIHGLWPDDQN-TILNDCESDDKYTD-IKDPRMRKQLEFH  58

Query  477  WPGLEQQDDSL-----FWAPLLEISRFPSNKYWTENAIYWSETMFLSN------------  349
            WP L  +   L     FW          S + + ++A Y+   + L N            
Sbjct  59   WPDLTAKVGDLKKNQGFWEYEFNKHGTCSQELYDQDA-YFDLALKLKNKFDFLTTLRNHG  117

Query  348  -IPTKMNVRKNLRGKFRPTTT  289
             IP K+   KN+       TT
Sbjct  118  IIPGKIYTVKNVEDAIEAVTT  138



>gb|ABW74346.1| S33-RNase [Prunus cerasus]
Length=238

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C   K C   + +Q FTIHGLWP + S  ++P        N   +  +L
Sbjct  33   FQFVQQWPPTTCTVRKKCSKARPLQIFTIHGLWPSNYSNPTMPSNCNGSQFNFTKVSPQL  92

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R+ L + WP +E  +D+ FW
Sbjct  93   RADLERSWPDVESGNDTRFW  112



>gb|ADZ74121.1| self-incompatibility associated ribonuclease S1 [Prunus pseudocerasus]
Length=226

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  33   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKVSP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  93   KMRIKLKKSWPDVESGNDTRFW  114



>emb|CAZ68890.1| S-ribonuclease, partial [Prunus dulcis]
 emb|CAZ68891.1| S-ribonuclease, partial [Prunus dulcis]
Length=187

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P     P  + + +  
Sbjct  21   FQFVQQWPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L   WP +E  +D+ FW
Sbjct  81   KMRIKLKISWPDVESGNDTRFW  102



>emb|CAM84221.1| ribonuclease [Prunus webbii]
Length=173

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  1    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L + WP +E  +D+ FW
Sbjct  61   KMRVKLKRSWPDVESGNDTRFW  82



>gb|ABY65899.1| S-RNase [Prunus pseudocerasus]
Length=224

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKVSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  91   KMRIKLKKSWPDVESGNDTRFW  112



>gb|AFJ20699.1| putative self-incompatibility S-RNase, partial [Prunus virginiana]
Length=153

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  600  FTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQLVKDWPGLEQQDDSLFW  439
            FTIHGLWP + S   +P        +D+ +  KLR++L K WP +E  +D+ FW
Sbjct  1    FTIHGLWPSNYSNPKMPSNCNGSQFDDRKVSPKLRAKLKKSWPNVESSNDTKFW  54



>dbj|BAC75459.1| Sl-RNase [Prunus salicina]
Length=188

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P        N+  +   L
Sbjct  15   FQFVQQWPPTNCRVRTKCSNPRPLQIFTIHGLWPSNYSNPTMPSNCIGSQFNESKLYPHL  74

Query  498  RSQLVKDWPGLEQQDDSLFWA  436
            RS+L + WP +E  +D+ FW 
Sbjct  75   RSKLKRSWPDVEGGNDTNFWG  95



>dbj|BAA83480.1| S4-RNase [Prunus avium]
Length=223

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S   +P        N + +  +
Sbjct  31   FQFVQQWPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  91   LRSDLKISWPDVESGNDTRFW  111



>gb|ABY82412.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
Length=226

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  33   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKVSP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L K WP +E  +D+ FW
Sbjct  93   KMRIKLKKSWPDVESGNDTRFW  114



>gb|ABR19609.1| S22-RNase [Prunus avium]
Length=226

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C  ++ +Q FTIHGLWP + S   +P        N   +  +
Sbjct  31   FQFVQQWPPATCIRSNKPCSKHRPLQIFTIHGLWPSNYSNPKMPSTCTGARFNFTKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR  L K WP +E  +D+ FW
Sbjct  91   LRKDLKKSWPDVESGNDTKFW  111



>ref|XP_002649213.1| ribonuclease T2 [Dictyostelium discoideum AX4]
 gb|EEU04137.1| ribonuclease T2 [Dictyostelium discoideum AX4]
Length=236

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 39/78 (50%), Gaps = 3/78 (4%)
 Frame = -2

Query  669  FALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQ  490
            F   W   YC    CI NK  + FTIHGLWP+D++  S P     P  +   I + L  Q
Sbjct  44   FVQQWIYSYCSESKCIENKEREAFTIHGLWPNDRN-NSYPAFCTGPSFDLGEI-SDLEDQ  101

Query  489  LVKDWPGLEQQDDSLFWA  436
            L  DW  L  +D+ LFW 
Sbjct  102  LNVDWISL-TEDNDLFWT  118



>emb|CAC27785.1| RNase S2 [Prunus avium]
Length=226

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        + + +  
Sbjct  33   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDGRKVSP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR++L + WP +E  +D+ FW
Sbjct  93   QLRAKLKRSWPDVESGNDTRFW  114



>emb|CAQ51504.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=166

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    K C   + +Q+FTIHGLWP + S  + P        +D+ +  
Sbjct  1    FQFVQQWPLTNCRVRIKKPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGTKFDDRKVYP  60

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             +RS+L   WP +E  +D+ FW
Sbjct  61   HMRSKLKISWPDVESGNDTNFW  82



>gb|AFI24538.1| self-incompatibility associated ribonuclease S5, partial [Prunus 
virginiana]
Length=197

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIV--QHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +   NK +  Q FTIHGLWP + S    P     P  + + +  +
Sbjct  25   FQFVQQWPPTTCRLSSKPSNKHLPLQRFTIHGLWPSNYSNPRKPSNCNGPQFDARKVSPQ  84

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  85   LRSKLKISWPDVESGNDTQFW  105



>gb|AAK58579.1|AF267512_1 Si-RNase [Prunus dulcis]
Length=165

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 3/81 (4%)
 Frame = -2

Query  672  KFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
            +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P     P  + + +  K
Sbjct  1    QFVQQWPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSPK  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            +R +L   WP +E  +D+ FW
Sbjct  61   MRIKLKISWPDVESGNDTRFW  81



>gb|ABW04806.1| S-RNase [Prunus dulcis]
Length=169

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ ++ C   + +Q+FTIHGLWP + S    P        N   +  +L
Sbjct  2    FQFVQQWPPTNCRVRSKCTKPRPLQNFTIHGLWPSNYSNPKKPSNCAGSRFNFTKMYPQL  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  62   RSELKMSWPDVESGNDTKFW  81



>gb|AAZ67032.1| Sf-RNase [Prunus dulcis]
Length=210

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L + WP +E  +D+ FW
Sbjct  91   KMRVKLKRSWPDVESGNDTRFW  112



>gb|AAK58578.1| Sk-RNase [Prunus dulcis]
Length=169

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  672  KFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
            +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P            +  +
Sbjct  1    QFVQQWPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEANKLSPE  60

Query  501  LRSQLVKDWPGLEQQDDSLFWA  436
            +R++L K WP +E  +D+ FWA
Sbjct  61   MRTKLKKSWPDVESGNDTKFWA  82



>emb|CAJ77729.1| ribonuclease S16 precursor [Prunus dulcis]
 emb|CAJ77730.1| ribonuclease S17 precursor [Prunus dulcis]
Length=194

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  21   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L + WP +E  +D+ FW
Sbjct  81   KMRVKLKRSWPDVESGNDTRFW  102



>dbj|BAF56286.1| S-RNase [Prunus speciosa]
Length=168

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPN---KIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP+  C+ +  +P    + +Q+FTIHGLWP + S  + P        +   +  
Sbjct  2    FQFVQQWPSTNCRVRIKLPCSHPRPLQYFTIHGLWPSNYSNPTKPSNCAGSQFSFTKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS+L + WP +E  +D+ FW
Sbjct  62   QLRSKLKRSWPDVESGNDTKFW  83



>emb|CAM84223.1| ribonuclease [Prunus dulcis]
Length=187

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 4/81 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLN-DKIIDAK  502
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  ++P     P     KI+  +
Sbjct  6    FQFVQQWPPTNCRVRTKCSHPRPLQIFTIHGLWPSNYSNPTIP--SNCPGSQFKKILSPQ  63

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L++ WP +E  +D+ FW
Sbjct  64   LRSSLMRSWPDVEGGNDTKFW  84



>gb|AAZ57490.1| Si-RNase [Prunus dulcis]
Length=198

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P         D+ +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKV-P  89

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L + WP +E  +D+ FW
Sbjct  90   KLRSKLKRSWPDVESGNDTRFW  111



>dbj|BAF56249.1| S-RNase [Prunus speciosa]
Length=169

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q+FTIHGLWP + S  ++P          + +  +
Sbjct  2    FQFVQQWPPTNCRVRKRPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSQFKKENVYPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  62   LRSKLKISWPDVESGNDTRFW  82



>emb|CAJ77746.1| ribonuclease S18 precursor [Prunus dulcis]
Length=191

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ---TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  + P        N+  +  
Sbjct  21   FQFVQQWPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSP  80

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L   WP +E  +D+ FW
Sbjct  81   KLRSKLKISWPDVESGNDTKFW  102



>gb|AAZ67034.1| Sg-RNase [Prunus dulcis]
Length=200

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ---TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  + P        N+  +  
Sbjct  30   FQFVQQWPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSP  89

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L   WP +E  +D+ FW
Sbjct  90   KLRSKLKISWPDVESGNDTKFW  111



>dbj|BAF56251.1| S-RNase [Prunus speciosa]
Length=170

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C  +  +  FTIHGLWP + S  ++P     P  N+  +  K
Sbjct  2    FQFVQQWPPATCIRSRKPCSKHLPLPIFTIHGLWPSNYSNPTMPSNCIGPLFNESKLCPK  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  62   LRSKLKISWPDVESGNDTQFW  82



>emb|CAJ77736.1| ribonuclease S25 precursor [Prunus dulcis]
Length=188

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ ++ C   + +Q+FTIHGLWP + S    P        N   +  +L
Sbjct  21   FQFVQQWPPTNCRVRSKCTKPRPLQNFTIHGLWPSNYSNPKKPSNCAGSRFNFTKMYPQL  80

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  81   RSELKMSWPDVESGNDTKFW  100



>gb|ABL86035.1| S-RNase [Prunus tenella]
Length=178

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C  ++ +Q+FTIHGLWP + S  + P        N+  +  +
Sbjct  13   FQFVQQWPPATCIRSKKPCSKHRALQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQ  72

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L S+L   WP +E  +D+ FW
Sbjct  73   LISKLRISWPDVESGNDTQFW  93



>gb|AAF73756.1|AF149039_1 S1-RNase [Prunus dulcis]
Length=172

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = -2

Query  672  KFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
            +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  K
Sbjct  1    QFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSPK  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            +R +L + WP +E  +D+ FW
Sbjct  61   MRVKLKRSWPDVESGNDTRFW  81



>emb|CAN90134.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=165

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S  ++P          + +  +
Sbjct  1    FQFVQQWPPTSCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSRFKKENVYPQ  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS++   WP +E  +D+ FW
Sbjct  61   LRSKMKISWPDVESGNDTRFW  81



>dbj|BAA88127.1| S3-RNase [Prunus avium]
Length=132

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q+FTIHGLWP + S  ++P          +++  ++
Sbjct  15   FQFVQQWPPTTCRVQKKCSKPRPLQNFTIHGLWPSNYSNPTMPSNCNGSRFKKELLSPRM  74

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +S+L   WP +   +D+ FW
Sbjct  75   QSKLKISWPNVVSSNDTKFW  94



>ref|XP_003746238.1| PREDICTED: ribonuclease DdI-like [Metaseiulus occidentalis]
Length=258

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 14/87 (16%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
            L FA   P GYC++   + CI ++I + FT+HGLWP  +          +   + +  D 
Sbjct  27   LVFAQQHPPGYCRSTFKQKCIADRINESFTVHGLWPSAKD-------DSIQNCDSRKFDV  79

Query  504  K----LRSQLVKDWPGLEQQDDSLFWA  436
            K    +RS+L K WP     D ++FWA
Sbjct  80   KDVQPIRSRLEKAWPSFRTNDPTVFWA  106



>emb|CAN90135.1| self-incompatibility ribonuclease [Prunus cerasifera]
 emb|CAN90140.1| self-incompatibility ribonuclease [Prunus salicina]
Length=169

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q FTIHGLWP + S    P         D  +  +
Sbjct  1    FQFVQQWPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSNPWKPSNCSGSQFKDGKVYPQ  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L K WP +E  +D+ FW
Sbjct  61   LRSKLKKSWPDVESGNDTKFW  81



>dbj|BAA24018.1| ribonuclease precursor [Nicotiana alata]
Length=218

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            ++  L WP  +C T AC    I  +FTIHGLWP D   T L   +G     D I D K +
Sbjct  27   MQLVLQWPTAFCHTTAC--TIIPTNFTIHGLWP-DNVSTMLNYCEGRKNKYDSITDDKRK  83

Query  495  SQLVKDWPGL  466
            S L + WP L
Sbjct  84   SDLYEHWPDL  93



>dbj|BAF56253.1| S-RNase [Prunus speciosa]
Length=170

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K    ++ +Q FTIHGLWP + S    P         D  +  +
Sbjct  2    FQFVQQWPPATCRFSRKPANKHRPLQIFTIHGLWPSNYSNPRRPSNCNGSQFKDGKVYPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L K WP +E  +D+ FW
Sbjct  62   LRSKLKKSWPDVESGNDTKFW  82



>gb|AAT72309.1| S63-RNase [Prunus dulcis]
Length=177

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 3/80 (4%)
 Frame = -2

Query  672  KFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
            +F   WP   C  +TK   P ++ Q FTIHGLWP + S   +P        N+  +  KL
Sbjct  1    QFVQQWPPTNCIVRTKCSKPRRL-QTFTIHGLWPSNYSNPKMPSNCMGSQFNESNLYLKL  59

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  60   RSKLKISWPDVESGNDTNFW  79



>dbj|BAF56255.1| S-RNase [Prunus speciosa]
Length=167

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S  ++P          + +  +
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSQFKKENVYPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS++   WP +E  +D+ FW
Sbjct  62   LRSKMKISWPDVESGNDTRFW  82



>gb|ADZ48270.1| S-locus-associated ribonuclease [Prunus speciosa]
Length=226

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P        N   +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTMPNKCTGSKFNFTKVFP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             LRS L K WP +E  +D+ FW
Sbjct  91   YLRSNLKKSWPDVESGNDTKFW  112



>gb|AAK15435.1|AF239908_1 self-incompatibility ribonuclease [Petunia axillaris]
Length=218

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (46%), Gaps = 25/129 (19%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            L+  LTWP  +C  K+C  N+I ++FTIHGLWP +Q        K       KI D    
Sbjct  27   LQLVLTWPPSFCHEKSC--NRIPRNFTIHGLWPDNQHVMLNDCAKTFK----KITDVLKS  80

Query  495  SQLVKDWPGLEQQDDSL-----FWAPLLEISRFPSNKYWTENAIYWSETMFLSNIPTKMN  331
             +L   WP L+   ++      FW       R+  NK+ T  +  +++  +        +
Sbjct  81   KELDDRWPDLKYSRNNAIQTQSFW-------RYEYNKHGTCCSQRYNQQAYF-------D  126

Query  330  VRKNLRGKF  304
            + KNL+ KF
Sbjct  127  IAKNLKDKF  135



>dbj|BAI77869.1| S23-RNase [Prunus dulcis]
Length=224

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P     P  + + +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L   WP +E  +D+ FW
Sbjct  91   KMRIKLKISWPDVESGNDTRFW  112



>gb|ABA26546.1| S-RNase [Prunus dulcis]
Length=227

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ---TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  + P        N+  +  
Sbjct  31   FQFVQQWPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L   WP +E  +D+ FW
Sbjct  91   KLRSKLKISWPDVESGNDTKFW  112



>ref|XP_004517056.1| PREDICTED: ribonuclease S-1-like [Cicer arietinum]
Length=125

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 43/84 (51%), Gaps = 9/84 (11%)
 Frame = -2

Query  672  KFALTWPNGYCQ------TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKII  511
            K A  WP  YC+       K C PN  ++ FT+HGLWP + S  S P       LN  +I
Sbjct  22   KLAQQWPTTYCRHSPQTINKPCNPNVPIK-FTLHGLWPSNHS-GSTPSHCSQTKLNKTLI  79

Query  510  DAKLRSQLVKDWPGLEQQDDSLFW  439
               L+++L+ +WP L   DD  FW
Sbjct  80   VGNLKTRLIAEWPNL-IGDDFQFW  102



>gb|ABY82414.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
 gb|ADZ74122.1| self-incompatibility associated ribonuclease S5 [Prunus pseudocerasus]
Length=227

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ---TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  + P        N+  +  
Sbjct  31   FQFVQQWPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L   WP +E  +D+ FW
Sbjct  91   KLRSKLKISWPDVESGNDTKFW  112



>gb|ABW88928.1| S25-RNase [Prunus salicina]
Length=116

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q+FTIHGLWP + S   +P        N+  +   L
Sbjct  31   FQFVQQWPPTNCRVRTKCSNPRPLQYFTIHGLWPSNYSNPKMPSNCIGSQFNESRVYPYL  90

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            R +L   WP +E  +D+ FW
Sbjct  91   RPKLKISWPDVESGNDTKFW  110



>dbj|BAA34663.1| Sb-RNase [Prunus dulcis]
 gb|ABA26544.1| S-RNase [Prunus dulcis]
Length=231

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L + WP +E  +D+ FW
Sbjct  91   KMRVKLKRSWPDVESGNDTRFW  112



>gb|ABY19371.1| S7-RNase [Prunus webbii]
Length=154

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K+C   + +Q FTIHGLWP + S    P          + +  K
Sbjct  21   FQFVQQWPPTTCRISNKSCHQQRPLQMFTIHGLWPSNYSNPRKPSSCTGSQFKLEKLYPK  80

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  81   LRSKLKISWPNVESGNDTKFW  101



>dbj|BAF56265.1| S-RNase [Prunus speciosa]
Length=167

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S    P      P N   +   
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPRRPSNCAGSPFNFTKVYPH  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            +RS+L   WP +E  +D+ FW
Sbjct  62   MRSKLKISWPDVESGNDTKFW  82



>gb|ABW88927.1| S24-RNase [Prunus salicina]
Length=117

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K    ++ +Q FTIHGLWP + S    P        N   +  K
Sbjct  31   FQFVQQWPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKPSNCNGSKFNFTKVSPK  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            +R +L + WP +E  +D+ FW
Sbjct  91   MRVKLKRSWPDVESGNDTRFW  111



>gb|ABV02075.1| S-locus S-RNase S16 [Prunus spinosa]
Length=227

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ---TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  + P        N+  +  
Sbjct  31   FQFVQQWPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLRS+L   WP +E  +D+ FW
Sbjct  91   KLRSKLKISWPDVESGNDTKFW  112



>dbj|BAF56276.1| S-RNase [Prunus speciosa]
Length=169

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K     + +Q FTIHGLWP + S   +P        N   +  +
Sbjct  2    FQFVQQWPPTTCRFSSKPSNQQRRLQIFTIHGLWPSNYSNPRMPSNCTGSQFNFTKVYPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L K WP +E  +D+ FW
Sbjct  62   LRSKLKKSWPDVESGNDTRFW  82



>dbj|BAJ24847.1| Self-incompatibility ribonuclease precursor [Petunia x hybrida]
Length=218

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 61/135 (45%), Gaps = 37/135 (27%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLND------KI  514
            ++  LTWP  +C TK C   +  ++FTIHGLWP DQ             LND       I
Sbjct  27   IQLVLTWPPSFCHTKPC--KRTPRNFTIHGLWPDDQHVL----------LNDCDKTYTTI  74

Query  513  IDAKLRSQLVKDWPGLE-QQDDSL----FWAPLLEISRFPSNKYWTENAIYWSETMFLSN  349
             DA+ + +L   WP L   + D++    FW       R+  NK+ T  +  + +  +   
Sbjct  75   SDAREKKELDARWPDLRYTERDAIQLQSFW-------RYEYNKHGTCCSERYDQEAYF--  125

Query  348  IPTKMNVRKNLRGKF  304
                 N+ KNL+ KF
Sbjct  126  -----NLAKNLKDKF  135



>gb|AAM22178.1| RNase [Prunus dulcis]
 gb|AAM76700.1| RNase [Prunus dulcis]
Length=161

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = -2

Query  657  WPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQLVK  481
            WP   C+ +  C   + +Q FTIHGLWP + S  ++P        + + +  +LR++L +
Sbjct  4    WPPTNCRVRTKCSNPRPLQVFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQLRNKLKR  63

Query  480  DWPGLEQQDDSLFW  439
             WP +E  +D+ FW
Sbjct  64   SWPDVESGNDTKFW  77



>dbj|BAF42762.1| Sk-RNase [Prunus dulcis]
 dbj|BAF42768.1| S1-RNase [Prunus persica]
Length=230

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (51%), Gaps = 3/83 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P            +  
Sbjct  33   FQFVQQWPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEANKLSP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFWA  436
            ++R++L K WP +E  +D+ FWA
Sbjct  93   EMRTKLKKSWPDVESGNDTKFWA  115



>gb|ABL86023.1| S-RNase [Prunus tenella]
Length=172

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 40/82 (49%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+    + C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  13   FQFVQQWPPTNCRVHVKRPCSNPRPLQYFTIHGLWPSNYSNPTRPSNCNGSKFNFTKVYP  72

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR  L K WP +E  +D+ FW
Sbjct  73   QLRKDLKKSWPDVESGNDTKFW  94



>dbj|BAF56285.1| S-RNase [Prunus speciosa]
Length=168

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 40/82 (49%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTRPSNCNGSKFNFTKVYP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR  L K WP +E  +D+ FW
Sbjct  62   QLRKDLKKSWPDVESGNDTKFW  83



>gb|AAX38606.1| ribonuclease S3 [Prunus avium]
Length=171

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q+FTIHGLWP + S  ++P          +++  ++
Sbjct  2    FQFVQQWPPTTCRVQKKCSKPRPLQNFTIHGLWPSNYSNPTMPSNCNGSRFKKELLSPRM  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +S+L   WP +   +D+ FW
Sbjct  62   QSKLKISWPNVVSSNDTKFW  81



>gb|AAL27623.1|AF432850_1 S-RNase [Prunus mume]
Length=88

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%), Gaps = 2/79 (3%)
 Frame = -2

Query  669  FALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            F   WP   C+ +   C   + +Q FTIHGLWP + S    P         D  +  +LR
Sbjct  1    FVQQWPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSDPWKPSNCSGSQFKDGKVYPQLR  60

Query  495  SQLVKDWPGLEQQDDSLFW  439
            S+L K WP +E  +D+ FW
Sbjct  61   SKLKKSWPDVESGNDTKFW  79



>dbj|BAK19919.1| self-incompatibility associated ribonuclease [Prunus mira]
Length=178

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C  ++  Q+FTIHGLWP + S  + P        N+  +  +
Sbjct  20   FQFVQQWPPATCIRSKKPCSKHRAFQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQ  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L S+L   WP +E  +D+ FW
Sbjct  80   LISKLRISWPDVESGNDTQFW  100



>dbj|BAF91159.1| S-ribonuclease [Prunus mume]
Length=185

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q FTIHGLWP + S    P         D  +  +
Sbjct  18   FQFVQQWPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSDPWKPSNCSGSQFKDGKVYPQ  77

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L K WP +E  +D+ FW
Sbjct  78   LRSKLKKSWPDVESGNDTKFW  98



>dbj|BAF56246.1| S-RNase [Prunus speciosa]
Length=171

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q+FTIHGLWP + S  ++P          +++  ++
Sbjct  2    FQFVQQWPPTTCRVQKKCSKPRPLQNFTIHGLWPSNYSNPTMPSNCNGSRFKKELLSPRM  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +S+L   WP +   +D+ FW
Sbjct  62   QSKLKISWPNVVSSNDTKFW  81



>gb|ABD49102.1| S13m-RNase [Prunus cerasus]
Length=137

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K    ++  Q FTIHGLWP + S    P        +D+ +   
Sbjct  31   FQFVQQWPPTTCRLSSKPSHQHRPFQRFTIHGLWPSNYSNPRKPSNCNGSQFDDRKVYPD  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L + WP +E  +D+ FW
Sbjct  91   LRSDLKRSWPDVEGGNDTKFW  111



>dbj|BAF56275.1| S-RNase [Prunus speciosa]
Length=168

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P        + + +  
Sbjct  2    FQFVQQWPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTVPSNCNGSKFDARKVSP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LR++L   WP +E  +D+ FW
Sbjct  62   QLRNKLKISWPDVESGNDTKFW  83



>gb|ABQ51152.1| S11-RNase [Prunus armeniaca]
Length=187

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 0/79 (0%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
             +F   WP   C+ + C   + +Q FTIHGLWP + S  S P          + +  +L+
Sbjct  24   FQFVQQWPPTNCKFRKCSKPRPLQRFTIHGLWPSNYSNPSRPSNCTGLQFEARKVYPQLQ  83

Query  495  SQLVKDWPGLEQQDDSLFW  439
            S L   WP +E  +D+ FW
Sbjct  84   SDLKISWPDVESGNDTKFW  102



>gb|ABW88924.1| S21-RNase [Prunus salicina]
Length=116

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C  +  C   + +Q+FTIHGLWP + S   +P        N   +  +L
Sbjct  31   FQFVQQWPPTNCILRTKCSKPRPLQNFTIHGLWPSNYSNPKMPSNCVGSRFNFTRVPPRL  90

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  91   RSKLKISWPDVESGNDTKFW  110



>gb|ABY82413.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
Length=227

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+ +   C   + +Q+FTIHGLWP + S  ++P          + +  +
Sbjct  33   FQFVQQWPPTNCRVRKRPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSQFKKENVYPQ  92

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  93   LRSKLKISWPDVESGNDTRFW  113



>ref|XP_004505385.1| PREDICTED: ribonuclease S-7-like [Cicer arietinum]
Length=218

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 43/83 (52%), Gaps = 4/83 (5%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQ-SWTSLPPVKGLPPLN--DKIIDA  505
             K A  WP  +C++  C P      FTIHGLWP +Q S  S   V   P L   +K + +
Sbjct  31   FKMAEQWPPTFCRSNPC-PTIPQGKFTIHGLWPSNQTSLQSSKCVTKDPHLQSFNKAMIS  89

Query  504  KLRSQLVKDWPGLEQQDDSLFWA  436
             L +QL   WP L+ Q + LFWA
Sbjct  90   TLEAQLNLSWPNLKGQSNELFWA  112



>dbj|BAF56267.1| S-RNase [Prunus speciosa]
Length=175

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  2    FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCIGSQFNFTKVSP  61

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            K+R +L + WP +E  +D+ FW
Sbjct  62   KMRVKLKRSWPDVESGNDTRFW  83



>gb|ABV02074.1| S-locus S-RNase S15 [Prunus spinosa]
Length=204

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ ++ C   + +Q+FTIHGLWP + S    P        N   +  +L
Sbjct  10   FQFVQQWPPTNCRVRSKCSKPRPLQNFTIHGLWPSNYSNPKKPSNCAGSRFNFTKMYPQL  69

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            RS+L   WP +E  +D+ FW
Sbjct  70   RSELKMSWPDVESGNDTKFW  89



>gb|AAT69248.1| S4-RNase protein [Prunus armeniaca]
 gb|ADZ73655.1| S-locus associated ribonuclease [Prunus armeniaca]
Length=231

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C    K C  ++ +Q+FTIHGLWP + S  + P        N+  +  +
Sbjct  31   FQFVQQWPPATCIRSKKPCSKHRALQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L S+L   WP +E  +D+ FW
Sbjct  91   LISKLRISWPDVESGNDTQFW  111



>emb|CAQ51499.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=172

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C   TK   P + +Q FTIHGLWP + S  ++P        + K +  +
Sbjct  1    FQFVQQWPPTNCIVHTKCSNP-RPLQMFTIHGLWPSNYSNPTVPSNCNGSKFDAKKVYPQ  59

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L+S+L K WP +E  +D+ FW
Sbjct  60   LQSKLKKSWPDVESGNDTKFW  80



>gb|ABL86031.1| S-RNase [Prunus tenella]
Length=175

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K    ++ +Q FTIHGLWP + S    P        + + +  +
Sbjct  13   FQFVQQWPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKPSNCNGLQFDARKVSPR  72

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  73   LRSKLKMSWPNVESDNDTKFW  93



>gb|ABB85340.1| S13-RNase protein [Prunus armeniaca]
Length=63

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  600  FTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQLVKDWPGLEQQDDSLFW  439
            FTIHGLWP + S  ++P         D+ +  +LRS+L + WP +E  +D+ FW
Sbjct  1    FTIHGLWPSNYSNPTMPSNCNGSKFEDRKVSPQLRSKLKRSWPDVESGNDTKFW  54



>dbj|BAF91156.1| S-ribonuclease [Prunus mume]
Length=187

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKI--VQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+      NK   +Q FTIHGLWP + S    P         D  +  +
Sbjct  20   FQFVQQWPPATCRFSRKPANKRRPLQIFTIHGLWPSNYSHPRRPSNCNGSQFKDGKVYPQ  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L K WP +E  +D+ FW
Sbjct  80   LRTKLKKSWPDVESGNDTKFW  100



>emb|CAN90141.1| self-incompatibility ribonuclease [Prunus mume]
Length=167

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%), Gaps = 2/79 (3%)
 Frame = -2

Query  669  FALTWPNGYCQTKA--CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
            F   WP   C+ +   C   + +Q FTIHGLWP + S    P         D  +  +LR
Sbjct  1    FVQQWPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSDPWKPSNCSGSQFKDGKVYPQLR  60

Query  495  SQLVKDWPGLEQQDDSLFW  439
            S+L K WP +E  +D+ FW
Sbjct  61   SKLKKSWPDVESGNDTKFW  79



>dbj|BAF56274.1| S-RNase [Prunus speciosa]
Length=180

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  TK    ++ +Q+FTIHGLWP + S   +P          KI+  K
Sbjct  2    FQFVQQWPPTTCRLSTKPSNKHRPLQNFTIHGLWPSNYSNPKMPSNCAGSQF-KKILSPK  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L ++L + WP +E+ +D+ FW
Sbjct  61   LLTKLKRSWPDVEKGNDTEFW  81



>dbj|BAF56252.1| S-RNase [Prunus speciosa]
Length=165

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 39/79 (49%), Gaps = 0/79 (0%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLR  496
             +F   WP   C+ + C   + +Q FTIHGLWP + S  + P          + +  +L+
Sbjct  2    FQFVQQWPPTNCKFRKCSKPRPLQRFTIHGLWPSNYSNPTRPSNCTGLQFEARKVYPQLQ  61

Query  495  SQLVKDWPGLEQQDDSLFW  439
            S L   WP +E  +D+ FW
Sbjct  62   SDLKISWPDVESGNDTKFW  80



>dbj|BAF56263.1| S-RNase [Prunus speciosa]
Length=166

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQ-TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  +LP          + +  +L
Sbjct  2    FQFVQQWPPTNCKISTKCSKPRALQMFTIHGLWPSNYSNPTLPSNCQGSLFEARKVYPQL  61

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +++L + WP +E+ +D+ FW
Sbjct  62   QTKLKRSWPDVERGNDTKFW  81



>dbj|BAF56261.1| S-RNase [Prunus speciosa]
Length=174

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C   TK C  ++ +  FTIHGLWP + S    P        +   +  +
Sbjct  2    FQFVQQWPPATCIRSTKPCSKHRSLPIFTIHGLWPSNYSNPKTPSNCNGSQFDAIKLSPR  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L + WP +E  +D  FW
Sbjct  62   LRSKLKRSWPDVESGNDEGFW  82



>gb|ABB92551.1| SRNase precursor, partial [Prunus avium]
Length=185

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K+C   + +Q FTIHGLWP + S    P          + +  K
Sbjct  13   FQFVQQWPPTTCRISNKSCHQQRPLQMFTIHGLWPSNYSNPRKPSSCTGSQFKLEKLYPK  72

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  73   LRSKLKISWPNVESGNDTKFW  93



>dbj|BAJ41469.1| S-ribonuclease 4 [Prunus persica]
Length=225

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K+   ++ +Q FTIHGLWP + S  + P        N   +  +
Sbjct  31   FQFVQQWPPTTCRLSSKSSNQHRPLQRFTIHGLWPSNYSNPTKPSNCNGSRFNFTKVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L K WP +E  +D+ FW
Sbjct  91   LRTKLKKSWPDVESGNDTKFW  111



>gb|AAZ91363.1| S4 S-RNase [Prunus webbii]
Length=198

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  ++P        + + +  
Sbjct  33   FQFVQQWPPTNCRVRVKRPCSNPRPLQYFTIHGLWPSNYSNPTIPSNCKGSKFDARKVYP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
             +RS+L   WP +E  +D+ FW
Sbjct  93   HMRSKLKISWPDVESGNDTRFW  114



>gb|ACG50929.1| S2-RNase [Prunus simonii]
Length=190

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C  + K C   +++Q+FTIHGLW  + S  ++P          + +  +
Sbjct  22   FQFVQQWPPTTCGVRGKPCSKPRLLQNFTIHGLWSSNYSNPTMPSNCNGSKFEARKVYPQ  81

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  82   LRSDLKISWPDVESGNDTKFW  102



>ref|XP_004367303.1| ribonuclease T2 [Dictyostelium fasciculatum]
 gb|EGG20320.1| ribonuclease T2 [Dictyostelium fasciculatum]
Length=232

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 3/78 (4%)
 Frame = -2

Query  669  FALTWPNGYC-QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRS  493
            F   W   YC Q + C+P+KI   FTIHGLWP++ + T     KG    +  I D  +  
Sbjct  42   FVTQWIYSYCTQGQKCLPSKIRSAFTIHGLWPNNNNGTYPSFCKGASYSSSAIQD--ILV  99

Query  492  QLVKDWPGLEQQDDSLFW  439
            +L +DWP L   +++ FW
Sbjct  100  ELDQDWPSLFALNNNDFW  117



>dbj|BAC56116.1| S7-RNase [Prunus mume]
 dbj|BAF91155.1| S-ribonuclease [Prunus mume]
Length=226

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K     + +Q FTIHGLWP + S   +P        N   +  +
Sbjct  32   FQFVQQWPPTTCRFSSKPSNQQRRLQIFTIHGLWPSNYSNPRMPSNCTGSQFNFTKVYPQ  91

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L K WP +E  +D+ FW
Sbjct  92   LRSKLKKSWPDVESGNDTRFW  112



>gb|ABD98450.1| self-incompatibility ribonuclease, partial [Prunus dulcis]
Length=168

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = -2

Query  657  WPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQL  487
            WP   C+ +    C   + +Q+FTIHGLWP + S  + P            +  ++R++L
Sbjct  4    WPPTNCRVRIKQPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEANKLSPEMRTKL  63

Query  486  VKDWPGLEQQDDSLFWA  436
             K WP +E  +D+ FWA
Sbjct  64   KKSWPDVESGNDTKFWA  80



>gb|ABW04809.1| S-RNase [Prunus dulcis]
Length=182

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  ++P          K +  +
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCNGSQFEAKKVYPR  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L+S+L   WP +E  +D+ FW
Sbjct  62   LQSKLKISWPDVESGNDTNFW  82



>emb|CAJ77744.1| ribonuclease S13 precursor [Prunus dulcis]
 emb|CAJ77731.1| ribonuclease S19 precursor [Prunus dulcis]
Length=166

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S  + P          + +  +
Sbjct  1    FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQ  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS++   WP +E  +D+ FW
Sbjct  61   LRSKMKISWPDVESGNDTRFW  81



>dbj|BAA36389.1| S3-RNase [Prunus avium]
 emb|CAC27786.1| RNase S3 [Prunus avium]
 gb|AAT72119.1| S3-RNase [Prunus avium]
Length=229

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQT-KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+  K C   + +Q+FTIHGLWP + S  ++P          +++  ++
Sbjct  33   FQFVQQWPPTTCRVQKKCSKPRPLQNFTIHGLWPSNYSNPTMPSNCNGSRFKKELLSPRM  92

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +S+L   WP +   +D+ FW
Sbjct  93   QSKLKISWPNVVSSNDTKFW  112



>gb|ABW81472.1| self-incompatibility S13-RNase [Prunus dulcis]
Length=165

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S  + P          + +  +
Sbjct  1    FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQ  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS++   WP +E  +D+ FW
Sbjct  61   LRSKMKISWPDVESGNDTRFW  81



>dbj|BAF56264.1| S-RNase [Prunus speciosa]
Length=173

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYC--QTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C   TK   P + +Q FTIHGLWP + S  ++P        + + +  +
Sbjct  2    FQFVQQWPPTNCIVHTKCSNP-RPLQMFTIHGLWPSNYSNPTVPSNCNGSKFDARKVYPQ  60

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L+S+L K WP +E  +D+ FW
Sbjct  61   LQSKLKKSWPDVESGNDTKFW  81



>gb|ACU25554.1| self-incompatibility associated ribonuclease S4 [Prunus pseudocerasus]
Length=247

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q FTIHGLWP + S  ++P        N+  +  
Sbjct  33   FQFVQQWPPTNCRVRIKRPCSNPRPLQIFTIHGLWPSNYSNPTMPSNCIGSQFNETKLSP  92

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            KLR++L + WP +E  +D+  W
Sbjct  93   KLRNKLKRSWPNVESGNDTELW  114



>emb|CAM84220.1| ribonuclease [Prunus webbii]
Length=186

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q FTIHGLWP + S  + P     P     I+  +
Sbjct  21   FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTKPSNCNGPQFKP-ILSPR  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L   WP +E  +D+ FW
Sbjct  80   LRSKLKISWPDVESGNDTKFW  100



>gb|AAZ91362.1| S3 S-RNase, partial [Prunus webbii]
Length=180

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKL  499
             +F   WP   C+ +  C   + +Q FTIHGLWP + S  +LP          + +  +L
Sbjct  17   FQFVQQWPPTNCKIRTKCSKPRQLQMFTIHGLWPSNYSNPTLPSNCKGSLFEARKVYPQL  76

Query  498  RSQLVKDWPGLEQQDDSLFW  439
            +++L + WP +E  +D+ FW
Sbjct  77   QTKLKRSWPDVESGNDTKFW  96



>gb|ABY19372.1| S9-RNase [Prunus webbii]
Length=198

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  TK    ++ +Q+FTIHGLWP + S   +P          KI+  K
Sbjct  21   FQFVQQWPPTTCRLSTKPSNKHRPLQNFTIHGLWPSNYSNPKMPSNCAGSQF-KKILSPK  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L ++L + WP +E+ +D+ FW
Sbjct  80   LLTKLKRSWPDVEKGNDTEFW  100



>gb|ABQ51155.1| S16-RNase [Prunus armeniaca]
Length=186

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K C   + +Q+FTI GLWP + S    P        ND  +  +
Sbjct  21   FQFVQQWPPTNCRVRSKPCSKPRPLQNFTIPGLWPSNYSNPRAPSNCNGSRFNDGKLSPE  80

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L   WP +E  +D+ FW
Sbjct  81   LRAKLKISWPDVESGNDTKFW  101



>gb|ABY19369.1| S5-RNase [Prunus webbii]
Length=186

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + + +FTIHGLWP + S   +P        N + +  +
Sbjct  21   FQFVQQWPPTNCRVRNKPCTKPRPLLNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQ  80

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L   WP +E  +D+ FW
Sbjct  81   LRSDLKISWPDVESGNDTRFW  101



>gb|AAL59323.2| RNase [Prunus dulcis]
Length=162

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 40/76 (53%), Gaps = 3/76 (4%)
 Frame = -2

Query  657  WPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQL  487
            WP   C+ +    C   + +Q+FTIHGLWP + S  + P     P  + + +  K+R +L
Sbjct  4    WPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSPKMRIKL  63

Query  486  VKDWPGLEQQDDSLFW  439
               WP +E  +D+ FW
Sbjct  64   KISWPDVESGNDTRFW  79



>emb|CAJ77745.1| ribonuclease S14 precursor [Prunus dulcis]
Length=199

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  TK    ++ +Q+FTIHGLWP + S   +P          KI+  K
Sbjct  21   FQFVQQWPPTTCRLSTKPSNKHRPLQNFTIHGLWPSNYSNPKMPSNCAGSQF-KKILSPK  79

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            L ++L + WP +E+ +D+ FW
Sbjct  80   LLTKLKRSWPDVEKGNDTEFW  100



>gb|ABD49101.1| S13-RNase [Prunus avium]
Length=225

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K    ++  Q FTIHGLWP + S    P        +D+ +   
Sbjct  31   FQFVQQWPPTTCRLSSKPSHQHRPFQRFTIHGLWPSNYSNPRKPSNCNGSQFDDRKVYPD  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS L + WP +E  +D+ FW
Sbjct  91   LRSDLKRSWPDVEGGNDTKFW  111



>gb|ABY82415.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
Length=226

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  +K     + +Q FTIHGLWP + S   +P        N   +  +
Sbjct  32   FQFVQQWPPTTCRFSSKPSNQQRRLQIFTIHGLWPSNYSNPRMPSNCTGSQFNFTKVYPQ  91

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS+L K WP +E  +D+ FW
Sbjct  92   LRSKLKKSWPDVESGNDTKFW  112



>gb|AAL59321.1|AF454000_1 RNase [Prunus dulcis]
 gb|AAM76697.1| RNase [Prunus dulcis]
Length=179

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 4/75 (5%)
 Frame = -2

Query  657  WPNGYCQTKA-CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLN-DKIIDAKLRSQLV  484
            WP   C+ +  C   + +Q FTIHGLWP + S  ++P     P     KI+  +LRS L+
Sbjct  4    WPPTNCRVRTKCSHPRPLQIFTIHGLWPSNYSNPTIP--SNCPGSQFKKILSPQLRSSLM  61

Query  483  KDWPGLEQQDDSLFW  439
            + WP +E  +D+ FW
Sbjct  62   RSWPDVEGGNDTKFW  76



>gb|AAZ91370.1| S10 S-RNase, partial [Prunus webbii]
 gb|AAZ91371.1| S10' S-RNase [Prunus webbii]
 gb|ABJ97526.1| S-RNase, partial [Prunus webbii]
 gb|ACZ55922.1| ribonuclease S36 precursor [Prunus dulcis]
 gb|ACZ55923.1| ribonuclease S36 precursor [Prunus dulcis]
 gb|AIV99934.1| S-RNase S10-1, partial [Prunus dulcis]
Length=163

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 3/76 (4%)
 Frame = -2

Query  657  WPNGYCQT---KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQL  487
            WP   C+    K C   + +Q+FTIHGLWP + S  + P        +D+ +   +RS+L
Sbjct  4    WPPTNCRVRIKKPCSNPRPLQYFTIHGLWPGNYSNPTKPSNCNGTKFDDRKVYPHMRSKL  63

Query  486  VKDWPGLEQQDDSLFW  439
               WP +E  +D+ FW
Sbjct  64   KISWPDVESGNDTNFW  79



>gb|AAZ67033.1| Sg-RNase [Prunus dulcis]
Length=196

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQT--KACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+   K C   + +Q+FTIHGLWP + S  + P          + +  +
Sbjct  31   FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQ  90

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LRS++   WP +E  +D+ FW
Sbjct  91   LRSKMKISWPDVESGNDTRFW  111



>gb|AAL35747.1| RNase [Prunus dulcis]
 gb|AAM76702.1| RNase [Prunus dulcis]
 gb|AAZ91365.1| S6 S-RNase [Prunus webbii]
Length=170

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 39/76 (51%), Gaps = 3/76 (4%)
 Frame = -2

Query  657  WPNGYCQTK---ACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQL  487
            WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  K+R +L
Sbjct  4    WPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSPKMRVKL  63

Query  486  VKDWPGLEQQDDSLFW  439
             + WP +E  +D+ FW
Sbjct  64   KRSWPDVESGNDTRFW  79



>ref|XP_640939.1| ribonuclease T2 [Dictyostelium discoideum AX4]
 sp|Q7M438.3|RNDI_DICDI RecName: Full=Ribonuclease DdI; Short=RNase DdI; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL66943.1| ribonuclease T2 [Dictyostelium discoideum AX4]
Length=223

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 33/68 (49%), Gaps = 2/68 (3%)
 Frame = -2

Query  669  FALTWPNGYCQTKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQ  490
            F   W   YC ++ CI NK  + FTIHGLWP + S  S P     P  N   I   L  Q
Sbjct  37   FVQQWIYSYCDSQTCIQNKEREAFTIHGLWP-ENSDGSYPSFCSGPSFNVNAIQ-DLEDQ  94

Query  489  LVKDWPGL  466
            L  DWP L
Sbjct  95   LNFDWPSL  102



>gb|ADZ48267.1| S-locus-associated ribonuclease [Prunus pseudocerasus]
Length=225

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 40/82 (49%), Gaps = 3/82 (4%)
 Frame = -2

Query  675  LKFALTWPNGYCQTKA---CIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDA  505
             +F   WP   C+ +    C   + +Q+FTIHGLWP + S  + P        N   +  
Sbjct  31   FQFVQQWPPTNCRVRIKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCAGSQFNFTKVSP  90

Query  504  KLRSQLVKDWPGLEQQDDSLFW  439
            +LRS L   WP +E  +D+ FW
Sbjct  91   QLRSILKTSWPDVESGNDTKFW  112



>dbj|BAF56257.1| S-RNase [Prunus speciosa]
Length=171

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -2

Query  675  LKFALTWPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAK  502
             +F   WP   C+  ++    ++ +Q FTIHGLWP + S  ++P          + +  +
Sbjct  2    FQFVQQWPPVTCRFSSRTRYQHRPLQIFTIHGLWPSNYSNPTMPSNCIGLQFKKENVSPQ  61

Query  501  LRSQLVKDWPGLEQQDDSLFW  439
            LR++L + WP +E ++D+ FW
Sbjct  62   LRAKLERSWPNVESRNDTRFW  82



>gb|ABV02076.1| S-locus S-RNase S19 [Prunus spinosa]
Length=188

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 2/75 (3%)
 Frame = -2

Query  657  WPNGYCQ--TKACIPNKIVQHFTIHGLWPHDQSWTSLPPVKGLPPLNDKIIDAKLRSQLV  484
            WP   C+   K C  ++ +Q FTIHGLWP + S  + P     P  N+  +  +LRS+L 
Sbjct  2    WPPVTCRFSRKPCYKHQPLQIFTIHGLWPSNYSNPTTPSNCVGPRFNESKLPPQLRSKLK  61

Query  483  KDWPGLEQQDDSLFW  439
              WP +E  +++ FW
Sbjct  62   MSWPDVESGNNTNFW  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553087273260