BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8597_g1_i1 len=402 path=[1:0-401]

Length=402
                                                                      Score     E

ref|XP_004238867.1|  PREDICTED: ATP synthase subunit beta, mitoch...  55.8    2e-06   
ref|XP_006344203.1|  PREDICTED: ATP synthase subunit beta, mitoch...  54.3    6e-06   
ref|XP_009613485.1|  PREDICTED: ATP synthase subunit beta, mitoch...  53.9    9e-06   
ref|NP_001289494.1|  ATP synthase subunit beta, mitochondrial-like    53.9    9e-06   
gb|AAD03393.1|  ATPase beta subunit                                   53.9    9e-06   Nicotiana sylvestris



>ref|XP_004238867.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum 
lycopersicum]
Length=557

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = +1

Query  238  VANSLTRPRPTTRSSPAGFLLNRLARYSTsaapadkpas---kpaGNEPTGKITDEFT  402
            +ANS+  P+ T+R+SPAGFLLNR  +Y+TSAA     ++   K +GNEPTGKITDEFT
Sbjct  26   LANSI--PKATSRASPAGFLLNRAVKYATSAAAPADKSATPPKSSGNEPTGKITDEFT  81



>ref|XP_006344203.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum 
tuberosum]
Length=556

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 4/57 (7%)
 Frame = +1

Query  238  VANSLTRPRPTTRSSPAGFLLNRLARYSTsaapadkpas--kpaGNEPTGKITDEFT  402
            +ANS+  P+ T+R+SPAGFLLNR  +Y+TSAAPADK A+  K +GNEP+GKITDEFT
Sbjct  26   LANSI--PKTTSRASPAGFLLNRAVKYATSAAPADKSATPPKSSGNEPSGKITDEFT  80



>ref|XP_009613485.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=556

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = +1

Query  238  VANSLTRPRPTTRSSPAGFLLNRLARYSTsaapadkpas--kpaGNEPTGKITDEFT  402
            +ANS+  PR T+R+SP GFLLNR  +Y+TSAA     A+  KP+GNEPTGKITDEFT
Sbjct  26   LANSI--PRTTSRASPKGFLLNRAVKYATSAAAEKPKATPPKPSGNEPTGKITDEFT  80



>ref|NP_001289494.1| ATP synthase subunit beta, mitochondrial-like [Nicotiana sylvestris]
 gb|AAD03392.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris]
Length=556

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = +1

Query  238  VANSLTRPRPTTRSSPAGFLLNRLARYSTsaapadkpas--kpaGNEPTGKITDEFT  402
            +ANS+  PR T+R+SP GFLLNR  +Y+TSAA     A+  KP+GNEPTGKITDEFT
Sbjct  26   LANSI--PRTTSRASPKGFLLNRAVKYATSAAAEKPKATPPKPSGNEPTGKITDEFT  80



>gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris]
Length=555

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = +1

Query  238  VANSLTRPRPTTRSSPAGFLLNRLARYSTsaapadkpas--kpaGNEPTGKITDEFT  402
            +ANS+  PR T+R+SP GFLLNR  +Y+TSAA     A+  KP+GNEPTGKITDEFT
Sbjct  26   LANSI--PRTTSRASPKGFLLNRAVKYATSAAAEKPKATPPKPSGNEPTGKITDEFT  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508466684456