BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85966_g1_i1 len=825 path=[803:0-824]

Length=825
                                                                      Score     E

emb|CDP03039.1|  unnamed protein product                                103   2e-23   
emb|CBI27760.3|  unnamed protein product                                101   2e-22   
ref|XP_002275644.1|  PREDICTED: uncharacterized protein LOC100266455    101   2e-22   Vitis vinifera
ref|XP_006353770.1|  PREDICTED: uncharacterized protein LOC102587510  99.0    2e-21   
ref|XP_009764068.1|  PREDICTED: uncharacterized protein LOC104215...  96.3    2e-20   
ref|XP_004243683.1|  PREDICTED: uncharacterized protein LOC101268587  95.1    5e-20   
ref|XP_010049360.1|  PREDICTED: uncharacterized protein LOC104438001  93.6    1e-19   
ref|XP_010049331.1|  PREDICTED: uncharacterized protein LOC104437967  93.6    1e-19   
ref|XP_011078141.1|  PREDICTED: uncharacterized protein LOC105161958  93.2    1e-19   
ref|XP_006381568.1|  auxin-responsive family protein                  91.7    5e-19   
ref|XP_009610752.1|  PREDICTED: uncharacterized protein LOC104104386  91.7    7e-19   
ref|XP_011039922.1|  PREDICTED: uncharacterized protein LOC105136...  90.9    8e-19   
ref|XP_004488140.1|  PREDICTED: uncharacterized protein LOC101508911  90.9    9e-19   
gb|KEH37650.1|  SAUR-like auxin-responsive family protein             90.9    9e-19   
ref|XP_009764070.1|  PREDICTED: auxin-induced protein 15A-like is...  89.7    1e-18   
ref|XP_011039920.1|  PREDICTED: uncharacterized protein LOC105136...  90.9    1e-18   
ref|XP_010261728.1|  PREDICTED: uncharacterized protein LOC104600476  90.5    1e-18   
ref|XP_007012552.1|  SAUR-like auxin-responsive protein family        90.5    1e-18   
ref|XP_010273992.1|  PREDICTED: uncharacterized protein LOC104609396  89.7    2e-18   
gb|KDP33955.1|  hypothetical protein JCGZ_07526                       90.1    2e-18   
ref|XP_011010972.1|  PREDICTED: uncharacterized protein LOC105115...  89.7    3e-18   
ref|XP_011093884.1|  PREDICTED: uncharacterized protein LOC105173720  89.4    3e-18   
ref|XP_011010970.1|  PREDICTED: uncharacterized protein LOC105115...  89.7    3e-18   
ref|XP_006452873.1|  hypothetical protein CICLE_v10009722mg           89.4    3e-18   
gb|AAN65371.1|  auxin-regulated protein                               89.0    4e-18   Phaseolus vulgaris [French bean]
ref|XP_006474596.1|  PREDICTED: uncharacterized protein LOC102619589  89.4    4e-18   
ref|XP_006349979.1|  PREDICTED: uncharacterized protein LOC102582085  90.5    4e-18   
ref|XP_006400646.1|  hypothetical protein EUTSA_v10014872mg           89.4    4e-18   
ref|XP_009766516.1|  PREDICTED: uncharacterized protein LOC104217885  89.0    5e-18   
gb|KHN47616.1|  Indole-3-acetic acid-induced protein ARG7             89.0    6e-18   
ref|XP_006288810.1|  hypothetical protein CARUB_v10002144mg           89.0    6e-18   
ref|XP_006452874.1|  hypothetical protein CICLE_v10009722mg           89.0    6e-18   
ref|XP_002516215.1|  Indole-3-acetic acid-induced protein ARG7, p...  88.6    6e-18   Ricinus communis
ref|XP_010520521.1|  PREDICTED: uncharacterized protein LOC104799608  88.6    7e-18   
gb|KHG20809.1|  Auxin-induced 15A                                     88.6    7e-18   
ref|XP_010103079.1|  hypothetical protein L484_003321                 88.2    1e-17   
ref|XP_009792064.1|  PREDICTED: uncharacterized protein LOC104239...  89.0    1e-17   
ref|XP_009120769.1|  PREDICTED: uncharacterized protein LOC103845643  87.8    1e-17   
ref|XP_006586657.1|  PREDICTED: uncharacterized protein LOC100527...  88.2    1e-17   
emb|CDX92434.1|  BnaA10g14730D                                        87.8    1e-17   
ref|XP_009591557.1|  PREDICTED: uncharacterized protein DDB_G0286...  89.0    1e-17   
ref|XP_009792063.1|  PREDICTED: uncharacterized protein LOC104239...  88.6    1e-17   
ref|XP_010493190.1|  PREDICTED: uncharacterized protein LOC104770457  87.4    2e-17   
ref|XP_010314062.1|  PREDICTED: uncharacterized protein LOC101254455  87.8    2e-17   
ref|XP_009126477.1|  PREDICTED: indole-3-acetic acid-induced prot...  87.0    2e-17   
gb|EYU28302.1|  hypothetical protein MIMGU_mgv1a017169mg              84.7    3e-17   
emb|CDY16564.1|  BnaC09g37090D                                        86.7    3e-17   
ref|XP_002875598.1|  hypothetical protein ARALYDRAFT_484787           86.3    4e-17   
ref|XP_010541681.1|  PREDICTED: uncharacterized protein LOC104815072  86.3    4e-17   
ref|XP_007154547.1|  hypothetical protein PHAVU_003G127800g           88.2    4e-17   
ref|XP_009406684.1|  PREDICTED: uncharacterized protein LOC103989538  85.9    5e-17   
gb|KHN49080.1|  Indole-3-acetic acid-induced protein ARG7             85.9    6e-17   
ref|XP_002871957.1|  hypothetical protein ARALYDRAFT_488986           85.9    6e-17   
ref|NP_001238039.1|  uncharacterized protein LOC100527570             85.9    7e-17   
ref|XP_009123263.1|  PREDICTED: uncharacterized protein LOC103848025  85.5    7e-17   
ref|NP_189898.1|  SAUR-like auxin-responsive protein                  85.5    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62891.1|  unknown                                               85.5    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28585.1|  unknown                                               85.5    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425808.1|  PREDICTED: uncharacterized protein LOC104710848  85.5    8e-17   
ref|XP_006419133.1|  hypothetical protein EUTSA_v10002695mg           85.5    8e-17   
ref|XP_003551054.1|  PREDICTED: uncharacterized protein LOC100795275  85.1    9e-17   
ref|XP_010103473.1|  hypothetical protein L484_014484                 85.5    1e-16   
ref|XP_002324724.1|  auxin-responsive family protein                  85.1    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010514710.1|  PREDICTED: uncharacterized protein LOC104790628  85.1    1e-16   
ref|XP_006345246.1|  PREDICTED: uncharacterized protein LOC102605164  85.5    1e-16   
ref|XP_010503025.1|  PREDICTED: uncharacterized protein LOC104780223  84.7    1e-16   
ref|XP_007202616.1|  hypothetical protein PRUPE_ppa011868mg           84.7    2e-16   
ref|XP_008460570.1|  PREDICTED: uncharacterized protein LOC103499...  84.0    3e-16   
ref|XP_008242284.1|  PREDICTED: uncharacterized protein LOC103340...  84.3    3e-16   
ref|XP_008242287.1|  PREDICTED: uncharacterized protein LOC103340...  84.3    3e-16   
ref|NP_197581.2|  SAUR-like auxin-responsive protein                  83.6    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010321126.1|  PREDICTED: uncharacterized protein LOC101264326  84.3    4e-16   
ref|XP_004289003.1|  PREDICTED: uncharacterized protein LOC101294986  84.3    4e-16   
ref|XP_008460569.1|  PREDICTED: uncharacterized protein LOC103499...  83.6    6e-16   
gb|KHN07872.1|  Indole-3-acetic acid-induced protein ARG7             82.8    7e-16   
ref|XP_008337812.1|  PREDICTED: uncharacterized protein LOC103400902  83.2    9e-16   
ref|NP_001031914.1|  SAUR-like auxin-responsive protein               83.2    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359696.1|  PREDICTED: uncharacterized protein LOC103950...  82.8    1e-15   
ref|XP_006292206.1|  hypothetical protein CARUB_v10018411mg           82.0    1e-15   
ref|XP_009611200.1|  PREDICTED: uncharacterized protein LOC104104...  82.4    1e-15   
ref|XP_010454386.1|  PREDICTED: uncharacterized protein LOC104736151  82.0    1e-15   
ref|NP_001236981.1|  uncharacterized protein LOC100527760             82.0    1e-15   
ref|XP_009359697.1|  PREDICTED: uncharacterized protein LOC103950...  82.4    1e-15   
ref|XP_010420926.1|  PREDICTED: uncharacterized protein LOC104706427  82.0    1e-15   
ref|XP_009611201.1|  PREDICTED: uncharacterized protein LOC104104...  82.0    1e-15   
gb|EPS70661.1|  hypothetical protein M569_04099                       81.6    1e-15   
ref|XP_008391750.1|  PREDICTED: uncharacterized protein LOC103453...  82.4    1e-15   
ref|XP_009343362.1|  PREDICTED: uncharacterized protein LOC103935...  82.4    2e-15   
ref|XP_009348903.1|  PREDICTED: uncharacterized protein LOC103940...  82.4    2e-15   
ref|XP_008391743.1|  PREDICTED: uncharacterized protein LOC103453...  82.0    2e-15   
ref|XP_009348905.1|  PREDICTED: uncharacterized protein LOC103940...  82.0    2e-15   
ref|XP_009348904.1|  PREDICTED: uncharacterized protein LOC103940...  82.0    2e-15   
ref|XP_009343363.1|  PREDICTED: uncharacterized protein LOC103935...  82.0    2e-15   
ref|XP_009348906.1|  PREDICTED: uncharacterized protein LOC103940...  82.0    2e-15   
ref|XP_008391757.1|  PREDICTED: uncharacterized protein LOC103453...  82.0    2e-15   
ref|XP_009343361.1|  PREDICTED: uncharacterized protein LOC103935...  82.4    2e-15   
emb|CDX70944.1|  BnaC03g10280D                                        81.6    2e-15   
ref|XP_009131816.1|  PREDICTED: uncharacterized protein LOC103856463  80.9    4e-15   
ref|XP_004508030.1|  PREDICTED: uncharacterized protein LOC101493355  80.5    4e-15   
ref|XP_007138620.1|  hypothetical protein PHAVU_009G224000g           80.1    7e-15   
gb|EYU25814.1|  hypothetical protein MIMGU_mgv1a018984mg              77.8    7e-15   
ref|XP_003609957.1|  Auxin-induced protein 6B                         78.6    2e-14   
ref|XP_008803404.1|  PREDICTED: uncharacterized protein LOC103716962  76.6    7e-14   
ref|XP_009401534.1|  PREDICTED: uncharacterized protein LOC103985535  76.6    7e-14   
ref|XP_004142814.1|  PREDICTED: uncharacterized protein LOC101207913  76.6    9e-14   
ref|XP_010917417.1|  PREDICTED: uncharacterized protein LOC105042015  76.3    1e-13   
gb|KGN57847.1|  hypothetical protein Csa_3G346940                     76.3    1e-13   
ref|XP_009410256.1|  PREDICTED: uncharacterized protein LOC103992337  74.3    6e-13   
gb|ABR17095.1|  unknown                                               72.8    1e-12   Picea sitchensis
ref|XP_008784357.1|  PREDICTED: auxin-induced protein 15A-like        72.4    2e-12   
ref|XP_004956905.1|  PREDICTED: uncharacterized protein LOC101782...  72.4    3e-12   
ref|XP_004956904.1|  PREDICTED: uncharacterized protein LOC101782...  72.4    3e-12   
ref|XP_008652763.1|  PREDICTED: uncharacterized protein LOC103632...  73.2    4e-12   
gb|KHF97540.1|  Auxin-induced 15A                                     71.6    4e-12   
ref|XP_010687567.1|  PREDICTED: uncharacterized protein LOC104901671  71.6    5e-12   
ref|XP_008652765.1|  PREDICTED: uncharacterized protein LOC103632...  72.8    6e-12   
ref|XP_008652764.1|  PREDICTED: uncharacterized protein LOC103632...  72.8    6e-12   
ref|XP_006661272.1|  PREDICTED: uncharacterized protein LOC102719796  72.0    7e-12   
ref|XP_002462442.1|  hypothetical protein SORBIDRAFT_02g025620        71.2    9e-12   Sorghum bicolor [broomcorn]
gb|ADE76442.1|  unknown                                               70.1    2e-11   
gb|EAZ09231.1|  hypothetical protein OsI_31504                        70.1    3e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001063264.1|  Os09g0437400                                     70.1    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006843842.1|  hypothetical protein AMTR_s00007p00261250        67.8    1e-10   
ref|XP_010239379.1|  PREDICTED: uncharacterized protein LOC100841069  67.0    3e-10   
gb|AEW08460.1|  hypothetical protein 2_10399_01                       65.1    6e-10   
ref|XP_008670215.1|  PREDICTED: uncharacterized protein LOC103647...  62.4    2e-08   
tpg|DAA40139.1|  TPA: hypothetical protein ZEAMMB73_735705            61.6    2e-08   
ref|XP_008670214.1|  PREDICTED: uncharacterized protein LOC103647...  62.8    3e-08   
ref|XP_004291305.1|  PREDICTED: uncharacterized protein LOC101314623  60.8    3e-08   
ref|XP_007011526.1|  SAUR family protein                              60.1    9e-08   
ref|XP_004240286.1|  PREDICTED: uncharacterized protein LOC101252288  59.7    1e-07   
ref|XP_003588611.1|  Auxin-induced protein 6B                         59.7    1e-07   
ref|XP_003574590.1|  PREDICTED: auxin-induced protein X15-like        58.5    2e-07   
ref|XP_010092524.1|  hypothetical protein L484_010412                 57.8    2e-07   
ref|XP_009367954.1|  PREDICTED: uncharacterized protein LOC103957507  59.3    2e-07   
gb|KHN46698.1|  Indole-3-acetic acid-induced protein ARG7             57.0    3e-07   
ref|XP_004136303.1|  PREDICTED: auxin-induced protein 6B-like         58.2    4e-07   
ref|XP_010655292.1|  PREDICTED: uncharacterized protein LOC100244383  57.8    4e-07   
gb|KHN46691.1|  Indole-3-acetic acid-induced protein ARG7             56.2    4e-07   
gb|EMT06372.1|  hypothetical protein F775_12410                       57.0    5e-07   
ref|XP_008361160.1|  PREDICTED: uncharacterized protein LOC103424846  58.2    5e-07   
ref|XP_006587671.1|  PREDICTED: auxin-induced protein 6B-like         57.8    5e-07   
ref|XP_006406409.1|  hypothetical protein EUTSA_v10021791mg           57.0    6e-07   
gb|KDP33420.1|  hypothetical protein JCGZ_06991                       57.8    6e-07   
ref|XP_003539974.1|  PREDICTED: auxin-induced protein 6B-like         56.2    7e-07   
ref|XP_009396221.1|  PREDICTED: indole-3-acetic acid-induced prot...  57.0    8e-07   
ref|XP_010246391.1|  PREDICTED: auxin-induced protein 15A-like        56.2    9e-07   
ref|XP_003527361.1|  PREDICTED: auxin-induced protein 15A             55.5    1e-06   
ref|XP_007132894.1|  hypothetical protein PHAVU_011G133900g           55.8    1e-06   
ref|NP_001045869.2|  Os02g0143400                                     56.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN13740.1|  Auxin-induced protein 6B                              55.5    1e-06   
ref|XP_002266875.1|  PREDICTED: uncharacterized protein LOC100247885  56.6    1e-06   Vitis vinifera
ref|XP_006360678.1|  PREDICTED: uncharacterized protein LOC102595713  57.0    1e-06   
gb|AFK44459.1|  unknown                                               57.0    1e-06   
ref|XP_010246393.1|  PREDICTED: auxin-induced protein 15A-like        55.8    1e-06   
gb|KHN29232.1|  Indole-3-acetic acid-induced protein ARG7             55.5    1e-06   
ref|XP_003531444.1|  PREDICTED: indole-3-acetic acid-induced prot...  55.5    1e-06   
ref|XP_011006641.1|  PREDICTED: uncharacterized protein LOC105112603  56.6    1e-06   
gb|KHN11779.1|  Auxin-induced protein 6B                              56.6    1e-06   
ref|XP_009400356.1|  PREDICTED: auxin-induced protein 15A-like        55.5    2e-06   
dbj|BAD13235.1|  auxin-induced protein-like                           56.2    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008363801.1|  PREDICTED: indole-3-acetic acid-induced prot...  55.5    2e-06   
ref|XP_008781914.1|  PREDICTED: auxin-induced protein 6B-like         55.8    2e-06   
ref|XP_006450104.1|  hypothetical protein CICLE_v10010302mg           56.2    2e-06   
ref|XP_009368350.1|  PREDICTED: auxin-induced protein 15A-like        55.1    2e-06   
ref|XP_006483628.1|  PREDICTED: uncharacterized protein LOC102619609  56.2    2e-06   
gb|KHN13736.1|  Auxin-induced protein 6B                              54.3    2e-06   
ref|XP_008378142.1|  PREDICTED: uncharacterized protein LOC103441218  56.2    2e-06   
gb|ABK22919.1|  unknown                                               55.8    2e-06   Picea sitchensis
ref|XP_010913783.1|  PREDICTED: auxin-induced protein 6B-like         55.5    3e-06   
ref|XP_010491789.1|  PREDICTED: auxin-induced protein 6B-like         55.5    3e-06   
emb|CAN62213.1|  hypothetical protein VITISV_011168                   55.8    3e-06   Vitis vinifera
ref|XP_010246394.1|  PREDICTED: auxin-induced protein 15A-like        54.7    3e-06   
ref|XP_009368374.1|  PREDICTED: auxin-induced protein 15A-like        54.7    3e-06   
ref|XP_010246396.1|  PREDICTED: auxin-induced protein 15A-like        54.7    3e-06   
gb|EAY84447.1|  hypothetical protein OsI_05820                        55.1    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009402006.1|  PREDICTED: auxin-induced protein X10A-like       55.1    3e-06   
ref|XP_010544871.1|  PREDICTED: auxin-induced protein 15A-like        55.1    3e-06   
ref|XP_010251734.1|  PREDICTED: auxin-induced protein X15-like        54.7    4e-06   
sp|P33081.1|AX15A_SOYBN  RecName: Full=Auxin-induced protein 15A      53.9    4e-06   Glycine max [soybeans]
ref|XP_006836558.1|  hypothetical protein AMTR_s00131p00053580        54.7    4e-06   
ref|XP_006339758.1|  PREDICTED: auxin-induced protein 15A-like        54.3    4e-06   
ref|XP_010244080.1|  PREDICTED: auxin-induced protein 15A-like        54.3    5e-06   
gb|KHN13734.1|  Auxin-induced protein 6B                              53.9    5e-06   
ref|XP_010246395.1|  PREDICTED: auxin-induced protein X15-like        53.9    5e-06   
ref|XP_006382198.1|  auxin-responsive family protein                  55.1    5e-06   
dbj|BAK06469.1|  predicted protein                                    54.3    5e-06   
emb|CDX72302.1|  BnaC07g43240D                                        55.8    5e-06   
gb|KHN25449.1|  Auxin-induced protein 6B                              53.9    5e-06   
ref|XP_001752517.1|  predicted protein                                53.5    5e-06   
ref|XP_009138004.1|  PREDICTED: uncharacterized protein LOC103862042  55.8    5e-06   
ref|XP_004966106.1|  PREDICTED: auxin-induced protein 6B-like         54.7    6e-06   
gb|KHN08189.1|  Auxin-induced protein 6B                              53.5    6e-06   
ref|XP_010664793.1|  PREDICTED: auxin-induced protein 15A             53.9    6e-06   
emb|CDX68733.1|  BnaC01g07200D                                        55.1    6e-06   
ref|XP_010034089.1|  PREDICTED: uncharacterized protein LOC104423276  55.1    6e-06   
ref|XP_003607123.1|  Auxin-induced protein 6B                         53.5    6e-06   
gb|EMT02079.1|  hypothetical protein F775_07059                       53.9    7e-06   
ref|XP_003527610.1|  PREDICTED: auxin-induced protein 10A5-like       53.5    7e-06   
ref|XP_003602327.1|  Auxin-induced protein 10A5                       54.3    7e-06   
ref|XP_004235010.1|  PREDICTED: auxin-induced protein X15-like        53.9    7e-06   
sp|P32295.1|ARG7_VIGRR  RecName: Full=Indole-3-acetic acid-induce...  53.5    7e-06   Vigna radiata var. radiata [golden gram]
gb|AFK37533.1|  unknown                                               53.9    7e-06   
ref|XP_008237032.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.5    7e-06   
gb|KCW55445.1|  hypothetical protein EUGRSUZ_I01347                   53.5    7e-06   
ref|XP_002446101.1|  hypothetical protein SORBIDRAFT_06g001800        53.9    8e-06   Sorghum bicolor [broomcorn]
ref|XP_003522807.1|  PREDICTED: auxin-induced protein 10A5-like       53.5    8e-06   
ref|XP_009391130.1|  PREDICTED: auxin-induced protein 15A-like        53.5    8e-06   
ref|XP_007023649.1|  SAUR-like auxin-responsive protein family, p...  54.7    8e-06   
ref|XP_009347320.1|  PREDICTED: auxin-induced protein 15A-like        53.1    9e-06   
ref|XP_007135905.1|  hypothetical protein PHAVU_009G001700g           53.1    9e-06   
gb|EMS54722.1|  hypothetical protein TRIUR3_21602                     53.5    1e-05   
ref|XP_009361302.1|  PREDICTED: auxin-induced protein 15A             53.5    1e-05   
gb|EPS67974.1|  hypothetical protein M569_06800                       53.1    1e-05   
ref|XP_010100683.1|  hypothetical protein L484_023452                 53.5    1e-05   
ref|XP_002883237.1|  hypothetical protein ARALYDRAFT_479541           53.5    1e-05   
ref|XP_007200657.1|  hypothetical protein PRUPE_ppa016788mg           52.8    1e-05   
ref|XP_008376800.1|  PREDICTED: auxin-induced protein 15A             53.5    1e-05   
emb|CDY13423.1|  BnaA03g51410D                                        54.3    1e-05   
ref|XP_008783079.1|  PREDICTED: auxin-induced protein 6B-like         53.9    1e-05   
ref|XP_010683705.1|  PREDICTED: auxin-induced protein 15A             53.1    1e-05   
ref|XP_002265932.1|  PREDICTED: auxin-induced protein 6B-like         53.9    1e-05   Vitis vinifera
ref|XP_010927192.1|  PREDICTED: auxin-induced protein 6B-like         53.5    1e-05   
gb|AES89354.2|  SAUR-like auxin-responsive family protein             52.8    1e-05   
ref|XP_009368355.1|  PREDICTED: auxin-induced protein 15A-like        53.1    1e-05   
ref|XP_002513309.1|  calmodulin binding protein, putative             53.1    1e-05   Ricinus communis
ref|XP_007201443.1|  hypothetical protein PRUPE_ppa013837mg           52.8    1e-05   
ref|XP_010246392.1|  PREDICTED: auxin-induced protein 15A-like        52.8    1e-05   
gb|KHN26920.1|  Auxin-induced protein 15A                             52.4    1e-05   
ref|XP_008659173.1|  PREDICTED: uncharacterized protein LOC103637951  54.7    1e-05   
ref|XP_010928766.1|  PREDICTED: auxin-induced protein 6B-like         53.5    2e-05   
ref|NP_001241474.1|  uncharacterized protein LOC100798690             52.4    2e-05   
gb|KHN39378.1|  Auxin-induced protein 15A                             53.1    2e-05   
emb|CDP15258.1|  unnamed protein product                              53.1    2e-05   
gb|KHN29234.1|  Auxin-induced protein 6B                              52.4    2e-05   
ref|XP_007023648.1|  SAUR-like auxin-responsive protein family, p...  53.5    2e-05   
ref|XP_010263288.1|  PREDICTED: auxin-induced protein X15-like        52.8    2e-05   
ref|XP_003539973.1|  PREDICTED: indole-3-acetic acid-induced prot...  52.4    2e-05   
ref|XP_011047001.1|  PREDICTED: indole-3-acetic acid-induced prot...  52.4    2e-05   
ref|XP_002312996.1|  hypothetical protein POPTR_0009s12950g           52.4    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009351936.1|  PREDICTED: auxin-induced protein 15A-like        52.8    2e-05   
ref|XP_010545490.1|  PREDICTED: vacuolar-processing enzyme alpha-...  55.5    2e-05   
ref|XP_007200158.1|  hypothetical protein PRUPE_ppa016758mg           52.4    2e-05   
ref|XP_009793038.1|  PREDICTED: auxin-induced protein X15-like        52.4    2e-05   
ref|XP_003607103.1|  Auxin-induced protein-like protein               52.4    2e-05   
gb|KHN13737.1|  Indole-3-acetic acid-induced protein ARG7             52.0    2e-05   
ref|XP_006347637.1|  PREDICTED: indole-3-acetic acid-induced prot...  52.4    2e-05   
ref|XP_010432376.1|  PREDICTED: auxin-induced protein X15-like        52.4    2e-05   
ref|XP_008448013.1|  PREDICTED: auxin-induced protein 15A-like        52.4    2e-05   
gb|KHN13729.1|  Indole-3-acetic acid-induced protein ARG7             52.0    2e-05   
ref|XP_010472101.1|  PREDICTED: auxin-induced protein X15             52.0    2e-05   
ref|XP_009375726.1|  PREDICTED: uncharacterized protein LOC103964518  53.1    2e-05   
ref|XP_006412606.1|  hypothetical protein EUTSA_v10027570mg           53.5    2e-05   
ref|XP_006300148.1|  hypothetical protein CARUB_v10016378mg           52.4    3e-05   
ref|XP_010437566.1|  PREDICTED: auxin-induced protein X15-like        52.0    3e-05   
ref|XP_004967237.1|  PREDICTED: auxin-induced protein 6B-like         52.4    3e-05   
gb|KCW55449.1|  hypothetical protein EUGRSUZ_I01351                   52.0    3e-05   
ref|NP_196660.1|  SAUR-like auxin-responsive protein                  52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132886.1|  hypothetical protein PHAVU_011G133100g           51.6    3e-05   
ref|XP_010028674.1|  PREDICTED: indole-3-acetic acid-induced prot...  51.6    3e-05   
ref|XP_004975081.1|  PREDICTED: auxin-induced protein 10A5-like       52.4    3e-05   
gb|KCW55456.1|  hypothetical protein EUGRSUZ_I01358                   51.6    3e-05   
ref|XP_008457620.1|  PREDICTED: uncharacterized protein LOC103497270  53.5    3e-05   
ref|XP_003607137.1|  Auxin-induced protein 6B                         51.6    3e-05   
ref|XP_004301662.1|  PREDICTED: uncharacterized protein LOC101295922  53.1    3e-05   
ref|XP_006400348.1|  hypothetical protein EUTSA_v10015121mg           51.6    3e-05   
gb|ADM74027.1|  auxin responsive family-like protein                  52.4    3e-05   
ref|XP_003556991.1|  PREDICTED: auxin-induced protein 15A-like        51.2    3e-05   
ref|NP_195205.1|  SAUR-like auxin-responsive protein                  51.6    3e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CBI23067.3|  unnamed protein product                              52.0    4e-05   
ref|XP_001756689.1|  predicted protein                                51.2    4e-05   
gb|KHN35585.1|  Auxin-induced protein 6B                              51.2    4e-05   
sp|P33083.1|AX6B_SOYBN  RecName: Full=Auxin-induced protein 6B        51.2    4e-05   Glycine max [soybeans]
ref|XP_006365925.1|  PREDICTED: auxin-induced protein 10A5-like       51.6    4e-05   
gb|ADM74010.1|  auxin responsive family-like protein                  52.4    4e-05   
gb|EPS60697.1|  hypothetical protein M569_14106                       51.6    4e-05   
ref|XP_006850943.1|  hypothetical protein AMTR_s00025p00192620        52.4    4e-05   
ref|XP_009347333.1|  PREDICTED: auxin-induced protein 15A-like        51.2    4e-05   
ref|XP_010934541.1|  PREDICTED: auxin-induced protein 15A-like        51.6    4e-05   
ref|XP_008466269.1|  PREDICTED: uncharacterized protein LOC103503729  52.4    4e-05   
ref|XP_003530361.1|  PREDICTED: indole-3-acetic acid-induced prot...  52.4    4e-05   
ref|XP_002889033.1|  auxin-responsive family protein                  52.4    4e-05   
ref|XP_007146132.1|  hypothetical protein PHAVU_006G014900g           51.2    4e-05   
gb|KHN07748.1|  Auxin-induced protein X15                             50.8    4e-05   
gb|KDP27619.1|  hypothetical protein JCGZ_19624                       51.2    4e-05   
ref|XP_007136493.1|  hypothetical protein PHAVU_009G049900g           51.6    4e-05   
ref|XP_010271402.1|  PREDICTED: auxin-induced protein X10A-like       51.2    4e-05   
ref|XP_006350722.1|  PREDICTED: indole-3-acetic acid-induced prot...  51.6    4e-05   
ref|XP_008381430.1|  PREDICTED: auxin-induced protein 15A-like        51.6    5e-05   
ref|XP_006582283.1|  PREDICTED: auxin-induced protein X15-like        50.8    5e-05   
ref|XP_006293412.1|  hypothetical protein CARUB_v10024901mg           52.0    5e-05   
gb|KHN46692.1|  Indole-3-acetic acid-induced protein ARG7             51.2    5e-05   
ref|XP_002263012.1|  PREDICTED: auxin-induced protein 15A             51.6    5e-05   
ref|XP_008233080.1|  PREDICTED: auxin-induced protein 15A             51.6    5e-05   
gb|KCW55457.1|  hypothetical protein EUGRSUZ_I01359                   51.2    5e-05   
ref|XP_007218591.1|  hypothetical protein PRUPE_ppa013301mg           51.6    5e-05   
ref|XP_010453133.1|  PREDICTED: auxin-induced protein 6B-like         52.0    5e-05   
ref|XP_006423537.1|  hypothetical protein CICLE_v10029871mg           51.2    5e-05   
gb|ADM74030.1|  auxin responsive family-like protein                  52.0    5e-05   
sp|P33082.1|AXX15_SOYBN  RecName: Full=Auxin-induced protein X15      50.8    5e-05   
ref|XP_010092523.1|  hypothetical protein L484_010411                 51.2    5e-05   
ref|XP_007200097.1|  hypothetical protein PRUPE_ppa019366mg           51.2    5e-05   
ref|XP_009368353.1|  PREDICTED: auxin-induced protein 15A-like        51.2    5e-05   
ref|XP_004951913.1|  PREDICTED: auxin-induced protein X15-like        51.6    6e-05   
ref|XP_004300228.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.8    6e-05   
ref|XP_006846948.1|  hypothetical protein AMTR_s00017p00021670        51.2    6e-05   
ref|XP_010669485.1|  PREDICTED: uncharacterized protein DDB_G0283357  53.1    6e-05   
ref|XP_002273092.1|  PREDICTED: auxin-induced protein X15             51.2    6e-05   
ref|XP_010419652.1|  PREDICTED: auxin-induced protein 6B-like         51.6    6e-05   
ref|XP_010471672.1|  PREDICTED: auxin-induced protein 6B-like iso...  51.6    6e-05   
ref|XP_004170628.1|  PREDICTED: auxin-induced protein 6B-like         50.8    6e-05   
ref|XP_003607106.1|  Auxin-induced protein 6B                         50.8    6e-05   
ref|XP_002321970.1|  hypothetical protein POPTR_0015s00920g           51.2    6e-05   
gb|ABR17640.1|  unknown                                               51.6    6e-05   
gb|KFK23434.1|  hypothetical protein AALP_AAs63894U000200             50.8    6e-05   
ref|XP_003607115.1|  Auxin-induced protein 6B                         50.8    6e-05   
ref|XP_009402035.1|  PREDICTED: auxin-induced protein X10A-like       51.2    6e-05   
ref|XP_008237080.1|  PREDICTED: auxin-induced protein 15A-like        50.8    6e-05   
gb|KDP27608.1|  hypothetical protein JCGZ_19613                       50.8    6e-05   
gb|AFG56380.1|  hypothetical protein 0_8672_01                        51.6    6e-05   
ref|XP_008648308.1|  PREDICTED: small auxin up RNA1 isoform X3        52.0    7e-05   
gb|KCW55452.1|  hypothetical protein EUGRSUZ_I01354                   50.8    7e-05   
ref|XP_008237036.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.8    7e-05   
ref|XP_009790302.1|  PREDICTED: uncharacterized protein LOC104237780  51.6    7e-05   
ref|XP_006846965.1|  hypothetical protein AMTR_s00017p00065780        50.8    7e-05   
ref|XP_002306152.1|  hypothetical protein POPTR_0004s17230g           50.8    7e-05   
ref|XP_006494594.1|  PREDICTED: auxin-induced protein 10A5-like       50.8    7e-05   
ref|XP_006592466.1|  PREDICTED: auxin-induced protein X10A-like       50.4    7e-05   
gb|KCW55447.1|  hypothetical protein EUGRSUZ_I01349                   50.4    7e-05   
gb|KHN29230.1|  Auxin-induced protein 6B                              50.4    7e-05   
ref|XP_003607101.1|  Auxin-induced protein-like protein               50.4    7e-05   
ref|XP_007201460.1|  hypothetical protein PRUPE_ppa013981mg           50.4    7e-05   
ref|XP_011023120.1|  PREDICTED: auxin-induced protein 15A-like        50.8    7e-05   
sp|P33079.1|A10A5_SOYBN  RecName: Full=Auxin-induced protein 10A5     50.4    8e-05   
ref|XP_004293889.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.8    8e-05   
ref|XP_006423546.1|  hypothetical protein CICLE_v10029651mg           50.8    8e-05   
ref|XP_004498552.1|  PREDICTED: uncharacterized protein LOC101505346  52.0    8e-05   
ref|XP_007217560.1|  hypothetical protein PRUPE_ppa021682mg           51.2    8e-05   
ref|NP_565113.1|  SAUR-like auxin-responsive protein                  51.6    8e-05   
ref|XP_008228005.1|  PREDICTED: indole-3-acetic acid-induced prot...  51.2    8e-05   
gb|KCW55443.1|  hypothetical protein EUGRSUZ_I01345                   50.4    8e-05   
ref|XP_003610907.1|  Auxin-induced protein-like protein               51.2    8e-05   
ref|NP_188657.1|  SAUR-like auxin-responsive protein                  50.8    8e-05   
ref|XP_009133442.1|  PREDICTED: auxin-induced protein X15-like        50.4    8e-05   
ref|XP_004301532.1|  PREDICTED: uncharacterized protein LOC101295821  51.6    8e-05   
ref|XP_008811428.1|  PREDICTED: auxin-induced protein 15A             50.4    8e-05   
ref|NP_001105573.1|  small auxin up RNA1                              51.2    8e-05   
gb|KHN29233.1|  Indole-3-acetic acid-induced protein ARG7             50.4    9e-05   
ref|XP_007131728.1|  hypothetical protein PHAVU_011G036800g           50.4    9e-05   
ref|XP_004230018.1|  PREDICTED: auxin-induced protein 15A             50.4    9e-05   
ref|XP_004147005.1|  PREDICTED: auxin-induced protein 15A-like        50.4    9e-05   
ref|XP_008237034.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.4    9e-05   
gb|KHN11771.1|  Auxin-induced protein 6B                              50.4    9e-05   
ref|XP_003534346.1|  PREDICTED: auxin-induced protein 6B-like         50.4    9e-05   
ref|XP_002985683.1|  hypothetical protein SELMODRAFT_49560            50.1    9e-05   
ref|XP_007199401.1|  hypothetical protein PRUPE_ppa026172mg           50.4    9e-05   
ref|XP_008234672.1|  PREDICTED: auxin-induced protein 15A-like        50.8    9e-05   
ref|XP_002301429.2|  auxin-responsive family protein                  50.4    9e-05   
emb|CDX73182.1|  BnaC06g36300D                                        51.2    9e-05   
ref|XP_003607121.1|  Auxin-induced SAUR-like protein                  50.4    9e-05   
ref|XP_004144905.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.4    9e-05   
ref|XP_003539979.1|  PREDICTED: auxin-induced protein 6B-like         50.1    1e-04   
ref|XP_004293892.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.1    1e-04   
ref|XP_007200167.1|  hypothetical protein PRUPE_ppa016712mg           50.4    1e-04   
gb|KHN11761.1|  Indole-3-acetic acid-induced protein ARG7             50.1    1e-04   
ref|XP_004147056.1|  PREDICTED: auxin-induced protein X10A-like       51.2    1e-04   
ref|XP_009346461.1|  PREDICTED: indole-3-acetic acid-induced prot...  51.2    1e-04   
ref|XP_007201437.1|  hypothetical protein PRUPE_ppa013765mg           50.4    1e-04   
ref|XP_002868866.1|  hypothetical protein ARALYDRAFT_490650           50.4    1e-04   
gb|KHN26922.1|  Auxin-induced protein 6B                              50.1    1e-04   
ref|XP_007218348.1|  hypothetical protein PRUPE_ppa010986mg           52.4    1e-04   
ref|XP_002271594.1|  PREDICTED: auxin-induced protein 15A-like        50.4    1e-04   
gb|KHN38103.1|  Auxin-induced protein X15                             51.2    1e-04   
ref|XP_009382023.1|  PREDICTED: auxin-induced protein 15A-like        50.4    1e-04   
ref|XP_009415076.1|  PREDICTED: auxin-induced protein 6B-like         50.8    1e-04   
ref|NP_001234994.1|  uncharacterized protein LOC100500483             50.1    1e-04   
ref|XP_003527365.2|  PREDICTED: auxin-induced protein 10A5-like       50.4    1e-04   
ref|XP_008219982.1|  PREDICTED: uncharacterized protein LOC103320129  51.6    1e-04   
ref|XP_004300227.1|  PREDICTED: uncharacterized protein LOC101304289  52.4    1e-04   
ref|XP_006400352.1|  hypothetical protein EUTSA_v10015118mg           50.1    1e-04   
ref|XP_002306156.1|  hypothetical protein POPTR_0004s17290g           50.1    1e-04   
ref|XP_007135906.1|  hypothetical protein PHAVU_009G001800g           50.1    1e-04   
ref|XP_007132869.1|  hypothetical protein PHAVU_011G131500g           50.1    1e-04   
ref|XP_003523506.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.1    1e-04   
ref|XP_010263292.1|  PREDICTED: uncharacterized protein LOC104601597  51.2    1e-04   
ref|XP_003527372.2|  PREDICTED: auxin-induced protein 10A5-like       50.4    1e-04   
gb|KFK30478.1|  hypothetical protein AALP_AA7G266000                  50.1    1e-04   
ref|XP_010665874.1|  PREDICTED: auxin-induced protein X15-like        50.1    1e-04   
ref|XP_006284807.1|  hypothetical protein CARUB_v10006077mg           50.4    1e-04   
ref|XP_007041969.1|  SAUR-like auxin-responsive protein family        50.1    1e-04   
ref|XP_009379575.1|  PREDICTED: auxin-induced protein 15A-like        50.1    1e-04   
ref|XP_010648451.1|  PREDICTED: uncharacterized protein LOC100250771  51.2    1e-04   
ref|XP_006411674.1|  hypothetical protein EUTSA_v10026657mg           50.1    1e-04   
ref|XP_006487293.1|  PREDICTED: auxin-induced protein X10A-like       50.1    1e-04   
ref|XP_003563516.1|  PREDICTED: auxin-induced protein 15A-like        50.4    1e-04   
ref|XP_009347325.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.1    1e-04   
ref|XP_002869126.1|  auxin-responsive family protein                  50.1    1e-04   
ref|XP_006466560.1|  PREDICTED: auxin-induced protein X15-like        49.7    1e-04   
ref|XP_010647509.1|  PREDICTED: auxin-induced protein X15             50.1    1e-04   
gb|KDO42793.1|  hypothetical protein CISIN_1g047919mg                 50.1    1e-04   
gb|ABK27017.1|  unknown                                               50.8    1e-04   
ref|XP_002438964.1|  hypothetical protein SORBIDRAFT_10g029060        50.4    1e-04   
ref|XP_004300217.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.1    1e-04   
ref|XP_006423538.1|  hypothetical protein CICLE_v10029885mg           50.1    1e-04   
ref|XP_008791264.1|  PREDICTED: auxin-induced protein 15A-like        50.1    1e-04   
gb|KHN25458.1|  Indole-3-acetic acid-induced protein ARG7             50.1    1e-04   
ref|XP_008391976.1|  PREDICTED: auxin-induced protein 15A-like        50.1    1e-04   
ref|XP_008237099.1|  PREDICTED: auxin-induced protein 15A-like        50.4    1e-04   
gb|KDP27616.1|  hypothetical protein JCGZ_19621                       50.1    1e-04   
ref|XP_006304311.1|  hypothetical protein CARUB_v10010680mg           50.1    1e-04   
ref|NP_001058487.2|  Os06g0701900                                     50.4    1e-04   
ref|XP_003529710.1|  PREDICTED: uncharacterized protein LOC100818996  50.4    1e-04   
emb|CDO96969.1|  unnamed protein product                              50.1    1e-04   
ref|XP_006587672.1|  PREDICTED: auxin-induced protein 15A-like        49.7    1e-04   
ref|XP_009379578.1|  PREDICTED: auxin-induced protein 15A-like        49.7    1e-04   
ref|NP_192691.1|  SAUR-like auxin-responsive protein                  50.1    1e-04   
ref|NP_195595.1|  SAUR-like auxin-responsive protein                  50.1    1e-04   
gb|AES89323.2|  SAUR-like auxin-responsive family protein             49.7    1e-04   
ref|XP_001762797.1|  predicted protein                                49.3    1e-04   
ref|XP_003607098.1|  Auxin-induced protein 6B                         49.7    1e-04   
ref|XP_010028671.1|  PREDICTED: indole-3-acetic acid-induced prot...  49.7    1e-04   
ref|XP_003607127.1|  Auxin-induced protein 6B                         49.7    1e-04   
ref|XP_004300216.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.1    1e-04   
gb|KFK29713.1|  hypothetical protein AALP_AA7G169300                  51.2    1e-04   
ref|XP_002871447.1|  auxin-responsive family protein                  50.4    1e-04   
ref|XP_003534354.1|  PREDICTED: auxin-induced protein 10A5-like       49.7    1e-04   
gb|EAY84446.1|  hypothetical protein OsI_05819                        50.1    1e-04   
ref|NP_001119142.1|  SAUR-like auxin-responsive protein               49.7    1e-04   
ref|XP_004510629.1|  PREDICTED: auxin-induced protein 10A5-like       50.1    1e-04   
ref|XP_003607107.1|  Auxin-induced protein-like protein               49.7    1e-04   
ref|XP_002968677.1|  hypothetical protein SELMODRAFT_69255            49.3    1e-04   
ref|XP_004290374.1|  PREDICTED: indole-3-acetic acid-induced prot...  49.7    2e-04   
ref|XP_003534350.1|  PREDICTED: auxin-induced protein X10A-like       49.7    2e-04   
ref|XP_009590415.1|  PREDICTED: auxin-induced protein 15A-like        50.1    2e-04   
ref|XP_010428584.1|  PREDICTED: uncharacterized protein LOC104713210  50.4    2e-04   
ref|XP_009131624.1|  PREDICTED: auxin-induced protein 15A-like        49.7    2e-04   
ref|XP_010466201.1|  PREDICTED: vacuolar-processing enzyme alpha-...  52.8    2e-04   
ref|XP_003607135.1|  Auxin-induced SAUR                               49.7    2e-04   
ref|XP_010101890.1|  hypothetical protein L484_015480                 49.7    2e-04   
emb|CDX72503.1|  BnaC07g45250D                                        49.7    2e-04   
ref|XP_010487992.1|  PREDICTED: vacuolar-processing enzyme alpha-...  52.8    2e-04   
gb|KFK26040.1|  hypothetical protein AALP_AA8G195400                  49.7    2e-04   
ref|XP_009101924.1|  PREDICTED: auxin-induced protein 15A-like        49.7    2e-04   
emb|CBI17630.3|  unnamed protein product                              49.3    2e-04   
ref|XP_008237037.1|  PREDICTED: indole-3-acetic acid-induced prot...  49.7    2e-04   
gb|KDP34550.1|  hypothetical protein JCGZ_11100                       49.7    2e-04   
ref|XP_004240979.1|  PREDICTED: auxin-induced protein X15             49.7    2e-04   
ref|NP_001148413.1|  SAUR31 - auxin-responsive SAUR family member     49.7    2e-04   
gb|ACU16335.1|  unknown                                               49.3    2e-04   
ref|XP_006400344.1|  hypothetical protein EUTSA_v10015117mg           49.7    2e-04   
ref|XP_003527385.2|  PREDICTED: auxin-induced protein 10A5-like       49.7    2e-04   
ref|XP_003607145.1|  Auxin-induced protein-like protein               49.7    2e-04   
gb|KHN29231.1|  Auxin-induced protein 10A5                            49.7    2e-04   
ref|XP_009368370.1|  PREDICTED: auxin-induced protein 15A-like        49.7    2e-04   
ref|XP_009366349.1|  PREDICTED: auxin-induced protein 15A-like        49.7    2e-04   
gb|AFK33527.1|  unknown                                               49.7    2e-04   
ref|XP_001781743.1|  predicted protein                                48.9    2e-04   
ref|XP_010539047.1|  PREDICTED: auxin-induced protein X15-like        49.7    2e-04   
ref|XP_007131737.1|  hypothetical protein PHAVU_011G037700g           49.3    2e-04   
ref|XP_002271427.1|  PREDICTED: auxin-induced protein 15A             49.7    2e-04   
ref|XP_010264205.1|  PREDICTED: uncharacterized protein LOC104602283  50.4    2e-04   
emb|CDY29803.1|  BnaC05g31870D                                        49.7    2e-04   
ref|XP_002301987.1|  auxin-responsive family protein                  50.4    2e-04   
ref|XP_009116859.1|  PREDICTED: auxin-induced protein X15             49.7    2e-04   
gb|EYU35269.1|  hypothetical protein MIMGU_mgv1a017198mg              49.3    2e-04   
gb|AAM64884.1|  auxin-induced protein, putative                       50.4    2e-04   
ref|XP_004974494.1|  PREDICTED: auxin-induced protein 15A-like        49.3    2e-04   
gb|ADM74031.1|  auxin responsive family-like protein                  50.4    2e-04   
ref|NP_001235363.1|  uncharacterized protein LOC100306459             49.3    2e-04   
gb|ADM74001.1|  auxin responsive family-like protein                  50.4    2e-04   
ref|NP_001236844.1|  uncharacterized protein LOC100500615             49.3    2e-04   
gb|KHN20021.1|  Indole-3-acetic acid-induced protein ARG7             49.3    2e-04   
ref|XP_007131734.1|  hypothetical protein PHAVU_011G037400g           49.3    2e-04   
gb|KGN61862.1|  hypothetical protein Csa_2G257100                     51.6    2e-04   
gb|KHN20018.1|  Auxin-induced protein X10A                            49.3    2e-04   
emb|CDX69087.1|  BnaC01g03660D                                        49.7    2e-04   
gb|ADM73997.1|  auxin responsive family-like protein                  50.4    2e-04   
ref|XP_004964614.1|  PREDICTED: auxin-induced protein 6B-like         49.7    2e-04   
ref|XP_003607139.1|  Auxin-induced protein-like protein               49.3    2e-04   
ref|XP_003607114.1|  Auxin-induced protein-like protein               49.3    2e-04   
ref|XP_007201447.1|  hypothetical protein PRUPE_ppa013863mg           49.3    2e-04   
ref|XP_003601676.1|  Auxin-induced protein-like protein               49.3    2e-04   
gb|KGN61863.1|  hypothetical protein Csa_2G258100                     50.8    2e-04   
ref|XP_006494597.1|  PREDICTED: auxin-induced protein X10A-like       49.7    2e-04   
ref|XP_010245477.1|  PREDICTED: auxin-induced protein 15A-like        49.7    2e-04   
ref|XP_006487292.1|  PREDICTED: auxin-induced protein X10A-like       49.3    2e-04   
ref|XP_010536042.1|  PREDICTED: auxin-induced protein 15A-like        49.3    2e-04   
ref|XP_010030680.1|  PREDICTED: uncharacterized protein LOC104420559  51.6    2e-04   
ref|XP_007200638.1|  hypothetical protein PRUPE_ppa013834mg           49.3    2e-04   
gb|KHN11760.1|  Auxin-induced protein 10A5                            49.3    2e-04   
ref|XP_004309347.1|  PREDICTED: indole-3-acetic acid-induced prot...  49.3    2e-04   
ref|XP_011028981.1|  PREDICTED: indole-3-acetic acid-induced prot...  50.1    2e-04   
ref|XP_004231443.1|  PREDICTED: auxin-induced protein 15A-like        49.3    2e-04   
ref|XP_006435151.1|  hypothetical protein CICLE_v10002928mg           49.3    2e-04   
ref|XP_009368356.1|  PREDICTED: indole-3-acetic acid-induced prot...  49.3    2e-04   
emb|CDY25466.1|  BnaC09g39810D                                        49.3    2e-04   
ref|XP_009145659.1|  PREDICTED: auxin-induced protein X15             49.7    2e-04   
ref|XP_010649236.1|  PREDICTED: auxin-induced protein 15A-like        49.3    2e-04   
ref|XP_003607159.1|  Auxin-induced protein-like protein               49.3    2e-04   
ref|XP_004506989.1|  PREDICTED: auxin-induced protein 10A5-like       50.8    2e-04   



>emb|CDP03039.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 88/147 (60%), Gaps = 20/147 (14%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSA-------------  380
            KV GIR+IVRL  F++KW+ +         + T          +  A             
Sbjct  8    KVTGIRQIVRLKEFLQKWQNVTLGTKDGDASNTQCNNDQSRGGISPAISRRLMSCNVYCD  67

Query  381  ----DCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
                 C   + P DVPKGY+ VYVG    LRRFIIPT YLSDPLFKVLLEKVEEEFGF+H
Sbjct  68   SDEDGCASPEPPHDVPKGYLAVYVG--PELRRFIIPTRYLSDPLFKVLLEKVEEEFGFDH  125

Query  546  RGGLIIPCEIETFKYLLKCMEIHERDQ  626
             GGL IPCE ETFKYLLKCME H+RDQ
Sbjct  126  SGGLTIPCETETFKYLLKCMETHQRDQ  152



>emb|CBI27760.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 95/144 (66%), Gaps = 16/144 (11%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV----KSADCVRQA--  398
             KV GIR+IVRL  F++KW+ +  +     +    +T   +SPA+    ++++ +  +  
Sbjct  7    NKVTGIRQIVRLKEFLQKWQSVTLSPKGNNSVHPNQTPGGISPAINMRLRNSNVISDSDE  66

Query  399  --------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                    P DVPKGY+ VYVG    LRRFIIPT+YL+ PLFKVLLEKVEEEFGF+H GG
Sbjct  67   DGCHSPEPPPDVPKGYLAVYVGS--ELRRFIIPTSYLTHPLFKVLLEKVEEEFGFDHSGG  124

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCEIETFKYL+KCME H   Q
Sbjct  125  LTIPCEIETFKYLMKCMESHPEAQ  148



>ref|XP_002275644.1| PREDICTED: uncharacterized protein LOC100266455 [Vitis vinifera]
Length=165

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 95/144 (66%), Gaps = 16/144 (11%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV----KSADCVRQA--  398
             KV GIR+IVRL  F++KW+ +  +     +    +T   +SPA+    ++++ +  +  
Sbjct  9    NKVTGIRQIVRLKEFLQKWQSVTLSPKGNNSVHPNQTPGGISPAINMRLRNSNVISDSDE  68

Query  399  --------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                    P DVPKGY+ VYVG    LRRFIIPT+YL+ PLFKVLLEKVEEEFGF+H GG
Sbjct  69   DGCHSPEPPPDVPKGYLAVYVGS--ELRRFIIPTSYLTHPLFKVLLEKVEEEFGFDHSGG  126

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCEIETFKYL+KCME H   Q
Sbjct  127  LTIPCEIETFKYLMKCMESHPEAQ  150



>ref|XP_006353770.1| PREDICTED: uncharacterized protein LOC102587510 [Solanum tuberosum]
Length=172

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 95/151 (63%), Gaps = 22/151 (15%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv-----sPAV-------  371
            G   KV GIR+IVRL   + KW+ +  +      ++ +++         SPA+       
Sbjct  5    GGGSKVTGIRQIVRLKELLHKWQNVTLSPKGTLQSSNIDSNNGNFHGGISPAITKRLKNS  64

Query  372  -----KSADCVRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekvee  527
                  S D   Q+P     VPKGY+GVYVG    LRRFIIPTTYLSDPLFKVLLEKVEE
Sbjct  65   INVCCDSDDESCQSPEPPHGVPKGYLGVYVG--PELRRFIIPTTYLSDPLFKVLLEKVEE  122

Query  528  efgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            EFGF+H GGL IPCEIETFKYLL+CME H+R
Sbjct  123  EFGFDHTGGLTIPCEIETFKYLLQCMESHQR  153



>ref|XP_009764068.1| PREDICTED: uncharacterized protein LOC104215845 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764069.1| PREDICTED: uncharacterized protein LOC104215845 isoform X1 [Nicotiana 
sylvestris]
Length=179

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 92/160 (58%), Gaps = 29/160 (18%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvs-------------PA  368
            G   KV GIR+IVRL   + KW+ +  +                S             PA
Sbjct  5    GAGNKVTGIRQIVRLKELLHKWQNVTLSPKANNNQNHCTHGHFQSSNNSNGNIYGGISPA  64

Query  369  V----KSAD-CVR---------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkv  506
            +    KS++ C           + P  VPKGY+ VYVG    LRRFIIPT+YLSDPLFKV
Sbjct  65   IMKRLKSSNVCCDSDDESCQSPEPPHGVPKGYLAVYVG--PELRRFIIPTSYLSDPLFKV  122

Query  507  llekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHERDQ  626
            LLEKVEEEFGF+H GGL IPCEIETFKYLL+CME H+RD 
Sbjct  123  LLEKVEEEFGFDHTGGLTIPCEIETFKYLLQCMENHQRDH  162



>ref|XP_004243683.1| PREDICTED: uncharacterized protein LOC101268587 [Solanum lycopersicum]
 ref|XP_010323980.1| PREDICTED: uncharacterized protein LOC101268587 [Solanum lycopersicum]
Length=181

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 95/161 (59%), Gaps = 32/161 (20%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarn---------------nsvrrttttvettasvs  362
            G   KV GIR+IVRL   + KW+ +  +                S    +++      +S
Sbjct  6    GGGSKVTGIRQIVRLKELLHKWQNVTLSPKGTNSCHEHDQHPLQSSNIDSSSGNFHGGIS  65

Query  363  PAV------------KSADCVRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPl  497
            PA+             S D   Q+P     VPKGY+GVYVG    LRRFIIPTTYLSDPL
Sbjct  66   PAITKRLKNSINVYCDSDDESCQSPEPPHGVPKGYLGVYVG--PELRRFIIPTTYLSDPL  123

Query  498  fkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            FKVLLEKVEEEFGF+H GGL IPCEIETFKYLL+CME H+R
Sbjct  124  FKVLLEKVEEEFGFDHTGGLTIPCEIETFKYLLQCMESHQR  164



>ref|XP_010049360.1| PREDICTED: uncharacterized protein LOC104438001 [Eucalyptus grandis]
 gb|KCW81908.1| hypothetical protein EUGRSUZ_C03286 [Eucalyptus grandis]
 gb|KCW81909.1| hypothetical protein EUGRSUZ_C03286 [Eucalyptus grandis]
Length=162

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 87/139 (63%), Gaps = 14/139 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv------sPAVKSADCVRQA-  398
            K+ GIR+IVRL   ++KW+ +  N+                        ++  D   ++ 
Sbjct  8    KLTGIRQIVRLKELLQKWQSVTLNSKADNPEPEEGQGNVSPLVNKRIANLQCCDSDEESC  67

Query  399  -----PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
                 PADVPKGY+ VYVG+   LRRFIIPT+YLS  LFKVLLEKVEEEFGF+H GGL I
Sbjct  68   PSPEPPADVPKGYLAVYVGQ--ELRRFIIPTSYLSHSLFKVLLEKVEEEFGFDHSGGLTI  125

Query  564  PCEIETFKYLLKCMEIHER  620
            PCEIETFK+LLKCME H+ 
Sbjct  126  PCEIETFKFLLKCMENHQN  144



>ref|XP_010049331.1| PREDICTED: uncharacterized protein LOC104437967 [Eucalyptus grandis]
 gb|KCW81857.1| hypothetical protein EUGRSUZ_C03209 [Eucalyptus grandis]
Length=162

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 87/139 (63%), Gaps = 14/139 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv------sPAVKSADCVRQA-  398
            K+ GIR+IVRL   ++KW+ +  N+                        ++  D   ++ 
Sbjct  8    KLTGIRQIVRLKELLQKWQSVTLNSKADNPEPEEGQGNISPLVNKRIANLQCCDSDEESC  67

Query  399  -----PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
                 PADVPKGY+ VYVG+   LRRFIIPT+YLS  LFKVLLEKVEEEFGF+H GGL I
Sbjct  68   PSPEPPADVPKGYLAVYVGQ--ELRRFIIPTSYLSHSLFKVLLEKVEEEFGFDHSGGLTI  125

Query  564  PCEIETFKYLLKCMEIHER  620
            PCEIETFK+LLKCME H+ 
Sbjct  126  PCEIETFKFLLKCMENHQN  144



>ref|XP_011078141.1| PREDICTED: uncharacterized protein LOC105161958 [Sesamum indicum]
 ref|XP_011078142.1| PREDICTED: uncharacterized protein LOC105161958 [Sesamum indicum]
Length=159

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 92/143 (64%), Gaps = 16/143 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK------------SAD  383
            K+ GI++I++L  F+++W+          +  + E    +SP +               D
Sbjct  12   KITGIKQIIKLKEFIQRWQHATLGPRSSNSPRSDEVCGGISPEISWRLRNSSVRCDSDED  71

Query  384  CVR--QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
              +  + P+DVP+GY+ VYVG    LRRFIIPT+YLSDPLFKVLLEKVEEEFGF+H GGL
Sbjct  72   SCQSLEMPSDVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKVLLEKVEEEFGFDHSGGL  129

Query  558  IIPCEIETFKYLLKCMEIHERDQ  626
             IPC+IETFKYLL+CME H + Q
Sbjct  130  TIPCDIETFKYLLQCMENHRKGQ  152



>ref|XP_006381568.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ERP59365.1| auxin-responsive family protein [Populus trichocarpa]
Length=160

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 87/142 (61%), Gaps = 16/142 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK----SADCVR-----  392
            K+ GIR+IVRL   + KW+ +   +      +   +     PAV     S  C       
Sbjct  8    KLTGIRQIVRLKEILHKWQSVTIGSKETSPPSGHPSNGIP-PAVNKRLNSVKCCDSDEDS  66

Query  393  ----QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLI  560
                + PADVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEKVEEEFGF+H G L 
Sbjct  67   CHSPEPPADVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFKVLLEKVEEEFGFDHTGALT  124

Query  561  IPCEIETFKYLLKCMEIHERDQ  626
            IPCEIETFK+LLKCME H +D 
Sbjct  125  IPCEIETFKFLLKCMESHPKDH  146



>ref|XP_009610752.1| PREDICTED: uncharacterized protein LOC104104386 [Nicotiana tomentosiformis]
 ref|XP_009610753.1| PREDICTED: uncharacterized protein LOC104104386 [Nicotiana tomentosiformis]
Length=181

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 93/162 (57%), Gaps = 31/162 (19%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettas---------------vs  362
            G   KV GIR+IVRL   + KW+ +  +                              +S
Sbjct  5    GVGSKVTGIRQIVRLKELLHKWQNVTLSPKANNNQNHCTNGHHFRSSNNNSNGNIYGGIS  64

Query  363  PAV----KSAD-CVR---------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlf  500
            PA+    KS++ C           + P  VPKGY+ VYVG    LRRFIIPT+YLSDPLF
Sbjct  65   PAIMKRLKSSNVCCDSDDESCQSPEPPHGVPKGYLAVYVG--PELRRFIIPTSYLSDPLF  122

Query  501  kvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHERDQ  626
            KVLLEKVEEEFGF+H GGL IPCEIETFKYLL+CME H+R+ 
Sbjct  123  KVLLEKVEEEFGFDHTGGLTIPCEIETFKYLLQCMENHQREH  164



>ref|XP_011039922.1| PREDICTED: uncharacterized protein LOC105136325 isoform X2 [Populus 
euphratica]
Length=160

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 86/141 (61%), Gaps = 14/141 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett------asvsPAVKSADCVRQA-  398
            K+ GIR+IVRL   + KW+ +   +      +   +            +VK  D    + 
Sbjct  8    KLTGIRQIVRLKEILHKWQSVTIGSKETSPPSGHPSNGIPPVVNKRLNSVKCCDSDEDSC  67

Query  399  -----PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
                 PADVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEKVEEEFGF+H G L I
Sbjct  68   HSPEPPADVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFKVLLEKVEEEFGFDHTGALTI  125

Query  564  PCEIETFKYLLKCMEIHERDQ  626
            PCEIETFK+LLKCME H +D 
Sbjct  126  PCEIETFKFLLKCMESHPKDH  146



>ref|XP_004488140.1| PREDICTED: uncharacterized protein LOC101508911 [Cicer arietinum]
Length=162

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 86/148 (58%), Gaps = 15/148 (10%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK-------SADC  386
            G   KV GIR+IVRL   ++KW+ +             ET  S SP +        S D 
Sbjct  4    GGGSKVTGIRQIVRLKEILQKWQSVTIGTKTPNLKPEDETDDSRSPIINKRIARIVSCDS  63

Query  387  VRQA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHR  548
              ++      P DVPKGY+ VYVG    LRRFIIPTTYLS  LFK+LLEK  EEFGF+  
Sbjct  64   DEESCQTPEPPPDVPKGYLAVYVGP--ELRRFIIPTTYLSHSLFKMLLEKAAEEFGFDQS  121

Query  549  GGLIIPCEIETFKYLLKCMEIHERDQRR  632
            GGL IPCEIETFKYLL C+E  E  ++ 
Sbjct  122  GGLTIPCEIETFKYLLNCIENQEEKEQH  149



>gb|KEH37650.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=163

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 87/146 (60%), Gaps = 14/146 (10%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv------sPAVKSADCV  389
            G   KV GIR+IVRL   ++KW+ +  ++        +   +           V S D  
Sbjct  4    GGGSKVTGIRQIVRLKEILQKWQNVTISSKTSNRKLEITDGSRSPMINKRITNVISCDSD  63

Query  390  RQA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
             ++      P DVPKG++ VYVG    LRRFIIPT+YLS  LFK+LLEK  EEFGF+  G
Sbjct  64   EESCQSPEPPPDVPKGFLAVYVGP--ELRRFIIPTSYLSHSLFKMLLEKAAEEFGFDQSG  121

Query  552  GLIIPCEIETFKYLLKCMEIHERDQR  629
            GL IPCEIETFKYLLKC+E  E++Q 
Sbjct  122  GLTIPCEIETFKYLLKCIETQEKEQH  147



>ref|XP_009764070.1| PREDICTED: auxin-induced protein 15A-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009764071.1| PREDICTED: auxin-induced protein 15A-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009764072.1| PREDICTED: auxin-induced protein 15A-like isoform X2 [Nicotiana 
sylvestris]
Length=114

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P  VPKGY+ VYVG    LRRFIIPT+YLSDPLFKVLLEKVEEEFGF+H GGL IPCE
Sbjct  22   EPPHGVPKGYLAVYVGP--ELRRFIIPTSYLSDPLFKVLLEKVEEEFGFDHTGGLTIPCE  79

Query  573  IETFKYLLKCMEIHERDQ  626
            IETFKYLL+CME H+RD 
Sbjct  80   IETFKYLLQCMENHQRDH  97



>ref|XP_011039920.1| PREDICTED: uncharacterized protein LOC105136325 isoform X1 [Populus 
euphratica]
 ref|XP_011039921.1| PREDICTED: uncharacterized protein LOC105136325 isoform X1 [Populus 
euphratica]
Length=164

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 86/141 (61%), Gaps = 14/141 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett------asvsPAVKSADCVRQA-  398
            K+ GIR+IVRL   + KW+ +   +      +   +            +VK  D    + 
Sbjct  8    KLTGIRQIVRLKEILHKWQSVTIGSKETSPPSGHPSNGIPPVVNKRLNSVKCCDSDEDSC  67

Query  399  -----PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
                 PADVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEKVEEEFGF+H G L I
Sbjct  68   HSPEPPADVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFKVLLEKVEEEFGFDHTGALTI  125

Query  564  PCEIETFKYLLKCMEIHERDQ  626
            PCEIETFK+LLKCME H +D 
Sbjct  126  PCEIETFKFLLKCMESHPKDH  146



>ref|XP_010261728.1| PREDICTED: uncharacterized protein LOC104600476 [Nelumbo nucifera]
 ref|XP_010261729.1| PREDICTED: uncharacterized protein LOC104600476 [Nelumbo nucifera]
Length=166

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 15/145 (10%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett-asvsPAVKS----------  377
            E  KV GIR+IVRL   ++KW+ I  ++     + +   +   +SP V +          
Sbjct  5    EAGKVTGIRQIVRLKEIIQKWQSITLSHRGNSGSPSDNKSRGGISPDVTNYTICDSDEES  64

Query  378  --ADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
              + C    P  VPKGY+ VYVG    LRRFIIPTTYL+ P+FKVLLEKVEEEFGFEH+G
Sbjct  65   CHSPCPESPPLGVPKGYLAVYVGP--ELRRFIIPTTYLTLPVFKVLLEKVEEEFGFEHKG  122

Query  552  GLIIPCEIETFKYLLKCMEIHERDQ  626
            GL IPCEIETFKYLL CM+ + ++ 
Sbjct  123  GLTIPCEIETFKYLLNCMDNYHKEH  147



>ref|XP_007012552.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
 gb|EOY30171.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
Length=159

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 82/139 (59%), Gaps = 14/139 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVR---------  392
            K+ GIR+IVRL   ++KW+ +   +                P  K    V          
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTLGSRPNAPQLEENQGGVSGPVNKRLTNVMCCDSDEESC  67

Query  393  ---QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
               + P DVPKGY+ VYVG    LRRFIIPT+YLS P+FK+LLEK EEEFG+ H GGL +
Sbjct  68   HSPEPPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHPVFKILLEKAEEEFGYNHNGGLTL  125

Query  564  PCEIETFKYLLKCMEIHER  620
            PCEIETFKYLLKC+E + +
Sbjct  126  PCEIETFKYLLKCIENNHK  144



>ref|XP_010273992.1| PREDICTED: uncharacterized protein LOC104609396, partial [Nelumbo 
nucifera]
Length=153

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 96/150 (64%), Gaps = 20/150 (13%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKW-KRIarnnsvrrttttvettasvsPAV-----------  371
            G   KV GIR+IVRL G ++KW    +++     ++T+ +    +SP +           
Sbjct  6    GAAAKVTGIRQIVRLKGILQKWHSNTSKSRRSSSSSTSSKGHGDISPVITNRLRNTYTST  65

Query  372  ------KSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeef  533
                  ++ +   + P DVP+G++ VYVG    LRRFIIPT+YLS P+FKVLLEKVEEEF
Sbjct  66   ACDSDEETINSHDEFPVDVPRGFLAVYVG--PELRRFIIPTSYLSLPVFKVLLEKVEEEF  123

Query  534  gfeHRGGLIIPCEIETFKYLLKCMEIHERD  623
            GF+++GGL IPCEIETFKYLL CME H +D
Sbjct  124  GFDNKGGLTIPCEIETFKYLLTCMETHNKD  153



>gb|KDP33955.1| hypothetical protein JCGZ_07526 [Jatropha curcas]
Length=158

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 86/142 (61%), Gaps = 14/142 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsP------AVKSADCVRQA-  398
            K  GIR+I +L   ++KW+ +   +       +       +       +VKS D   +  
Sbjct  8    KATGIRQIAKLKEIIQKWQSVTIGSKPTGPEGSNTHGGISAEINRRLTSVKSCDSDEEGC  67

Query  399  -----PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
                 P DVP+GY+ VYVG  +  RRFIIPT+YLS  LFKVLL KVEEEFGF+H GGL I
Sbjct  68   QSPGPPPDVPRGYLAVYVGPEQ--RRFIIPTSYLSHSLFKVLLAKVEEEFGFDHSGGLTI  125

Query  564  PCEIETFKYLLKCMEIHERDQR  629
            PCEIETFK+LLKCME H +D +
Sbjct  126  PCEIETFKFLLKCMEHHPKDHQ  147



>ref|XP_011010972.1| PREDICTED: uncharacterized protein LOC105115704 isoform X2 [Populus 
euphratica]
 ref|XP_011010973.1| PREDICTED: uncharacterized protein LOC105115704 isoform X2 [Populus 
euphratica]
Length=163

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett---------asvsPAVKSADCVR  392
            K+ GIR+IVRL   ++KW+ +   +      +                   +VK  D   
Sbjct  8    KLTGIRQIVRLKEILQKWQSVTVGSKETSLPSPPSDQPPCGIPLAINKRLNSVKCCDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            ++      PADVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLL KVEEEFGF+H G 
Sbjct  68   ESCHSPEPPADVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLVKVEEEFGFDHTGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCEIETFK+LL+CME H +D  
Sbjct  126  LTIPCEIETFKFLLQCMENHPKDHE  150



>ref|XP_011093884.1| PREDICTED: uncharacterized protein LOC105173720 [Sesamum indicum]
 ref|XP_011093885.1| PREDICTED: uncharacterized protein LOC105173720 [Sesamum indicum]
Length=151

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 91/143 (64%), Gaps = 19/143 (13%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK------------SAD  383
            +V GIR+IVRL G ++KW+ +       R+       +   PAV               D
Sbjct  8    RVIGIRQIVRLKGLLQKWQHVTLGPKAPRSGRACGGIS---PAVSRRLRSSNVYCDSDED  64

Query  384  CVR--QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
              +  + P DVP+GY+ VYVG    LRRFIIPT+YL+DPLFKVLLEKVEEEFGF+  GGL
Sbjct  65   SCQSPEPPHDVPRGYLAVYVG--PELRRFIIPTSYLTDPLFKVLLEKVEEEFGFDQSGGL  122

Query  558  IIPCEIETFKYLLKCMEIHERDQ  626
             IPCE ETFKYL++C+E H+++Q
Sbjct  123  TIPCETETFKYLIQCIENHQKEQ  145



>ref|XP_011010970.1| PREDICTED: uncharacterized protein LOC105115704 isoform X1 [Populus 
euphratica]
 ref|XP_011010971.1| PREDICTED: uncharacterized protein LOC105115704 isoform X1 [Populus 
euphratica]
Length=167

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett---------asvsPAVKSADCVR  392
            K+ GIR+IVRL   ++KW+ +   +      +                   +VK  D   
Sbjct  8    KLTGIRQIVRLKEILQKWQSVTVGSKETSLPSPPSDQPPCGIPLAINKRLNSVKCCDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            ++      PADVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLL KVEEEFGF+H G 
Sbjct  68   ESCHSPEPPADVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLVKVEEEFGFDHTGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCEIETFK+LL+CME H +D  
Sbjct  126  LTIPCEIETFKFLLQCMENHPKDHE  150



>ref|XP_006452873.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
 gb|ESR66113.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
 gb|KDO73802.1| hypothetical protein CISIN_1g044419mg [Citrus sinensis]
Length=160

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 89/141 (63%), Gaps = 14/141 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK-----------SADC  386
            K+ GIR+IV+L   ++KW+ +  ++    ++ +      +SP +               C
Sbjct  8    KLNGIRQIVKLKEILQKWQSVTLSSPKPSSSQSSPNHGGISPVINKRLANVPCDSDEESC  67

Query  387  VR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
               + P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H G L I
Sbjct  68   YSPEPPHDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHCGALTI  125

Query  564  PCEIETFKYLLKCMEIHERDQ  626
            PCEIETFKYLLKC+E H++D 
Sbjct  126  PCEIETFKYLLKCIESHQKDH  146



>gb|AAN65371.1| auxin-regulated protein [Phaseolus vulgaris]
Length=156

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 82/143 (57%), Gaps = 15/143 (10%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK-----------  374
            G   K+ GIR+IVRL    +KW+ +   +      + V     + P +            
Sbjct  4    GGGSKLSGIRQIVRLKEMFQKWQTVTLGSKESNHDSDVARPGGIPPMINKRLTNVLYCDS  63

Query  375  -SADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHR  548
                C   Q P DVPKGY+ VYV  G  LRRFIIPT+YLS  LFKVLLEK  EEFGF+  
Sbjct  64   DEDSCYSPQPPHDVPKGYLAVYV--GPELRRFIIPTSYLSHSLFKVLLEKAAEEFGFDQS  121

Query  549  GGLIIPCEIETFKYLLKCMEIHE  617
            GGL IPCEIETFKYLL CME H+
Sbjct  122  GGLTIPCEIETFKYLLNCMENHD  144



>ref|XP_006474596.1| PREDICTED: uncharacterized protein LOC102619589 [Citrus sinensis]
Length=160

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 89/141 (63%), Gaps = 14/141 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV-----------KSADC  386
            K+ GIR+IV+L   ++KW+ +  ++    ++ +      +SP +               C
Sbjct  8    KLNGIRQIVKLKEILQKWQSVTLSSPKPSSSQSSPNHGGISPVISKRLANVPCDSDEESC  67

Query  387  VR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
               + P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H G L I
Sbjct  68   YSPEPPHDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHCGALTI  125

Query  564  PCEIETFKYLLKCMEIHERDQ  626
            PCEIETFKYLLKC+E H++D 
Sbjct  126  PCEIETFKYLLKCIESHQKDH  146



>ref|XP_006349979.1| PREDICTED: uncharacterized protein LOC102582085 [Solanum tuberosum]
Length=213

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P  VP+GY+ VYVG    LRRFIIPT+YLSDPLFK+LLEKVEEEFGF+H GGL IPCE
Sbjct  121  EPPHGVPRGYLAVYVGS--ELRRFIIPTSYLSDPLFKLLLEKVEEEFGFDHTGGLTIPCE  178

Query  573  IETFKYLLKCMEIHERDQ  626
            IETFK+L++CME H+RDQ
Sbjct  179  IETFKFLMQCMENHQRDQ  196



>ref|XP_006400646.1| hypothetical protein EUTSA_v10014872mg [Eutrema salsugineum]
 gb|ESQ42099.1| hypothetical protein EUTSA_v10014872mg [Eutrema salsugineum]
Length=165

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +               +    +SPA       VK+ D   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSEVPPLAAGKQAAEMISPAINKRLLAVKNCDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       PADVPKGY+ VYVG    LRRFIIPTTYL   LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPADVPKGYLAVYVGPD--LRRFIIPTTYLGHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCE+ETFKYLLKCME + +D  
Sbjct  126  LTIPCEVETFKYLLKCMENNTKDHH  150



>ref|XP_009766516.1| PREDICTED: uncharacterized protein LOC104217885 [Nicotiana sylvestris]
 ref|XP_009766517.1| PREDICTED: uncharacterized protein LOC104217885 [Nicotiana sylvestris]
Length=171

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv---------sPAV---  371
            G   KV GIR+IVRL   + KW+ +  +   +         +S          SP++   
Sbjct  5    GGGTKVTGIRQIVRLKQLLHKWQNVTLSPKGKNHQKLDRVKSSNRKDDSYGGISPSISKR  64

Query  372  -----------KSADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvlle  515
                          +C   + P  VP+GY+ VYVG    LRRFIIPT+YLSDPLFKVLLE
Sbjct  65   LRSSSIYWGDSDEDNCQSPEPPHGVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKVLLE  122

Query  516  kveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            KVEEEFGF+H GGL IPCEIETFK+LL+CME H+R
Sbjct  123  KVEEEFGFDHSGGLTIPCEIETFKFLLQCMENHQR  157



>gb|KHN47616.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=167

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 91/148 (61%), Gaps = 21/148 (14%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnn--svrrttttvettasvsPAVKSA-----DCVR--  392
            K+ GIR+IV+L   ++KW+ +      S   +        S+SP +  +     +C    
Sbjct  8    KLNGIRQIVKLKEMLQKWQSVTLGTKPSNSLSDHVTNDDGSISPLINKSVLNVMNCESDN  67

Query  393  ----QAPA------DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
                Q+PA      DVPKGY+ VYVG    LRRFIIPT+YLS PLFKVLLEK  +EFGF+
Sbjct  68   EDSCQSPAEPLPPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHPLFKVLLEKAADEFGFD  125

Query  543  HRGGLIIPCEIETFKYLLKCMEIHERDQ  626
              GGL IPCEIETFKYLLKCME  +++Q
Sbjct  126  QSGGLTIPCEIETFKYLLKCMENEQKEQ  153



>ref|XP_006288810.1| hypothetical protein CARUB_v10002144mg [Capsella rubella]
 gb|EOA21708.1| hypothetical protein CARUB_v10002144mg [Capsella rubella]
Length=162

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 85/140 (61%), Gaps = 12/140 (9%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsP----AVKSADCVRQA---  398
            K+ GIR+IVRL   ++KW+ +             E  A         VK+AD   +    
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSDVPPLAAELIAPAINKRLLGVKNADSDEENCQS  67

Query  399  ---PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
               P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+  G L IPC
Sbjct  68   PEPPHDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGALTIPC  125

Query  570  EIETFKYLLKCMEIHERDQR  629
            E+ETFKYLLKCME + +D +
Sbjct  126  EVETFKYLLKCMENNPKDHQ  145



>ref|XP_006452874.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
 gb|ESR66114.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
Length=167

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 89/141 (63%), Gaps = 14/141 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK-----------SADC  386
            K+ GIR+IV+L   ++KW+ +  ++    ++ +      +SP +               C
Sbjct  8    KLNGIRQIVKLKEILQKWQSVTLSSPKPSSSQSSPNHGGISPVINKRLANVPCDSDEESC  67

Query  387  VR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
               + P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H G L I
Sbjct  68   YSPEPPHDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHCGALTI  125

Query  564  PCEIETFKYLLKCMEIHERDQ  626
            PCEIETFKYLLKC+E H++D 
Sbjct  126  PCEIETFKYLLKCIESHQKDH  146



>ref|XP_002516215.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus 
communis]
 gb|EEF46217.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus 
communis]
Length=161

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 88/145 (61%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttv-ettasvsPAVKS-----ADCVRQ--  395
            KV GIR+IVRL   ++KW+ +   +               +SP +        +C     
Sbjct  8    KVTGIRQIVRLKEILQKWQSVTIGSKAPEPEGGTRSPPGGISPMINKRLKGIQNCCDSDE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEKVEEEFGF+H GG
Sbjct  68   ENCQSPGSPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFKVLLEKVEEEFGFDHSGG  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCEIETFK+LLKCME H +D +
Sbjct  126  LTIPCEIETFKFLLKCMEHHPKDHQ  150



>ref|XP_010520521.1| PREDICTED: uncharacterized protein LOC104799608 [Tarenaya hassleriana]
Length=163

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 89/142 (63%), Gaps = 16/142 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnns-vrrttttvettasvsPA-------VKSADCVRQ  395
            K+ GIR+IVRL   ++KW+ +   +      T   +    +SPA       VK+ D   +
Sbjct  8    KLTGIRQIVRLKEILQKWQSVTIGSDPDGSLTAAQKHGGFISPAISKRLMDVKNCDSDEE  67

Query  396  ------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
                  AP DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H G L
Sbjct  68   TCHSPGAPPDVPEGYLAVYVGP--ELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHSGAL  125

Query  558  IIPCEIETFKYLLKCMEIHERD  623
             IPCE+ETFK+LLKCME   +D
Sbjct  126  TIPCEVETFKFLLKCMENQSKD  147



>gb|KHG20809.1| Auxin-induced 15A [Gossypium arboreum]
Length=161

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett--------asvsPAVKSADCVRQ  395
            K  GIR+IVRL   ++KW+ I         T   E                + S D    
Sbjct  8    KSTGIRQIVRLKEILQKWQTITLCTMPSTDTPHSEENHGVFCPPINQRLKNIMSFDSDED  67

Query  396  A------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
            +      P DVPKGY+ VYVG    LRRFIIPT+YLS P+F +LLEK EEEFG++H GGL
Sbjct  68   SCHGSEPPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHPVFTILLEKAEEEFGYDHNGGL  125

Query  558  IIPCEIETFKYLLKCMEIHERDQ  626
             +PCEIETFKYLLKC+E H  + 
Sbjct  126  TLPCEIETFKYLLKCIENHPNNH  148



>ref|XP_010103079.1| hypothetical protein L484_003321 [Morus notabilis]
 gb|EXB94757.1| hypothetical protein L484_003321 [Morus notabilis]
Length=175

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 83/139 (60%), Gaps = 16/139 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV------------KSAD  383
            K+ GIR+IVRL   ++KW+ +  + +        E      P                 D
Sbjct  8    KLTGIRQIVRLKEILQKWQSVTLSPTKPENEPDAEGDPGGIPPAINKRLTEVICCDSDED  67

Query  384  CVR--QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
              +  + P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL
Sbjct  68   SCQSPEPPPDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHGGGL  125

Query  558  IIPCEIETFKYLLKCMEIH  614
             IPCEIETFKYLLKCME H
Sbjct  126  TIPCEIETFKYLLKCMENH  144



>ref|XP_009792064.1| PREDICTED: uncharacterized protein LOC104239193 isoform X2 [Nicotiana 
sylvestris]
Length=206

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 89/154 (58%), Gaps = 26/154 (17%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv----------sPAV-----  371
             KV GI++IVRL  F+ KW+                  +S           SP++     
Sbjct  38   NKVTGIKQIVRLKEFLSKWQNATLGPKGNNNDNNNNLGSSSKRSSNSPGGISPSISMRLR  97

Query  372  --------KSADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekve  524
                        C   + P  VP+GY+ VYVG    LRRFIIPT+YLSDPLFK+LLEKVE
Sbjct  98   NYNIYCDSDEESCQSPEPPHGVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKLLLEKVE  155

Query  525  eefgfeHRGGLIIPCEIETFKYLLKCMEIHERDQ  626
            EEFGF+H GGL IPCEIETFK+L++CME H+RDQ
Sbjct  156  EEFGFDHTGGLTIPCEIETFKFLMQCMENHQRDQ  189



>ref|XP_009120769.1| PREDICTED: uncharacterized protein LOC103845643 [Brassica rapa]
 ref|XP_009120770.1| PREDICTED: uncharacterized protein LOC103845643 [Brassica rapa]
Length=166

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 90/143 (63%), Gaps = 17/143 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKR--IarnnsvrrttttvettasvsP-------AVKSADCVR  392
            K+ GIR+IVRL   ++KW+   I   + +       +  A +SP       AVK+ D   
Sbjct  8    KLSGIRQIVRLKEILQKWQTATIGPESDIAPLEAGKQAAAMISPVINKRLFAVKNCDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       PADVPKGY+ VYVG    LRRFIIPTTYLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPADVPKGYLAVYVGPE--LRRFIIPTTYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERD  623
            L IPCE+ETFK+L+KCME + +D
Sbjct  126  LTIPCEVETFKFLIKCMENNPKD  148



>ref|XP_006586657.1| PREDICTED: uncharacterized protein LOC100527570 isoform X1 [Glycine 
max]
Length=186

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 91/148 (61%), Gaps = 21/148 (14%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnn--svrrttttvettasvsPAVKSA-----DCVR--  392
            K+ GIR+IV+L   ++KW+ +      S   +        S+SP +  +     +C    
Sbjct  8    KLNGIRQIVKLKEMLQKWQSVTLGTKPSNSLSDHVTNDDGSISPLINKSVLNVMNCESDN  67

Query  393  ----QAPA------DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
                Q+PA      DVPKGY+ VYVG    LRRFIIPT+YLS PLFKVLLEK  +EFGF+
Sbjct  68   EDSCQSPAEPLPPPDVPKGYLAVYVG--PELRRFIIPTSYLSHPLFKVLLEKAADEFGFD  125

Query  543  HRGGLIIPCEIETFKYLLKCMEIHERDQ  626
              GGL IPCEIETFKYLLKCME  +++Q
Sbjct  126  QSGGLTIPCEIETFKYLLKCMENEQKEQ  153



>emb|CDX92434.1| BnaA10g14730D [Brassica napus]
Length=166

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 90/143 (63%), Gaps = 17/143 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKR--IarnnsvrrttttvettasvsP-------AVKSADCVR  392
            K+ GIR+IVRL   ++KW+   I   + +       +  A +SP       AVK+ D   
Sbjct  8    KLSGIRQIVRLKEILQKWQTATIGPKSDIAPLEAGKQAAAMISPVINKRLFAVKNCDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       PADVPKGY+ VYVG    LRRFIIPTTYLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPADVPKGYLAVYVGPE--LRRFIIPTTYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERD  623
            L IPCE+ETFK+L+KCME + +D
Sbjct  126  LTIPCEVETFKFLIKCMENNPKD  148



>ref|XP_009591557.1| PREDICTED: uncharacterized protein DDB_G0286379-like [Nicotiana 
tomentosiformis]
Length=234

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P  VP+GY+ VYVG    LRRFIIPT+YLSDPLFK+LLEKVEEEFGF+H GGL IPCE
Sbjct  117  EPPHGVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKLLLEKVEEEFGFDHTGGLTIPCE  174

Query  573  IETFKYLLKCMEIHERDQ  626
            IETFK+L++CME H+RDQ
Sbjct  175  IETFKFLMQCMENHQRDQ  192



>ref|XP_009792063.1| PREDICTED: uncharacterized protein LOC104239193 isoform X1 [Nicotiana 
sylvestris]
Length=217

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 89/154 (58%), Gaps = 26/154 (17%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv----------sPAV-----  371
             KV GI++IVRL  F+ KW+                  +S           SP++     
Sbjct  38   NKVTGIKQIVRLKEFLSKWQNATLGPKGNNNDNNNNLGSSSKRSSNSPGGISPSISMRLR  97

Query  372  --------KSADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekve  524
                        C   + P  VP+GY+ VYVG    LRRFIIPT+YLSDPLFK+LLEKVE
Sbjct  98   NYNIYCDSDEESCQSPEPPHGVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKLLLEKVE  155

Query  525  eefgfeHRGGLIIPCEIETFKYLLKCMEIHERDQ  626
            EEFGF+H GGL IPCEIETFK+L++CME H+RDQ
Sbjct  156  EEFGFDHTGGLTIPCEIETFKFLMQCMENHQRDQ  189



>ref|XP_010493190.1| PREDICTED: uncharacterized protein LOC104770457 [Camelina sativa]
 ref|XP_010493191.1| PREDICTED: uncharacterized protein LOC104770457 [Camelina sativa]
 ref|XP_010493192.1| PREDICTED: uncharacterized protein LOC104770457 [Camelina sativa]
Length=167

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +               +    ++PA       VK+AD   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSDVPPLEAGKQAAEMIAPALNKRLLEVKNADSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPRDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCE+ETFKYLLKCME +  D  
Sbjct  126  LTIPCEVETFKYLLKCMENNPNDHH  150



>ref|XP_010314062.1| PREDICTED: uncharacterized protein LOC101254455 [Solanum lycopersicum]
Length=186

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 86/159 (54%), Gaps = 32/159 (20%)
 Frame = +3

Query  234  KRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKS------------  377
            + K+ GIR+IVRL   + KW+ +    +  +             +  +            
Sbjct  6    ETKLTGIRQIVRLKQLLHKWQNVTFTPNTTKGKNHNPKVECTKSSFNNRKNETCRGGISP  65

Query  378  -----------------ADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfk  503
                              +C   ++P  VPKGY+ VYVG    LRRFIIPTTYLSD LFK
Sbjct  66   SISKRLRSSNVYWDSDEENCQSPESPRGVPKGYLAVYVG--PELRRFIIPTTYLSDSLFK  123

Query  504  vllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
             LLEKVEEEFGF+H GGL IPCEIETFKYLL+CME H+R
Sbjct  124  KLLEKVEEEFGFDHSGGLTIPCEIETFKYLLQCMENHQR  162



>ref|XP_009126477.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brassica 
rapa]
 ref|XP_009126478.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brassica 
rapa]
 ref|XP_009126480.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brassica 
rapa]
 emb|CDY45067.1| BnaA02g05090D [Brassica napus]
Length=165

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +   +           +  A +SPA       VK+ D   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGSKSDVPPLEDGKQAAALISPAINKRLLAVKNCDSDD  67

Query  393  Q------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       PADVP+GY+ VY+G    LRRFIIPT+YLS  LFKVLL+K EEEFGF+  G 
Sbjct  68   ENSQSPKTPADVPRGYLAVYIGPE--LRRFIIPTSYLSHSLFKVLLQKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCE+ETFKYLLKCME + +D  
Sbjct  126  LTIPCEVETFKYLLKCMENNLKDHH  150



>gb|EYU28302.1| hypothetical protein MIMGU_mgv1a017169mg [Erythranthe guttata]
Length=90

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +3

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
            P DVP+GY+ VYVG    LRRFIIPT+YLSDPLFKVLLEKVEEEFGF+H G L IPC+ E
Sbjct  2    PNDVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKVLLEKVEEEFGFDHSGALTIPCDAE  59

Query  579  TFKYLLKCMEIHERDQ  626
            TFKYL++CME H ++Q
Sbjct  60   TFKYLIQCMENHRKEQ  75



>emb|CDY16564.1| BnaC09g37090D [Brassica napus]
Length=166

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 90/143 (63%), Gaps = 17/143 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKR--IarnnsvrrttttvettasvsP-------AVKSADCVR  392
            K+ GIR+IVRL   ++KW+   I   + +       +  A +SP       +VK+ D   
Sbjct  8    KLSGIRQIVRLKEILQKWQTATIGPKSDIAPLAAGKQAAAMISPVINKRLFSVKNCDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       PADVPKGY+ VYVG    LRRFIIPTTYLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPADVPKGYLAVYVGPE--LRRFIIPTTYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERD  623
            L IPCE+ETFK+L+KCME + +D
Sbjct  126  LTIPCEVETFKFLIKCMENNPKD  148



>ref|XP_002875598.1| hypothetical protein ARALYDRAFT_484787 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51857.1| hypothetical protein ARALYDRAFT_484787 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +         +   ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDGELGAKKHTAIISPVINKRLLDLKTCDSDEE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCHSPESPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFKYLLKC+E H +D 
Sbjct  126  LTIPCEVETFKYLLKCIENHPKDD  149



>ref|XP_010541681.1| PREDICTED: uncharacterized protein LOC104815072 [Tarenaya hassleriana]
 ref|XP_010541682.1| PREDICTED: uncharacterized protein LOC104815072 [Tarenaya hassleriana]
Length=162

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 87/142 (61%), Gaps = 16/142 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr-ttttvettasvsPA-------VKSADCVRQ  395
            K+ GIR+IVRL   ++KW+ +   +      T   +    +SPA       VK  D   +
Sbjct  8    KLSGIRQIVRLKEILQKWQSVTIKSKSDGPQTGARKHGGIISPALSKRLMDVKCCDSDEE  67

Query  396  A------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
                   P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H G L
Sbjct  68   TCQSPEPPLDVPKGYLAVYVGL--ELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHSGAL  125

Query  558  IIPCEIETFKYLLKCMEIHERD  623
             IPCE+ETFKYLL+CME   +D
Sbjct  126  TIPCEVETFKYLLQCMENQHKD  147



>ref|XP_007154547.1| hypothetical protein PHAVU_003G127800g [Phaseolus vulgaris]
 gb|ESW26541.1| hypothetical protein PHAVU_003G127800g [Phaseolus vulgaris]
Length=282

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 82/143 (57%), Gaps = 15/143 (10%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK-----------  374
            G   K+ GIR+IVRL    +KW+ +   +      + V     + P +            
Sbjct  4    GGGSKLSGIRQIVRLKEMFQKWQTVTLGSKESNHDSDVARPGGIPPMINKRLTNVLYCDS  63

Query  375  -SADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHR  548
                C   Q P DVPKGY+ VYV  G  LRRFIIPT+YLS  LFKVLLEK  EEFGF+  
Sbjct  64   DEDSCYSPQPPHDVPKGYLAVYV--GPELRRFIIPTSYLSHSLFKVLLEKAAEEFGFDQS  121

Query  549  GGLIIPCEIETFKYLLKCMEIHE  617
            GGL IPCEIETFKYLL CME H+
Sbjct  122  GGLTIPCEIETFKYLLNCMENHD  144



>ref|XP_009406684.1| PREDICTED: uncharacterized protein LOC103989538 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406685.1| PREDICTED: uncharacterized protein LOC103989538 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406686.1| PREDICTED: uncharacterized protein LOC103989538 [Musa acuminata 
subsp. malaccensis]
Length=163

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 93/147 (63%), Gaps = 21/147 (14%)
 Frame = +3

Query  222  LVGEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV----KSA---  380
            + G+  K+ GIR+IVRL   ++KW      ++  R        A V PAV    KSA   
Sbjct  10   MAGKGGKLTGIRQIVRLREILQKWH-----SAALRPKEGRRKAAGVPPAVDKRLKSALLL  64

Query  381  -----DCVR--QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgf  539
                 +C R  +AP DVPKGY  VYVG  +  RRF+IPTTYL  P+F++LL+K EEEFGF
Sbjct  65   CDSDEECCRSPEAPPDVPKGYCPVYVGPEQ--RRFVIPTTYLGLPVFRLLLQKAEEEFGF  122

Query  540  eHRGGLIIPCEIETFKYLLKCMEIHER  620
            +H+G L IPCEIETFKY+L+CME H +
Sbjct  123  DHKGALTIPCEIETFKYILQCMERHAK  149



>gb|KHN49080.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=164

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 85/145 (59%), Gaps = 18/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnns--vrrttttvettasvsPAVK----------SAD  383
            K+ GIR+IV++   ++KW+ +          +        S+SP +              
Sbjct  8    KLTGIRQIVKIKEMLQKWQSVTLGPKPCNSLSDHVANDDGSISPLINKRVVNVISDNEDS  67

Query  384  CVRQA----PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
            C   A    PADVPKGY+ VYVG    LRRFIIPT+YLS  LF VLLEK  EEFGF+  G
Sbjct  68   CQSPAEPLPPADVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFIVLLEKAAEEFGFDQSG  125

Query  552  GLIIPCEIETFKYLLKCMEIHERDQ  626
            GL IPCEIETFKYLLKCME  +++Q
Sbjct  126  GLTIPCEIETFKYLLKCMENEQKEQ  150



>ref|XP_002871957.1| hypothetical protein ARALYDRAFT_488986 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48216.1| hypothetical protein ARALYDRAFT_488986 [Arabidopsis lyrata subsp. 
lyrata]
Length=165

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 87/143 (61%), Gaps = 17/143 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +               +  A +SPA       VK+ D   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSDVPPLAAGKQAVAMISPAINKRLLDVKNGDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPHDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERD  623
            L IPCE+ETFKYLLKCME + +D
Sbjct  126  LTIPCEVETFKYLLKCMENNLKD  148



>ref|NP_001238039.1| uncharacterized protein LOC100527570 [Glycine max]
 gb|ACU16678.1| unknown [Glycine max]
Length=167

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 90/148 (61%), Gaps = 21/148 (14%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnn--svrrttttvettasvsPAVKSA-----DCVR--  392
            K+ GIR+IV+L   ++KW+ +      S   +        S+SP +  +     +C    
Sbjct  8    KLNGIRQIVKLKEMLQKWQSVTLGTKPSNSLSDHVTNDDGSISPLINKSVLNVMNCESDN  67

Query  393  ----QAPA------DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
                Q+PA      DVPKGY+ VYVG    LRRFIIPT+YLS PLFKVLLEK  +EFGF+
Sbjct  68   EDSCQSPAEPLPPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHPLFKVLLEKAADEFGFD  125

Query  543  HRGGLIIPCEIETFKYLLKCMEIHERDQ  626
              GGL IPCEI TFKYLLKCME  +++Q
Sbjct  126  QSGGLTIPCEIGTFKYLLKCMENEQKEQ  153



>ref|XP_009123263.1| PREDICTED: uncharacterized protein LOC103848025 [Brassica rapa]
 emb|CDY12336.1| BnaA06g20080D [Brassica napus]
Length=159

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 85/143 (59%), Gaps = 16/143 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +    T        ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQSVTIGSKSDDTELGARKHTAIISPVINQRLLDMKTCDSDEE  67

Query  396  A------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
                   P+DVP+GY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G L
Sbjct  68   TSQSPEPPSDVPEGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGAL  125

Query  558  IIPCEIETFKYLLKCMEIHERDQ  626
             IPCE+ETFKYLL C+E H +D 
Sbjct  126  TIPCEVETFKYLLNCIENHPKDD  148



>ref|NP_189898.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 emb|CAB86483.1| putative protein [Arabidopsis thaliana]
 gb|ABE65986.1| auxin-responsive protein-like protein [Arabidopsis thaliana]
 gb|AEE77766.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=160

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 84/144 (58%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +             ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDGELGARKHTAIISPVINKRLLDLKTCDSDEE  67

Query  396  A-------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                    P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCQSPEPPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFKYLLKC+E H +D 
Sbjct  126  LTIPCEVETFKYLLKCIENHPKDD  149



>gb|AAM62891.1| unknown [Arabidopsis thaliana]
Length=160

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 84/144 (58%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI+ IVRL   ++KW+ +   +             ++   V        K+ D   +
Sbjct  8    KLTGIKHIVRLKEILQKWQTVTIGSKSDDGELGARKHTAIISPVINKRLLDLKTCDSDEE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCQSPESPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFKYLLKC+E H +D 
Sbjct  126  LTIPCEVETFKYLLKCIENHPKDD  149



>gb|ABK28585.1| unknown [Arabidopsis thaliana]
Length=161

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 84/144 (58%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +             ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDGELGARKHTAIISPVINKRLLDLKTCDSDEE  67

Query  396  A-------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                    P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCQSPEPPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFKYLLKC+E H +D 
Sbjct  126  LTIPCEVETFKYLLKCIENHPKDD  149



>ref|XP_010425808.1| PREDICTED: uncharacterized protein LOC104710848 [Camelina sativa]
 ref|XP_010425809.1| PREDICTED: uncharacterized protein LOC104710848 [Camelina sativa]
Length=160

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 87/144 (60%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +    +    +   ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDSELGAKKHTAIISPVINKRLLDLKTCDSDEE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCHSPESPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFK+LLKC+E H +D 
Sbjct  126  LTIPCEVETFKFLLKCIENHPKDD  149



>ref|XP_006419133.1| hypothetical protein EUTSA_v10002695mg [Eutrema salsugineum]
 gb|ESQ37569.1| hypothetical protein EUTSA_v10002695mg [Eutrema salsugineum]
Length=159

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 85/143 (59%), Gaps = 16/143 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +    T        ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDTELGARKHTAIISPVINKRLLDLKTCDSDEE  67

Query  396  A------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
                   P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G L
Sbjct  68   TCQSPEPPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGAL  125

Query  558  IIPCEIETFKYLLKCMEIHERDQ  626
             IPCE+ETFK+LLKC+E H +D 
Sbjct  126  TIPCEVETFKFLLKCIENHPKDD  148



>ref|XP_003551054.1| PREDICTED: uncharacterized protein LOC100795275 [Glycine max]
 gb|KHN17751.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 83/140 (59%), Gaps = 16/140 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttve-ttasvsPAVK------------SA  380
            K+ GI++IVRL    +KW+ +   +      + V      +SP +               
Sbjct  8    KLHGIKQIVRLKEIFQKWQTVTLGSKDSNNHSDVTRHHGGISPMINKRLTNIVYCDSDED  67

Query  381  DCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
             C   Q P DVPKGY+ VYVG    LRRFIIPTTYLS PLFKVLLEK  EEFGF+  GGL
Sbjct  68   GCYSPQPPHDVPKGYLAVYVGP--ELRRFIIPTTYLSHPLFKVLLEKAAEEFGFDQSGGL  125

Query  558  IIPCEIETFKYLLKCMEIHE  617
             IPCEIETFKYLL C+E H+
Sbjct  126  TIPCEIETFKYLLNCIENHD  145



>ref|XP_010103473.1| hypothetical protein L484_014484 [Morus notabilis]
 gb|EXB95966.1| hypothetical protein L484_014484 [Morus notabilis]
Length=176

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 83/141 (59%), Gaps = 16/141 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsP-----------AVKSADC  386
            K+ GIR+I+R+   ++KW+ +    +        E      P              S + 
Sbjct  8    KLTGIRQIMRIKEILQKWQSVTLTPTKPENEPDAEGAPGGIPPPINKRLTEVICCDSDED  67

Query  387  VRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
              Q+P    DVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL
Sbjct  68   SCQSPGPPPDVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHGGGL  125

Query  558  IIPCEIETFKYLLKCMEIHER  620
             IPCEIETFKYLLKCME H  
Sbjct  126  TIPCEIETFKYLLKCMENHHH  146



>ref|XP_002324724.1| auxin-responsive family protein [Populus trichocarpa]
 gb|EEF03289.1| auxin-responsive family protein [Populus trichocarpa]
Length=167

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 88/145 (61%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttt--tvettasvsPAVK----SADCVR---  392
            K+ GIR+IVRL   ++KW+ +   +      +  + ++   + PA+     S  C     
Sbjct  8    KLTGIRQIVRLKEILQKWQSLTVGSKETSLPSPPSDQSPCGIPPAINKRLNSVTCCDSDE  67

Query  393  ------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                  + PADVPKGY+ VYVG    LRRFIIPT+YLS  LFKVLL KVEEEFGF+H G 
Sbjct  68   ESCHSPEPPADVPKGYLAVYVGPE--LRRFIIPTSYLSHSLFKVLLVKVEEEFGFDHTGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCEIETFK+LL+CME    D  
Sbjct  126  LTIPCEIETFKFLLQCMENRPNDHE  150



>ref|XP_010514710.1| PREDICTED: uncharacterized protein LOC104790628 [Camelina sativa]
Length=160

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (60%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +    +        ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDSELGARKHTAIISPVINKRVLDLKTCDSDEE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCHSPESPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFK+LLKC+E H +D 
Sbjct  126  LTIPCEVETFKFLLKCIENHPKDD  149



>ref|XP_006345246.1| PREDICTED: uncharacterized protein LOC102605164 [Solanum tuberosum]
Length=179

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            ++P  VPKGY+ VYVG    LRRFIIPT+YLSD LFK LLEKVEEEFGF+H GGL IPCE
Sbjct  89   ESPHGVPKGYLAVYVG--PELRRFIIPTSYLSDSLFKKLLEKVEEEFGFDHSGGLTIPCE  146

Query  573  IETFKYLLKCMEIHER  620
            IETFK+LL+CME H+R
Sbjct  147  IETFKFLLQCMENHQR  162



>ref|XP_010503025.1| PREDICTED: uncharacterized protein LOC104780223 [Camelina sativa]
 ref|XP_010503026.1| PREDICTED: uncharacterized protein LOC104780223 [Camelina sativa]
Length=160

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (60%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +    +        ++   V        K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQTVTIGSKSDDSELGARKHTAIISPVIDKRLLDLKTCDSDEE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H G 
Sbjct  68   TTCHSPESPPDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFK+LLKC+E H +D 
Sbjct  126  LTIPCEVETFKFLLKCIENHPKDD  149



>ref|XP_007202616.1| hypothetical protein PRUPE_ppa011868mg [Prunus persica]
 gb|EMJ03815.1| hypothetical protein PRUPE_ppa011868mg [Prunus persica]
Length=192

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + PADVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  104  EPPADVPEGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHSGGLTIPCE  161

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  162  TETFKYLLKCMENHQK  177



>ref|XP_008460570.1| PREDICTED: uncharacterized protein LOC103499361 isoform X2 [Cucumis 
melo]
Length=167

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 85/144 (59%), Gaps = 21/144 (15%)
 Frame = +3

Query  249  GIRRIVRLMGFVRKWKRIa------rnnsvrrttttvettasvsPAVK----------SA  380
            GIR+IVRL   ++ W+ +              +    +    +SPA+           S 
Sbjct  10   GIRQIVRLKETLQHWQGVTVCPKSKAAAHENGSQNQNQNHGILSPAINKRLTNVLCCDSD  69

Query  381  DCVRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
            +   Q+P    DVPKGY+ VYVG    LRRFIIPT+YLS  +FKVLLEK EEEFGF+H G
Sbjct  70   EETCQSPEHPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHSVFKVLLEKAEEEFGFDHSG  127

Query  552  GLIIPCEIETFKYLLKCMEIHERD  623
            GL  PCEIETFKYLLKCME  ++D
Sbjct  128  GLTFPCEIETFKYLLKCMESQQKD  151



>ref|XP_008242284.1| PREDICTED: uncharacterized protein LOC103340628 isoform X1 [Prunus 
mume]
Length=187

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + PADVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  99   EPPADVPEGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHSGGLTIPCE  156

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H+ 
Sbjct  157  TETFKYLLKCMENHQN  172



>ref|XP_008242287.1| PREDICTED: uncharacterized protein LOC103340628 isoform X2 [Prunus 
mume]
Length=186

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + PADVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  99   EPPADVPEGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHSGGLTIPCE  156

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H+ 
Sbjct  157  TETFKYLLKCMENHQN  172



>ref|NP_197581.2| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 dbj|BAC43209.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39930.1| At5g20810 [Arabidopsis thaliana]
 gb|AED92891.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=165

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 86/143 (60%), Gaps = 17/143 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +               +  A +SPA       VK+ D   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSEVPPLAAGKQAVAMISPAINKRLLDVKNGDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVPKG + VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ETCQSPEPPHDVPKGNLAVYVGPE--LRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERD  623
            L IPCE+ETFKYLLKCME + +D
Sbjct  126  LTIPCEVETFKYLLKCMENNLKD  148



>ref|XP_010321126.1| PREDICTED: uncharacterized protein LOC101264326 [Solanum lycopersicum]
Length=207

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P  VP+GY+ VYVG    LRRFIIPT+YLSDPLFK+LLEKVEEEFGF+H GG+ IPC+
Sbjct  120  EPPHGVPRGYLAVYVG--PELRRFIIPTSYLSDPLFKLLLEKVEEEFGFDHTGGVTIPCK  177

Query  573  IETFKYLLKCMEIHERDQ  626
             +TFK+L+KCME H+RDQ
Sbjct  178  TQTFKFLMKCMENHQRDQ  195



>ref|XP_004289003.1| PREDICTED: uncharacterized protein LOC101294986 [Fragaria vesca 
subsp. vesca]
Length=206

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P+DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  114  EPPSDVPEGYLAVYVG--PELRRFIIPTSYLSHNLFKVLLEKAEEEFGFDHSGGLTIPCE  171

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  172  TETFKYLLKCMENHQK  187



>ref|XP_008460569.1| PREDICTED: uncharacterized protein LOC103499361 isoform X1 [Cucumis 
melo]
Length=186

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 85/144 (59%), Gaps = 21/144 (15%)
 Frame = +3

Query  249  GIRRIVRLMGFVRKWKRIa------rnnsvrrttttvettasvsPAVK----------SA  380
            GIR+IVRL   ++ W+ +              +    +    +SPA+           S 
Sbjct  29   GIRQIVRLKETLQHWQGVTVCPKSKAAAHENGSQNQNQNHGILSPAINKRLTNVLCCDSD  88

Query  381  DCVRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
            +   Q+P    DVPKGY+ VYVG    LRRFIIPT+YLS  +FKVLLEK EEEFGF+H G
Sbjct  89   EETCQSPEHPPDVPKGYLAVYVGP--ELRRFIIPTSYLSHSVFKVLLEKAEEEFGFDHSG  146

Query  552  GLIIPCEIETFKYLLKCMEIHERD  623
            GL  PCEIETFKYLLKCME  ++D
Sbjct  147  GLTFPCEIETFKYLLKCMESQQKD  170



>gb|KHN07872.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 82/140 (59%), Gaps = 16/140 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvetta-svsPAVKS--ADCVR------  392
            K+ GI++IVRL    +KW+ +   +      + V      +SP +     D V       
Sbjct  8    KLHGIKQIVRLKEMFQKWQTVTLGSKDSNNHSDVTHHHGVLSPMINKRLTDIVYCDSDED  67

Query  393  -----QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
                 Q P DVPKGY+ VYVG    LRRFIIPT+YLS  LFK LLEK  EEFGF+  GGL
Sbjct  68   GCYSPQPPHDVPKGYLAVYVGP--QLRRFIIPTSYLSHSLFKALLEKAAEEFGFDQSGGL  125

Query  558  IIPCEIETFKYLLKCMEIHE  617
             IPCEIETFKYLL C+E H+
Sbjct  126  TIPCEIETFKYLLNCIENHD  145



>ref|XP_008337812.1| PREDICTED: uncharacterized protein LOC103400902 [Malus domestica]
Length=191

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P D+PKGY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  103  EPPHDIPKGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHSGGLTIPCE  160

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  161  TETFKYLLKCMENHQK  176



>ref|NP_001031914.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AED92892.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=190

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 88/143 (62%), Gaps = 17/143 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKR--IarnnsvrrttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+   I   + V       +  A +SPA       VK+ D   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSEVPPLAAGKQAVAMISPAINKRLLDVKNGDSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVPKG + VYVG    LRRFIIPT+YLS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ETCQSPEPPHDVPKGNLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERD  623
            L IPCE+ETFKYLLKCME + +D
Sbjct  126  LTIPCEVETFKYLLKCMENNLKD  148



>ref|XP_009359696.1| PREDICTED: uncharacterized protein LOC103950233 isoform X1 [Pyrus 
x bretschneideri]
Length=191

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P D+PKGY+ VYVG    LRRFI+PT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  103  EPPHDIPKGYLAVYVG--PELRRFIVPTSYLSHSLFKVLLEKAEEEFGFDHSGGLTIPCE  160

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  161  TETFKYLLKCMENHQK  176



>ref|XP_006292206.1| hypothetical protein CARUB_v10018411mg [Capsella rubella]
 gb|EOA25104.1| hypothetical protein CARUB_v10018411mg [Capsella rubella]
Length=160

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 17/144 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsP--------AVKSADCVRQ  395
            K+ GI++IVRL   ++KW+ +   +             ++           +K+ D   +
Sbjct  8    KLTGIKQIVRLKEILQKWQSVTIGSKSYDGELGARKHTAIISPMIDKRLLELKTCDSDEE  67

Query  396  -------APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
                   +P DVPKGY+ VYVG    LRRFIIPT +LS  LFKVLLEK EEE+GF+H   
Sbjct  68   TTCPSPESPHDVPKGYLAVYVGPE--LRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSSA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQ  626
            L IPCE+ETFKYLL C+E H +D+
Sbjct  126  LTIPCEVETFKYLLNCIENHPKDE  149



>ref|XP_009611200.1| PREDICTED: uncharacterized protein LOC104104752 isoform X1 [Nicotiana 
tomentosiformis]
Length=173

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 87/151 (58%), Gaps = 26/151 (17%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv------------------sP  365
            KV GIR+IVRL   + KW+ +  +   +         +S                   S 
Sbjct  9    KVTGIRQIVRLKQLLHKWQNVTLSPKGKNHQKLGCVKSSNRKNDSYEGISPSISKRLRSS  68

Query  366  AVKSADCVR------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekvee  527
            +V   D         + P  VP+GY+ VYVG    LRRFII T+YLSDPLFKVLLEKVEE
Sbjct  69   SVYWGDSDEDYCQSPEPPHGVPRGYLAVYVG--PELRRFIIRTSYLSDPLFKVLLEKVEE  126

Query  528  efgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            EFGF+H GGL IPCEIETFK+LL+CME H+R
Sbjct  127  EFGFDHSGGLTIPCEIETFKFLLQCMEKHQR  157



>ref|XP_010454386.1| PREDICTED: uncharacterized protein LOC104736151 [Camelina sativa]
 ref|XP_010454387.1| PREDICTED: uncharacterized protein LOC104736151 [Camelina sativa]
Length=167

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 82/138 (59%), Gaps = 17/138 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +               +    + PA       VK+AD   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSDVPPLAAGKQAAEMIVPAINKRLLEVKNADSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVPKGY+ VYVG    LRRFIIPT+ LS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPHDVPKGYLAVYVGPE--LRRFIIPTSCLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCME  608
            L IPCE+ETFKYLLKCME
Sbjct  126  LTIPCEVETFKYLLKCME  143



>ref|NP_001236981.1| uncharacterized protein LOC100527760 [Glycine max]
 gb|ACU16920.1| unknown [Glycine max]
Length=157

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 82/140 (59%), Gaps = 16/140 (11%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvetta-svsPAVKS--ADCVR------  392
            K+ GI++IVRL    +KW+ +   +      + V      +SP +     D V       
Sbjct  8    KLHGIKQIVRLKEMFQKWQTVTLGSKDSNNHSDVTHHHGVLSPMINKRLTDIVYCDSDED  67

Query  393  -----QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
                 Q P DVPKGY+ VYVG    LRRFIIPT+YLS  LFK LLEK  EEFGF+  GGL
Sbjct  68   GCYSPQPPHDVPKGYLTVYVGP--QLRRFIIPTSYLSHSLFKALLEKAAEEFGFDQSGGL  125

Query  558  IIPCEIETFKYLLKCMEIHE  617
             IPCEIETFKYLL C+E H+
Sbjct  126  TIPCEIETFKYLLNCIENHD  145



>ref|XP_009359697.1| PREDICTED: uncharacterized protein LOC103950233 isoform X2 [Pyrus 
x bretschneideri]
Length=184

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P D+PKGY+ VYVG    LRRFI+PT+YLS  LFKVLLEK EEEFGF+H GGL IPCE
Sbjct  96   EPPHDIPKGYLAVYVG--PELRRFIVPTSYLSHSLFKVLLEKAEEEFGFDHSGGLTIPCE  153

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  154  TETFKYLLKCMENHQK  169



>ref|XP_010420926.1| PREDICTED: uncharacterized protein LOC104706427 [Camelina sativa]
Length=167

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 82/138 (59%), Gaps = 17/138 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR+IVRL   ++KW+ +               +    + PA       VK+AD   
Sbjct  8    KLTGIRQIVRLKEILQKWQTVTIGPKSDVPPLAAGKQAAEMIVPAINKRLLEVKNADSDE  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVPKGY+ VYVG    LRRFIIPT+ LS  LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPHDVPKGYLAVYVGPE--LRRFIIPTSCLSHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCME  608
            L IPCE+ETFKYLLKCME
Sbjct  126  LTIPCEVETFKYLLKCME  143



>ref|XP_009611201.1| PREDICTED: uncharacterized protein LOC104104752 isoform X2 [Nicotiana 
tomentosiformis]
Length=171

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 87/151 (58%), Gaps = 26/151 (17%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv------------------sP  365
            KV GIR+IVRL   + KW+ +  +   +         +S                   S 
Sbjct  9    KVTGIRQIVRLKQLLHKWQNVTLSPKGKNHQKLGCVKSSNRKNDSYEGISPSISKRLRSS  68

Query  366  AVKSADCVR------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekvee  527
            +V   D         + P  VP+GY+ VYVG    LRRFII T+YLSDPLFKVLLEKVEE
Sbjct  69   SVYWGDSDEDYCQSPEPPHGVPRGYLAVYVG--PELRRFIIRTSYLSDPLFKVLLEKVEE  126

Query  528  efgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            EFGF+H GGL IPCEIETFK+LL+CME H+R
Sbjct  127  EFGFDHSGGLTIPCEIETFKFLLQCMEKHQR  157



>gb|EPS70661.1| hypothetical protein M569_04099 [Genlisea aurea]
Length=156

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +3

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
            P D+P+GY+ VYVG     RRFIIPT+YLSDPLFK+LLEKVEEEFGF+H G L IPC+IE
Sbjct  71   PNDIPRGYLPVYVGPEN--RRFIIPTSYLSDPLFKLLLEKVEEEFGFDHGGALTIPCDIE  128

Query  579  TFKYLLKCMEIHERDQRR  632
            TFKYLL+CME+H +   +
Sbjct  129  TFKYLLQCMELHTKQTTK  146



>ref|XP_008391750.1| PREDICTED: uncharacterized protein LOC103453925 isoform X2 [Malus 
domestica]
 ref|XP_008344160.1| PREDICTED: uncharacterized protein LOC103406972 isoform X2 [Malus 
domestica]
Length=183

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  95   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  152

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  153  TETFKYLLKCMENHQK  168



>ref|XP_009343362.1| PREDICTED: uncharacterized protein LOC103935326 isoform X2 [Pyrus 
x bretschneideri]
Length=184

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  96   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  153

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  154  TETFKYLLKCMENHQK  169



>ref|XP_009348903.1| PREDICTED: uncharacterized protein LOC103940510 isoform X1 [Pyrus 
x bretschneideri]
Length=190

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  102  EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  159

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  160  TETFKYLLKCMENHQK  175



>ref|XP_008391743.1| PREDICTED: uncharacterized protein LOC103453925 isoform X1 [Malus 
domestica]
 ref|XP_008344159.1| PREDICTED: uncharacterized protein LOC103406972 isoform X1 [Malus 
domestica]
Length=184

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  96   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  153

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  154  TETFKYLLKCMENHQK  169



>ref|XP_009348905.1| PREDICTED: uncharacterized protein LOC103940510 isoform X3 [Pyrus 
x bretschneideri]
Length=183

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  95   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  152

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  153  TETFKYLLKCMENHQK  168



>ref|XP_009348904.1| PREDICTED: uncharacterized protein LOC103940510 isoform X2 [Pyrus 
x bretschneideri]
Length=184

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  96   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  153

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  154  TETFKYLLKCMENHQK  169



>ref|XP_009343363.1| PREDICTED: uncharacterized protein LOC103935326 isoform X3 [Pyrus 
x bretschneideri]
Length=183

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  95   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  152

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  153  TETFKYLLKCMENHQK  168



>ref|XP_009348906.1| PREDICTED: uncharacterized protein LOC103940510 isoform X4 [Pyrus 
x bretschneideri]
Length=176

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  88   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  145

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  146  TETFKYLLKCMENHQK  161



>ref|XP_008391757.1| PREDICTED: uncharacterized protein LOC103453925 isoform X3 [Malus 
domestica]
 ref|XP_008344161.1| PREDICTED: uncharacterized protein LOC103406972 isoform X3 [Malus 
domestica]
Length=176

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  88   EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  145

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  146  TETFKYLLKCMENHQK  161



>ref|XP_009343361.1| PREDICTED: uncharacterized protein LOC103935326 isoform X1 [Pyrus 
x bretschneideri]
Length=190

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVP+GY+ VYVG    LRRFIIPT+YLS  LFKVLLEK EEE+GF+H GGL IPCE
Sbjct  102  EPPPDVPQGYLAVYVG--PELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCE  159

Query  573  IETFKYLLKCMEIHER  620
             ETFKYLLKCME H++
Sbjct  160  TETFKYLLKCMENHQK  175



>emb|CDX70944.1| BnaC03g10280D [Brassica napus]
Length=170

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 17/149 (11%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSA  380
              + K+ GIR++VRL   ++KW+ +   +           +  A +SPA       VK+ 
Sbjct  4    NNEAKLTGIRQVVRLKEILQKWQTVTIGSKSDVPPLAAGKQAAAMISPAINKRLLAVKNC  63

Query  381  DCVRQA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
            D   +       P DVP+GY+ VYVG    LRRFIIPT+YL   LFKVLLEK EEEFGF+
Sbjct  64   DSDEENCQSPEPPVDVPRGYLAVYVGPE--LRRFIIPTSYLGHSLFKVLLEKAEEEFGFD  121

Query  543  HRGGLIIPCEIETFKYLLKCMEIHERDQR  629
              G L IPCE+ETFK+L+KCME + +D  
Sbjct  122  QSGALTIPCEVETFKFLVKCMENNSKDHH  150



>ref|XP_009131816.1| PREDICTED: uncharacterized protein LOC103856463 [Brassica rapa]
 emb|CDX88840.1| BnaA03g08090D [Brassica napus]
Length=170

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 87/145 (60%), Gaps = 17/145 (12%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrr--ttttvettasvsPA-------VKSADCVR  392
            K+ GIR++VRL   ++KW+ +   +           +  A +SPA       VK+ D   
Sbjct  8    KLTGIRQVVRLKEILQKWQTVTIGSKSDVPPLAAGKQAAAMISPAINKRLLAVKNCDSDD  67

Query  393  QA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +       P DVP+GY+ VYVG    LRRFIIPT+YL   LFKVLLEK EEEFGF+  G 
Sbjct  68   ENCQSPEPPVDVPRGYLAVYVGPE--LRRFIIPTSYLGHSLFKVLLEKAEEEFGFDQSGA  125

Query  555  LIIPCEIETFKYLLKCMEIHERDQR  629
            L IPCE+ETFK+L+KCME + +D  
Sbjct  126  LTIPCEVETFKFLVKCMENNSKDHH  150



>ref|XP_004508030.1| PREDICTED: uncharacterized protein LOC101493355 [Cicer arietinum]
Length=153

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +3

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
            P DVPKGY+ VYVG    LRRFIIPT+YLS  LFK+LLEK  +EFGF+  GGL IPCEIE
Sbjct  69   PHDVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFKMLLEKAADEFGFDQSGGLTIPCEIE  126

Query  579  TFKYLLKCMEIHERDQ  626
            TFKYLL CME H  + 
Sbjct  127  TFKYLLSCMENHHDND  142



>ref|XP_007138620.1| hypothetical protein PHAVU_009G224000g [Phaseolus vulgaris]
 ref|XP_007138621.1| hypothetical protein PHAVU_009G224000g [Phaseolus vulgaris]
 gb|ESW10614.1| hypothetical protein PHAVU_009G224000g [Phaseolus vulgaris]
 gb|ESW10615.1| hypothetical protein PHAVU_009G224000g [Phaseolus vulgaris]
Length=167

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 79/147 (54%), Gaps = 20/147 (14%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIar-------nnsvrrttttvettasvsPAVKSADCVRQA  398
            KV GIR+IVRL   ++KW+ +           S +               V   +C    
Sbjct  8    KVTGIRQIVRLKEMLQKWQNVTLGPKPSIPTISDQVPNDGTLKPLINKRVVNVMNCESDT  67

Query  399  PADVP-----------KGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
                            KGY+ VYVG    LRRFIIPTTYLS  LFKVLLEK  +EFGF+H
Sbjct  68   EESCQSPEPLPPPDVPKGYLAVYVGPE--LRRFIIPTTYLSHSLFKVLLEKAADEFGFDH  125

Query  546  RGGLIIPCEIETFKYLLKCMEIHERDQ  626
             GGL IPCEIETFKYLLKC+E  ++DQ
Sbjct  126  SGGLTIPCEIETFKYLLKCIENEQKDQ  152



>gb|EYU25814.1| hypothetical protein MIMGU_mgv1a018984mg, partial [Erythranthe 
guttata]
Length=79

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +3

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFK  587
            VPKG++ VYV     LRRFIIP +YLSDPLFKVLL K EEEFGF+H GGL IPCEIETFK
Sbjct  5    VPKGFLAVYVE--PELRRFIIPMSYLSDPLFKVLLAKAEEEFGFDHSGGLTIPCEIETFK  62

Query  588  YLLKCMEIHERD  623
            YLL CME H R+
Sbjct  63   YLLHCMENHRRE  74



>ref|XP_003609957.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES92154.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=155

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            +AP DVPKGY+ VYVG    LRRFIIPT+YLS  LFK+LLEK  +EFGF   GGL IPCE
Sbjct  64   KAPHDVPKGYLAVYVGP--ELRRFIIPTSYLSHSLFKMLLEKAADEFGFNQCGGLTIPCE  121

Query  573  IETFKYLLKCME  608
            IETFKYLL CME
Sbjct  122  IETFKYLLSCME  133



>ref|XP_008803404.1| PREDICTED: uncharacterized protein LOC103716962 [Phoenix dactylifera]
 ref|XP_008803405.1| PREDICTED: uncharacterized protein LOC103716962 [Phoenix dactylifera]
Length=154

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 82/139 (59%), Gaps = 11/139 (8%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVR------  392
            E  KV GIR+IVR    ++KW  I        +  +    A          C        
Sbjct  4    ENVKVTGIRQIVRFREMLQKWHSITLGPKENESKASGIPPAVDKRLKNVCSCCDSDEEGC  63

Query  393  ---QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
               + P DVPKGY+ +YVG     RRF++PT+YLS PLFK+LLEK EEEFGF+HRG + I
Sbjct  64   QSPEPPPDVPKGYIPIYVGPEH--RRFVVPTSYLSLPLFKLLLEKAEEEFGFDHRGAITI  121

Query  564  PCEIETFKYLLKCMEIHER  620
            PCEIETFKY+L+CME H++
Sbjct  122  PCEIETFKYILQCMERHQK  140



>ref|XP_009401534.1| PREDICTED: uncharacterized protein LOC103985535 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401535.1| PREDICTED: uncharacterized protein LOC103985535 [Musa acuminata 
subsp. malaccensis]
Length=154

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 85/142 (60%), Gaps = 21/142 (15%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKS-----------  377
            E  KV  I +IVRL   ++KW+ IA      R   +        P V S           
Sbjct  4    EAGKVTSIWQIVRLREILQKWQSIALGPKEDRHRASGIP-----PTVSSRRKDVCVQCDS  58

Query  378  -ADCVR--QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHR  548
              +C +  +AP DVPKG   VYVG  +  RRF+IPT+Y S P+FK+LLEK E+EFGF+H+
Sbjct  59   DEECCQSPEAPPDVPKGCCPVYVGPEQ--RRFVIPTSYFSLPVFKLLLEKAEKEFGFDHK  116

Query  549  GGLIIPCEIETFKYLLKCMEIH  614
            GGL IPCEIETFKY+L+CM+ H
Sbjct  117  GGLTIPCEIETFKYILQCMDRH  138



>ref|XP_004142814.1| PREDICTED: uncharacterized protein LOC101207913 [Cucumis sativus]
 ref|XP_004168724.1| PREDICTED: uncharacterized LOC101207913 [Cucumis sativus]
 gb|KGN51419.1| hypothetical protein Csa_5G534970 [Cucumis sativus]
Length=167

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 82/145 (57%), Gaps = 21/145 (14%)
 Frame = +3

Query  249  GIRRIVRLMGFVRKWKRIa------rnnsvrrttttvettasvsPAVK----------SA  380
            GIR+IVRL   ++ W+ +              +    +    +SPA+           S 
Sbjct  10   GIRQIVRLKETLQHWQGVTVCPKSKAAAHENGSQNQNQNHGILSPAINKRLTNVLCCDSD  69

Query  381  DCVRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
            +   Q+P    DVPKGY+ VYVG    LRRFIIPT+YL   +FKVLLEK EEEFGF+H G
Sbjct  70   EETCQSPEHPPDVPKGYLAVYVGP--ELRRFIIPTSYLRHSVFKVLLEKAEEEFGFDHSG  127

Query  552  GLIIPCEIETFKYLLKCMEIHERDQ  626
             L  PCEIE FKYLLKCME  ++D 
Sbjct  128  ALTFPCEIEIFKYLLKCMESQQKDH  152



>ref|XP_010917417.1| PREDICTED: uncharacterized protein LOC105042015 [Elaeis guineensis]
 ref|XP_010917418.1| PREDICTED: uncharacterized protein LOC105042015 [Elaeis guineensis]
 ref|XP_010917419.1| PREDICTED: uncharacterized protein LOC105042015 [Elaeis guineensis]
Length=154

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 21/144 (15%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAV--------KSADC  386
            E  KV GIR+IVR    + KW   A       +  +        PAV         S D 
Sbjct  4    ENVKVTGIRQIVRFREMLHKWHSTALGTKENESKASGIP-----PAVDKRLKNVCNSCDS  58

Query  387  VRQA------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHR  548
              +       P DVPKGY+ +YVG     RRF+IPT+YLS PLFK+LLEK EEEFGF+HR
Sbjct  59   DEEGCQSPEPPPDVPKGYIPIYVGPEH--RRFVIPTSYLSLPLFKLLLEKAEEEFGFDHR  116

Query  549  GGLIIPCEIETFKYLLKCMEIHER  620
            G + IPCEIETFKY+L+CME H++
Sbjct  117  GAITIPCEIETFKYILQCMERHQK  140



>gb|KGN57847.1| hypothetical protein Csa_3G346940 [Cucumis sativus]
Length=159

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 82/145 (57%), Gaps = 21/145 (14%)
 Frame = +3

Query  249  GIRRIVRLMGFVRKWKRIa------rnnsvrrttttvettasvsPAVK----------SA  380
            GIR+IVRL   ++ W+ +              +    +    +SPA+           S 
Sbjct  10   GIRQIVRLKETLQHWQGVTVCPKSKAAAHENGSQNQNQNHGILSPAINKRLTNVLCCDSD  69

Query  381  DCVRQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
            +   Q+P    DVPKGY+ VYVG    LRRFIIPT+YL   +FKVLLEK EEEFGF+H G
Sbjct  70   EETCQSPEHPPDVPKGYLAVYVGP--ELRRFIIPTSYLRHSVFKVLLEKAEEEFGFDHSG  127

Query  552  GLIIPCEIETFKYLLKCMEIHERDQ  626
             L  PCEIE FKYLLKCME  ++D 
Sbjct  128  ALTFPCEIEIFKYLLKCMESQQKDH  152



>ref|XP_009410256.1| PREDICTED: uncharacterized protein LOC103992337 [Musa acuminata 
subsp. malaccensis]
Length=154

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 11/138 (8%)
 Frame = +3

Query  222  LVGEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrr--------ttttvettasvsPAVKS  377
            +  E  K+ GI +IVRL   + KW+ +A +    +        +                
Sbjct  1    MSDESVKMTGIWQIVRLREMLHKWQLVALSKKEEQPCSSGIPPSVDKRLKNVLSQCDSDE  60

Query  378  ADCVR-QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
              C   Q P DVPKG+  VY+G  +  RRF+IPT+YLS P+FK+LLEK EEEFGF+H+G 
Sbjct  61   ESCQSPQPPPDVPKGHCPVYIGPEQ--RRFVIPTSYLSLPVFKLLLEKAEEEFGFDHQGA  118

Query  555  LIIPCEIETFKYLLKCME  608
            L+IPCE+ETFKY+L CME
Sbjct  119  LMIPCEVETFKYILLCME  136



>gb|ABR17095.1| unknown [Picea sitchensis]
Length=139

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrtt---ttvettasvsPAVKSAD---CVRQA  398
            +K+ GI +IVRL   V+KW  IA + +    T   +    +   SP    +D   C  QA
Sbjct  4    KKMDGILQIVRLRQLVKKWHMIAGSQNSPSGTVLCSLSPKSNHCSPVSDDSDQDCCTNQA  63

Query  399  --PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
              P DVP+GY+ VYVGR    RRFIIPT+YLS P+F+ LL++ EEEFGF+H+GGL IPCE
Sbjct  64   WPPPDVPEGYLAVYVGRER--RRFIIPTSYLSRPVFRTLLDRAEEEFGFDHQGGLTIPCE  121

Query  573  IETFKYLLK  599
            +  F  +L+
Sbjct  122  VSVFTQVLR  130



>ref|XP_008784357.1| PREDICTED: auxin-induced protein 15A-like [Phoenix dactylifera]
Length=132

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + P DVPKG + +YVG     RRF++PT+YLS P FK+LLEK EEEFGFEH G + IPCE
Sbjct  48   EPPPDVPKGCIPIYVGPEH--RRFVVPTSYLSHPAFKLLLEKAEEEFGFEHGGAITIPCE  105

Query  573  IETFKYLLKCMEIHER  620
            IETFKY+L+CM+ H+R
Sbjct  106  IETFKYILQCMKQHQR  121



>ref|XP_004956905.1| PREDICTED: uncharacterized protein LOC101782623 isoform X2 [Setaria 
italica]
Length=169

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 83/153 (54%), Gaps = 24/153 (16%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPA-------------  368
            G  +   G+++I RL   + KW+ +A   + ++    V        A             
Sbjct  5    GATKAATGMKQIARLRELLHKWQTMALGANKQQREDEVPDVDEEMVASAIPPFVLRRLRR  64

Query  369  VKSADCVR---------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekv  521
              +AD V          + P DVP+GY  VYVG  +  RRF+IPTTYL+ P+F++LLEK 
Sbjct  65   ADTADSVLSDDESCHSPEPPPDVPRGYCPVYVGPEQ--RRFVIPTTYLAHPVFRLLLEKA  122

Query  522  eeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            EEEFGF H G L IPCE E FKY+L+C+E H++
Sbjct  123  EEEFGFRHEGALAIPCETEAFKYILQCVERHDK  155



>ref|XP_004956904.1| PREDICTED: uncharacterized protein LOC101782623 isoform X1 [Setaria 
italica]
Length=178

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 83/153 (54%), Gaps = 24/153 (16%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPA-------------  368
            G  +   G+++I RL   + KW+ +A   + ++    V        A             
Sbjct  5    GATKAATGMKQIARLRELLHKWQTMALGANKQQREDEVPDVDEEMVASAIPPFVLRRLRR  64

Query  369  VKSADCV---------RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekv  521
              +AD V          + P DVP+GY  VYVG  +  RRF+IPTTYL+ P+F++LLEK 
Sbjct  65   ADTADSVLSDDESCHSPEPPPDVPRGYCPVYVGPEQ--RRFVIPTTYLAHPVFRLLLEKA  122

Query  522  eeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            EEEFGF H G L IPCE E FKY+L+C+E H++
Sbjct  123  EEEFGFRHEGALAIPCETEAFKYILQCVERHDK  155



>ref|XP_008652763.1| PREDICTED: uncharacterized protein LOC103632809 isoform X1 [Zea 
mays]
 tpg|DAA61630.1| TPA: hypothetical protein ZEAMMB73_636097 [Zea mays]
Length=244

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 94/176 (53%), Gaps = 32/176 (18%)
 Frame = +3

Query  183  PSIRR--AGIRMAELLVGEK---RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvet  347
            PS+RR  A +R    ++G+    +   G+++IVRL   + +W   A     ++       
Sbjct  42   PSLRRCTATVRARASVMGDDDGAKAASGVKQIVRLRELLHRWHFTALGAKQQQQREEEGR  101

Query  348  tasvsPA-----------------VKSADCVR--------QAPADVPKGYMGVYVGRGEV  452
              +  P                   ++AD V         + P DVP+GY  VYVG  + 
Sbjct  102  GHAGVPEGAVAPAIPPFVLRRLRRTETADSVSDDESCHSPEPPPDVPRGYCPVYVGPEQ-  160

Query  453  LRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
             RRF+IPT+YL+ P+F++LLEK EEEFGF H+G L IPCE E FKY+L+C+E H++
Sbjct  161  -RRFVIPTSYLAHPVFRLLLEKAEEEFGFRHQGALAIPCETEAFKYILQCVERHDQ  215



>gb|KHF97540.1| Auxin-induced 15A [Gossypium arboreum]
Length=157

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 2/67 (3%)
 Frame = +3

Query  414  KGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            KGY+ VYVG    LRRFIIPTTYL+ P+FKVLLEK ++EFG++H GGL +PCEIE FKYL
Sbjct  75   KGYLAVYVG--PELRRFIIPTTYLTHPVFKVLLEKAKDEFGYDHNGGLTLPCEIEIFKYL  132

Query  594  LKCMEIH  614
            L+C+E H
Sbjct  133  LQCIENH  139



>ref|XP_010687567.1| PREDICTED: uncharacterized protein LOC104901671 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687568.1| PREDICTED: uncharacterized protein LOC104901671 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687569.1| PREDICTED: uncharacterized protein LOC104901671 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 81/143 (57%), Gaps = 15/143 (10%)
 Frame = +3

Query  240  KVCGIRRIVRLMGFVRKWKRIarnnsvrrtttt-------------vettasvsPAVKSA  380
             V GIR+I RL G+   W+  A N+ +                   ++ +A    + +  
Sbjct  8    NVSGIRQIGRLTGYFHIWQNAAINSRMLNHHDQPPPGGIPPEVNRRLQNSAVAGDSDEEG  67

Query  381  DCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLI  560
                + P DVPKG++ VYVG    LRRF+I T YLS  LFKVLLEK EEEFGF+H GGL 
Sbjct  68   CASPEPPPDVPKGFLAVYVGP--ELRRFLIRTDYLSHHLFKVLLEKTEEEFGFDHAGGLT  125

Query  561  IPCEIETFKYLLKCMEIHERDQR  629
            IPCEIETFKYLL C++    D+ 
Sbjct  126  IPCEIETFKYLLNCIKKENSDKE  148



>ref|XP_008652765.1| PREDICTED: uncharacterized protein LOC103632809 isoform X3 [Zea 
mays]
Length=236

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 94/176 (53%), Gaps = 32/176 (18%)
 Frame = +3

Query  183  PSIRR--AGIRMAELLVGEK---RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvet  347
            PS+RR  A +R    ++G+    +   G+++IVRL   + +W   A     ++       
Sbjct  42   PSLRRCTATVRARASVMGDDDGAKAASGVKQIVRLRELLHRWHFTALGAKQQQQREEEGR  101

Query  348  tasvsPA-----------------VKSADCVR--------QAPADVPKGYMGVYVGRGEV  452
              +  P                   ++AD V         + P DVP+GY  VYVG  + 
Sbjct  102  GHAGVPEGAVAPAIPPFVLRRLRRTETADSVSDDESCHSPEPPPDVPRGYCPVYVGPEQ-  160

Query  453  LRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
             RRF+IPT+YL+ P+F++LLEK EEEFGF H+G L IPCE E FKY+L+C+E H++
Sbjct  161  -RRFVIPTSYLAHPVFRLLLEKAEEEFGFRHQGALAIPCETEAFKYILQCVERHDQ  215



>ref|XP_008652764.1| PREDICTED: uncharacterized protein LOC103632809 isoform X2 [Zea 
mays]
Length=241

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 94/176 (53%), Gaps = 32/176 (18%)
 Frame = +3

Query  183  PSIRR--AGIRMAELLVGEK---RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvet  347
            PS+RR  A +R    ++G+    +   G+++IVRL   + +W   A     ++       
Sbjct  42   PSLRRCTATVRARASVMGDDDGAKAASGVKQIVRLRELLHRWHFTALGAKQQQQREEEGR  101

Query  348  tasvsPA-----------------VKSADCVR--------QAPADVPKGYMGVYVGRGEV  452
              +  P                   ++AD V         + P DVP+GY  VYVG  + 
Sbjct  102  GHAGVPEGAVAPAIPPFVLRRLRRTETADSVSDDESCHSPEPPPDVPRGYCPVYVGPEQ-  160

Query  453  LRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
             RRF+IPT+YL+ P+F++LLEK EEEFGF H+G L IPCE E FKY+L+C+E H++
Sbjct  161  -RRFVIPTSYLAHPVFRLLLEKAEEEFGFRHQGALAIPCETEAFKYILQCVERHDQ  215



>ref|XP_006661272.1| PREDICTED: uncharacterized protein LOC102719796 [Oryza brachyantha]
Length=189

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + PADVP+GY  VYVG  +  RRF+IPT YL  P+F++LL K EEEFGF H G L IPCE
Sbjct  93   EPPADVPRGYCPVYVGPEQ--RRFVIPTGYLGHPVFRLLLGKAEEEFGFRHEGALAIPCE  150

Query  573  IETFKYLLKCMEIHER  620
             ETFKY+L+C+E H++
Sbjct  151  TETFKYILQCVERHDK  166



>ref|XP_002462442.1| hypothetical protein SORBIDRAFT_02g025620 [Sorghum bicolor]
 gb|EER98963.1| hypothetical protein SORBIDRAFT_02g025620 [Sorghum bicolor]
Length=189

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 81/160 (51%), Gaps = 32/160 (20%)
 Frame = +3

Query  228  GEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQA---  398
            G K    GI++IVRL   + KW  +    + ++     +        V   D V  A   
Sbjct  5    GAKAAATGIKQIVRLRELLHKW-HLMALGAKQQRDHQEDDEDHAGGGVPDQDAVASAIPP  63

Query  399  --------------------------PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlf  500
                                      P DVP+GY  VYVG  +  RRF+IPT+YL+ P+F
Sbjct  64   FVLRRLRRAETADSVLSDDESYSPEPPPDVPRGYCPVYVGPEQ--RRFVIPTSYLAHPVF  121

Query  501  kvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            ++LLEK EEEFGF H+G L IPCE E FKY+L+C+E H++
Sbjct  122  RLLLEKAEEEFGFRHQGALAIPCETEAFKYILQCVERHDK  161



>gb|ADE76442.1| unknown [Picea sitchensis]
Length=177

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 77/125 (62%), Gaps = 9/125 (7%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKS----ADCVR---QAPADV  410
            IR+IVRL   V+KW+  A + S   +     +       + S    +DC R     P DV
Sbjct  6    IRQIVRLRRLVKKWRTFALSRSNPSSVGCSLSPKFKHRNLFSYDSDSDCCRTPASPPPDV  65

Query  411  PKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKY  590
            P+GY+ VYVGR    RRFIIPT YLS P+F+ LL++ EEEFGF+H+GGL IPCE+  FK 
Sbjct  66   PEGYLAVYVGRER--RRFIIPTDYLSRPVFRTLLDRAEEEFGFDHQGGLTIPCEVNVFKQ  123

Query  591  LLKCM  605
            +L+ +
Sbjct  124  VLRVL  128



>gb|EAZ09231.1| hypothetical protein OsI_31504 [Oryza sativa Indica Group]
Length=188

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + PADVP+GY  VYVG  +  RRF+IPT YL  P+F++LLEK EEEFGF H+G L IPCE
Sbjct  93   EPPADVPRGYCPVYVGPEQ--RRFVIPTRYLGHPVFRLLLEKAEEEFGFCHQGALAIPCE  150

Query  573  IETFKYLLKCMEIHER  620
             E FKY+L+C+E H+ 
Sbjct  151  TEAFKYILQCVERHDN  166



>ref|NP_001063264.1| Os09g0437400 [Oryza sativa Japonica Group]
 dbj|BAD36439.1| auxin-induced protein-like [Oryza sativa Japonica Group]
 dbj|BAF25178.1| Os09g0437400 [Oryza sativa Japonica Group]
Length=190

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            + PADVP+GY  VYVG  +  RRF+IPT YL  P+F++LLEK EEEFGF H+G L IPCE
Sbjct  95   EPPADVPRGYCPVYVGPEQ--RRFVIPTRYLGHPVFRLLLEKAEEEFGFCHQGALAIPCE  152

Query  573  IETFKYLLKCMEIHER  620
             E FKY+L+C+E H+ 
Sbjct  153  TEAFKYILQCVERHDN  168



>ref|XP_006843842.1| hypothetical protein AMTR_s00007p00261250 [Amborella trichopoda]
 gb|ERN05517.1| hypothetical protein AMTR_s00007p00261250 [Amborella trichopoda]
Length=144

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +3

Query  414  KGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            KGY+ VYVG    LRRF+IPT YL+ P+FKVLLEK EEEFGF H+G L IPCEIETFKYL
Sbjct  72   KGYLAVYVG--PELRRFVIPTDYLTQPVFKVLLEKAEEEFGFYHKGALTIPCEIETFKYL  129

Query  594  LKCMEIHERDQR  629
            L+ M  + +D+ 
Sbjct  130  LRFMAQNHKDEE  141



>ref|XP_010239379.1| PREDICTED: uncharacterized protein LOC100841069 [Brachypodium 
distachyon]
Length=172

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCE  572
            +A  DVP+GY  VYVG  +  RRF+IPT+YL  P+F++LLEK EEEFGF   G L IPCE
Sbjct  77   EAAPDVPRGYCPVYVGMEQ--RRFVIPTSYLGHPVFRLLLEKAEEEFGFRQEGALAIPCE  134

Query  573  IETFKYLLKCMEIHER  620
             E FKY+L+C+E H++
Sbjct  135  TEAFKYILQCVERHDK  150



>gb|AEW08460.1| hypothetical protein 2_10399_01, partial [Pinus radiata]
 gb|AFG52138.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52139.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52140.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52141.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52142.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52143.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52144.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52145.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52146.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52147.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52148.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52149.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52150.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52151.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
 gb|AFG52152.1| hypothetical protein 2_10399_01, partial [Pinus taeda]
Length=123

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 4/76 (5%)
 Frame = +3

Query  384  CVRQA--PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
            C  +A  P DVP+GY+ VYVGR    RRFIIPT+YLS P+F+ LL++ EEEFGF+HRGGL
Sbjct  5    CTNRALPPPDVPEGYLAVYVGRER--RRFIIPTSYLSRPVFRTLLDRAEEEFGFDHRGGL  62

Query  558  IIPCEIETFKYLLKCM  605
             IPCE+  F  +L+ +
Sbjct  63   TIPCEVSVFNQVLRVL  78



>ref|XP_008670215.1| PREDICTED: uncharacterized protein LOC103647454 isoform X2 [Zea 
mays]
Length=217

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +3

Query  414  KGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            +GY  VYVG  +  RRF+IPT YL+ P+F++LLEK EEEFGF+H+G L IPCE E FKY+
Sbjct  135  RGYCPVYVGAEQ--RRFVIPTGYLAHPVFRLLLEKAEEEFGFQHQGALAIPCETEAFKYI  192

Query  594  LKCMEIHER  620
            L+C++ H+R
Sbjct  193  LQCVQRHDR  201



>tpg|DAA40139.1| TPA: hypothetical protein ZEAMMB73_735705 [Zea mays]
Length=181

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +3

Query  414  KGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            +GY  VYVG  +  RRF+IPT YL+ P+F++LLEK EEEFGF+H+G L IPCE E FKY+
Sbjct  99   RGYCPVYVGAEQ--RRFVIPTGYLAHPVFRLLLEKAEEEFGFQHQGALAIPCETEAFKYI  156

Query  594  LKCMEIHER  620
            L+C++ H+R
Sbjct  157  LQCVQRHDR  165



>ref|XP_008670214.1| PREDICTED: uncharacterized protein LOC103647454 isoform X1 [Zea 
mays]
Length=253

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +3

Query  414  KGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            +GY  VYVG  +  RRF+IPT YL+ P+F++LLEK EEEFGF+H+G L IPCE E FKY+
Sbjct  135  RGYCPVYVGAEQ--RRFVIPTGYLAHPVFRLLLEKAEEEFGFQHQGALAIPCETEAFKYI  192

Query  594  LKCMEIHER  620
            L+C++ H+R
Sbjct  193  LQCVQRHDR  201



>ref|XP_004291305.1| PREDICTED: uncharacterized protein LOC101314623 [Fragaria vesca 
subsp. vesca]
Length=160

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 74/138 (54%), Gaps = 10/138 (7%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvett-------asvsPAVKSADCV  389
            + +K   IR IVRL   ++KW++IA +      TT+                    + C 
Sbjct  2    DSKKSNKIREIVRLQQILKKWRKIANSPKANSITTSSSNKSIKFLKRTLSLSDKTGSTCD  61

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
                A VPKGY+ V VG  + L+RF+IPT YL  P F+ LL + EEEFGF+  G L IPC
Sbjct  62   ASNNAHVPKGYLAVCVG--DELKRFVIPTDYLGRPAFQFLLREAEEEFGFQQTGVLRIPC  119

Query  570  EIETFKYLLKCMEIHERD  623
            E+  F+ LLK +E  +RD
Sbjct  120  EVSVFEELLKMVE-EDRD  136



>ref|XP_007011526.1| SAUR family protein [Theobroma cacao]
 gb|EOY29145.1| SAUR family protein [Theobroma cacao]
Length=161

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 74/129 (57%), Gaps = 5/129 (4%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKS--ADCVRQAPA  404
            + RK   IR IVRL   ++KW+++A  +       +   +        S   + VR+A +
Sbjct  2    DSRKSNKIREIVRLQQILKKWRKLANTSKSSSNCNSGSKSIKFLKRTLSLSDNSVREASS  61

Query  405  D-VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIET  581
            + VPKGY+ V VG  E  +RFIIPT YLS   F +LL + EEEFGF+  G L IPCE+  
Sbjct  62   NTVPKGYLAVSVG--EEQKRFIIPTEYLSHHAFHLLLREAEEEFGFQQAGVLRIPCEVSI  119

Query  582  FKYLLKCME  608
            F+ ++K +E
Sbjct  120  FESIVKMVE  128



>ref|XP_004240286.1| PREDICTED: uncharacterized protein LOC101252288 [Solanum lycopersicum]
Length=172

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPK  416
            +KV  I +IVRL   V++WK  +       + ++ ++       + S    R+ P+    
Sbjct  8    KKVHMITKIVRLKQVVKRWKDNSLRTRSVLSYSSSDSDEPAQTNLNSNSNRRRTPS----  63

Query  417  GYMGVYVGRGEVL-RRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            G + VYVG  E   RRF+IPT +L+ P+F  LL+K EEEFG++  GGLI+PCE+E F  +
Sbjct  64   GSLAVYVGVDENERRRFVIPTRFLNLPVFISLLDKAEEEFGYQPTGGLILPCEVELFTVI  123

Query  594  LKCMEIHER  620
            LK +EI+E+
Sbjct  124  LKLLEINEQ  132



>ref|XP_003588611.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES58862.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=179

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 75/142 (53%), Gaps = 10/142 (7%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvr--------rttttvettasvsPAVKSADC  386
            +++K   IR IVRL   ++KW++IA ++             +             +    
Sbjct  4    DQKKSNKIREIVRLQQILKKWRKIANSSKTTANTTTITRSKSMKFLKRTLSLSEREGGTT  63

Query  387  VRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIP  566
                   VPKGY+ V VG  E L+RFIIPT YL    F++LL + EEEFGF+  G L IP
Sbjct  64   SSNNNGSVPKGYLAVCVG--EELKRFIIPTEYLGHQAFQILLREAEEEFGFQQAGVLRIP  121

Query  567  CEIETFKYLLKCMEIHERDQRR  632
            CE+ TF+ +LK +E H +++ +
Sbjct  122  CEVSTFESILKMVEDHGKNKDK  143



>ref|XP_003574590.1| PREDICTED: auxin-induced protein X15-like [Brachypodium distachyon]
 ref|XP_010233801.1| PREDICTED: auxin-induced protein X15-like [Brachypodium distachyon]
 ref|XP_010233802.1| PREDICTED: auxin-induced protein X15-like [Brachypodium distachyon]
Length=129

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 19/116 (16%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   ++KWKR+A                   P   +        ADVP+G+  V
Sbjct  12   IRDIVRLQQLLKKWKRLALA-----------------PKAGNGKHGSGGAADVPRGFFAV  54

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E +RRF+IPT YL    F+ LL + EEEFGF H G L IPC++E F+ +L+
Sbjct  55   CVG--EEMRRFVIPTEYLGHWAFEELLREAEEEFGFRHEGALRIPCDVEVFEGILR  108



>ref|XP_010092524.1| hypothetical protein L484_010412 [Morus notabilis]
 ref|XP_010092527.1| hypothetical protein L484_010415 [Morus notabilis]
 gb|EXB51433.1| hypothetical protein L484_010412 [Morus notabilis]
 gb|EXB51436.1| hypothetical protein L484_010415 [Morus notabilis]
Length=92

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  387  VRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLII  563
            +R++ +DVPKGY+ VYVG    +RRF++P +YL+ P F+ LL + EEEFGF+   GGL I
Sbjct  16   MRRSSSDVPKGYLAVYVGDESKMRRFVVPVSYLNRPSFQELLNQAEEEFGFDRPMGGLTI  75

Query  564  PCEIETFKYLLKCM  605
            PC  +TF  LL C+
Sbjct  76   PCREDTFIDLLSCL  89



>ref|XP_009367954.1| PREDICTED: uncharacterized protein LOC103957507 [Pyrus x bretschneideri]
Length=172

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK---------SAD  383
            + +K   IR IVRL   ++KW++IA ++    T TT  +T+     +K         +  
Sbjct  6    DSKKSNKIRDIVRLQQILKKWRKIANSSKAISTATTTSSTSKSIKFLKRTLSLSEKTTTS  65

Query  384  CVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
            C     A VPKGY+ V VG  E L+RF+IPT YL  P F +LL + EEEFGF+  G L I
Sbjct  66   CEASNNAAVPKGYLAVCVG--EELKRFVIPTDYLGRPAFHILLREAEEEFGFQQTGVLRI  123

Query  564  PCEIETFKYLLKCME  608
            PCE+  F+ +LK +E
Sbjct  124  PCEVSVFEGILKMVE  138



>gb|KHN46698.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=68

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKGY+ VYVG  E +RRF+IP +YL+ PLF+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  2    DVPKGYLAVYVG--EKMRRFVIPVSYLNQPLFQDLLSQAEEDFGYHHPMGGLTIPCSEDV  59

Query  582  FKYLLKCM  605
            F+++  C+
Sbjct  60   FQHITSCL  67



>ref|XP_004136303.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]
 ref|XP_004169513.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]
 gb|KGN60192.1| SAUR family protein [Cucumis sativus]
Length=165

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVR----QAPA  404
            +K   IR IVRL   ++KW+++A ++      T         PA KS   ++     A  
Sbjct  6    KKSNKIRDIVRLQQILKKWRKLANSSKTANKITGTAAG----PAGKSIKFLKRTLSSAGG  61

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            +VPKGY+ V VG  E  +RF+IPT+YL  P F++LL + EEEFGF+  G L +PCE+  F
Sbjct  62   EVPKGYLAVSVG--EEQKRFVIPTSYLGHPAFEILLREAEEEFGFQQTGVLRLPCEVFVF  119

Query  585  KYLLKCME  608
            + ++K +E
Sbjct  120  ENVVKLVE  127



>ref|XP_010655292.1| PREDICTED: uncharacterized protein LOC100244383 [Vitis vinifera]
 emb|CBI18455.3| unnamed protein product [Vitis vinifera]
Length=141

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            +VP+G++ VYVG    LRRF+IPT+YLS P F+ L+E++ +EF F+  GGL IPCE E F
Sbjct  57   EVPRGFLAVYVG--PELRRFVIPTSYLSMPDFRALMERMADEFEFKQEGGLQIPCEEEDF  114

Query  585  KYLL-KCMEIH  614
            + +L KC+  H
Sbjct  115  QEILGKCLTRH  125



>gb|KHN46691.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=68

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKGY+ VYVG  E +RRF+IP +YL+ PLF+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  2    DVPKGYVAVYVG--EKMRRFVIPVSYLNQPLFQDLLSQAEEDFGYHHPMGGLTIPCSEDV  59

Query  582  FKYLLKCM  605
            F+++  C+
Sbjct  60   FQHITSCL  67



>gb|EMT06372.1| hypothetical protein F775_12410 [Aegilops tauschii]
Length=109

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = +3

Query  396  APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG-LIIPCE  572
            APA VP+G   VYVG     RRF++PT+YL +P+F+ LLEK EEEF F + GG L IPC+
Sbjct  5    APAGVPRGCCAVYVGAER--RRFVVPTSYLGNPVFRRLLEKAEEEFEFVYVGGALTIPCD  62

Query  573  IETFKYLLKCMEIHER  620
             E+FKY+L  ME H +
Sbjct  63   TESFKYILAVMERHRK  78



>ref|XP_008361160.1| PREDICTED: uncharacterized protein LOC103424846 [Malus domestica]
 ref|XP_008367703.1| PREDICTED: uncharacterized protein LOC103431331 [Malus domestica]
Length=172

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 72/128 (56%), Gaps = 11/128 (9%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK---------SADCVRQAPA  404
            IR IVRL   ++KW++IA ++      TT  +T+     +K            C     A
Sbjct  13   IRDIVRLQQILKKWRKIANSSKAISAATTTTSTSKSIKFLKRTLSLSEKTXTSCEASNNA  72

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
             VPKGY+ V VG  E L+RF+IPT YL  P F +LL + EEEFGF+  G L IPCE+  F
Sbjct  73   AVPKGYLAVCVG--EELKRFVIPTDYLGGPAFHILLREAEEEFGFQQTGVLRIPCEVSVF  130

Query  585  KYLLKCME  608
            + +LK +E
Sbjct  131  EGILKMVE  138



>ref|XP_006587671.1| PREDICTED: auxin-induced protein 6B-like [Glycine max]
Length=165

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
            A+ +A+ V     DVPKGY+  YV  G+ ++RF+IP +YL+ P F+ LL + EEEFG++H
Sbjct  84   ALFAANQVSSKTVDVPKGYLAAYV--GDKMKRFVIPVSYLNQPSFQELLSQAEEEFGYDH  141

Query  546  -RGGLIIPCEIETFKYLLKCME  608
              GGL IPC  + F+++  C+ 
Sbjct  142  PMGGLTIPCSEDVFQHITSCLN  163



>ref|XP_006406409.1| hypothetical protein EUTSA_v10021791mg [Eutrema salsugineum]
 gb|ESQ47862.1| hypothetical protein EUTSA_v10021791mg [Eutrema salsugineum]
Length=116

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  378  ADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGL  557
            +D  R+A   VP+G++ VYVGR E ++RF+IPT YL  P F+VL+++V +EFG++H GG+
Sbjct  35   SDGGRRASDGVPRGHLAVYVGRDE-MQRFVIPTKYLQYPEFRVLMDEVADEFGYDHEGGI  93

Query  558  IIPCEIETFKYLL  596
             IPCE   F+ +L
Sbjct  94   HIPCEESVFEEIL  106



>gb|KDP33420.1| hypothetical protein JCGZ_06991 [Jatropha curcas]
Length=168

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 12/135 (9%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK--------SADC  386
            + +K   I  IVRL   ++KW+++A ++  +  T T  +  S   ++K        S   
Sbjct  2    DSKKSNKITEIVRLQQILKKWRKLANSSKAKANTNTNTSNGSSK-SIKFLRRTLSLSETS  60

Query  387  VRQAPAD-VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLII  563
             +  P++ VPKGY+ + VG  E L+RFIIPT YL  P F  LL + EEEFGF+  G L I
Sbjct  61   SQSTPSNAVPKGYLAICVG--EELKRFIIPTEYLGHPAFHFLLREAEEEFGFQQTGVLRI  118

Query  564  PCEIETFKYLLKCME  608
            PCE+  F+ +LK +E
Sbjct  119  PCEVAVFESILKLVE  133



>ref|XP_003539974.1| PREDICTED: auxin-induced protein 6B-like [Glycine max]
 gb|KHN46697.1| Auxin-induced protein 6B [Glycine soja]
Length=91

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKGY+ VYVG  E +RRF+IP +YL+ P F+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  25   DVPKGYVAVYVG--EKMRRFVIPVSYLNQPSFQDLLSQAEEDFGYHHPMGGLSIPCSEDV  82

Query  582  FKYLLKCME  608
            F+++  C+ 
Sbjct  83   FQHITSCLN  91



>ref|XP_009396221.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Musa 
acuminata subsp. malaccensis]
Length=145

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 9/126 (7%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADV  410
            + +K   I  IVRL   ++KWK++A        + +++        +K       A  DV
Sbjct  2    DSKKSNKITEIVRLQQILKKWKKLAVTPKSGGGSKSIKF-------LKRTLSFTDASGDV  54

Query  411  PKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKY  590
            PKGY+ V VG  E +RRF+IPT YL    F  LL + EEEFGF+  G L IPCE+  F+ 
Sbjct  55   PKGYLAVCVG--EEMRRFVIPTEYLGHRAFAALLREAEEEFGFQQEGVLRIPCEVAVFES  112

Query  591  LLKCME  608
            +LK +E
Sbjct  113  ILKVVE  118



>ref|XP_010246391.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=101

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            A+VPKG++ VYVG  E  RRF+IP +YL+ P F+ LL + EEEFGF+H  GGL IPC+ +
Sbjct  32   ANVPKGHLAVYVGEAEK-RRFVIPVSYLNHPSFQDLLGQAEEEFGFDHPMGGLTIPCKED  90

Query  579  TFKYLLKCME  608
            TF +LL  M+
Sbjct  91   TFIHLLNGMD  100



>ref|XP_003527361.1| PREDICTED: auxin-induced protein 15A [Glycine max]
 ref|XP_006582281.1| PREDICTED: auxin-induced protein 15A-like [Glycine max]
 ref|XP_006606999.1| PREDICTED: auxin-induced protein 15A-like [Glycine max]
Length=82

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            AD PKGY+ VYVG  E L+RF+IP +YL+ P F+ LL + EEEFG++H  GGL IPC  +
Sbjct  15   ADAPKGYLAVYVG--EKLKRFVIPVSYLNQPSFQDLLSQAEEEFGYDHPMGGLTIPCSED  72

Query  579  TFKYLLKCME  608
             F+ +  C+ 
Sbjct  73   VFQRITSCLN  82



>ref|XP_007132894.1| hypothetical protein PHAVU_011G133900g [Phaseolus vulgaris]
 gb|ESW04888.1| hypothetical protein PHAVU_011G133900g [Phaseolus vulgaris]
Length=92

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
            A+ SA+       D PKGY+ VYV  GE ++RF+IP +YL+ P F+ LL + EEEFG+ H
Sbjct  11   AIFSANLASSKAVDAPKGYLAVYV--GEKMKRFVIPVSYLNQPPFQDLLSEGEEEFGYYH  68

Query  546  R-GGLIIPCEIETFKYLLKCM  605
              GGL IPC  + F+ +  C 
Sbjct  69   SMGGLTIPCNEDVFQRITSCF  89



>ref|NP_001045869.2| Os02g0143400 [Oryza sativa Japonica Group]
 gb|EAZ21715.1| hypothetical protein OsJ_05348 [Oryza sativa Japonica Group]
 dbj|BAF07783.2| Os02g0143400 [Oryza sativa Japonica Group]
Length=130

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 21/116 (18%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   +++WKR A                    A K+        A VPKG+  V
Sbjct  13   IRDIVRLHQLLKRWKRAAL-------------------APKAGKNNNGGGASVPKGFFAV  53

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E +RRF+IPT YL    F+ LL K EEEFGF+H G L IPC++E F+ +L+
Sbjct  54   CVG--EEMRRFVIPTEYLGHWAFEQLLRKAEEEFGFQHEGALRIPCDVEVFEGILR  107



>gb|KHN13740.1| Auxin-induced protein 6B, partial [Glycine soja]
Length=85

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKGY+ VYVG  E +RRF+IP +YL+ P F+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  20   DVPKGYVAVYVG--EKMRRFVIPVSYLNQPSFQDLLSQAEEDFGYHHPMGGLTIPCSDDV  77

Query  582  FKYLLKCM  605
            F+++  C+
Sbjct  78   FQHITSCL  85



>ref|XP_002266875.1| PREDICTED: uncharacterized protein LOC100247885 [Vitis vinifera]
 emb|CBI18451.3| unnamed protein product [Vitis vinifera]
Length=137

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            +VP+G++ VYVG    LRRF+IPT+YLS P F+ L+E++ +EFGFE  GGL IPCE E F
Sbjct  58   EVPRGFLAVYVG--PELRRFVIPTSYLSMPDFRALMERMADEFGFEQEGGLQIPCEEEDF  115

Query  585  KYLL-KCMEIHERDQRR  632
            + +L KC+  H+  + +
Sbjct  116  EEILGKCLTRHKMKKHK  132



>ref|XP_006360678.1| PREDICTED: uncharacterized protein LOC102595713 [Solanum tuberosum]
Length=166

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 79/129 (61%), Gaps = 8/129 (6%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPK  416
            +KV  I +IVRL   V++WK    N+   R+  +  ++ S  PA   ++  R+ P+    
Sbjct  5    KKVHMITKIVRLKQVVKRWK---DNSLRPRSVLSYSSSDSDEPAQTDSNSRRRTPS----  57

Query  417  GYMGVYVGRGEVLRR-FIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYL  593
            G + VYVG  E  RR F+IPT +L+ P+F  LL+K EEEFGF+  GGL++PCE+E F  +
Sbjct  58   GSLAVYVGVDEDERRRFVIPTRFLNLPVFISLLDKAEEEFGFQPTGGLVLPCEVELFSEI  117

Query  594  LKCMEIHER  620
            L  +EI E+
Sbjct  118  LSLLEIDEQ  126



>gb|AFK44459.1| unknown [Lotus japonicus]
Length=166

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPAD-VPKGYMG  428
            IR IVRL   ++KW+R+A ++   R+ ++   T+ +   +  +D      ++ VPKGY+ 
Sbjct  10   IREIVRLQQILKKWRRVANSSKTTRSNSSNHKTSFLKRTLSISDRAEGGSSNLVPKGYLA  69

Query  429  VYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCME  608
            V V  GE L RF+IPT YL    F +LL + EEEFGFE  G L IPC++  F+ +LK +E
Sbjct  70   VCV--GEDLSRFVIPTEYLGHQAFHMLLREAEEEFGFEQTGVLRIPCDVYVFQSILKIVE  127

Query  609  IHER  620
              +R
Sbjct  128  GKDR  131



>ref|XP_010246393.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            A+VPKG++ VYVG  E  RRF+IP +YL+ P F+ LL + EEEFGF+H  GGL IPC+ +
Sbjct  32   ANVPKGHLAVYVGEAEK-RRFVIPVSYLNHPSFQELLGQAEEEFGFDHPMGGLTIPCKED  90

Query  579  TFKYLLKCM  605
            TF +LL  +
Sbjct  91   TFIHLLNAL  99



>gb|KHN29232.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=92

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
             + +A+       D PKGY+ VYVG  E ++RF+IP +YL+ P F+ LL + EEEFG++H
Sbjct  11   GIFAANQASSKTVDAPKGYLAVYVG--EKMKRFVIPVSYLNQPSFQDLLNRAEEEFGYDH  68

Query  546  -RGGLIIPCEIETFKYLLKCME  608
              GGL IPC  + F+++  C+ 
Sbjct  69   PMGGLTIPCSEDVFQHITSCLN  90



>ref|XP_003531444.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
Length=92

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
             + +A+       D PKGY+ VYVG  E ++RF+IP +YL+ P F+ LL + EEEFG++H
Sbjct  11   GIFAANQASSKTVDAPKGYLAVYVG--EKMKRFVIPVSYLNQPSFQDLLSRAEEEFGYDH  68

Query  546  -RGGLIIPCEIETFKYLLKCME  608
              GGL IPC  + F+++  C+ 
Sbjct  69   PMGGLTIPCSEDVFQHITSCLN  90



>ref|XP_011006641.1| PREDICTED: uncharacterized protein LOC105112603 [Populus euphratica]
 ref|XP_011008683.1| PREDICTED: uncharacterized protein LOC105113999 [Populus euphratica]
Length=169

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv----sPAVKSADCVRQA  398
            + +K   IR IVRL   ++KW+++A ++     +TT  + +      + ++        +
Sbjct  2    DSKKSNKIRDIVRLQQILKKWRKLASSSKTSAVSTTTSSKSMKFLKRTLSISDNSAKETS  61

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
               VPKGY+ V  G GE  +RFIIPT YLS P F VLL + EEEFGF+  G L IPCE+ 
Sbjct  62   SNAVPKGYLAV--GVGEEQKRFIIPTDYLSHPAFLVLLREAEEEFGFQQAGVLRIPCEVA  119

Query  579  TFKYLLKCME  608
             F+ +LK +E
Sbjct  120  VFESILKLVE  129



>gb|KHN11779.1| Auxin-induced protein 6B [Glycine soja]
Length=169

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
            A+ +A+ V     DVPKGY+  YV  G+ ++RF+IP +YL+ P F+ LL + EEEFG++H
Sbjct  11   ALFAANQVSSKTVDVPKGYLAAYV--GDKMKRFVIPVSYLNQPSFQELLSQAEEEFGYDH  68

Query  546  -RGGLIIPCEIETFKYLLKCME  608
              GGL IPC  + F+++  C+ 
Sbjct  69   PVGGLTIPCSEDVFQHITSCLN  90



>ref|XP_009400356.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=98

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +3

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
            RQ PADVPKG+  VYV  GE   RFI+P +YL+ P F+ LL + EEEFGF+H  GL IPC
Sbjct  28   RQQPADVPKGHFAVYV--GESRSRFIVPISYLTYPEFQSLLRQAEEEFGFDHDMGLTIPC  85

Query  570  EIETFKYL  593
            E   F+ L
Sbjct  86   EEVVFRSL  93



>dbj|BAD13235.1| auxin-induced protein-like [Oryza sativa Japonica Group]
Length=154

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 21/116 (18%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   +++WKR A                    A K+        A VPKG+  V
Sbjct  13   IRDIVRLHQLLKRWKRAAL-------------------APKAGKNNNGGGASVPKGFFAV  53

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E +RRF+IPT YL    F+ LL K EEEFGF+H G L IPC++E F+ +L+
Sbjct  54   CVG--EEMRRFVIPTEYLGHWAFEQLLRKAEEEFGFQHEGALRIPCDVEVFEGILR  107



>ref|XP_008363801.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=118

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D+PKGY  VYVG  +  +RF+IP +YL+DPLF+ LL + EEEFG++H  GG+ IPC  +T
Sbjct  50   DIPKGYFAVYVGERQK-KRFVIPISYLNDPLFQNLLSQAEEEFGYDHPMGGITIPCSEDT  108

Query  582  FKYLLKCMEI  611
            F +L  C  +
Sbjct  109  FHHLTSCSSV  118



>ref|XP_008781914.1| PREDICTED: auxin-induced protein 6B-like [Phoenix dactylifera]
Length=147

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 7/116 (6%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            I  IVRL   ++KWK++A        +              SA        DVPKGY+ V
Sbjct  9    ITEIVRLQQMLKKWKKLAVAPKSNSKSIKFLKRTLSFSDASSA-----LSGDVPKGYLAV  63

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E ++RF+IPT YLS   F VLL + EEEFGF+  G L IPCE+  F+ +LK
Sbjct  64   CVG--EEMQRFVIPTEYLSRRAFAVLLREAEEEFGFQQEGVLRIPCEVSVFESILK  117



>ref|XP_006450104.1| hypothetical protein CICLE_v10010302mg [Citrus clementina]
 gb|ESR63344.1| hypothetical protein CICLE_v10010302mg [Citrus clementina]
 gb|KDO67187.1| hypothetical protein CISIN_1g048575mg [Citrus sinensis]
Length=172

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 74/133 (56%), Gaps = 9/133 (7%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarn-------nsvrrttttvettasvsPAVKSADCV  389
            E +K   IR IVRL   +RKW+++A +       N+   + +        + ++      
Sbjct  2    ESKKSNKIREIVRLQQILRKWRKLANSPKTSTGGNNNNNSASKSIKFLKRTLSLSDNPLH  61

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
              + + VPKGY+ V VG  E L+RFIIPT YLS   F +LL + EEEFGF+  G L IPC
Sbjct  62   NASTSTVPKGYLAVCVG--EELKRFIIPTDYLSHQAFHILLREAEEEFGFQQTGVLRIPC  119

Query  570  EIETFKYLLKCME  608
            E+  F+ +LK +E
Sbjct  120  EVAVFESILKMVE  132



>ref|XP_009368350.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=99

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D+PKGY  VYVG  +  +RF+IP +YL+DPLF+ LL + EEEFG++H  GG+ IPC  +T
Sbjct  31   DIPKGYFAVYVGERQK-KRFVIPISYLNDPLFQNLLSQAEEEFGYDHPMGGITIPCSEDT  89

Query  582  FKYLLKCMEI  611
            F +L  C  +
Sbjct  90   FLHLTSCSSV  99



>ref|XP_006483628.1| PREDICTED: uncharacterized protein LOC102619609 [Citrus sinensis]
Length=172

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (55%), Gaps = 9/133 (7%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarn-------nsvrrttttvettasvsPAVKSADCV  389
            E +K   IR IVRL   +RKW+++A +       N+   + +        + ++      
Sbjct  2    ESKKSNKIREIVRLQQILRKWRKLANSPKTSTGGNNNNNSASKSIKFLKRTLSLSDNPLH  61

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
              + + VPKGY+ V VG  E L+RFIIPT YLS   F +LL + EEEFGF   G L IPC
Sbjct  62   NASTSTVPKGYLAVCVG--EELKRFIIPTDYLSHQAFHILLREAEEEFGFHQTGVLRIPC  119

Query  570  EIETFKYLLKCME  608
            E+  F+ +LK +E
Sbjct  120  EVAVFESILKMVE  132



>gb|KHN13736.1| Auxin-induced protein 6B [Glycine soja]
Length=69

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKG + VYVG  E +RRF+IP +YL+ P F+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  2    DVPKGNLAVYVG-DEKMRRFVIPVSYLNQPSFQDLLSQAEEDFGYHHPMGGLTIPCSEDV  60

Query  582  FKYLLKCM  605
            F+++  C+
Sbjct  61   FQHITSCL  68



>ref|XP_008378142.1| PREDICTED: uncharacterized protein LOC103441218 [Malus domestica]
Length=173

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 14/138 (10%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVK------------  374
            + +K   IR IVRL   ++KW++IA +++    TT   T  S S ++K            
Sbjct  6    DSKKSNKIRDIVRLRQILKKWRKIANSSNAISGTTAATTATSSSKSIKFLKRTLSLPEKT  65

Query  375  SADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
            +        A VPKGY+ V VG  E L+RF+IPT YL  P F +LL + EEEFGF+  G 
Sbjct  66   TTSFEASNNAAVPKGYLAVCVG--EXLKRFVIPTDYLGRPAFHILLREAEEEFGFQQTGV  123

Query  555  LIIPCEIETFKYLLKCME  608
            L IPCE+  F+ +LK +E
Sbjct  124  LRIPCEVSVFEGILKMVE  141



>gb|ABK22919.1| unknown [Picea sitchensis]
Length=174

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +3

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
            P DVPKG+  VYVG      RFI+PT+YL+ PLF+ LLEK +E +GF    GL IPCE E
Sbjct  89   PMDVPKGHFSVYVGSER--SRFIVPTSYLNHPLFQSLLEKAKEVYGFHQHMGLTIPCEKE  146

Query  579  TFKYLLKCME  608
             F+Y+   +E
Sbjct  147  AFEYITSVLE  156



>ref|XP_010913783.1| PREDICTED: auxin-induced protein 6B-like [Elaeis guineensis]
Length=148

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADV  410
            + +K+  I  IVRL   ++KWK++A        +              SA     +   V
Sbjct  2    DSKKLNKITEIVRLQRMLKKWKKLAVAPKSNSKSIKFLKRTLSFSDTSSA----LSGDHV  57

Query  411  PKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKY  590
            PKGY+ V VG  E ++RF+IPT YLS   F VLL + EEEFGF+  G L IPCE+  F+ 
Sbjct  58   PKGYLAVCVG--EEMQRFVIPTQYLSHRAFAVLLREAEEEFGFQQEGVLRIPCEVSVFES  115

Query  591  LLKCME  608
            +LK +E
Sbjct  116  ILKVVE  121



>ref|XP_010491789.1| PREDICTED: auxin-induced protein 6B-like [Camelina sativa]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 63/122 (52%), Gaps = 23/122 (19%)
 Frame = +3

Query  222  LVGEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAP  401
            + G   K C IR IV+L   +R+W+                     S A  S+   R  P
Sbjct  1    MAGAIGKCCKIRHIVKLRQMLRQWR---------------------SKARMSSSVRRCVP  39

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIET  581
            +DVP G++ VYVG     RRF++  TYL+ P+   LL K EEEFGF ++G L+IPCE   
Sbjct  40   SDVPSGHVAVYVGSS--CRRFVVRATYLNHPILVNLLVKAEEEFGFANQGPLVIPCEESV  97

Query  582  FK  587
            F+
Sbjct  98   FE  99



>emb|CAN62213.1| hypothetical protein VITISV_011168 [Vitis vinifera]
Length=173

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            +VP+G++ VYVG    LRRF+IPT+YLS P F+ L+E++ +EFGFE  GGL IPCE E F
Sbjct  58   EVPRGFLAVYVG--PELRRFVIPTSYLSMPDFRALMERMADEFGFEQEGGLQIPCEEEDF  115

Query  585  KYLL-KCMEIH  614
            + +L KC+  H
Sbjct  116  EEILGKCLTRH  126



>ref|XP_010246394.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            A+VPKG++ VYVG  E  RRF+IP +YL+ P F+ LL + EEEFGF+H  GGL IPC+ +
Sbjct  32   ANVPKGHLAVYVGEAEK-RRFVIPVSYLNHPSFQELLGQAEEEFGFDHPMGGLTIPCKED  90

Query  579  TFKYLLKCM  605
            TF +LL  +
Sbjct  91   TFIHLLNGL  99



>ref|XP_009368374.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            ADVPKGY  VYVG  E  +RF++P ++L+ P F+ LL   EEEFGF+H  GGL IPC  +
Sbjct  31   ADVPKGYFPVYVGESEK-QRFVVPISFLNQPAFQDLLSAAEEEFGFDHPMGGLTIPCRQD  89

Query  579  TFKYLLKCME  608
            TF  L+ C++
Sbjct  90   TFLDLISCLK  99



>ref|XP_010246396.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            A+VPKG++ VYVG  E  RRF+IP +YL+ P F+ LL + EEEFGF+H  GGL IPC+ +
Sbjct  32   ANVPKGHLAVYVGEAEK-RRFVIPVSYLNHPSFQELLRQAEEEFGFDHPMGGLTIPCKED  90

Query  579  TFKYLLKCM  605
            TF +LL  +
Sbjct  91   TFIHLLNGL  99



>gb|EAY84447.1| hypothetical protein OsI_05820 [Oryza sativa Indica Group]
Length=130

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 61/116 (53%), Gaps = 21/116 (18%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   +++WKR A                    A K         A VPKG+  V
Sbjct  13   IRDIVRLHQLLKRWKRAAL-------------------APKPGKNNNGGGASVPKGFFAV  53

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E +RRF+IPT YL    F+ LL K EEEFGF+H G L IPC++E F+ +L+
Sbjct  54   CVG--EEMRRFVIPTEYLGHWAFEQLLRKAEEEFGFQHEGALRIPCDVEVFEGILR  107



>ref|XP_009402006.1| PREDICTED: auxin-induced protein X10A-like [Musa acuminata subsp. 
malaccensis]
Length=128

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = +3

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFK  587
            VPKG M VYVG G  +RRF+IPT+YL  P F+ L+EKVEEEFGF+  GGL IPCE E F+
Sbjct  42   VPKGCMAVYVGDG--MRRFVIPTSYLRLPAFRQLMEKVEEEFGFDQAGGLRIPCEEEDFQ  99

Query  588  YLLKCM  605
             LL  +
Sbjct  100  ELLDAL  105



>ref|XP_010544871.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=123

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +3

Query  363  PAVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
            P +KS+   +QA  DVPKG + + VG+GE  +R I+P  Y + PLF  LL++ EEE+GFE
Sbjct  16   PHLKSSS--KQAIKDVPKGCLAIKVGQGEEQQRIIVPVVYFNHPLFMQLLKEAEEEYGFE  73

Query  543  HRGGLIIPCEIETFKYL  593
             +G + IPC +E F+Y+
Sbjct  74   QKGTITIPCHVEEFRYV  90



>ref|XP_010251734.1| PREDICTED: auxin-induced protein X15-like [Nelumbo nucifera]
Length=115

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +3

Query  363  PAVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
            P +      ++   D+PKGY+ + VG+GE  +RF+IP  Y + PLF  LL++ E+E+GF+
Sbjct  16   PHLNHGGTGKKEMRDIPKGYLAIMVGQGEEQQRFVIPIFYFNHPLFMQLLKEAEDEYGFD  75

Query  543  HRGGLIIPCEIETFKYL  593
             +G + IPC +E F+Y+
Sbjct  76   QKGTITIPCHVEEFRYV  92



>sp|P33081.1|AX15A_SOYBN RecName: Full=Auxin-induced protein 15A [Glycine max]
 gb|AAB23279.1| orf 15A [Glycine max]
 gb|KHN26923.1| Auxin-induced protein 15A [Glycine soja]
 gb|KHN33969.1| Auxin-induced protein 15A [Glycine soja]
Length=82

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 5/76 (7%)
 Frame = +3

Query  387  VRQAP--ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGL  557
            +R+A   AD PKGY+ VYVG  E L+RF+IP +YL+ P F+ LL + EEEFG++H  GGL
Sbjct  8    IRKASKAADAPKGYLAVYVG--EKLKRFVIPVSYLNQPSFQDLLSQAEEEFGYDHPMGGL  65

Query  558  IIPCEIETFKYLLKCM  605
             IPC  + F+ +  C+
Sbjct  66   TIPCSEDVFQCITSCL  81



>ref|XP_006836558.1| hypothetical protein AMTR_s00131p00053580 [Amborella trichopoda]
 gb|ERM99411.1| hypothetical protein AMTR_s00131p00053580 [Amborella trichopoda]
Length=122

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +3

Query  375  SADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGG  554
             +D  ++ P DV KG++ VYV  G+ LRR++IP +YL+  +F  LL+K EEEFGF + GG
Sbjct  45   GSDDAKEFPTDVHKGFIAVYV--GQELRRYVIPVSYLNHSVFMALLQKAEEEFGFTNNGG  102

Query  555  LIIPCEIETFKYLLKCME  608
            + +PCE+  F+++L  ++
Sbjct  103  IKLPCEVAVFEHILWLLK  120



>ref|XP_006339758.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=109

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +3

Query  390  RQAPADVPKGYMGVYVGRG-EVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIP  566
            +Q   DVPKGY+ + VG+  EV +RFI+P +Y + PLF  LL++ EE +GF H+G + IP
Sbjct  23   KQGKRDVPKGYLAIKVGQAEEVQQRFIVPVSYFNHPLFIQLLKQAEEVYGFHHKGTITIP  82

Query  567  CEIETFKYLLKCMEIHERD  623
            C +E F+ +   ++ H  +
Sbjct  83   CHVEQFRCVQGKIDKHHHN  101



>ref|XP_010244080.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=101

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            A+VPKG++ VYVG  E  RRF+IP +YL+   F+ LL + EEEFGF+H  GGL IPC+ +
Sbjct  32   ANVPKGHLAVYVGEAEK-RRFVIPVSYLNHSSFQELLGQAEEEFGFDHPMGGLTIPCKED  90

Query  579  TFKYLLKCME  608
            TF +LL  M+
Sbjct  91   TFIHLLNGMD  100



>gb|KHN13734.1| Auxin-induced protein 6B [Glycine soja]
Length=91

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKGY+ VYVG  E +RRF+IP +YL+ P F+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  25   DVPKGYVAVYVG--EKMRRFVIPVSYLNQPSFQDLLSQAEEDFGYHHPMGGLTIPCCEDV  82

Query  582  FKYLLKCM  605
            F+++  C+
Sbjct  83   FQHITSCL  90



>ref|XP_010246395.1| PREDICTED: auxin-induced protein X15-like [Nelumbo nucifera]
Length=101

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +3

Query  375  SADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RG  551
            +A+    A  DVPKG++ VY+G     +RF++P +YL+ P F+ LL + EEEFGF+H  G
Sbjct  21   TANQSTSAATDVPKGHLAVYIGETTQKKRFVVPISYLNHPSFQSLLTRAEEEFGFDHPMG  80

Query  552  GLIIPCEIETFKYLLKCME  608
             L IPC+ E F  L  C+ 
Sbjct  81   ALTIPCQEEAFIRLTSCLN  99



>ref|XP_006382198.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ERP59995.1| auxin-responsive family protein [Populus trichocarpa]
Length=169

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasv----sPAVKSADCVRQA  398
            + +K   IR IVRL   ++KW+++A ++     +TT  + +      + ++        +
Sbjct  2    DSKKSNKIRDIVRLQQILKKWRKLASSSRTTAASTTTSSKSMKFLKRTLSIPENSAKETS  61

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
               VPKGY+ V  G GE  +RFIIPT YLS P F +LL + EEEFGF+  G L IPCE+ 
Sbjct  62   SNAVPKGYLAV--GVGEEQKRFIIPTEYLSHPAFLILLREAEEEFGFQQAGVLRIPCEVA  119

Query  579  TFKYLLKCME  608
             F+ +LK +E
Sbjct  120  VFESILKLVE  129



>dbj|BAK06469.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=127

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 65/124 (52%), Gaps = 27/124 (22%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   +++WKR+                     AV       ++   VPKG   V
Sbjct  12   IRDIVRLQQLLKRWKRM---------------------AVAPG----KSDGGVPKGSFAV  46

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEI  611
            YVG  E +RRF+IPT YL    F+ LL + EEEFGF H G L IPC++E F+ +L+ +  
Sbjct  47   YVG--EEMRRFVIPTEYLGHWAFEELLREAEEEFGFRHEGALRIPCDVEAFEGILRLVAA  104

Query  612  HERD  623
             ++D
Sbjct  105  GKKD  108



>emb|CDX72302.1| BnaC07g43240D [Brassica napus]
Length=209

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 72/145 (50%), Gaps = 15/145 (10%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAP---  401
            E +K   IR IV+L   ++KW+++A+ +     +         +   K+           
Sbjct  28   EAKKSNKIRDIVKLQQILKKWRKVAQASKQANNSKINNEEDINNNLTKTGSGSASKSIKF  87

Query  402  ----------ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
                        VPKGY+ V VG+ E  +R+ IPT YLS   F  LL + EEEFGF+  G
Sbjct  88   LKRTLSFTDVTAVPKGYLAVSVGKEE--KRYKIPTDYLSHQAFHALLREAEEEFGFQQAG  145

Query  552  GLIIPCEIETFKYLLKCMEIHERDQ  626
             L IPCE+  F+ +LK ME ++ D+
Sbjct  146  VLKIPCEVAVFESILKIMEDNKSDE  170



>gb|KHN25449.1| Auxin-induced protein 6B [Glycine soja]
Length=92

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
            A+ +A+       D PKGY+ VYV  GE ++RF+IP  YL+ P F+ LL   EEEFG+EH
Sbjct  11   ALFAANQASSKAVDAPKGYLAVYV--GEKMKRFVIPVLYLNQPSFQDLLSHAEEEFGYEH  68

Query  546  -RGGLIIPCEIETFKYLLKCME  608
              GGL IPC  + F+ +  C+ 
Sbjct  69   PMGGLTIPCSEDVFQRITSCLN  90



>ref|XP_001752517.1| predicted protein [Physcomitrella patens]
 gb|EDQ82756.1| predicted protein [Physcomitrella patens]
Length=71

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +3

Query  396  APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEI  575
            AP DVP+GY+ VYVG G   RRF+I   YLS  +FK LL K  EEFG+EH+ GL I CE+
Sbjct  5    APDDVPEGYLVVYVGEGR--RRFVIKAKYLSHTVFKALLNKSAEEFGYEHKRGLEIACEV  62

Query  576  ETFKYLL  596
            + F++LL
Sbjct  63   DFFEHLL  69



>ref|XP_009138004.1| PREDICTED: uncharacterized protein LOC103862042 [Brassica rapa]
Length=209

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 71/145 (49%), Gaps = 15/145 (10%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAP---  401
            E +K   IR IV+L   ++KW+++A+ +               +   K+           
Sbjct  28   EAKKSNKIRDIVKLQQILKKWRKVAQASKQANNNKINNEEDINNNLTKTGSGSASKSIKF  87

Query  402  ----------ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
                        VPKGY+ V VG+ E  +R+ IPT YLS   F  LL + EEEFGF+  G
Sbjct  88   LKRTLSFTDVTAVPKGYLAVSVGKEE--KRYKIPTDYLSHQAFHALLREAEEEFGFQQAG  145

Query  552  GLIIPCEIETFKYLLKCMEIHERDQ  626
             L IPCE+  F+ +LK ME ++ D+
Sbjct  146  VLKIPCEVAVFESILKIMEDNKSDE  170



>ref|XP_004966106.1| PREDICTED: auxin-induced protein 6B-like [Setaria italica]
Length=143

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 18/124 (15%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   ++KWK++A                   P+   +       + VP+G   V
Sbjct  19   IRDIVRLQQLLKKWKKLATVT----------------PSASGSGGKGGGRSSVPRGSFAV  62

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEI  611
            YVG  E +RRF+IPT YL    F  LL + EEEFGF+H G L IPC++E F+ +L+ ++ 
Sbjct  63   YVG--EEMRRFVIPTEYLGHWAFAELLREAEEEFGFQHEGALRIPCDVEVFEGILRLVQG  120

Query  612  HERD  623
             ++D
Sbjct  121  RKKD  124



>gb|KHN08189.1| Auxin-induced protein 6B [Glycine soja]
Length=91

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D+PKG + VYVG  E +RRF+IP +YL+ P F+ LL + EE+FG+ H  GGL IPC  + 
Sbjct  25   DLPKGNLAVYVG--EKMRRFVIPVSYLNQPSFQDLLSQAEEDFGYHHPMGGLTIPCSEDV  82

Query  582  FKYLLKCME  608
            F+++  C+ 
Sbjct  83   FRHITSCLN  91



>ref|XP_010664793.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI19838.3| unnamed protein product [Vitis vinifera]
Length=104

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +3

Query  396  APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCE  572
            A ADVPKGY  VYVG  +  +RF++P +YL+ P F+ LL + EEEFGF+H  GGL IPC+
Sbjct  30   ATADVPKGYFAVYVGENQK-QRFVVPISYLNHPSFQDLLSQAEEEFGFDHPMGGLTIPCK  88

Query  573  IETFKYLLKCMEIHE  617
            I  F  L   ++++ 
Sbjct  89   IANFIELTSRLQVNN  103



>emb|CDX68733.1| BnaC01g07200D [Brassica napus]
Length=188

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 69/144 (48%), Gaps = 13/144 (9%)
 Frame = +3

Query  225  VGEKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVR----  392
              E +K   IR IV+L   ++KW++ A  +         E   +      S    +    
Sbjct  7    ASEAKKSNKIREIVKLQQILKKWRKAAHASKQASNKIDDEENNNKLNRTGSGSASKGIKF  66

Query  393  -------QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRG  551
                        VPKGY+ V VG+ E  +R+ IPT YLS   F  LL + EEEFGF+  G
Sbjct  67   LKRTLSFTDVTAVPKGYLAVSVGKEE--KRYKIPTDYLSHQAFHALLREAEEEFGFQQAG  124

Query  552  GLIIPCEIETFKYLLKCMEIHERD  623
             L IPCE+  F+ +LK ME ++ D
Sbjct  125  VLKIPCEVAVFESILKIMEDNKAD  148



>ref|XP_010034089.1| PREDICTED: uncharacterized protein LOC104423276 [Eucalyptus grandis]
 gb|KCW53982.1| hypothetical protein EUGRSUZ_J03183 [Eucalyptus grandis]
Length=178

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 72/142 (51%), Gaps = 18/142 (13%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKS-----------  377
            + +K   I  IVRL   ++KWK+IA        +    T  S S    +           
Sbjct  2    DSKKSNKISDIVRLQQILKKWKKIANAPKNTNRSGNSSTGNSNSTTTSTGNGSKSIKFLK  61

Query  378  -----ADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
                 +D    +   VPKG++ V VG+   L+RF+IPT +L  P F +LL++ EEEFGF+
Sbjct  62   RTLSFSDVTASSSDAVPKGFLAVSVGK--ELKRFVIPTEHLRHPAFGILLQEAEEEFGFQ  119

Query  543  HRGGLIIPCEIETFKYLLKCME  608
              G L IPCE+  F+ +LK +E
Sbjct  120  QEGVLKIPCEVRVFEMILKAVE  141



>ref|XP_003607123.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES89320.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=92

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            A+VPKGY+ VYV  GE  +RF++P +YL+ PLF+ LL + EEEFG++H  GGL IPC  +
Sbjct  23   AEVPKGYVAVYV--GEKQKRFVVPISYLNQPLFQELLHQAEEEFGYDHPMGGLTIPCSED  80

Query  579  TFKYLLKCME  608
             F+++  C+ 
Sbjct  81   VFQHITSCLN  90



>gb|EMT02079.1| hypothetical protein F775_07059 [Aegilops tauschii]
Length=125

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 60/116 (52%), Gaps = 22/116 (19%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR IVRL   +RKWKR+A                        A       A VP+G+  V
Sbjct  11   IRDIVRLQQLLRKWKRLAL--------------------APKAGSRHGGGAGVPRGFFAV  50

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E +RRF+IPT YL    F+ LL + EEEFGF H G L IPC++E F+ +L+
Sbjct  51   CVG--EEMRRFVIPTEYLGHWAFEELLREAEEEFGFRHEGALRIPCDVEVFEGILR  104



>ref|XP_003527610.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max]
 gb|KHN20020.1| Auxin-induced protein 10A5 [Glycine soja]
Length=100

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  378  ADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGG  554
            A+       DVPKG+  VYVG GE  +RF+IP +YL+ P F+ LL   EEEFGF H  GG
Sbjct  22   ANHAATTSLDVPKGHFAVYVGEGEK-KRFVIPVSYLNQPSFQELLSIAEEEFGFSHPMGG  80

Query  555  LIIPCEIETF  584
            LIIPC  E F
Sbjct  81   LIIPCTEEIF  90



>ref|XP_003602327.1| Auxin-induced protein 10A5 [Medicago truncatula]
Length=135

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
             +   D+PKG + V VG+GE  ++F+IP  Y++ PLF  LL++ EEE+GF+H+G +IIPC
Sbjct  48   HEKNKDIPKGCLAVMVGQGEEQQKFVIPVIYINHPLFMQLLKEAEEEYGFDHKGPIIIPC  107

Query  570  EIETFK  587
            ++E F+
Sbjct  108  QVEEFR  113



>ref|XP_004235010.1| PREDICTED: auxin-induced protein X15-like [Solanum lycopersicum]
Length=114

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  363  PAVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfe  542
            P +   +  ++   ++PKG + V VG+GE  +RF+IP  Y++ PLF  LL++ E+EFGF+
Sbjct  16   PHINFHNHGKKELKNIPKGCLAVIVGQGEEQQRFVIPVNYINHPLFLQLLKEAEKEFGFD  75

Query  543  HRGGLIIPCEIETFKYL  593
            H+G + IPC +E F+Y+
Sbjct  76   HKGPINIPCHVEQFRYV  92



>sp|P32295.1|ARG7_VIGRR RecName: Full=Indole-3-acetic acid-induced protein ARG7 [Vigna 
radiata var. radiata]
 dbj|BAA03310.1| hypothetical protein [Vigna radiata var. radiata]
Length=92

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D PKGY+ VYV  GE ++RF+IP ++L+ PLF+ LL + EEEFG++H  GGL IPC  + 
Sbjct  24   DAPKGYLAVYV--GENMKRFVIPVSHLNQPLFQDLLSQAEEEFGYDHPMGGLTIPCSEDL  81

Query  582  FKYLLKCM  605
            F+++  C+
Sbjct  82   FQHITSCL  89



>gb|AFK37533.1| unknown [Medicago truncatula]
 gb|AES72578.2| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=114

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
             +   D+PKG + V VG+GE  ++F+IP  Y++ PLF  LL++ EEE+GF+H+G +IIPC
Sbjct  27   HEKNKDIPKGCLAVMVGQGEEQQKFVIPVIYINHPLFMQLLKEAEEEYGFDHKGPIIIPC  86

Query  570  EIETFK  587
            ++E F+
Sbjct  87   QVEEFR  92



>ref|XP_008237032.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Prunus 
mume]
Length=100

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D+P+GY  VYVG  +  +RF+IP +YL++PLF  LL + EEEFG++H  GG+ IPC  +T
Sbjct  32   DIPRGYFAVYVGESQK-KRFVIPVSYLNEPLFLDLLSQAEEEFGYDHPMGGITIPCSEDT  90

Query  582  FKYLLKCMEI  611
            F +L  C+ +
Sbjct  91   FLHLTSCLSV  100



>gb|KCW55445.1| hypothetical protein EUGRSUZ_I01347 [Eucalyptus grandis]
Length=98

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  387  VRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLII  563
            V  AP DVPKGY  VYVG  +  +RFI+P +YLS P F+ LL + EEEFGF+H  GGL I
Sbjct  27   VDSAPLDVPKGYFPVYVGENQK-KRFIVPLSYLSRPSFQDLLSQAEEEFGFDHPMGGLTI  85

Query  564  PCEIETFKYLLK  599
            PC  E F  L+ 
Sbjct  86   PCNEEVFLNLID  97



>ref|XP_002446101.1| hypothetical protein SORBIDRAFT_06g001800 [Sorghum bicolor]
 gb|EES10429.1| hypothetical protein SORBIDRAFT_06g001800 [Sorghum bicolor]
Length=136

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFK  587
            VPKGY  VYVG     RRF++PT+YLS+P F+ L+E+  EEFGF   GGL IPC  E F+
Sbjct  48   VPKGYFAVYVG--AESRRFVVPTSYLSEPAFRELMERAAEEFGFNQAGGLRIPCREEDFQ  105

Query  588  YLLKCMEIHER  620
              +  +E   R
Sbjct  106  ATVAALEQSRR  116



>ref|XP_003522807.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max]
 gb|KHN33703.1| Auxin-induced protein 10A5 [Glycine soja]
Length=106

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  378  ADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGG  554
            A+       DVPKG+  VYVG GE  RR++IP +YL+ P F+ LL   EEEFGF H  GG
Sbjct  22   ANHAATTSLDVPKGHFAVYVGEGEK-RRYVIPVSYLNQPSFQELLSIAEEEFGFSHPMGG  80

Query  555  LIIPCEIETF  584
            LIIPC  E F
Sbjct  81   LIIPCTEENF  90



>ref|XP_009391130.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=99

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +3

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
            +Q P DVPKG+  VYV  GE   RFI+P +YL+ P F+ LL + EEEFGF+H  GL IPC
Sbjct  29   KQQPVDVPKGHFAVYV--GESRSRFIVPISYLTHPEFQSLLRQAEEEFGFDHDMGLTIPC  86

Query  570  EIETFKYL  593
            E   F+ L
Sbjct  87   EEVVFRSL  94



>ref|XP_007023649.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOY26271.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=173

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 75/132 (57%), Gaps = 11/132 (8%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPA-------VKSADCVRQAPAD-  407
            IR IVRL   ++KWK++A        +++ + T S S           S   V  A AD 
Sbjct  9    IREIVRLQQILKKWKKLANAPKNISGSSSSQLTTSGSSKSIRFLKRTLSFTDVSAASADA  68

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFK  587
            VPKG++ V VG+   L+RF+IPT YL    F VLL K EEEFGF+  G L IPCE+ TF+
Sbjct  69   VPKGFLAVCVGKE--LKRFVIPTEYLGHQAFGVLLRKAEEEFGFQQEGVLKIPCEVSTFE  126

Query  588  YLLKCMEIHERD  623
             +L+ M  H +D
Sbjct  127  KILE-MVQHRKD  137



>ref|XP_009347320.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=98

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            ADVPKGY+ VYVG  E  +RF+IP +YL+ P F+ LL + E+EFGF+H  GGL IPC  +
Sbjct  31   ADVPKGYLAVYVGENE-RKRFVIPISYLNQPSFQDLLSEAEQEFGFDHPMGGLTIPCRQD  89

Query  579  TF  584
            TF
Sbjct  90   TF  91



>ref|XP_007135905.1| hypothetical protein PHAVU_009G001700g [Phaseolus vulgaris]
 gb|ESW07899.1| hypothetical protein PHAVU_009G001700g [Phaseolus vulgaris]
Length=98

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKG+  VYVG GE  +RF+IP +YL+ P F+ LL   EEEFGF H  GGLIIPC  E 
Sbjct  31   DVPKGHFAVYVGEGEK-KRFVIPVSYLNQPSFQELLSIAEEEFGFSHPMGGLIIPCSQEF  89

Query  582  F  584
            F
Sbjct  90   F  90



>gb|EMS54722.1| hypothetical protein TRIUR3_21602 [Triticum urartu]
Length=120

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  453  LRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCMEIHER  620
            +RRF+IPT YL  P+F++LLEK EEEFGF H G L IPC+ E FKY+L+C+E H++
Sbjct  37   VRRFVIPTGYLGHPVFRLLLEKAEEEFGFRHEGALAIPCDTEAFKYILQCVERHDK  92



>ref|XP_009361302.1| PREDICTED: auxin-induced protein 15A [Pyrus x bretschneideri]
Length=130

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            D+PKG M V VG+GE  +RF+IP  Y++ PLF  LLE+ E+E+GF+H+G + IPC +E F
Sbjct  42   DIPKGCMAVMVGQGEDQQRFVIPVIYINHPLFMQLLEEAEKEYGFDHKGPITIPCHVEEF  101

Query  585  K  587
            +
Sbjct  102  R  102



>gb|EPS67974.1| hypothetical protein M569_06800, partial [Genlisea aurea]
Length=100

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +3

Query  387  VRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIP  566
            V   P DVPKG+  +YVG GE  RR I+P ++LS P F+ LL++ EEEFGF+H  GL IP
Sbjct  29   VEAVPVDVPKGHFAMYVGVGERRRRCIVPISFLSHPEFQYLLKRAEEEFGFDHDMGLTIP  88

Query  567  CEIETFKYLL  596
            C  E F YL 
Sbjct  89   C--EDFHYLF  96



>ref|XP_010100683.1| hypothetical protein L484_023452 [Morus notabilis]
 gb|EXB83845.1| hypothetical protein L484_023452 [Morus notabilis]
Length=128

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  390  RQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPC  569
            +Q   D+PKG + V VG+GE  +RF++P  Y + PLF  LL++ EEE+GF+ +G +IIPC
Sbjct  37   KQMIRDIPKGCLAVKVGQGEEQQRFVVPVMYFNHPLFMQLLKEAEEEYGFDQKGTIIIPC  96

Query  570  EIETFKYL  593
             +E F+Y+
Sbjct  97   HVEEFRYV  104



>ref|XP_002883237.1| hypothetical protein ARALYDRAFT_479541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59496.1| hypothetical protein ARALYDRAFT_479541 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            DVP+G++ VYVGR E  +RF+IPT YL  P F+ L+++V +EFG++H GG+ IPCE   F
Sbjct  46   DVPRGHLAVYVGREE-RQRFVIPTKYLQYPEFRTLMDEVADEFGYDHEGGIHIPCEESVF  104

Query  585  KYLL  596
            + +L
Sbjct  105  EEIL  108



>ref|XP_007200657.1| hypothetical protein PRUPE_ppa016788mg [Prunus persica]
 gb|EMJ01856.1| hypothetical protein PRUPE_ppa016788mg [Prunus persica]
Length=93

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 5/79 (6%)
 Frame = +3

Query  390  RQAPA---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGL  557
             Q P+   DVPKGY  VYVG  +  +RF+IP + L+ P F+ LL + E+EFG++H  GG+
Sbjct  14   NQVPSKGLDVPKGYFAVYVGESQK-KRFVIPVSILNQPSFQNLLSQAEDEFGYDHPMGGI  72

Query  558  IIPCEIETFKYLLKCMEIH  614
             IPC  ETF +L+ C + +
Sbjct  73   TIPCSEETFLHLISCFDAN  91



>ref|XP_008376800.1| PREDICTED: auxin-induced protein 15A [Malus domestica]
Length=134

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            D+PKG M V VG+GE  +RF+IP  Y++ PLF  LLE+ E+E+GF+H+G + IPC +E F
Sbjct  42   DIPKGCMAVMVGQGENQQRFVIPVIYINHPLFMQLLEEAEKEYGFDHKGPITIPCHVEEF  101

Query  585  K  587
            +
Sbjct  102  R  102



>emb|CDY13423.1| BnaA03g51410D [Brassica napus]
Length=178

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 11/137 (8%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPA--  404
            E +K   IR IV+L   ++KW++I     +    T   + +    A KS   +++  +  
Sbjct  9    EAKKSNKIRDIVKLQQILKKWRKINNEEDINNNLTKTGSGS----ASKSIKFLKRTLSFT  64

Query  405  ---DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEI  575
                VPKGY+ V VG+ E  +R+ IPT YLS   F  LL + EEEFGF+  G L IPCE+
Sbjct  65   DVTAVPKGYLAVSVGKEE--KRYKIPTDYLSHQAFHALLREAEEEFGFQQAGVLKIPCEV  122

Query  576  ETFKYLLKCMEIHERDQ  626
              F+ +LK ME ++ D+
Sbjct  123  AVFESILKIMEDNKSDE  139



>ref|XP_008783079.1| PREDICTED: auxin-induced protein 6B-like [Phoenix dactylifera]
Length=148

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 62/119 (52%), Gaps = 6/119 (5%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            I  IVRL   ++KWK++A        +              S         DVPKGY+ V
Sbjct  9    ITEIVRLQQMLKKWKKLAVAPKSNSKSIKFLKRTLSF----SDTSYSALSGDVPKGYLAV  64

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCME  608
             VG  E ++RF+IPT YL    F VLL + EEEFGF+  G L IPCE+  F+ +LK +E
Sbjct  65   CVG--EEMQRFVIPTEYLGHRAFAVLLREAEEEFGFQQEGVLRIPCEVSAFESILKVVE  121



>ref|XP_010683705.1| PREDICTED: auxin-induced protein 15A [Beta vulgaris subsp. vulgaris]
Length=122

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +3

Query  396  APADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEI  575
             P  +P G+  VYVG  E   RF++PT++LS PLFK+LLEK  +EFGFE + GLI+PC +
Sbjct  49   TPTKIPTGFFAVYVG--EERERFVVPTSFLSHPLFKILLEKTYDEFGFEQKNGLIVPCSV  106

Query  576  ETFKYLLKCMEIHER  620
             TF+ ++  +E + +
Sbjct  107  STFQEVVNAVESNHK  121



>ref|XP_002265932.1| PREDICTED: auxin-induced protein 6B-like [Vitis vinifera]
Length=163

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 11/127 (9%)
 Frame = +3

Query  237  RKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPK  416
            + V  IR+IVRL   +++WK ++ +   R   +          +   +DC   +    P 
Sbjct  6    KSVEKIRQIVRLKQVMQRWKTMSVSLRPRSIRSF---------SDSDSDCTSGSIRRTPS  56

Query  417  GYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLL  596
            G++ VYVG     RRF+IPT  L+ P+F  LL K EEEFG    GGL++PCE+  FK +L
Sbjct  57   GFLAVYVGADR--RRFVIPTRLLNLPIFVALLNKAEEEFGLRSSGGLVLPCEVGFFKEVL  114

Query  597  KCMEIHE  617
            + +E  E
Sbjct  115  RFLEKDE  121



>ref|XP_010927192.1| PREDICTED: auxin-induced protein 6B-like [Elaeis guineensis]
Length=147

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 7/116 (6%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            I  IVRL   ++KWK++A         +      +VS +  SA       +D+PKG+  V
Sbjct  10   ITEIVRLQQVLKKWKKLAVAPKKSGKKSINFLKRTVSFSDTSA-----PSSDIPKGFFAV  64

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLK  599
             VG  E ++RF+IPT YLS   F +LL++ EEEFGF+  G L IPCE+  F+ +LK
Sbjct  65   CVG--EEMKRFVIPTEYLSHQAFGLLLKEAEEEFGFQQEGVLRIPCEVSVFESILK  118



>gb|AES89354.2| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=93

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
             DVPKGY+ VYV  GE  +RF+IP +YL+ PLF+ LL +VEEE G++H  GGL IPC  +
Sbjct  24   VDVPKGYLAVYV--GEKQKRFVIPISYLNQPLFQDLLIQVEEEHGYDHPMGGLTIPCGED  81

Query  579  TFKYLLKCME  608
             F+++  C+ 
Sbjct  82   VFQHITSCLN  91



>ref|XP_009368355.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=134

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +3

Query  402  ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIE  578
            ADVPKGY+ VYVG  E  +RF+IP +YL+ P F+ LL   E+EFGF+H  GGL IPC  +
Sbjct  67   ADVPKGYLAVYVGENE-RQRFVIPVSYLNQPSFQDLLSVAEQEFGFDHPMGGLTIPCRQD  125

Query  579  TF  584
            TF
Sbjct  126  TF  127



>ref|XP_002513309.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF48712.1| calmodulin binding protein, putative [Ricinus communis]
Length=129

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
             VPKGY+GVYVG  E  RRF+IPT+YLS P  ++L+++  EEFG+   GGL +PCE   F
Sbjct  49   QVPKGYIGVYVG--EEKRRFVIPTSYLSMPEIRILMDRAGEEFGYSQEGGLHLPCEHHQF  106

Query  585  KYLL-KCMEI  611
            + +L +C ++
Sbjct  107  EEILFRCFKL  116



>ref|XP_007201443.1| hypothetical protein PRUPE_ppa013837mg [Prunus persica]
 gb|EMJ02642.1| hypothetical protein PRUPE_ppa013837mg [Prunus persica]
Length=100

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D+PKGY  VYVG+ +  +RF+IP +YL++ LF  LL + EEEFG++H  GG+ IPC  +T
Sbjct  32   DIPKGYFAVYVGKSQK-KRFVIPVSYLNETLFLDLLSQAEEEFGYDHPMGGITIPCSEDT  90

Query  582  FKYLLKCMEI  611
            F +L  C+ +
Sbjct  91   FLHLTSCLSV  100



>ref|XP_010246392.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 2/68 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            +VPKG++ VYVG  E  RRF+IP +YL+ P F+ LL +VEEEFGF+H  GGL IPC+ +T
Sbjct  33   NVPKGHLAVYVGEAEK-RRFVIPVSYLNHPSFQELLGQVEEEFGFDHPMGGLTIPCKEDT  91

Query  582  FKYLLKCM  605
            F +LL  +
Sbjct  92   FIHLLNGL  99



>gb|KHN26920.1| Auxin-induced protein 15A [Glycine soja]
Length=82

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +3

Query  387  VRQAP--ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGL  557
            +R+A   AD PKGY+  YVG  E L+RF+IP +YL+ P F+ LL + EEEFG++H  GGL
Sbjct  8    IRKASKAADAPKGYLAFYVG--EKLKRFVIPVSYLNQPSFQDLLSQAEEEFGYDHPMGGL  65

Query  558  IIPCEIETFKYLLKCM  605
             IPC  + F+ +  C+
Sbjct  66   TIPCSEDVFQRITSCL  81



>ref|XP_008659173.1| PREDICTED: uncharacterized protein LOC103637951 [Zea mays]
 gb|AFW85468.1| hypothetical protein ZEAMMB73_180738 [Zea mays]
Length=236

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +3

Query  393  QAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLI-IPC  569
             APADVP+G   VYVG     RRF++PT YL  P+F+ LLEK EEEF F++ GG + IPC
Sbjct  143  DAPADVPRGCCPVYVG--AERRRFVVPTAYLGMPVFRRLLEKAEEEFEFDYHGGAVTIPC  200

Query  570  EIETFKYLLKCMEIH  614
            + E FKY+L  M+ H
Sbjct  201  DTEAFKYILVVMDRH  215



>ref|XP_010928766.1| PREDICTED: auxin-induced protein 6B-like [Elaeis guineensis]
Length=147

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 7/126 (6%)
 Frame = +3

Query  231  EKRKVCGIRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADV  410
            + +K   I  IVRL   ++KWK++A        +            +  +D    +  DV
Sbjct  2    DSKKANKITEIVRLQQMLKKWKKLAVAPKSNSKSIKFLKR-----TLSFSDTSSASSGDV  56

Query  411  PKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKY  590
            PKGY+ V VG  E ++RF+IPT YL    F VLL + EEEFGF+  G L IPCE+  F+ 
Sbjct  57   PKGYLAVCVG--EEMQRFVIPTEYLGHRAFAVLLREAEEEFGFQQEGVLRIPCEVSVFES  114

Query  591  LLKCME  608
            +LK +E
Sbjct  115  ILKVVE  120



>ref|NP_001241474.1| uncharacterized protein LOC100798690 [Glycine max]
 gb|ACU17285.1| unknown [Glycine max]
Length=90

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D PKGY+ VYVG  E ++RF+IP +YL+ PLF+ LL + EEEFG+ H  GGL IPC  +T
Sbjct  24   DAPKGYLAVYVG--EKMKRFVIPVSYLNQPLFQDLLSEAEEEFGYNHPMGGLTIPCSEDT  81

Query  582  FKYL  593
            F+++
Sbjct  82   FQHI  85



>gb|KHN39378.1| Auxin-induced protein 15A [Glycine soja]
Length=142

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 13/129 (10%)
 Frame = +3

Query  252  IRRIVRLMGFVRKWKRIarnnsvrrttttvettasvsPAVKSADCVRQAPADVPKGYMGV  431
            IR +VRL   ++KWK++A  ++   +++        + +    + +      VPKG++ V
Sbjct  9    IREVVRLQQILKKWKKVATASNNNSSSSKGIKFLKRTLSFTDTNDI------VPKGFLAV  62

Query  432  YVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFKYLLKCME-  608
             VG+   L+RFIIPT YL    F++LL++ EEEFGF+  G L IPC++  F+ +LK +E 
Sbjct  63   CVGKE--LKRFIIPTDYLRHQAFEMLLQEAEEEFGFQQEGVLKIPCQVSVFEKILKAVED  120

Query  609  ----IHERD  623
                +HE D
Sbjct  121  NKEPLHEFD  129



>emb|CDP15258.1| unnamed protein product [Coffea canephora]
Length=145

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +3

Query  369  VKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-  545
            +++   +RQ+  DV KGY+ VYVG  E  +RF+IP +YL+ P F+ LL + EEEFGF+H 
Sbjct  66   LQAKQILRQSSKDVSKGYVAVYVGESEK-KRFVIPISYLNQPTFRELLSQAEEEFGFDHP  124

Query  546  RGGLIIPCEIETFKYLLKCM  605
             GGL IPC  + F  +  C+
Sbjct  125  MGGLTIPCREDKFIDVTSCL  144



>gb|KHN29234.1| Auxin-induced protein 6B [Glycine soja]
Length=92

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = +3

Query  375  SADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RG  551
            +A+       +VPKGY+ VYVG  E ++RF+IP +YLS P F+ LL  VEEEFG++H  G
Sbjct  14   AANIASSKAGEVPKGYIAVYVG--ERMKRFVIPISYLSQPSFQDLLSLVEEEFGYDHPMG  71

Query  552  GLIIPCEIETFKYLLKCME  608
            GL IPC  + F+++   + 
Sbjct  72   GLTIPCSEDVFQHITSSLN  90



>ref|XP_007023648.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOY26270.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=159

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +3

Query  399  PADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIE  578
            P  VPKG++ VYVG    LRRF+IP +YLS P FK+L++KV EEFGFE  GGL IPC+ +
Sbjct  73   PTQVPKGFIAVYVG--PELRRFVIPMSYLSMPEFKILMDKVAEEFGFEQEGGLQIPCDEQ  130

Query  579  TFKY-LLKCMEIHE  617
             F+  LLKC  + +
Sbjct  131  HFEQILLKCTALQQ  144



>ref|XP_010263288.1| PREDICTED: auxin-induced protein X15-like [Nelumbo nucifera]
Length=131

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF-  584
            VP+G++ VYVG     RRF+IP +YLS P F+VL+EKV EEFGFE +G L IPCE E F 
Sbjct  57   VPRGFLAVYVGPEN--RRFVIPASYLSMPDFRVLMEKVAEEFGFEQQGALKIPCEEEDFE  114

Query  585  KYLLKCMEIHER  620
            K LL+C E  E+
Sbjct  115  KILLRCFERQEK  126



>ref|XP_003539973.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
 gb|KHN46699.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=90

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  375  SADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RG  551
            +A+       D PKGY+ VYVG  E ++RF+IP +YL+ PLF+ LL + EEEFG++H  G
Sbjct  14   AANQASSKAVDAPKGYLAVYVG--EKMKRFVIPVSYLNQPLFQDLLSEAEEEFGYDHPMG  71

Query  552  GLIIPCEIETFKYL  593
            GL IPC  +TF+++
Sbjct  72   GLTIPCSEDTFQHI  85



>ref|XP_011047001.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Populus 
euphratica]
Length=98

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKG++ VYVG  E  +RF++P +YL+ P F+ LL K EEEFGF+H  GGL IPC  ET
Sbjct  29   DVPKGFLAVYVGETEK-KRFVVPVSYLNQPSFQDLLSKAEEEFGFDHPMGGLTIPCAEET  87

Query  582  FKYLLKCM  605
            F ++   +
Sbjct  88   FLHVTSSL  95



>ref|XP_002312996.1| hypothetical protein POPTR_0009s12950g [Populus trichocarpa]
 gb|EEE86951.1| hypothetical protein POPTR_0009s12950g [Populus trichocarpa]
Length=98

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            DVPKG++ VYVG  E  +RF++P +YL+ P F+ LL K E+EFGF+H  GGL IPC  ET
Sbjct  29   DVPKGFLAVYVGETEK-KRFVVPVSYLNQPSFQDLLSKAEDEFGFDHPMGGLTIPCAEET  87

Query  582  FKYLLKCM  605
            F ++   +
Sbjct  88   FLHVTSSL  95



>ref|XP_009351936.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=137

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            D+PKG M V VG+GE  +RF+IP  Y++ PLF  LL++ E+E+GF+H+G + IPC +E F
Sbjct  38   DIPKGCMAVMVGQGEDQQRFVIPVVYVNHPLFMQLLKEAEKEYGFDHKGPISIPCHVEEF  97

Query  585  K  587
            +
Sbjct  98   R  98



>ref|XP_010545490.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme isoform X2 
[Tarenaya hassleriana]
Length=566

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +3

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETFK  587
            +PKG++ VYVG G+  +RF+IPT  LS P FK L+++  +EFG++H GG+ IPCE +TFK
Sbjct  493  IPKGHLAVYVGDGQ--QRFVIPTKCLSCPDFKDLMDEAADEFGYDHEGGIHIPCEEDTFK  550

Query  588  Y-LLKCM  605
              LL+C+
Sbjct  551  QILLRCI  557



>ref|XP_007200158.1| hypothetical protein PRUPE_ppa016758mg [Prunus persica]
 gb|EMJ01357.1| hypothetical protein PRUPE_ppa016758mg [Prunus persica]
Length=93

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D+PKGY  VYVG G   +RF++P +YL++PLF  LL + EEEFG++H  GG+ IPC  ET
Sbjct  25   DIPKGYFAVYVG-GSQKKRFVVPISYLNEPLFLDLLSQAEEEFGYDHPMGGITIPCSDET  83

Query  582  FKYLLKCMEI  611
            F +L   + +
Sbjct  84   FIHLTSSLSV  93



>ref|XP_009793038.1| PREDICTED: auxin-induced protein X15-like [Nicotiana sylvestris]
Length=115

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            D+PKG + + VG GE  +RF+IP TY++ PLF  LL++ EEE+GF H+G + IPC IE F
Sbjct  30   DIPKGCLAITVGYGEEHQRFVIPVTYINHPLFMQLLKEAEEEYGFGHKGPIKIPCHIEEF  89

Query  585  KYL  593
            +++
Sbjct  90   RHV  92



>ref|XP_003607103.1| Auxin-induced protein-like protein [Medicago truncatula]
 gb|AES89300.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=93

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +3

Query  366  AVKSADCVRQAPADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH  545
            A  SA+       DVPKGY+ VYV  GE   R++IP +YLS P F+ LL +VEEEFG++H
Sbjct  12   ASFSANRSASKSVDVPKGYLAVYV--GEKQTRYLIPVSYLSQPSFQGLLSQVEEEFGYDH  69

Query  546  -RGGLIIPCEIETFKYLLKCME  608
              GGL IPC  + F+++  C  
Sbjct  70   PMGGLTIPCTEDVFQHITSCFN  91



>gb|KHN13737.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=90

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-RGGLIIPCEIET  581
            D PKGY+ VYVG  E ++RF+IP +YL+ PLF+ LL + EEEFG++H  GGL IPC  +T
Sbjct  24   DAPKGYLAVYVG--EKMKRFVIPVSYLNQPLFQDLLSEAEEEFGYDHPMGGLTIPCSEDT  81

Query  582  FKYL  593
            F+++
Sbjct  82   FQHI  85



>ref|XP_006347637.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=117

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  405  DVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHRGGLIIPCEIETF  584
            ++PKG + V VG+GE  +RF+IP  Y++ PLF  LL++ E+EFGF+H+G + IPC +E F
Sbjct  33   NIPKGCLAVIVGQGEEQQRFVIPVNYINHPLFLQLLKEAEKEFGFDHKGPINIPCHVEQF  92

Query  585  KYL  593
            +Y+
Sbjct  93   RYV  95



>ref|XP_010432376.1| PREDICTED: auxin-induced protein X15-like [Camelina sativa]
Length=105

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  408  VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeHR-GGLIIPCEIETF  584
            VPKG++ VYVG     +RF++P TYL+ P+F+  L + EEE G+ H  GGL IPC  E+F
Sbjct  36   VPKGHVAVYVGEQMEKKRFVVPITYLNHPMFREFLNRAEEECGYHHSMGGLTIPCREESF  95

Query  585  KYLLKCMEIH  614
             +L+   ++H
Sbjct  96   LHLITSHQLH  105



>ref|XP_008448013.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=100

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +3

Query  375  SADCVRQAP--ADVPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveeefgfeH-  545
            S+   R++P   DVPKGY  VYVG  E  +RF+IP +YL+ P F+ LL + +EEFG+ H 
Sbjct  19   SSTENRESPKAVDVPKGYFTVYVGE-EQKKRFVIPLSYLNQPSFQDLLSQAKEEFGYNHP  77

Query  546  RGGLIIPCEIETFKYLLKCME  608
             GG+ IPC  E F+ L + + 
Sbjct  78   MGGITIPCSEEIFQNLTQSLN  98



>gb|KHN13729.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=90

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 7/86 (8%)
 Frame = +3

Query  363  PAVKSA-DCVRQAPAD---VPKGYMGVYVGRGEVLRRFIIPTTYLSDPlfkvllekveee  530
            P ++ A   V QA +    VPKGY+ VYVG  E ++RF+IP +YL+ P F+ LL + EEE
Sbjct  6    PGIRKALFAVNQASSKAIHVPKGYLAVYVG--ENMKRFVIPVSYLNQPSFQDLLSQAEEE  63

Query  531  fgfeH-RGGLIIPCEIETFKYLLKCM  605
            FG++H  GGL IPC  + F+ +  C+
Sbjct  64   FGYDHPMGGLAIPCSEDVFQCITSCL  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566195601152