BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85919_g1_i1 len=127 path=[135:0-126]

Length=127
                                                                      Score     E

ref|XP_010244466.1|  PREDICTED: cellulose synthase-like protein H...  57.0    7e-08   
ref|XP_007049092.1|  Cellulose synthase-like B3, putative isoform 1   57.0    8e-08   
ref|XP_010244467.1|  PREDICTED: cellulose synthase-like protein H...  57.0    8e-08   
ref|XP_007049093.1|  Cellulose synthase-like B3, putative isoform 2   56.6    1e-07   
ref|XP_006364166.1|  PREDICTED: cellulose synthase-like protein H...  56.2    1e-07   
ref|XP_009588345.1|  PREDICTED: cellulose synthase-like protein H1    56.2    1e-07   
ref|XP_006364167.1|  PREDICTED: cellulose synthase-like protein H...  56.2    1e-07   
ref|XP_007049094.1|  Cellulose synthase-like B3, putative isoform 3   55.5    2e-07   
gb|KDP24850.1|  hypothetical protein JCGZ_24444                       52.8    2e-06   
ref|XP_004243487.1|  PREDICTED: cellulose synthase-like protein H1    52.4    3e-06   
ref|XP_003579750.1|  PREDICTED: cellulose synthase-like protein H1    52.0    4e-06   
gb|KDP30772.1|  hypothetical protein JCGZ_13715                       51.6    5e-06   
ref|XP_004287960.1|  PREDICTED: cellulose synthase-like protein H...  51.2    8e-06   
ref|XP_009781148.1|  PREDICTED: cellulose synthase-like protein B...  50.4    1e-05   
emb|CDP20180.1|  unnamed protein product                              50.4    1e-05   
ref|XP_004975623.1|  PREDICTED: cellulose synthase-like protein H...  50.4    1e-05   
gb|AFZ78580.1|  cellulose synthase-like protein                       50.4    1e-05   
ref|XP_004975622.1|  PREDICTED: cellulose synthase-like protein H...  50.4    2e-05   
ref|XP_006375533.1|  hypothetical protein POPTR_0014s15340g           49.7    2e-05   
ref|XP_004975624.1|  PREDICTED: cellulose synthase-like protein H...  50.4    2e-05   
emb|CDP21633.1|  unnamed protein product                              48.9    2e-05   
ref|XP_010657348.1|  PREDICTED: cellulose synthase-like protein H1    49.7    2e-05   
ref|XP_002529325.1|  transferase, putative                            49.7    3e-05   Ricinus communis
ref|XP_010252474.1|  PREDICTED: cellulose synthase-like protein H...  49.3    3e-05   
ref|XP_010035545.1|  PREDICTED: cellulose synthase-like protein B4    48.9    5e-05   
emb|CBI28826.3|  unnamed protein product                              48.5    7e-05   
ref|XP_009781147.1|  PREDICTED: cellulose synthase-like protein H...  48.1    8e-05   
tpg|DAA37782.1|  TPA: hypothetical protein ZEAMMB73_545753            48.1    8e-05   
ref|XP_002269831.2|  PREDICTED: cellulose synthase-like protein H1    48.1    8e-05   Vitis vinifera
gb|ADO34997.1|  cellulose synthase-like protein H1                    48.1    1e-04   
ref|XP_010252472.1|  PREDICTED: cellulose synthase-like protein H...  48.1    1e-04   
ref|XP_002302868.1|  cellulose synthase family protein                47.8    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010930912.1|  PREDICTED: cellulose synthase-like protein H...  47.4    1e-04   
ref|XP_010657215.1|  PREDICTED: cellulose synthase-like protein H1    47.4    2e-04   
ref|XP_010035546.1|  PREDICTED: cellulose synthase-like protein H...  47.4    2e-04   
ref|XP_008781463.1|  PREDICTED: cellulose synthase-like protein H...  47.4    2e-04   
ref|XP_010657214.1|  PREDICTED: cellulose synthase-like protein H1    47.4    2e-04   
ref|XP_008781464.1|  PREDICTED: cellulose synthase-like protein H...  47.4    2e-04   
emb|CBI28829.3|  unnamed protein product                              47.4    2e-04   
ref|XP_010035551.1|  PREDICTED: cellulose synthase-like protein B4    47.0    2e-04   
gb|EMT26547.1|  Cellulose synthase-like protein H1                    47.0    2e-04   
gb|KCW46974.1|  hypothetical protein EUGRSUZ_K00782                   47.0    2e-04   
gb|KHN44862.1|  Cellulose synthase-like protein H1                    47.0    2e-04   
ref|XP_003539497.1|  PREDICTED: cellulose synthase-like protein H...  47.0    2e-04   
ref|XP_008669410.1|  PREDICTED: cellulose synthase-like protein H...  47.0    3e-04   
ref|XP_008669411.1|  PREDICTED: cellulose synthase-like protein H...  46.6    3e-04   
ref|XP_008669412.1|  PREDICTED: cellulose synthase-like protein H...  46.6    3e-04   
ref|XP_002447842.1|  hypothetical protein SORBIDRAFT_06g016750        46.6    3e-04   Sorghum bicolor [broomcorn]
ref|XP_011047235.1|  PREDICTED: cellulose synthase-like protein H1    46.2    4e-04   
gb|ACN67534.1|  cellulose synthase-like protein H1                    45.8    5e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007049091.1|  Cellulose synthase-like B3, putative             45.8    5e-04   
ref|XP_011007182.1|  PREDICTED: cellulose synthase-like protein H1    45.8    5e-04   
emb|CBI28831.3|  unnamed protein product                              45.1    6e-04   
ref|XP_003633282.1|  PREDICTED: cellulose synthase-like protein H1    45.8    6e-04   
ref|XP_002447843.1|  hypothetical protein SORBIDRAFT_06g016760        45.4    6e-04   Sorghum bicolor [broomcorn]
gb|KDO54720.1|  hypothetical protein CISIN_1g006639mg                 45.4    7e-04   
emb|CBI28833.3|  unnamed protein product                              45.4    8e-04   
ref|XP_003540290.1|  PREDICTED: cellulose synthase-like protein H...  45.4    8e-04   
ref|XP_010657351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  45.1    8e-04   
ref|XP_010089469.1|  Cellulose synthase-like protein H1               45.4    8e-04   
ref|XP_006653401.1|  PREDICTED: putative cellulose synthase-like ...  45.1    9e-04   
gb|KDO54721.1|  hypothetical protein CISIN_1g006639mg                 45.1    9e-04   



>ref|XP_010244466.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nelumbo 
nucifera]
Length=760

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
           +H +PWLLA +CE WFTF+W+L +N KWNQ +
Sbjct  44  NHGVPWLLAFLCESWFTFIWVLNMNIKWNQFE  75



>ref|XP_007049092.1| Cellulose synthase-like B3, putative isoform 1 [Theobroma cacao]
 gb|EOX93249.1| Cellulose synthase-like B3, putative isoform 1 [Theobroma cacao]
Length=747

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            N+H +PW +AL+CE+WFTF W+L +NCKW+ ++
Sbjct  43   NNHGLPWFIALVCELWFTFNWVLVVNCKWSPVE  75



>ref|XP_010244467.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Nelumbo 
nucifera]
Length=749

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
           +H +PWLLA +CE WFTF+W+L +N KWNQ +
Sbjct  44  NHGVPWLLAFLCESWFTFIWVLNMNIKWNQFE  75



>ref|XP_007049093.1| Cellulose synthase-like B3, putative isoform 2 [Theobroma cacao]
 gb|EOX93250.1| Cellulose synthase-like B3, putative isoform 2 [Theobroma cacao]
Length=676

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            N+H +PW +AL+CE+WFTF W+L +NCKW+ ++
Sbjct  43   NNHGLPWFIALVCELWFTFNWVLVVNCKWSPVE  75



>ref|XP_006364166.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Solanum tuberosum]
Length=739

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  97  HIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
           H + WLLALICE WFTF+WILT++ KWNQ++
Sbjct  47  HGLQWLLALICESWFTFIWILTVSSKWNQVE  77



>ref|XP_009588345.1| PREDICTED: cellulose synthase-like protein H1 [Nicotiana tomentosiformis]
Length=751

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  91  IPWLLALICEVWFTFVWILTINCKWNQIQ  5
           +P+ LALICE WFTF+WILTIN KWNQ++
Sbjct  50  LPFFLALICESWFTFLWILTINAKWNQVE  78



>ref|XP_006364167.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Solanum tuberosum]
Length=700

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  97  HIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
           H + WLLALICE WFTF+WILT++ KWNQ++
Sbjct  47  HGLQWLLALICESWFTFIWILTVSSKWNQVE  77



>ref|XP_007049094.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
 gb|EOX93251.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
Length=587

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            N+H +PW +AL+CE+WFTF W+L +NCKW+ ++
Sbjct  43   NNHGLPWFIALVCELWFTFNWVLVVNCKWSPVE  75



>gb|KDP24850.1| hypothetical protein JCGZ_24444 [Jatropha curcas]
Length=440

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           +H   WLLAL+CE WFTFVW+LT++ KWN +
Sbjct  44  NHGFSWLLALLCESWFTFVWVLTVSTKWNPV  74



>ref|XP_004243487.1| PREDICTED: cellulose synthase-like protein H1 [Solanum lycopersicum]
Length=743

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  97  HIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
           H + WLLALICE WFTF+WILT++ KWNQ++
Sbjct  47  HGLQWLLALICESWFTFIWILTVSTKWNQVE  77



>ref|XP_003579750.1| PREDICTED: cellulose synthase-like protein H1 [Brachypodium distachyon]
Length=754

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -1

Query  88  PWLLALICEVWFTFVWILTINCKWNQIQ  5
           PWL AL+CE WFTFVW+LTIN KW+ ++
Sbjct  51  PWLAALVCEAWFTFVWLLTINGKWSPVR  78



>gb|KDP30772.1| hypothetical protein JCGZ_13715 [Jatropha curcas]
Length=704

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           +H   WLLAL+CE WFTFVW+LT++ KWN +
Sbjct  44  NHGFAWLLALLCESWFTFVWVLTVSTKWNPV  74



>ref|XP_004287960.1| PREDICTED: cellulose synthase-like protein H1-like [Fragaria 
vesca subsp. vesca]
Length=755

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQI  8
            N H + W +AL+CE+WFTF W++T+N KWN +
Sbjct  43   NKHGLSWFIALLCELWFTFSWVITMNNKWNMV  74



>ref|XP_009781148.1| PREDICTED: cellulose synthase-like protein B6 isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 3/41 (7%)
 Frame = -1

Query  127  FSLGTHNDNDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
             SL  H  N   + + LALICE WFTF+WIL ++ KWNQ++
Sbjct  41   LSLKNHGLN---LSFFLALICESWFTFLWILIVSTKWNQVE  78



>emb|CDP20180.1| unnamed protein product [Coffea canephora]
Length=424

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           +H   WL+AL+CE WFTF+WI+ +N KWN I
Sbjct  44  NHGFIWLVALLCESWFTFIWIVVVNIKWNPI  74



>ref|XP_004975623.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Setaria italica]
Length=813

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL AL+CE WFT VW+L +NCKWN ++
Sbjct  61  WLAALVCEAWFTVVWLLNVNCKWNPVR  87



>gb|AFZ78580.1| cellulose synthase-like protein [Populus tomentosa]
Length=746

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H   W+LAL+CE  FTF+W++T++CKWN ++
Sbjct  44   SNHGFAWVLALLCESCFTFIWVVTVSCKWNPVE  76



>ref|XP_004975622.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Setaria italica]
Length=844

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL AL+CE WFT VW+L +NCKWN ++
Sbjct  61  WLAALVCEAWFTVVWLLNVNCKWNPVR  87



>ref|XP_006375533.1| hypothetical protein POPTR_0014s15340g, partial [Populus trichocarpa]
 gb|ERP53330.1| hypothetical protein POPTR_0014s15340g, partial [Populus trichocarpa]
Length=361

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H   W+LAL+CE  FTF+W++T++CKWN ++
Sbjct  44   SNHGFAWVLALLCESCFTFIWVVTVSCKWNPVE  76



>ref|XP_004975624.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Setaria italica]
Length=811

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL AL+CE WFT VW+L +NCKWN ++
Sbjct  61  WLAALVCEAWFTVVWLLNVNCKWNPVR  87



>emb|CDP21633.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           +H   WL+AL+CE WFTF+WIL +N KWN I
Sbjct  44  NHGFIWLVALLCESWFTFIWILVVNIKWNPI  74



>ref|XP_010657348.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=551

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WLLA +CE WFTF+WIL ++ KWN +
Sbjct  49  WLLAFLCESWFTFIWILNVSTKWNPV  74



>ref|XP_002529325.1| transferase, putative [Ricinus communis]
 gb|EEF33042.1| transferase, putative [Ricinus communis]
Length=749

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            + H   W LAL+CE WFTF+W LT N KWN ++
Sbjct  43   DKHGFAWFLALLCESWFTFIWFLTANAKWNPVK  75



>ref|XP_010252474.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Nelumbo 
nucifera]
Length=582

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H + WLLA +CE WFT  W+LTIN  WN ++
Sbjct  43   SNHGVAWLLAFLCESWFTLCWVLTINSNWNPVE  75



>ref|XP_010035545.1| PREDICTED: cellulose synthase-like protein B4 [Eucalyptus grandis]
 gb|KCW46971.1| hypothetical protein EUGRSUZ_K00779 [Eucalyptus grandis]
Length=754

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           DH + W +AL CE WFTFVWIL I+ KWN +
Sbjct  45  DHGLEWQVALACESWFTFVWILVISTKWNPV  75



>emb|CBI28826.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WLLA +CE WFTF+WIL ++ KWN +
Sbjct  49  WLLAFLCESWFTFIWILNVSTKWNPV  74



>ref|XP_009781147.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nicotiana 
sylvestris]
Length=749

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 3/41 (7%)
 Frame = -1

Query  127  FSLGTHNDNDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
             SL  H  N   + + LALICE WFTF+WIL ++ KWNQ++
Sbjct  41   LSLKNHGLN---LSFFLALICESWFTFLWILIVSTKWNQVE  78



>tpg|DAA37782.1| TPA: hypothetical protein ZEAMMB73_545753, partial [Zea mays]
Length=828

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W+ ALICE WFT VW+L +N KWN ++
Sbjct  58  WVAALICEAWFTVVWLLNMNAKWNPVR  84



>ref|XP_002269831.2| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
 emb|CBI28824.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WLLA +CE WFTF+WIL ++ KWN +
Sbjct  49  WLLAFLCESWFTFIWILNVSTKWNPV  74



>gb|ADO34997.1| cellulose synthase-like protein H1 [Avena sativa]
Length=758

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 24/29 (83%), Gaps = 2/29 (7%)
 Frame = -1

Query  85  WL--LALICEVWFTFVWILTINCKWNQIQ  5
           WL  LAL+CE WFTFVW+L +NCKW+ ++
Sbjct  52  WLPALALVCEAWFTFVWLLNMNCKWSPVR  80



>ref|XP_010252472.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nelumbo 
nucifera]
Length=743

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H + WLLA +CE WFT  W+LTIN  WN ++
Sbjct  43   SNHGVAWLLAFLCESWFTLCWVLTINSNWNPVE  75



>ref|XP_002302868.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE82141.1| cellulose synthase family protein [Populus trichocarpa]
Length=749

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H   WLLAL+CE  FTF W+LT++ KWN ++
Sbjct  44   SNHGFAWLLALLCETCFTFTWVLTVSSKWNPVE  76



>ref|XP_010930912.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Elaeis 
guineensis]
Length=745

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL+A +CE WFTFVW+L +N KWN ++
Sbjct  49  WLIAFLCESWFTFVWVLYMNGKWNPVK  75



>ref|XP_010657215.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
 emb|CBI28832.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WLLA +CE WFTF+WIL ++ KWN +
Sbjct  49  WLLAFLCESWFTFIWILNLSSKWNPV  74



>ref|XP_010035546.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Eucalyptus 
grandis]
Length=753

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           DH + W +AL+CE WFTFVW+L ++ KW+ +
Sbjct  45  DHGLEWQVALVCESWFTFVWVLVVSSKWSPV  75



>ref|XP_008781463.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Phoenix 
dactylifera]
Length=744

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL+A +CE WFTF+W+L +N KWN ++
Sbjct  49  WLIAFLCESWFTFIWVLFMNAKWNPVK  75



>ref|XP_010657214.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=747

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WLLA +CE WFTF+WIL ++ KWN +
Sbjct  49  WLLAFLCESWFTFIWILNLSSKWNPV  74



>ref|XP_008781464.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Phoenix 
dactylifera]
Length=744

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL+A +CE WFTF+W+L +N KWN ++
Sbjct  49  WLIAFLCESWFTFIWVLFMNAKWNPVK  75



>emb|CBI28829.3| unnamed protein product [Vitis vinifera]
Length=765

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WLLA +CE WFTF+WIL ++ KWN +
Sbjct  49  WLLAFLCESWFTFIWILNLSSKWNPV  74



>ref|XP_010035551.1| PREDICTED: cellulose synthase-like protein B4 [Eucalyptus grandis]
Length=754

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           DH + W +AL CE WFTFVWIL I+ KW+ +
Sbjct  45  DHGLEWQVALACESWFTFVWILVISTKWSPV  75



>gb|EMT26547.1| Cellulose synthase-like protein H1 [Aegilops tauschii]
Length=717

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL AL+CE WF FVWIL +N KW+ ++
Sbjct  47  WLAALVCEAWFAFVWILNMNGKWSPVR  73



>gb|KCW46974.1| hypothetical protein EUGRSUZ_K00782 [Eucalyptus grandis]
Length=816

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           DH + W +AL CE WFTFVWIL I+ KW+ +
Sbjct  45  DHGLEWQVALACESWFTFVWILVISTKWSPV  75



>gb|KHN44862.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=748

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  109  NDNDHIIPWLLALICEVWFTFVWILTINCKWN  14
            + N+   PW LA +CE WFTF WI+ +N KW+
Sbjct  42   SSNNFTFPWFLAFLCESWFTFTWIVILNAKWS  73



>ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=748

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  109  NDNDHIIPWLLALICEVWFTFVWILTINCKWN  14
            + N+   PW LA +CE WFTF WI+ +N KW+
Sbjct  42   SSNNFTFPWFLAFLCESWFTFTWIVILNAKWS  73



>ref|XP_008669410.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Zea 
mays]
Length=784

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W+ ALICE WFT VW+L +N KWN ++
Sbjct  58  WVAALICEAWFTVVWLLNMNAKWNPVR  84



>ref|XP_008669411.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Zea 
mays]
Length=781

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W+ ALICE WFT VW+L +N KWN ++
Sbjct  58  WVAALICEAWFTVVWLLNMNAKWNPVR  84



>ref|XP_008669412.1| PREDICTED: cellulose synthase-like protein H1 isoform X3 [Zea 
mays]
Length=780

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W+ ALICE WFT VW+L +N KWN ++
Sbjct  58  WVAALICEAWFTVVWLLNMNAKWNPVR  84



>ref|XP_002447842.1| hypothetical protein SORBIDRAFT_06g016750 [Sorghum bicolor]
 gb|EES12170.1| hypothetical protein SORBIDRAFT_06g016750 [Sorghum bicolor]
Length=819

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W+ ALICE WFT VW++ +N KWN ++
Sbjct  59  WVAALICEAWFTVVWLINMNAKWNPVR  85



>ref|XP_011047235.1| PREDICTED: cellulose synthase-like protein H1 [Populus euphratica]
Length=747

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H   W+LAL+CE  FTF+W++T++ KWN ++
Sbjct  44   SNHGFAWVLALLCESCFTFIWVVTVSSKWNPVE  76



>gb|ACN67534.1| cellulose synthase-like protein H1 [Hordeum vulgare subsp. vulgare]
Length=751

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WL AL+CE WF FVWIL +N KW+ ++
Sbjct  47  WLAALVCEAWFAFVWILNMNGKWSPVR  73



>ref|XP_007049091.1| Cellulose synthase-like B3, putative [Theobroma cacao]
 gb|EOX93248.1| Cellulose synthase-like B3, putative [Theobroma cacao]
Length=750

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQI  8
            N+H   WLLA  CE WFTF W L ++ KWN +
Sbjct  43   NNHGFVWLLAFFCESWFTFNWFLLVSSKWNPV  74



>ref|XP_011007182.1| PREDICTED: cellulose synthase-like protein H1 [Populus euphratica]
Length=750

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  NDHIIPWLLALICEVWFTFVWILTINCKWNQIQ  5
            ++H   WLLAL+CE  FTF W +T++ KWN ++
Sbjct  44   SNHGFAWLLALLCETCFTFTWFVTVSSKWNPVE  76



>emb|CBI28831.3| unnamed protein product [Vitis vinifera]
Length=296

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WL+A +CE WFTF+W+L ++ KWN +
Sbjct  48  WLIAFLCESWFTFLWVLNLSSKWNPV  73



>ref|XP_003633282.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=751

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -1

Query  91  IPWLLALICEVWFTFVWILTINCKWNQI  8
           + WL+A +CE WFTF+W+L ++ KWN +
Sbjct  47  LTWLVAFLCESWFTFLWVLNLSSKWNPV  74



>ref|XP_002447843.1| hypothetical protein SORBIDRAFT_06g016760 [Sorghum bicolor]
 gb|EES12171.1| hypothetical protein SORBIDRAFT_06g016760 [Sorghum bicolor]
Length=756

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W+ ALICE WFT VW+L +N KWN ++
Sbjct  59  WVAALICEAWFTVVWLLNMNAKWNPVR  85



>gb|KDO54720.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=637

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           +H   W LA +CE  FTF+WIL +NCKW  +
Sbjct  46  NHGFAWFLAFLCESCFTFIWILIVNCKWTPL  76



>emb|CBI28833.3| unnamed protein product [Vitis vinifera]
Length=1566

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -1

Query  91  IPWLLALICEVWFTFVWILTINCKWNQI  8
           + WL+A +CE WFTF+W+L ++ KWN +
Sbjct  47  LTWLVAFLCESWFTFLWVLNLSSKWNPV  74



>ref|XP_003540290.1| PREDICTED: cellulose synthase-like protein H1-like isoformX1 
[Glycine max]
 gb|KHN44859.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=746

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -1

Query  109  NDNDHIIPWLLALICEVWFTFVWILTINCKWNQIQT  2
            + N+   PW LA ICE WFTF+WI+ +N KW+   T
Sbjct  42   SSNNFTFPWFLAFICESWFTFIWIVILNTKWSPAVT  77



>ref|XP_010657351.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
H1 [Vitis vinifera]
Length=379

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQI  8
           WL+A +CE WFTF+W+L ++ KWN +
Sbjct  48  WLIAFLCESWFTFLWVLNLSSKWNPV  73



>ref|XP_010089469.1| Cellulose synthase-like protein H1 [Morus notabilis]
 gb|EXB37862.1| Cellulose synthase-like protein H1 [Morus notabilis]
Length=763

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           WLLA +CE+WFTF W++ I+ KWN ++
Sbjct  55  WLLAFLCELWFTFYWVILISTKWNPVE  81



>ref|XP_006653401.1| PREDICTED: putative cellulose synthase-like protein H3-like [Oryza 
brachyantha]
Length=769

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  85  WLLALICEVWFTFVWILTINCKWNQIQ  5
           W +AL CE WF FVW+L +N KWN ++
Sbjct  53  WRVALACEAWFAFVWLLNMNAKWNPVR  79



>gb|KDO54721.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=595

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -1

Query  100 DHIIPWLLALICEVWFTFVWILTINCKWNQI  8
           +H   W LA +CE  FTF+WIL +NCKW  +
Sbjct  46  NHGFAWFLAFLCESCFTFIWILIVNCKWTPL  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515174157784