BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8579_g1_i1 len=1211 path=[1189:0-1210]

Length=1211
                                                                      Score     E

ref|XP_006348308.1|  PREDICTED: epidermis-specific secreted glyco...    405   7e-137   
ref|XP_004244276.2|  PREDICTED: epidermis-specific secreted glyco...    400   1e-134   
gb|AGI04215.1|  mannose binding lectin                                  396   3e-133   
gb|ADG04234.1|  mannose-binding lectin                                  391   3e-131   
ref|XP_006348307.1|  PREDICTED: epidermis-specific secreted glyco...    389   2e-130   
ref|XP_004244275.2|  PREDICTED: epidermis-specific secreted glyco...    389   5e-130   
ref|XP_009630449.1|  PREDICTED: epidermis-specific secreted glyco...    387   8e-130   
ref|XP_009797872.1|  PREDICTED: epidermis-specific secreted glyco...    387   2e-129   
emb|CDP01431.1|  unnamed protein product                                374   4e-122   
ref|XP_009630450.1|  PREDICTED: epidermis-specific secreted glyco...    366   2e-121   
ref|XP_009765600.1|  PREDICTED: epidermis-specific secreted glyco...    353   3e-116   
ref|XP_002525646.1|  Epidermis-specific secreted glycoprotein EP1...    357   5e-116   Ricinus communis
ref|XP_006487518.1|  PREDICTED: epidermis-specific secreted glyco...    350   2e-114   
ref|XP_003543212.1|  PREDICTED: epidermis-specific secreted glyco...    352   3e-114   
ref|XP_011083288.1|  PREDICTED: epidermis-specific secreted glyco...    351   9e-114   
ref|XP_006487519.1|  PREDICTED: epidermis-specific secreted glyco...    350   5e-113   
gb|KDO37691.1|  hypothetical protein CISIN_1g036296mg                   349   5e-113   
ref|XP_006442508.1|  hypothetical protein CICLE_v10020160mg             350   6e-113   
ref|XP_009340015.1|  PREDICTED: epidermis-specific secreted glyco...    349   7e-113   
ref|XP_008350012.1|  PREDICTED: epidermis-specific secreted glyco...    348   1e-112   
ref|XP_008386249.1|  PREDICTED: epidermis-specific secreted glyco...    348   1e-112   
gb|KCW67508.1|  hypothetical protein EUGRSUZ_F01237                     347   5e-112   
ref|XP_010060698.1|  PREDICTED: epidermis-specific secreted glyco...    347   7e-112   
ref|XP_002525645.1|  Epidermis-specific secreted glycoprotein EP1...    346   8e-112   Ricinus communis
ref|XP_007149384.1|  hypothetical protein PHAVU_005G065700g             346   2e-111   
ref|XP_008386250.1|  PREDICTED: epidermis-specific secreted glyco...    346   2e-111   
ref|XP_008370851.1|  PREDICTED: epidermis-specific secreted glyco...    346   2e-111   
ref|XP_008386254.1|  PREDICTED: epidermis-specific secreted glyco...    345   3e-111   
ref|XP_011082760.1|  PREDICTED: epidermis-specific secreted glyco...    345   4e-111   
ref|XP_010644121.1|  PREDICTED: epidermis-specific secreted glyco...    345   1e-110   
ref|XP_010675381.1|  PREDICTED: LOW QUALITY PROTEIN: epidermis-sp...    343   3e-110   
ref|XP_004489029.1|  PREDICTED: epidermis-specific secreted glyco...    342   4e-110   
ref|XP_008386251.1|  PREDICTED: epidermis-specific secreted glyco...    342   6e-110   
ref|XP_008367970.1|  PREDICTED: epidermis-specific secreted glyco...    342   8e-110   
gb|KCW67506.1|  hypothetical protein EUGRSUZ_F01235                     341   8e-110   
ref|XP_009340001.1|  PREDICTED: epidermis-specific secreted glyco...    342   9e-110   
ref|XP_010060697.1|  PREDICTED: epidermis-specific secreted glyco...    341   1e-109   
ref|XP_009339980.1|  PREDICTED: epidermis-specific secreted glyco...    341   1e-109   
ref|XP_002283208.2|  PREDICTED: epidermis-specific secreted glyco...    338   1e-108   Vitis vinifera
ref|XP_008226532.1|  PREDICTED: epidermis-specific secreted glyco...    337   6e-108   
emb|CAN75015.1|  hypothetical protein VITISV_035367                     337   6e-108   Vitis vinifera
gb|AFH57275.1|  epidermis-specific secreted glycoprotein EP1-like...    335   2e-107   
ref|XP_009334044.1|  PREDICTED: epidermis-specific secreted glyco...    335   2e-107   
ref|XP_007021733.1|  D-mannose binding lectin protein with Apple-...    334   7e-107   
ref|XP_006477737.1|  PREDICTED: epidermis-specific secreted glyco...    333   1e-106   
ref|XP_008226534.1|  PREDICTED: epidermis-specific secreted glyco...    333   1e-106   
ref|XP_006477736.1|  PREDICTED: epidermis-specific secreted glyco...    332   3e-106   
ref|XP_006442506.1|  hypothetical protein CICLE_v10020247mg             332   5e-106   
ref|XP_010263453.1|  PREDICTED: epidermis-specific secreted glyco...    332   6e-106   
ref|XP_010279128.1|  PREDICTED: epidermis-specific secreted glyco...    331   1e-105   
gb|KDO39421.1|  hypothetical protein CISIN_1g013934mg                   330   2e-105   
ref|XP_006442507.1|  hypothetical protein CICLE_v10020204mg             330   2e-105   
ref|XP_006370152.1|  hypothetical protein POPTR_0001s40180g             326   2e-105   
gb|AFK45514.1|  unknown                                                 330   2e-105   
gb|KDP32539.1|  hypothetical protein JCGZ_14742                         329   3e-105   
ref|XP_010060695.1|  PREDICTED: epidermis-specific secreted glyco...    328   1e-104   
emb|CAA61158.1|  SIEP1L protein                                         327   1e-104   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU45021.1|  hypothetical protein MIMGU_mgv1a026633mg                328   2e-104   
ref|XP_003596371.1|  hypothetical protein MTR_2g076490                  330   2e-104   
ref|XP_002316859.1|  hypothetical protein POPTR_0011s11150g             327   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_010644111.1|  PREDICTED: epidermis-specific secreted glyco...    327   4e-104   
ref|XP_006442504.1|  hypothetical protein CICLE_v10020212mg             327   5e-104   
ref|XP_006477738.1|  PREDICTED: epidermis-specific secreted glyco...    326   9e-104   
ref|XP_004294120.1|  PREDICTED: epidermis-specific secreted glyco...    325   2e-103   
ref|XP_004294118.1|  PREDICTED: epidermis-specific secreted glyco...    324   3e-103   
ref|XP_009339992.1|  PREDICTED: epidermis-specific secreted glyco...    323   7e-103   
ref|XP_003596378.1|  hypothetical protein MTR_2g076590                  323   2e-102   
ref|XP_004294119.1|  PREDICTED: epidermis-specific secreted glyco...    322   3e-102   
gb|AFY98639.1|  epidermis-specific secreted glycoprotein EP1-like...    320   1e-101   
ref|XP_010060694.1|  PREDICTED: epidermis-specific secreted glyco...    319   5e-101   
gb|KCW67504.1|  hypothetical protein EUGRSUZ_F01233                     319   5e-101   
ref|XP_011016210.1|  PREDICTED: epidermis-specific secreted glyco...    318   5e-101   
ref|XP_007025376.1|  D-mannose binding lectin protein with Apple-...    318   1e-100   
ref|XP_011029573.1|  PREDICTED: epidermis-specific secreted glyco...    317   2e-100   
ref|XP_010108237.1|  Epidermis-specific secreted glycoprotein EP1       312   1e-98    
sp|Q39688.1|EP1G_DAUCA  RecName: Full=Epidermis-specific secreted...    309   6e-98    Daucus carota [carrots]
ref|XP_002317462.2|  curculin-like lectin family protein                310   1e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010279124.1|  PREDICTED: epidermis-specific secreted glyco...    308   7e-97    
ref|XP_006370153.1|  hypothetical protein POPTR_0001s40200g             306   8e-97    
ref|XP_006442512.1|  hypothetical protein CICLE_v10023808mg             308   1e-96    
ref|XP_007149387.1|  hypothetical protein PHAVU_005G066000g             306   5e-96    
ref|XP_011005512.1|  PREDICTED: epidermis-specific secreted glyco...    305   1e-95    
ref|XP_011013507.1|  PREDICTED: epidermis-specific secreted glyco...    303   4e-95    
ref|XP_004137240.1|  PREDICTED: epidermis-specific secreted glyco...    303   5e-95    
gb|KGN53561.1|  hypothetical protein Csa_4G082380                       303   6e-95    
ref|XP_004156509.1|  PREDICTED: epidermis-specific secreted glyco...    303   1e-94    
ref|XP_006442513.1|  hypothetical protein CICLE_v10023807mg             301   2e-94    
gb|KDO47017.1|  hypothetical protein CISIN_1g048464mg                   301   2e-94    
ref|XP_004233063.1|  PREDICTED: epidermis-specific secreted glyco...    300   6e-94    
ref|XP_010108236.1|  Epidermis-specific secreted glycoprotein EP1       300   1e-93    
ref|XP_008451767.1|  PREDICTED: epidermis-specific secreted glyco...    301   1e-93    
ref|XP_006377749.1|  hypothetical protein POPTR_0011s11160g             297   5e-93    
ref|XP_004156508.1|  PREDICTED: epidermis-specific secreted glyco...    298   6e-93    
ref|XP_006487521.1|  PREDICTED: epidermis-specific secreted glyco...    305   1e-92    
ref|XP_011029572.1|  PREDICTED: epidermis-specific secreted glyco...    296   3e-92    
ref|XP_006362412.1|  PREDICTED: epidermis-specific secreted glyco...    296   3e-92    
gb|KGN53560.1|  hypothetical protein Csa_4G082370                       294   2e-91    
ref|XP_006442505.1|  hypothetical protein CICLE_v10020396mg             291   9e-91    
ref|XP_011029571.1|  PREDICTED: epidermis-specific secreted glyco...    291   2e-90    
gb|AAO15899.1|  secreted glycoprotein                                   290   4e-90    Linum usitatissimum
ref|XP_010108235.1|  Epidermis-specific secreted glycoprotein EP1       287   6e-89    
ref|XP_002316857.2|  curculin-like lectin family protein                287   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010279127.1|  PREDICTED: epidermis-specific secreted glyco...    286   3e-88    
ref|XP_008812087.1|  PREDICTED: epidermis-specific secreted glyco...    285   4e-88    
gb|KCW67507.1|  hypothetical protein EUGRSUZ_F01236                     284   5e-88    
ref|XP_010916746.1|  PREDICTED: epidermis-specific secreted glyco...    285   7e-88    
ref|XP_008359357.1|  PREDICTED: LOW QUALITY PROTEIN: epidermis-sp...    285   2e-87    
dbj|BAD24818.1|  cell attachment protein in somatic embryogenesis       283   3e-87    Daucus carota [carrots]
ref|XP_009404508.1|  PREDICTED: epidermis-specific secreted glyco...    283   5e-87    
gb|KDO39539.1|  hypothetical protein CISIN_1g043457mg                   280   3e-86    
ref|XP_006442511.1|  hypothetical protein CICLE_v10024064mg             278   2e-85    
ref|XP_006487520.1|  PREDICTED: epidermis-specific secreted glyco...    278   4e-85    
ref|XP_010108233.1|  Epidermis-specific secreted glycoprotein EP1       275   2e-84    
ref|XP_011013506.1|  PREDICTED: epidermis-specific secreted glyco...    268   9e-84    
ref|XP_010540152.1|  PREDICTED: epidermis-specific secreted glyco...    272   9e-83    
ref|XP_008386344.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    285   4e-82    
emb|CDY62606.1|  BnaCnng40530D                                          268   1e-81    
ref|XP_006301909.1|  hypothetical protein CARUB_v10022385mg             268   2e-81    
ref|XP_010472718.1|  PREDICTED: epidermis-specific secreted glyco...    268   2e-81    
ref|XP_002889216.1|  hypothetical protein ARALYDRAFT_895785             268   2e-81    
ref|XP_010417494.1|  PREDICTED: epidermis-specific secreted glyco...    268   3e-81    
ref|NP_178007.1|  curculin-like (mannose-binding) lectin family p...    266   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104565.1|  PREDICTED: epidermis-specific secreted glyco...    266   1e-80    
ref|XP_010429745.1|  PREDICTED: epidermis-specific secreted glyco...    266   2e-80    
ref|XP_009106600.1|  PREDICTED: epidermis-specific secreted glyco...    265   2e-80    
ref|XP_006378040.1|  hypothetical protein POPTR_0010s00810g             265   3e-80    
ref|XP_010429744.1|  PREDICTED: epidermis-specific secreted glyco...    265   4e-80    
ref|XP_010417493.1|  PREDICTED: epidermis-specific secreted glyco...    265   4e-80    
emb|CDX87429.1|  BnaA07g34440D                                          265   4e-80    
emb|CDY57940.1|  BnaA07g38400D                                          264   7e-80    
emb|CDX88484.1|  BnaC06g39280D                                          262   5e-79    
gb|AAN31898.1|  putative glycoprotein (EP1)                             262   6e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178006.1|  curculin-like (mannose-binding) lectin family p...    262   6e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389952.1|  hypothetical protein EUTSA_v10018565mg             261   2e-78    
ref|XP_009794707.1|  PREDICTED: epidermis-specific secreted glyco...    251   2e-78    
ref|XP_009118161.1|  PREDICTED: epidermis-specific secreted glyco...    259   6e-78    
ref|XP_004170214.1|  PREDICTED: epidermis-specific secreted glyco...    259   1e-77    
ref|XP_006417289.1|  hypothetical protein EUTSA_v10007630mg             258   1e-77    
ref|XP_004146093.1|  PREDICTED: epidermis-specific secreted glyco...    258   2e-77    
ref|XP_010540151.1|  PREDICTED: epidermis-specific secreted glyco...    257   3e-77    
gb|KHN36884.1|  Epidermis-specific secreted glycoprotein EP1            254   4e-77    
gb|KFK42262.1|  hypothetical protein AALP_AA2G232400                    256   6e-77    
gb|KCW67505.1|  hypothetical protein EUGRSUZ_F01234                     254   9e-77    
ref|XP_006301927.1|  hypothetical protein CARUB_v10022403mg             255   3e-76    
gb|AAN60345.1|  unknown                                                 254   4e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389953.1|  hypothetical protein EUTSA_v10018557mg             254   5e-76    
ref|XP_007211483.1|  hypothetical protein PRUPE_ppa007630mg             251   5e-76    
ref|XP_010537731.1|  PREDICTED: epidermis-specific secreted glyco...    254   8e-76    
ref|XP_007021734.1|  Curculin-like (mannose-binding) lectin famil...    254   9e-76    
ref|NP_565191.1|  curculin-like (mannose-binding) lectin-like pro...    253   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AAL38777.1|  unknown protein                                         253   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429723.1|  PREDICTED: epidermis-specific secreted glyco...    252   4e-75    
ref|XP_010417491.1|  PREDICTED: epidermis-specific secreted glyco...    252   5e-75    
ref|XP_008367995.1|  PREDICTED: epidermis-specific secreted glyco...    251   7e-75    
emb|CDP06010.1|  unnamed protein product                                251   1e-74    
emb|CBI20194.3|  unnamed protein product                                248   1e-74    
ref|XP_010472717.1|  PREDICTED: epidermis-specific secreted glyco...    251   1e-74    
ref|XP_009334041.1|  PREDICTED: epidermis-specific secreted glyco...    251   1e-74    
gb|KFK42261.1|  hypothetical protein AALP_AA2G232300                    251   2e-74    
ref|XP_002283150.1|  PREDICTED: epidermis-specific secreted glyco...    249   3e-74    Vitis vinifera
ref|XP_002889215.1|  hypothetical protein ARALYDRAFT_477046             248   1e-73    
ref|XP_007211490.1|  hypothetical protein PRUPE_ppa007720mg             244   2e-73    
ref|XP_008386253.1|  PREDICTED: epidermis-specific secreted glyco...    247   5e-73    
ref|XP_002532023.1|  Epidermis-specific secreted glycoprotein EP1...    240   8e-73    Ricinus communis
ref|XP_010429721.1|  PREDICTED: epidermis-specific secreted glyco...    245   2e-72    
ref|XP_009339971.1|  PREDICTED: epidermis-specific secreted glyco...    245   2e-72    
emb|CDX87431.1|  BnaA07g34420D                                          243   2e-71    
gb|AFP82244.1|  mannose-binding protein 2                               242   3e-71    
emb|CDX88481.1|  BnaC06g39250D                                          242   4e-71    
ref|XP_010417490.1|  PREDICTED: epidermis-specific secreted glyco...    242   4e-71    
emb|CDY57939.1|  BnaA07g38390D                                          241   4e-71    
ref|XP_010472716.1|  PREDICTED: epidermis-specific secreted glyco...    241   1e-70    
ref|XP_010498030.1|  PREDICTED: epidermis-specific secreted glyco...    240   1e-70    
ref|XP_009106596.1|  PREDICTED: epidermis-specific secreted glyco...    240   2e-70    
ref|XP_002889214.1|  hypothetical protein ARALYDRAFT_895783             239   3e-70    
ref|XP_006300474.1|  hypothetical protein CARUB_v10020275mg             239   4e-70    
ref|XP_009104566.1|  PREDICTED: epidermis-specific secreted glyco...    238   1e-69    
ref|XP_010459247.1|  PREDICTED: epidermis-specific secreted glyco...    233   6e-69    
ref|XP_010459248.1|  PREDICTED: epidermis-specific secreted glyco...    233   8e-69    
ref|XP_010531929.1|  PREDICTED: epidermis-specific secreted glyco...    233   4e-68    
ref|NP_178003.1|  D-mannose binding lectin protein with Apple-lik...    234   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596383.1|  hypothetical protein MTR_2g076650                  227   5e-68    
gb|AAM53294.1|  putative glycoprotein EP1                               232   2e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDP06008.1|  unnamed protein product                                232   7e-67    
gb|EYU43334.1|  hypothetical protein MIMGU_mgv1a009006mg                227   1e-66    
ref|NP_001077549.2|  curculin-like (mannose-binding) lectin-like ...    228   4e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211596.1|  hypothetical protein PRUPE_ppa005448mg             227   2e-65    
ref|XP_008226535.1|  PREDICTED: epidermis-specific secreted glyco...    227   2e-65    
ref|XP_002317422.2|  hypothetical protein POPTR_0011s07370g             224   3e-65    Populus trichocarpa [western balsam poplar]
emb|CDP06009.1|  unnamed protein product                                226   4e-65    
ref|XP_004294121.1|  PREDICTED: epidermis-specific secreted glyco...    226   6e-65    
gb|AAF99842.1|AC051629_9  Hypothetical protein                          222   3e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212712.1|  hypothetical protein PRUPE_ppa018756mg             216   7e-64    
ref|XP_010498022.1|  PREDICTED: epidermis-specific secreted glyco...    222   7e-64    
ref|XP_002892928.1|  sugar binding protein                              221   1e-63    
ref|XP_010459246.1|  PREDICTED: epidermis-specific secreted glyco...    219   5e-63    
gb|EYU43333.1|  hypothetical protein MIMGU_mgv1a026460mg                216   2e-62    
ref|XP_006416761.1|  hypothetical protein EUTSA_v10007731mg             216   7e-62    
gb|AFR61756.1|  curculin-like mannose-binding lectin family protein     196   2e-56    
gb|AFR61789.1|  curculin-like mannose-binding lectin family protein     196   2e-56    
gb|AFR61726.1|  curculin-like mannose-binding lectin family protein     196   2e-56    
gb|AFR61846.1|  curculin-like mannose-binding lectin family protein     195   3e-56    
gb|AFR61757.1|  curculin-like mannose-binding lectin family protein     195   4e-56    
gb|AFR61875.1|  curculin-like mannose-binding lectin family protein     195   4e-56    
gb|AFR61761.1|  curculin-like mannose-binding lectin family protein     194   7e-56    
gb|AFR61945.1|  curculin-like mannose-binding lectin family protein     194   8e-56    
gb|AFR61729.1|  curculin-like mannose-binding lectin family protein     194   8e-56    
gb|AFR61784.1|  curculin-like mannose-binding lectin family protein     193   2e-55    
gb|AAT72501.1|  AT1G78850                                               187   2e-53    Arabidopsis lyrata subsp. petraea
ref|XP_010673067.1|  PREDICTED: epidermis-specific secreted glyco...    194   6e-53    
ref|XP_003596380.1|  Epidermis-specific secreted glycoprotein EP1       187   4e-52    
gb|KFK43890.1|  hypothetical protein AALP_AA1G187200                    177   2e-45    
ref|XP_006442510.1|  hypothetical protein CICLE_v10024219mg             159   1e-41    
gb|KDO44630.1|  hypothetical protein CISIN_1g047082mg                   158   2e-41    
ref|XP_007214451.1|  hypothetical protein PRUPE_ppa024445mg             153   3e-41    
gb|AFK43600.1|  unknown                                                 156   2e-40    
ref|XP_007212643.1|  hypothetical protein PRUPE_ppa018111mg             154   3e-40    
gb|ABR18243.1|  unknown                                                 152   8e-38    Picea sitchensis
gb|ACN57418.1|  At1g78850-like protein                                  139   7e-36    Capsella grandiflora
gb|ACN57417.1|  At1g78850-like protein                                  139   7e-36    Capsella grandiflora
gb|ACN57425.1|  At1g78850-like protein                                  139   8e-36    Capsella grandiflora
gb|ACN57401.1|  At1g78850-like protein                                  139   9e-36    Capsella rubella
gb|ACN57415.1|  At1g78850-like protein                                  139   1e-35    Capsella grandiflora
gb|ACN57416.1|  At1g78850-like protein                                  139   1e-35    Capsella grandiflora
gb|ACN57429.1|  At1g78850-like protein                                  138   2e-35    Capsella grandiflora
gb|ACN57431.1|  At1g78850-like protein                                  137   4e-35    Capsella grandiflora
gb|ACN57428.1|  At1g78850-like protein                                  137   6e-35    Capsella grandiflora
gb|ACN57426.1|  At1g78850-like protein                                  137   7e-35    Capsella grandiflora
gb|ACN57427.1|  At1g78850-like protein                                  135   2e-34    Capsella grandiflora
gb|ACN57430.1|  At1g78850-like protein                                  134   4e-34    Capsella grandiflora
ref|XP_007212663.1|  hypothetical protein PRUPE_ppa018303mg             134   2e-32    
ref|XP_011007075.1|  PREDICTED: epidermis-specific secreted glyco...    122   2e-29    
ref|XP_002985869.1|  hypothetical protein SELMODRAFT_123124             127   2e-29    
gb|EMT14318.1|  Putative receptor protein kinase ZmPK1                  130   3e-29    
ref|XP_009778430.1|  PREDICTED: G-type lectin S-receptor-like ser...    130   5e-29    
ref|XP_009620921.1|  PREDICTED: G-type lectin S-receptor-like ser...    127   4e-28    
ref|XP_002987876.1|  hypothetical protein SELMODRAFT_126716             122   1e-27    
ref|XP_002990448.1|  hypothetical protein SELMODRAFT_131652             120   5e-27    
gb|KDO44632.1|  hypothetical protein CISIN_1g0184022mg                  119   5e-27    
ref|XP_006358140.1|  PREDICTED: G-type lectin S-receptor-like ser...    123   8e-27    
ref|XP_002984805.1|  hypothetical protein SELMODRAFT_121264             120   9e-27    
gb|EAY93506.1|  hypothetical protein OsI_15301                          119   2e-25    Oryza sativa Indica Group [Indian rice]
emb|CAH66217.1|  OSIGBa0157N01.3                                        119   2e-25    Oryza sativa [red rice]
gb|AFW71183.1|  putative D-mannose binding lectin receptor-like p...    116   1e-24    
gb|KDO39293.1|  hypothetical protein CISIN_1g040039mg                   111   1e-24    
ref|XP_006492266.1|  PREDICTED: G-type lectin S-receptor-like ser...    116   1e-24    
ref|XP_006448031.1|  hypothetical protein CICLE_v10014464mg             115   2e-24    
ref|XP_010038762.1|  PREDICTED: epidermis-specific secreted glyco...    110   3e-24    
gb|EAZ30147.1|  hypothetical protein OsJ_14201                          114   6e-24    Oryza sativa Japonica Group [Japonica rice]
emb|CAE05335.2|  OSJNBa0079M09.4                                        114   6e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006448032.1|  hypothetical protein CICLE_v10017695mg             114   7e-24    
ref|NP_001052412.2|  Os04g0303500                                       114   8e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010316849.1|  PREDICTED: epidermis-specific secreted glyco...    107   1e-23    
ref|XP_006492260.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   2e-23    
ref|NP_001045452.1|  Os01g0958200                                       110   2e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006448037.1|  hypothetical protein CICLE_v10015566mg             109   2e-23    
ref|XP_006492270.1|  PREDICTED: G-type lectin S-receptor-like ser...    110   3e-23    
gb|KDO44633.1|  hypothetical protein CISIN_1g0184021mg                  102   3e-23    
ref|XP_006492264.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   3e-23    
emb|CAH66079.1|  H0215E01.7                                             111   4e-23    Oryza sativa [red rice]
emb|CAE04686.2|  OSJNBb0018A10.15                                       111   5e-23    Oryza sativa [red rice]
ref|XP_006448036.1|  hypothetical protein CICLE_v10014371mg             110   6e-23    
ref|XP_006448035.1|  hypothetical protein CICLE_v10014371mg             110   7e-23    
ref|XP_010661456.1|  PREDICTED: epidermis-specific secreted glyco...    103   1e-22    
emb|CAH66083.1|  H0215E01.11                                            110   1e-22    Oryza sativa [red rice]
gb|KDO58621.1|  hypothetical protein CISIN_1g048192mg                   107   1e-22    
emb|CAE05332.2|  OSJNBa0079M09.1                                        110   1e-22    Oryza sativa Japonica Group [Japonica rice]
gb|KCW49730.1|  hypothetical protein EUGRSUZ_K03227                     103   1e-22    
gb|EEE60707.1|  hypothetical protein OsJ_14200                          110   1e-22    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173852.1|  Os04g0303300                                       109   2e-22    
gb|KCW47671.1|  hypothetical protein EUGRSUZ_K01410                     109   2e-22    
ref|XP_008791435.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    109   2e-22    
gb|KDP21143.1|  hypothetical protein JCGZ_21614                         109   2e-22    
gb|EMS64724.1|  G-type lectin S-receptor-like serine/threonine-pr...    109   2e-22    
ref|XP_008779646.1|  PREDICTED: epidermis-specific secreted glyco...    104   3e-22    
ref|XP_004243251.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   6e-22    
gb|EMT08394.1|  Putative receptor protein kinase ZmPK1                  108   7e-22    
ref|XP_010324079.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   8e-22    
ref|XP_009798696.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   8e-22    
ref|XP_010324078.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   9e-22    
ref|XP_002456960.1|  hypothetical protein SORBIDRAFT_03g046410          105   1e-21    
ref|XP_003632253.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   1e-21    
gb|KCW49728.1|  hypothetical protein EUGRSUZ_K03225                     107   1e-21    
ref|XP_004243252.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   1e-21    
gb|EAZ37312.1|  hypothetical protein OsJ_21652                          107   1e-21    
ref|XP_003578879.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   1e-21    
dbj|BAD27663.1|  putative S-receptor kinase                             106   2e-21    
gb|EEC72793.1|  hypothetical protein OsI_06477                          106   2e-21    
ref|XP_006647105.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   2e-21    
gb|EMT28453.1|  Epidermis-specific secreted glycoprotein EP1            102   2e-21    
gb|KCW49738.1|  hypothetical protein EUGRSUZ_K03237                     106   2e-21    
ref|XP_010039230.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   2e-21    
gb|KCW47382.1|  hypothetical protein EUGRSUZ_K01182                     105   3e-21    
gb|ACI26722.1|  receptor-like kinase                                    105   4e-21    
ref|XP_002451837.1|  hypothetical protein SORBIDRAFT_04g008440          105   4e-21    
ref|XP_006652160.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   5e-21    
ref|XP_006348903.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   6e-21    
emb|CAH66078.1|  H0215E01.6                                             103   7e-21    
ref|XP_002525879.1|  S-locus-specific glycoprotein precursor, put...    103   7e-21    
ref|XP_009763890.1|  PREDICTED: G-type lectin S-receptor-like ser...    104   7e-21    
gb|EEC76989.1|  hypothetical protein OsI_15296                          104   1e-20    
ref|XP_009605931.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   1e-20    
gb|EMT26049.1|  Putative receptor protein kinase ZmPK1                  103   1e-20    
ref|XP_004975239.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   2e-20    
ref|XP_011098378.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   2e-20    
ref|XP_006348915.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   2e-20    
gb|EEE60705.1|  hypothetical protein OsJ_14196                          103   2e-20    
ref|XP_006348914.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   2e-20    
ref|XP_006448033.1|  hypothetical protein CICLE_v10017951mg           97.8    2e-20    
ref|XP_010925665.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   2e-20    
ref|XP_006838827.1|  hypothetical protein AMTR_s00002p00263020          103   2e-20    
emb|CAE04684.2|  OSJNBb0018A10.13                                       102   3e-20    
gb|KCW47385.1|  hypothetical protein EUGRSUZ_K01186                     100   3e-20    
gb|EEC76988.1|  hypothetical protein OsI_15295                          102   4e-20    
gb|EMT19168.1|  Putative receptor protein kinase ZmPK1                  102   4e-20    
ref|XP_010323666.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   4e-20    
ref|XP_010039229.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   5e-20    
ref|XP_010038718.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   5e-20    
ref|XP_003572973.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   5e-20    
ref|XP_002525880.1|  serine-threonine protein kinase, plant-type,...    102   5e-20    
ref|XP_010058849.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   5e-20    
gb|KCW44223.1|  hypothetical protein EUGRSUZ_L02352                     102   5e-20    
ref|XP_006348984.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   6e-20    
gb|KCW47376.1|  hypothetical protein EUGRSUZ_K01175                     102   6e-20    
ref|XP_004971322.1|  PREDICTED: putative receptor protein kinase ...    100   7e-20    
gb|EYU30749.1|  hypothetical protein MIMGU_mgv1a019140mg                102   7e-20    
gb|KCW47380.1|  hypothetical protein EUGRSUZ_K01180                     101   7e-20    
gb|KCW49725.1|  hypothetical protein EUGRSUZ_K03222                     101   7e-20    
ref|XP_003571152.1|  PREDICTED: G-type lectin S-receptor-like ser...    101   9e-20    
emb|CDP15995.1|  unnamed protein product                                101   1e-19    
ref|XP_010038721.1|  PREDICTED: G-type lectin S-receptor-like ser...    101   1e-19    
ref|XP_010059113.1|  PREDICTED: G-type lectin S-receptor-like ser...    101   1e-19    
gb|KCW48954.1|  hypothetical protein EUGRSUZ_K02564                     100   1e-19    
ref|XP_009405076.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    101   1e-19    
ref|XP_004243248.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   1e-19    
ref|XP_002277451.2|  PREDICTED: G-type lectin S-receptor-like ser...    100   1e-19    
ref|XP_011010908.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   1e-19    
ref|XP_009605954.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   1e-19    
gb|EMS63048.1|  G-type lectin S-receptor-like serine/threonine-pr...    100   1e-19    
ref|XP_010038719.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   1e-19    
ref|XP_010657157.1|  PREDICTED: epidermis-specific secreted glyco...  96.3    1e-19    
ref|XP_006348913.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   1e-19    
ref|XP_009611942.1|  PREDICTED: G-type lectin S-receptor-like ser...  99.4    2e-19    
ref|XP_011010907.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   2e-19    
gb|KDP32540.1|  hypothetical protein JCGZ_14743                       96.7    2e-19    
gb|EYU30750.1|  hypothetical protein MIMGU_mgv1a024561mg                100   2e-19    
emb|CDP12449.1|  unnamed protein product                                100   2e-19    
ref|XP_009778145.1|  PREDICTED: G-type lectin S-receptor-like ser...  99.8    3e-19    
emb|CDP18750.1|  unnamed protein product                              97.8    4e-19    
ref|NP_001168278.1|  putative D-mannose binding lectin domain rel...  98.6    4e-19    
gb|KDP39797.1|  hypothetical protein JCGZ_03933                       98.2    4e-19    
emb|CAH66703.1|  OSIGBa0147J19.7                                      99.4    4e-19    
gb|EEC78162.1|  hypothetical protein OsI_17727                        99.4    5e-19    
emb|CAH66077.1|  H0215E01.5                                           99.0    5e-19    
gb|EMS64723.1|  G-type lectin S-receptor-like serine/threonine-pr...  99.0    6e-19    
ref|XP_009605940.1|  PREDICTED: G-type lectin S-receptor-like ser...  99.0    6e-19    
gb|EEE60704.1|  hypothetical protein OsJ_14195                        98.6    7e-19    
ref|XP_010323667.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.6    7e-19    
ref|XP_009593099.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.6    8e-19    
ref|XP_009605729.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.6    8e-19    
ref|XP_002278212.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.6    8e-19    
ref|XP_010256777.1|  PREDICTED: putative receptor protein kinase ...  98.6    9e-19    
ref|XP_009795619.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.2    1e-18    
ref|XP_009593100.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.8    1e-18    
ref|XP_010323668.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.8    1e-18    
dbj|BAJ89300.1|  predicted protein                                    97.8    1e-18    
gb|EMT08875.1|  Putative LRR receptor-like serine/threonine-prote...  97.8    1e-18    
dbj|BAJ90008.1|  predicted protein                                    97.1    1e-18    
gb|EMS49522.1|  G-type lectin S-receptor-like serine/threonine-pr...  97.8    2e-18    
ref|XP_010657072.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.4    2e-18    
gb|EEE61822.1|  hypothetical protein OsJ_16454                        97.4    2e-18    
ref|NP_001054113.1|  Os04g0655000                                     97.4    2e-18    
ref|XP_002437131.1|  hypothetical protein SORBIDRAFT_10g021740        97.4    2e-18    
ref|XP_011033510.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.4    2e-18    
gb|KCW49736.1|  hypothetical protein EUGRSUZ_K03234                   97.1    2e-18    
emb|CDM86673.1|  unnamed protein product                              95.9    2e-18    
ref|XP_010037953.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.1    2e-18    
ref|XP_011010909.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.1    2e-18    
ref|XP_010040878.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.1    3e-18    
ref|XP_002525876.1|  serine-threonine protein kinase, plant-type,...  97.1    3e-18    
ref|XP_006348904.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.1    3e-18    
gb|EMT26048.1|  Putative receptor protein kinase ZmPK1                97.1    3e-18    
gb|EEC80794.1|  hypothetical protein OsI_23330                        96.3    3e-18    
ref|XP_006656152.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.7    3e-18    
emb|CDP15997.1|  unnamed protein product                              96.7    3e-18    
gb|KCW44834.1|  hypothetical protein EUGRSUZ_L01598                   96.7    3e-18    
ref|XP_002445840.1|  hypothetical protein SORBIDRAFT_07g026780        96.7    3e-18    
ref|XP_006348981.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.7    3e-18    
emb|CBI22051.3|  unnamed protein product                              96.3    3e-18    
gb|EAY95859.1|  hypothetical protein OsI_17725                        96.3    4e-18    
gb|EMS64869.1|  G-type lectin S-receptor-like serine/threonine-pr...  96.3    4e-18    
ref|XP_002992140.1|  hypothetical protein SELMODRAFT_430340           96.3    5e-18    
emb|CDP15994.1|  unnamed protein product                              96.3    5e-18    
emb|CDO98553.1|  unnamed protein product                              96.3    5e-18    
emb|CDO98556.1|  unnamed protein product                              95.9    5e-18    
emb|CDP07729.1|  unnamed protein product                              95.9    5e-18    
ref|XP_010256775.1|  PREDICTED: putative receptor protein kinase ...  95.9    6e-18    
ref|XP_010242119.1|  PREDICTED: G-type lectin S-receptor-like ser...  95.9    6e-18    
ref|XP_004951359.1|  PREDICTED: G-type lectin S-receptor-like ser...  95.9    6e-18    
ref|XP_007048759.1|  S-domain-2 5, putative                           95.5    7e-18    
ref|XP_002305722.2|  hypothetical protein POPTR_0004s06050g           95.9    7e-18    
emb|CBI22052.3|  unnamed protein product                              95.5    8e-18    
ref|XP_002977255.1|  hypothetical protein SELMODRAFT_417153           95.5    8e-18    
ref|XP_010657163.1|  PREDICTED: G-type lectin S-receptor-like ser...  95.5    8e-18    
gb|KCW47386.1|  hypothetical protein EUGRSUZ_K01188                   95.1    9e-18    
ref|XP_010242180.1|  PREDICTED: G-type lectin S-receptor-like ser...  95.1    1e-17    
ref|XP_010657074.1|  PREDICTED: G-type lectin S-receptor-like ser...  94.7    1e-17    
ref|XP_002970206.1|  hypothetical protein SELMODRAFT_93883            94.0    1e-17    
ref|XP_002445841.1|  hypothetical protein SORBIDRAFT_07g026790        94.7    1e-17    
ref|XP_010039226.1|  PREDICTED: G-type lectin S-receptor-like ser...  94.7    1e-17    
gb|KCW49732.1|  hypothetical protein EUGRSUZ_K03230                   94.7    2e-17    
emb|CAE01553.2|  OSJNBb0022F16.8                                      94.7    2e-17    
gb|EEE61821.1|  hypothetical protein OsJ_16453                        94.4    2e-17    
emb|CDP15993.1|  unnamed protein product                              94.4    2e-17    
ref|XP_002977254.1|  hypothetical protein SELMODRAFT_417150           93.6    2e-17    
ref|XP_003575454.2|  PREDICTED: G-type lectin S-receptor-like ser...  94.0    3e-17    
ref|XP_010262647.1|  PREDICTED: putative receptor protein kinase ...  94.0    3e-17    
ref|XP_007026896.1|  S-locus lectin protein kinase family protein...  94.0    3e-17    
gb|EMT32501.1|  Putative receptor protein kinase ZmPK1                93.6    3e-17    
gb|KDP39795.1|  hypothetical protein JCGZ_03931                       93.6    3e-17    
ref|XP_002968697.1|  hypothetical protein SELMODRAFT_72382            87.0    4e-17    
ref|XP_002439623.1|  hypothetical protein SORBIDRAFT_09g017130        93.2    4e-17    
gb|AEI84329.1|  lectin-domain receptor-like kinase                    93.2    4e-17    
ref|XP_006664306.1|  PREDICTED: putative receptor protein kinase ...  93.6    4e-17    
emb|CAE04682.2|  OSJNBb0018A10.11                                     93.2    4e-17    
gb|EMT29879.1|  Putative receptor protein kinase ZmPK1                93.2    4e-17    
ref|XP_003571192.1|  PREDICTED: putative receptor protein kinase ...  93.2    5e-17    
ref|XP_006493594.1|  PREDICTED: putative receptor protein kinase ...  93.2    5e-17    
ref|XP_010239060.1|  PREDICTED: LOW QUALITY PROTEIN: epidermis-sp...  92.0    6e-17    
ref|XP_002965408.1|  hypothetical protein SELMODRAFT_439216           92.8    6e-17    
ref|XP_006370149.1|  hypothetical protein POPTR_0001s40150g           88.6    6e-17    
ref|XP_007037704.1|  S-domain-2 5, putative                           92.8    7e-17    
ref|XP_002965407.1|  hypothetical protein SELMODRAFT_406744           92.0    7e-17    
ref|XP_003575768.1|  PREDICTED: G-type lectin S-receptor-like ser...  92.4    8e-17    
ref|XP_002454976.1|  hypothetical protein SORBIDRAFT_03g002430        92.4    8e-17    
ref|XP_007208080.1|  hypothetical protein PRUPE_ppa001517mg           92.4    8e-17    
ref|XP_009618783.1|  PREDICTED: G-type lectin S-receptor-like ser...  92.0    9e-17    
gb|KCW89671.1|  hypothetical protein EUGRSUZ_A01943                   92.0    1e-16    
ref|XP_006429200.1|  hypothetical protein CICLE_v10013547mg           92.0    1e-16    
ref|XP_006429205.1|  hypothetical protein CICLE_v10013584mg           91.7    1e-16    
emb|CAN61888.1|  hypothetical protein VITISV_030055                   90.9    1e-16    
ref|XP_003579405.1|  PREDICTED: putative receptor protein kinase ...  91.7    1e-16    
ref|XP_009396505.1|  PREDICTED: putative receptor protein kinase ...  91.7    1e-16    
gb|EEC70837.1|  hypothetical protein OsI_02334                        91.3    2e-16    
ref|XP_010928583.1|  PREDICTED: putative receptor protein kinase ...  91.7    2e-16    
ref|XP_003633281.1|  PREDICTED: G-type lectin S-receptor-like ser...  91.3    2e-16    
ref|XP_010673822.1|  PREDICTED: G-type lectin S-receptor-like ser...  91.3    2e-16    
ref|XP_002989947.1|  hypothetical protein SELMODRAFT_72383            85.1    2e-16    
ref|XP_006429199.1|  hypothetical protein CICLE_v10011053mg           91.3    2e-16    
ref|XP_010673820.1|  PREDICTED: G-type lectin S-receptor-like ser...  91.3    2e-16    
ref|XP_010323669.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  91.3    2e-16    
dbj|BAD53660.1|  putative S-domain receptor-like protein kinase       90.9    2e-16    
ref|XP_004968567.1|  PREDICTED: G-type lectin S-receptor-like ser...  90.9    2e-16    
gb|EMS66247.1|  Putative receptor protein kinase ZmPK1                90.9    3e-16    
ref|XP_002445226.1|  hypothetical protein SORBIDRAFT_07g006250        90.5    3e-16    
ref|XP_002277643.1|  PREDICTED: G-type lectin S-receptor-like ser...  90.5    4e-16    
ref|XP_002978370.1|  hypothetical protein SELMODRAFT_109047           89.7    4e-16    
gb|EMT18051.1|  Putative serine/threonine-protein kinase              90.5    4e-16    
ref|XP_008779061.1|  PREDICTED: putative receptor protein kinase ...  90.5    4e-16    
ref|XP_010262649.1|  PREDICTED: putative receptor protein kinase ...  90.5    4e-16    
ref|XP_010657065.1|  PREDICTED: G-type lectin S-receptor-like ser...  90.5    4e-16    
ref|XP_002277928.2|  PREDICTED: G-type lectin S-receptor-like ser...  90.5    4e-16    
ref|XP_006373909.1|  hypothetical protein POPTR_0016s10340g           90.1    4e-16    
ref|XP_002277406.2|  PREDICTED: G-type lectin S-receptor-like ser...  90.1    5e-16    
ref|XP_009394605.1|  PREDICTED: putative receptor protein kinase ...  90.1    5e-16    
ref|XP_011094919.1|  PREDICTED: putative receptor protein kinase ...  89.7    5e-16    
ref|XP_010672406.1|  PREDICTED: putative receptor protein kinase ...  89.7    5e-16    
gb|EAY79819.1|  hypothetical protein OsI_34977                        89.7    6e-16    
ref|XP_002992105.1|  hypothetical protein SELMODRAFT_448668           88.2    6e-16    
ref|NP_001065666.2|  Os11g0132900                                     89.7    6e-16    
ref|XP_010672398.1|  PREDICTED: putative receptor protein kinase ...  89.7    6e-16    
ref|XP_008240299.1|  PREDICTED: putative receptor protein kinase ...  89.7    6e-16    
emb|CAN67059.1|  hypothetical protein VITISV_036716                   89.7    6e-16    
ref|XP_002991451.1|  hypothetical protein SELMODRAFT_429740           89.0    6e-16    
gb|ABA91378.1|  D-mannose binding lectin family protein, expressed    89.7    6e-16    
emb|CAH66082.1|  H0215E01.10                                          89.7    7e-16    
emb|CBX25229.1|  hypothetical_protein                                 89.7    7e-16    
gb|EEE60706.1|  hypothetical protein OsJ_14199                        89.4    8e-16    
emb|CBX25415.1|  hypothetical_protein                                 89.7    8e-16    
ref|XP_010920495.1|  PREDICTED: putative receptor protein kinase ...  89.4    8e-16    
ref|XP_003518113.1|  PREDICTED: G-type lectin S-receptor-like ser...  89.4    9e-16    
gb|KHN05964.1|  G-type lectin S-receptor-like serine/threonine-pr...  89.4    9e-16    
gb|EAZ01299.1|  hypothetical protein OsI_23331                        89.0    1e-15    
gb|KDO57935.1|  hypothetical protein CISIN_1g0418212mg                88.6    1e-15    
dbj|BAK00639.1|  predicted protein                                    89.0    1e-15    
ref|XP_010251948.1|  PREDICTED: G-type lectin S-receptor-like ser...  89.0    1e-15    
ref|XP_010254430.1|  PREDICTED: G-type lectin S-receptor-like ser...  89.0    1e-15    
ref|XP_006493595.1|  PREDICTED: putative receptor protein kinase ...  89.0    1e-15    
ref|XP_010254431.1|  PREDICTED: G-type lectin S-receptor-like ser...  88.6    1e-15    
dbj|BAJ90630.1|  predicted protein                                    88.6    1e-15    
ref|XP_004968870.1|  PREDICTED: G-type lectin S-receptor-like ser...  88.6    2e-15    
gb|EMT24819.1|  Putative receptor protein kinase ZmPK1                88.2    2e-15    
gb|EMT03839.1|  Putative receptor protein kinase ZmPK1                88.6    2e-15    
ref|XP_002464192.1|  hypothetical protein SORBIDRAFT_01g013860        88.2    2e-15    
emb|CBI22034.3|  unnamed protein product                              87.8    2e-15    
ref|XP_002465108.1|  hypothetical protein SORBIDRAFT_01g032150        87.8    2e-15    
dbj|BAJ94314.1|  predicted protein                                    87.8    2e-15    
ref|XP_002529861.1|  receptor protein kinase zmpk1, putative          87.8    2e-15    
ref|XP_002510148.1|  receptor protein kinase zmpk1, putative          87.4    2e-15    
ref|XP_007014677.1|  G-type lectin S-receptor serine/threonine-pr...  87.8    3e-15    



>ref|XP_006348308.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Solanum tuberosum]
Length=297

 Score =   405 bits (1042),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 232/303 (77%), Gaps = 8/303 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPF  948
             SPS  ++ L  L +  QI +C AQVP +NTFKFVNEGELGPYVVEYR DYRV+ +F+NPF
Sbjct  2     SPSWLTTLLASLFLFSQIFSCLAQVPLENTFKFVNEGELGPYVVEYRVDYRVISIFNNPF  61

Query  947   QLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDG  768
             QLCFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F    +GNLVLAD DG
Sbjct  62    QLCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFTFGTNGNLVLADADG  121

Query  767   RVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLV  588
             R+AWQ+ TANKGV GFKLL NGNMVLHD+KG FVWQSF++PTDTLLVGQ+LRLSGP KLV
Sbjct  122   RIAWQTNTANKGVTGFKLLPNGNMVLHDSKGKFVWQSFNYPTDTLLVGQTLRLSGPNKLV  181

Query  587   SRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKT  408
             SRAS  +N NGPY+++++P     YN+TK             WF  G S+LE VK N+  
Sbjct  182   SRASVKKNVNGPYSLVVQPKLFAIYNRTKLGVE-------LAWFDFGNSTLESVKLNSGN  234

Query  407   QTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE-ENFHWGESF  231
             Q LKLDY++AKS+K  +HV+A  K+NTTLTYLRLEIDGNLK YTF  D E + F W  ++
Sbjct  235   QRLKLDYRLAKSTKRSSHVMAFTKYNTTLTYLRLEIDGNLKAYTFVRDEEADEFRWKVTY  294

Query  230   KLF  222
             ++ 
Sbjct  295   QML  297



>ref|XP_004244276.2| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Solanum lycopersicum]
Length=308

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 236/316 (75%), Gaps = 12/316 (4%)
 Frame = -1

Query  1166  IKASYKLNLKNMSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYR  987
             I ++ KLN+    SPS  ++ L  L +  QI +C AQVP +NTFKFVNEGELGPYVVEY+
Sbjct  4     IISNNKLNM----SPSWPTTLLASLFLFSQIFSCIAQVPLENTFKFVNEGELGPYVVEYQ  59

Query  986   ADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFEL  807
             ADYRV+ VFSNPFQLCFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A    
Sbjct  60    ADYRVLSVFSNPFQLCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATLTF  119

Query  806   RQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLV  627
               +GNLVLAD DGR+AWQ+ TANKGV GFKLL NGNMVLHD+KG FVWQSF++PTDTLLV
Sbjct  120   GTNGNLVLADADGRIAWQTNTANKGVTGFKLLPNGNMVLHDSKGKFVWQSFNYPTDTLLV  179

Query  626   GQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVG  447
              Q+LRLSGP KLVSRAS  +N NGPY+++++P     YN+TK             WF  G
Sbjct  180   SQTLRLSGPNKLVSRASVKKNANGPYSLVVQPKLFAIYNRTKLGVE-------LAWFDFG  232

Query  446   KSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYS  267
              S LE VK N   Q LKLDY++AKS+K  +HV+A  K+NTTLTYLRLEIDGNLK YTF  
Sbjct  233   NSMLESVKLNNGNQRLKLDYRLAKSTKRSSHVMAFTKYNTTLTYLRLEIDGNLKAYTFVR  292

Query  266   DAE-ENFHWGESFKLF  222
             D E + F W  ++++ 
Sbjct  293   DEEADEFRWKVTYQML  308



>gb|AGI04215.1| mannose binding lectin [Withania somnifera]
Length=297

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 225/296 (76%), Gaps = 8/296 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPF  948
             SPS  ++    L +  QI  C AQVP +NTFKFVNEGELGP++VEYRADYRV+ VF+NPF
Sbjct  2     SPSWTTTLFASLFLFSQIFCCIAQVPDENTFKFVNEGELGPFIVEYRADYRVLSVFTNPF  61

Query  947   QLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDG  768
             QLCFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F L  DGNLVLA+ +G
Sbjct  62    QLCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFSLGTDGNLVLAEANG  121

Query  767   RVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLV  588
             R+ WQ+ TANKGV GFKLL NGNMVLHD+KG FVWQSF+HPTDTLLVGQSLRLSGP KLV
Sbjct  122   RIVWQTNTANKGVTGFKLLPNGNMVLHDSKGKFVWQSFNHPTDTLLVGQSLRLSGPNKLV  181

Query  587   SRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKT  408
             SRAS  +N NGP++++++P   G +N+ K             W   G S+LE VK N+  
Sbjct  182   SRASVKKNMNGPFSLVVQPKLFGIFNRNKLDVE-------LAWLDFGNSTLESVKLNSGN  234

Query  407   QTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE-ENFHW  243
             Q LKLDY++AKS+K  +HV+A   +NTTLTYLRLEIDGNLK YTF  D E + F W
Sbjct  235   QRLKLDYRLAKSTKRSSHVMAFTNYNTTLTYLRLEIDGNLKAYTFVRDEEADEFRW  290



>gb|ADG04234.1| mannose-binding lectin [Capsicum annuum]
Length=297

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 223/296 (75%), Gaps = 8/296 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPF  948
             SPS  ++  + L +  QI +C AQVPA+NTFKFVNEGELGPY+VEY ADYRV+ + + PF
Sbjct  2     SPSWTTTLFVSLFLFSQIFSCIAQVPAENTFKFVNEGELGPYIVEYSADYRVLRIATTPF  61

Query  947   QLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDG  768
             QLCFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F    DGNLVLAD DG
Sbjct  62    QLCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFTFGTDGNLVLADADG  121

Query  767   RVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLV  588
             R+AWQ+ TANKGV GFKLL NGNMVLHD+KG F+WQSF++PTDTLLVGQ+LRLS P KLV
Sbjct  122   RIAWQTNTANKGVTGFKLLPNGNMVLHDSKGKFLWQSFNYPTDTLLVGQTLRLSSPNKLV  181

Query  587   SRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKT  408
             SRAS   N NGPY+++++P   G Y  TK             WF+ G S+LE VK NA  
Sbjct  182   SRASVKNNANGPYSLVVQPRLFGVYKGTKLDVE-------LAWFNYGNSTLESVKLNAGN  234

Query  407   QTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE-ENFHW  243
             Q LKLDY++AKS+   +HV+A   +NTTLTYLRLEIDGNLK YTF  D E + F W
Sbjct  235   QRLKLDYRLAKSTTRSSHVMAFVNYNTTLTYLRLEIDGNLKAYTFVRDEEADEFRW  290



>ref|XP_006348307.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Solanum tuberosum]
Length=297

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 226/295 (77%), Gaps = 9/295 (3%)
 Frame = -1

Query  1121  SSYSSTLIF-LVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQ  945
             SS+ +TL+  L +  QI +C AQVPA+NTFKFVN+GELG YVVEYRA+YRV+ +F+NPFQ
Sbjct  3     SSWPTTLLASLFLFSQIFSCIAQVPAENTFKFVNDGELGDYVVEYRANYRVISIFNNPFQ  62

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             LCFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F    +GNLVLAD DGR
Sbjct  63    LCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFTFGTNGNLVLADADGR  122

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             +AWQ+ TANKGV GFKLL NGNMVLHD+KG FVWQSF++PTDTLLVGQ+LRLSGP KLVS
Sbjct  123   IAWQTNTANKGVTGFKLLPNGNMVLHDSKGKFVWQSFNYPTDTLLVGQTLRLSGPNKLVS  182

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ  405
             RAS  +N NGPY+++++P     Y   K             WF  G ++LE +K N+  Q
Sbjct  183   RASVKKNANGPYSLVVQPRLFAVYKGNKVDVEL-------AWFDYGNNTLESIKLNSGNQ  235

Query  404   TLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE-ENFHW  243
              LKLDY+ AKS++  +HV+A  K+NTTLTYLRLEIDGNLK YTF  D E + F W
Sbjct  236   RLKLDYRFAKSTQRSSHVMAFTKYNTTLTYLRLEIDGNLKAYTFVRDEEADEFRW  290



>ref|XP_004244275.2| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Solanum lycopersicum]
Length=308

 Score =   389 bits (998),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 232/310 (75%), Gaps = 14/310 (5%)
 Frame = -1

Query  1166  IKASYKLNLKNMSSPSSYSSTLIF-LVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEY  990
             IK++ KLN+      +S+ +TL+  L +  QI +C A VP +NTF+FVNEGELGPY+VEY
Sbjct  4     IKSNNKLNMT-----TSWPTTLLASLFLFSQIFSCIALVPLENTFEFVNEGELGPYIVEY  58

Query  989   RADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFE  810
             +ADYRV+ VF+NPFQLCFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F 
Sbjct  59    QADYRVLSVFNNPFQLCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFT  118

Query  809   LRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLL  630
                +GNLVLAD DGR+AWQS TANKGV GFKLL NGNMVLHD KG FVWQSF++PTDTLL
Sbjct  119   FGTNGNLVLADADGRIAWQSNTANKGVTGFKLLPNGNMVLHDKKGKFVWQSFNYPTDTLL  178

Query  629   VGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSV  450
             VGQ+LRLSGP KLVSRAS  +N NGPY+++++P     Y   K             WF  
Sbjct  179   VGQTLRLSGPNKLVSRASVKKNANGPYSLVVQPRLFAVYKGNKVDVE-------LAWFDY  231

Query  449   GKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFY  270
             G ++LE +K N+  Q LKLDY+ AKS++  +HV+A  K+NTTLTYLRLEIDGNLK YTF 
Sbjct  232   GNNTLESIKLNSGNQRLKLDYRFAKSTQRSSHVMAFTKYNTTLTYLRLEIDGNLKAYTFV  291

Query  269   SDAE-ENFHW  243
              D E + F W
Sbjct  292   RDEEADEFRW  301



>ref|XP_009630449.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nicotiana tomentosiformis]
Length=298

 Score =   387 bits (995),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 229/304 (75%), Gaps = 9/304 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-VFSNP  951
             SPS  ++ ++ L +  QI    AQVP + TFKFVNEGELGP+VVEY+ADYR    +F+NP
Sbjct  2     SPSLPTTLVVSLFLFCQIFPSIAQVPVEKTFKFVNEGELGPFVVEYQADYRAFSGIFTNP  61

Query  950   FQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVD  771
             FQ CFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F L  DGNLVLA+ +
Sbjct  62    FQFCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFALGTDGNLVLAEAN  121

Query  770   GRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKL  591
             GR+AWQ+ TANKGV G+KLL NGN VLH++KG F+WQSFDHPTDTLLVGQSLRLSGP KL
Sbjct  122   GRIAWQTNTANKGVTGYKLLPNGNFVLHNSKGKFIWQSFDHPTDTLLVGQSLRLSGPNKL  181

Query  590   VSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK  411
             +SRAS  +N NGPY++ ++P   G YN+TK +           WF +G S+LE VK N+ 
Sbjct  182   MSRASVKKNANGPYSLEVKPKLFGIYNRTKLAVE-------LAWFDLGNSTLESVKLNSG  234

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEEN-FHWGES  234
              Q LKLDY++AKS+   +HV+A  K NTTLTYLRLEIDGNLK YTFY D EE+ F W  +
Sbjct  235   NQRLKLDYRLAKSTTRSSHVMAFTKINTTLTYLRLEIDGNLKAYTFYEDKEEDRFRWRVT  294

Query  233   FKLF  222
             + + 
Sbjct  295   YNML  298



>ref|XP_009797872.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nicotiana sylvestris]
 ref|XP_009779101.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nicotiana sylvestris]
Length=298

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 228/304 (75%), Gaps = 9/304 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-VFSNP  951
             SPS  ++ +  L +  QI +  AQVP +NTFKFVNEGELGP+VVEY+ADYRV   +F+NP
Sbjct  2     SPSLPTTLVASLFLFCQIFSSIAQVPVENTFKFVNEGELGPFVVEYQADYRVFSGIFTNP  61

Query  950   FQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVD  771
             FQ CFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F L  DGNLVLA+ +
Sbjct  62    FQFCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFSLGTDGNLVLAEAN  121

Query  770   GRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKL  591
             GR+AWQ+ TA KGV GFKLL NGN VLH++KG F+WQSFDHPTDTLLVGQSLRLSGP KL
Sbjct  122   GRIAWQTNTAKKGVTGFKLLPNGNFVLHNSKGKFIWQSFDHPTDTLLVGQSLRLSGPNKL  181

Query  590   VSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK  411
             VSRAS  +N NGPY++ ++P   G YN+TK +           WF    S+LE +K N+ 
Sbjct  182   VSRASMKKNVNGPYSLEVKPKIFGIYNRTKLAVE-------LAWFDFKNSTLESIKLNSG  234

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEEN-FHWGES  234
              Q +KLDY++AKS+   +HV+A  K NTTLTYLRLEIDGNLK YTFY D EE+ F W  +
Sbjct  235   NQRVKLDYRLAKSTTRNSHVMAFTKINTTLTYLRLEIDGNLKAYTFYEDKEEDRFRWRVT  294

Query  233   FKLF  222
             + + 
Sbjct  295   YNML  298



>emb|CDP01431.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 230/313 (73%), Gaps = 11/313 (4%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQ--VPAKNTFKFVNEGELGPYVVEYRADYRVVDVF  960
             M+S     + L FL+  I   +  AQ  VP   TF++VNEGE G YVVEY ADYRV+DVF
Sbjct  1     MASFHCSFTRLAFLLFFIPTFSFIAQASVPDNETFQYVNEGEFGEYVVEYDADYRVLDVF  60

Query  959   SNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLA  780
             ++PFQLCFYNTTPNAYTLALRMGTVRSE  MRWVWEANRG PVR+ A     +DGNLVLA
Sbjct  61    NSPFQLCFYNTTPNAYTLALRMGTVRSESLMRWVWEANRGNPVRENATLTFGKDGNLVLA  120

Query  779   DVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGP  600
             D DGRVAWQS TANKGVVGFKLL +GNMVLHD KGNF+WQSFD PTDTLLVGQ+L+L GP
Sbjct  121   DSDGRVAWQSGTANKGVVGFKLLPDGNMVLHDFKGNFIWQSFDTPTDTLLVGQALKLGGP  180

Query  599   KKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKF  420
               LVSRASE +N NGPY+++L+P +   Y Q++NS R +LY+D +   SV K +LE VKF
Sbjct  181   TTLVSRASEKENINGPYSLVLDPKKFALYYQSENSPRSMLYYDLNTLLSV-KGNLESVKF  239

Query  419   NAKTQT-------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDA  261
              +  +T       +  +Y++  SS  G  +L++PK+N+TLTYLRL IDG+LK YTFY + 
Sbjct  240   TSNPETDEAFAYEITFEYQIVNSSSGGNRILSRPKYNSTLTYLRLGIDGSLKAYTFYPNV  299

Query  260   EENFHWGESFKLF  222
             +    W E++ LF
Sbjct  300   DYG-AWEETYTLF  311



>ref|XP_009630450.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nicotiana tomentosiformis]
Length=298

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 225/304 (74%), Gaps = 9/304 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYR-VVDVFSNP  951
             SPS  ++ +  L +  QI +  AQVP +NTFK+VN+GE GP  +EY A+YR + D+++ P
Sbjct  2     SPSLPTTLVASLFLFCQICSSIAQVPVENTFKYVNDGEFGPSNIEYGANYRGIYDIYTYP  61

Query  950   FQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVD  771
             F LCFYNTTPNA+TLA+RMG+V S   MRWVWEANRG PV+D A F L  DGNLVLAD D
Sbjct  62    FLLCFYNTTPNAWTLAMRMGSVPSNSIMRWVWEANRGNPVKDNATFALGTDGNLVLADAD  121

Query  770   GRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKL  591
             GR+AWQ+ TANKGV G+K+L NGN VLH++KG F+WQSF++PTDTLLVGQSLRLSGP KL
Sbjct  122   GRIAWQTNTANKGVTGYKILPNGNFVLHNSKGKFIWQSFNYPTDTLLVGQSLRLSGPNKL  181

Query  590   VSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK  411
             VSRAS  +N NGPY+++++P   G YN+TK             WF +G SSLE VK N+ 
Sbjct  182   VSRASVKKNANGPYSLVVKPKLFGIYNRTKLDVE-------LAWFDIGNSSLEAVKLNSG  234

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEEN-FHWGES  234
              Q LKLDY++AKS    +HV+A  K+NTT TYLRLEIDGNLK YTF  + +++ + W E+
Sbjct  235   NQRLKLDYRLAKSKTRSSHVMAFTKYNTTFTYLRLEIDGNLKAYTFTGNEQDDRYFWHET  294

Query  233   FKLF  222
             +K+ 
Sbjct  295   YKML  298



>ref|XP_009765600.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nicotiana sylvestris]
Length=298

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 220/302 (73%), Gaps = 9/302 (3%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYR-VVDVFSNP  951
             SPS  +  L+ L +  QI +  AQV    TF++VNEG+ GP  +EY A+YR + D+++ P
Sbjct  2     SPSLPTILLVSLFLFCQIFSSIAQVAVDKTFRYVNEGQFGPSNIEYGANYRGIFDIYTYP  61

Query  950   FQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVD  771
             F LCFYNTTPNA+TLA+RMG+V +   MRWVWEANRG PV++ A F L  DGNLVLAD D
Sbjct  62    FLLCFYNTTPNAWTLAMRMGSVPANSIMRWVWEANRGNPVKENATFALGADGNLVLADAD  121

Query  770   GRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKL  591
             GR+AWQ+ TANKGV G+K+L NGN VLH++KG F+WQSFD+PTDTLLVGQSLRLSGP KL
Sbjct  122   GRIAWQTHTANKGVTGYKILPNGNFVLHNSKGKFIWQSFDYPTDTLLVGQSLRLSGPNKL  181

Query  590   VSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK  411
             VSRAS  +N NGPY++ ++P   G YN+TK +           WF +  SSLE VK N+ 
Sbjct  182   VSRASVKKNANGPYSLEVKPKIFGIYNRTKLAVE-------LAWFDLRNSSLESVKLNSG  234

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEEN-FHWGES  234
              Q LKLDY++AKS    +HV+A  K+NTTL+YLRL IDGNLK YTF  D +++ + W E+
Sbjct  235   NQRLKLDYRLAKSKTRSSHVMAFTKYNTTLSYLRLGIDGNLKAYTFTGDEQDDKYFWHET  294

Query  233   FK  228
             +K
Sbjct  295   YK  296



>ref|XP_002525646.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative 
[Ricinus communis]
 gb|EEF36764.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative 
[Ricinus communis]
Length=427

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/280 (63%), Positives = 205/280 (73%), Gaps = 4/280 (1%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFK+VNEGE G Y+VEY A+YRV+D F+ PFQLCFYNTTPNA+TLALRMGTVR
Sbjct  22    ASVPPSATFKYVNEGEFGEYIVEYDANYRVLDPFAQPFQLCFYNTTPNAFTLALRMGTVR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE  MRWVWEANRG PVR+ A      DGNLVLAD DGR+AWQ+ TANKGVVGFKLL NG
Sbjct  82    SESLMRWVWEANRGNPVRENATLTFGTDGNLVLADADGRIAWQTNTANKGVVGFKLLSNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KG F+WQSFDHPTDTLLVGQSL+L    KLVSRASE QN NGPY+++LE   L
Sbjct  142   NMVLHDSKGKFIWQSFDHPTDTLLVGQSLKLGAATKLVSRASEKQNVNGPYSLVLEEHTL  201

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQ  342
               Y ++  S  P LY   S+ FSV    LE VKF +      L ++  KS+  G+  L +
Sbjct  202   AMYYKSPYSPNPFLYFSFSELFSVTDGPLESVKFESD---FTLTFQGVKSASAGSLTLKR  258

Query  341   PKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             PK+NTTL+YLRLEIDGNL+ YT Y D  +   W  ++ LF
Sbjct  259   PKYNTTLSYLRLEIDGNLRIYT-YEDNADYSAWENTYTLF  297



>ref|XP_006487518.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=348

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 218/305 (71%), Gaps = 7/305 (2%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  +    L +   I    AQVP   TF+FVNEG+ G ++VEY  DYR++ +F+ 
Sbjct  1     MSSSSAIITLFALLPLVFSIAN--AQVPPSETFQFVNEGDFGDFIVEYGGDYRMLGIFNA  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAYTLALRWGLTRQEPFFRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQ+ TANKGVVGFKLL NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR  G  K
Sbjct  119   DGTVVWQTNTANKGVVGFKLLSNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRAGGVAK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +GPY+ ++EP RL  Y ++ NS RP+LY  SS+WF+V + SLE + F +
Sbjct  179   LVSRASEKENIDGPYSFVMEPKRLAMYYKSSNSPRPVLYFTSSEWFTVREGSLENITFTS  238

Query  413   KTQTLK-LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
             + +T +   Y ++  S +    LA+P++N+T++ LRLE+DGNL+ YT+    +E   WG 
Sbjct  239   EPETEEAFAYHLSLDSSVAGVRLARPRYNSTISLLRLEMDGNLRIYTY----DERVDWGP  294

Query  236   SFKLF  222
             + K F
Sbjct  295   TEKTF  299



>ref|XP_003543212.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Glycine max]
 gb|KHN36885.1| Epidermis-specific secreted glycoprotein EP1 [Glycine soja]
Length=435

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 214/305 (70%), Gaps = 3/305 (1%)
 Frame = -1

Query  1130  SSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNP  951
             S P    S L     S   +   A VP   TFKF N GELGPY+VEY ADYR++ +F++P
Sbjct  3     SVPQPKISLLTLFFFSSFTIIAHAIVPQNETFKFENSGELGPYIVEYGADYRMISIFNSP  62

Query  950   FQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVD  771
             FQ+ FYNTTPNA+TLALR+G  RSE   RWVWEANR  PV + A F L  DGNLVLAD D
Sbjct  63    FQVGFYNTTPNAFTLALRVGLQRSEQLFRWVWEANRANPVGENATFSLGTDGNLVLADAD  122

Query  770   GRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKL  591
             GR+AWQ+ TANKGVV F+LL NGNMVL DA+G FVWQSFDHPTDTLLVGQ LR  GP KL
Sbjct  123   GRIAWQTNTANKGVVAFRLLSNGNMVLLDAQGGFVWQSFDHPTDTLLVGQYLRAKGPSKL  182

Query  590   VSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK  411
             VSR SE +N +GPY+++LEP  L  Y ++KNS +PILY  SS WF++ + SLE V F + 
Sbjct  183   VSRLSEKENVDGPYSLVLEPKGLALYYKSKNSPKPILYWFSSDWFTIQRGSLENVTFTSD  242

Query  410   TQTLKL--DYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
              +T +L  DY VA SS  G  +L +P  N+T+TYLRL IDGN++ YT++ D  +   W  
Sbjct  243   PETFELGFDYHVANSSSGGNRILGRPVNNSTITYLRLGIDGNIRFYTYFLDVRDGV-WQV  301

Query  236   SFKLF  222
             ++ LF
Sbjct  302   TYTLF  306



>ref|XP_011083288.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Sesamum indicum]
Length=427

 Score =   351 bits (901),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 221/306 (72%), Gaps = 10/306 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MS P  ++ + +   +  Q       VP   TF FVNEGE G Y+VEY A+YRV+ VFS+
Sbjct  1     MSLPCFFTLSFLLFCICAQ-----GVVPPSQTFNFVNEGEFGDYIVEYDANYRVLSVFSS  55

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQLCFYNTTP AYTLALRMGTVRSE  MRWVWEANRG PV + A F L  +GNLVLAD 
Sbjct  56    PFQLCFYNTTPGAYTLALRMGTVRSESLMRWVWEANRGNPVGENATFSLGANGNLVLADA  115

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DGRVAWQS TA+KGVVGF+LL NGNMVL+D+ G+FVWQSFD PTDTLLVGQ+LRL GP K
Sbjct  116   DGRVAWQSNTADKGVVGFRLLPNGNMVLYDSNGSFVWQSFDLPTDTLLVGQALRLKGPNK  175

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR SE +N +G Y+++LE  R   Y  +KNS RP+LY D++ + S+GK  L+ + FN+
Sbjct  176   LVSRLSEKENKDGAYSLVLESNRFVLYYASKNSPRPMLYFDATDYLSLGK--LDVLTFNS  233

Query  413   KTQTLK-LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
             + +T     Y++  ++   G  +L++PK+N+TLTYLRL IDG L+ YTFY + +    W 
Sbjct  234   QPETEDAFAYEIRLENPNAGTRILSRPKYNSTLTYLRLGIDGGLRAYTFYDNVDWG-AWE  292

Query  239   ESFKLF  222
             E+F LF
Sbjct  293   ETFTLF  298



>ref|XP_006487519.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=443

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 218/305 (71%), Gaps = 7/305 (2%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  +    L +   I    AQVP   TF+FVNEG+ G ++VEY  DYR++ +F+ 
Sbjct  1     MSSSSAIITLFALLPLVFSIAN--AQVPPSETFQFVNEGDFGDFIVEYGGDYRMLGIFNA  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAYTLALRWGLTRQEPFFRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQ+ TANKGVVGFKLL NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR  G  K
Sbjct  119   DGTVVWQTNTANKGVVGFKLLSNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRAGGVAK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +GPY+ ++EP RL  Y ++ NS RP+LY  SS+WF+V + SLE + F +
Sbjct  179   LVSRASEKENIDGPYSFVMEPKRLAMYYKSSNSPRPVLYFTSSEWFTVREGSLENITFTS  238

Query  413   KTQTLK-LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
             + +T +   Y ++  S +    LA+P++N+T++ LRLE+DGNL+ YT+    +E   WG 
Sbjct  239   EPETEEAFAYHLSLDSSVAGVRLARPRYNSTISLLRLEMDGNLRIYTY----DERVDWGP  294

Query  236   SFKLF  222
             + K F
Sbjct  295   TEKTF  299



>gb|KDO37691.1| hypothetical protein CISIN_1g036296mg [Citrus sinensis]
Length=433

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 218/305 (71%), Gaps = 7/305 (2%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  +    L +   I    AQVP   TF+FVNEG+ G ++VEY  DYR++ +F+ 
Sbjct  1     MSSSSAIITLFALLPLVFSIAN--AQVPPSETFQFVNEGDFGDFIVEYGGDYRMLGIFNA  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAYTLALRWGLTRQEPFFRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQ+ TANKGVVGFKLL NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR  G  K
Sbjct  119   DGTVVWQTNTANKGVVGFKLLSNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRAGGVAK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +GPY+ ++EP RL  Y ++ NS RP+LY  SS+WF+V + SLE + F +
Sbjct  179   LVSRASEKENIDGPYSFLMEPKRLAMYYKSSNSPRPVLYFTSSEWFTVREGSLENITFTS  238

Query  413   KTQTLK-LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
             + +T +   Y ++  S +    LA+P++N+T++ LRLE+DGNL+ YT+    +E   WG 
Sbjct  239   EPETEEAFAYHLSLDSSVAGVRLARPRYNSTISLLRLEMDGNLRIYTY----DERVDWGP  294

Query  236   SFKLF  222
             + K F
Sbjct  295   TEKTF  299



>ref|XP_006442508.1| hypothetical protein CICLE_v10020160mg [Citrus clementina]
 gb|ESR55748.1| hypothetical protein CICLE_v10020160mg [Citrus clementina]
Length=443

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 218/305 (71%), Gaps = 7/305 (2%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+      FL +   I    AQVP   TF+FVNEG+ G ++VEY  DYR++ +F+ 
Sbjct  1     MSSSSAIIILFAFLPLVFSIAN--AQVPPSETFQFVNEGDFGDFIVEYGGDYRMLGIFNA  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R E   RWVWEANRGKPVR+ A F L  DGNLVLA+V
Sbjct  59    PFQLGFYNTTPNAYTLALRWGLTRQEPFFRWVWEANRGKPVRENATFSLGTDGNLVLAEV  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQ+ TANKGVVGFKLL NGNMVLHD+KG F+WQSFD+PTDTLLVGQSLR  G  K
Sbjct  119   DGTVVWQTNTANKGVVGFKLLSNGNMVLHDSKGKFIWQSFDYPTDTLLVGQSLRAGGVAK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +GPY+ ++EP RL  Y ++ NS RP+LY  SS+WF+V + SLE + F +
Sbjct  179   LVSRASEKENIDGPYSFLMEPKRLAMYYKSSNSPRPVLYFTSSEWFTVREGSLENITFTS  238

Query  413   KTQTLK-LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
             + +T +   Y ++  S +    LA+P++N+T++ LRLE+DGNL+ YT+    +E   WG 
Sbjct  239   EPETEEAFAYHLSLDSSVAGVRLARPRYNSTISLLRLEMDGNLRIYTY----DERVDWGP  294

Query  236   SFKLF  222
             + K F
Sbjct  295   TEKTF  299



>ref|XP_009340015.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=432

 Score =   349 bits (895),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 212/287 (74%), Gaps = 11/287 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVNEGE GPY+VEY  +YR++ VFS+PFQL FYNTTPNA+TLALRMG  R
Sbjct  19    AQVPANQTFKFVNEGEFGPYIVEYDGNYRMLSVFSSPFQLAFYNTTPNAFTLALRMGLTR  78

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A     +DGNLVLAD DGRVAWQ++TANKGVVGFKLL  G
Sbjct  79    SESLFRWVWEANRGNPVGENATLAFGEDGNLVLADADGRVAWQTKTANKGVVGFKLLPTG  138

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFDHPTDTLLVGQSLR     KLVSR SET+N +GPY++++EP  +
Sbjct  139   NMVLYDSKGNFVWQSFDHPTDTLLVGQSLRPGTINKLVSRVSETENKDGPYSLVMEPKGI  198

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ NS + ILY   S+ F++ K SL+ V  N    T       + L+Y+VA SS  
Sbjct  199   FLYYKSNNSPKSILY---SQLFTIEKGSLDHVTLNVAPDTDEGYAYDISLEYQVANSSSG  255

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +LA+PK+N+TLT+LRL IDGN+K YT+Y D  +   W  +F LF
Sbjct  256   GNAILARPKYNSTLTFLRLGIDGNVKLYTYY-DKVDWRAWEVTFTLF  301



>ref|XP_008350012.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=432

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 211/287 (74%), Gaps = 11/287 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVNEGE GPY+VEY  +YR++ VFS+PFQL FYNTTPNA+TLALRMG  R
Sbjct  19    AQVPANQTFKFVNEGEFGPYIVEYDGNYRMLSVFSSPFQLAFYNTTPNAFTLALRMGLTR  78

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A     +DGNLVLAD DGRVAWQ+ TANKGVVGFKLL  G
Sbjct  79    SESLFRWVWEANRGNPVGENATLAFGEDGNLVLADADGRVAWQTNTANKGVVGFKLLPTG  138

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFDHPTDTLLVGQSLR     KLVSR SET+N +GPY++++EP  +
Sbjct  139   NMVLYDSKGNFVWQSFDHPTDTLLVGQSLRPGTINKLVSRVSETENKDGPYSLVMEPKGI  198

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ NS + ILY   S+ F++ K SL+ V  N    T       + L+Y+VA SS  
Sbjct  199   FLYYKSNNSPKSILY---SQLFTIEKGSLDHVTLNVAPDTDEGYAYDISLEYQVANSSSG  255

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +LA+PK+N+TLT+LRL IDGN+K YT+Y D  +   W  +F LF
Sbjct  256   GNAILARPKYNSTLTFLRLGIDGNVKLYTYY-DKVDWRAWEVTFTLF  301



>ref|XP_008386249.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=432

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 211/287 (74%), Gaps = 11/287 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVNEGE GPY+VEY  +YR++ VFS+PFQL FYNTTPNA+TLALRMG  R
Sbjct  19    AQVPANQTFKFVNEGEFGPYIVEYDGNYRMLSVFSSPFQLAFYNTTPNAFTLALRMGLTR  78

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A     +DGNLVLAD DGRVAWQ+ TANKGVVGFKLL  G
Sbjct  79    SESLFRWVWEANRGNPVGENATLAFGEDGNLVLADADGRVAWQTNTANKGVVGFKLLPTG  138

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFDHPTDTLLVGQSLR     KLVSR SET+N +GPY++++EP  +
Sbjct  139   NMVLYDSKGNFVWQSFDHPTDTLLVGQSLRPGTINKLVSRVSETENKDGPYSLVMEPKGI  198

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ NS + ILY   S+ F++ K SL+ V  N    T       + L+Y+VA SS  
Sbjct  199   FLYYKSNNSPKSILY---SQLFTIEKGSLDHVTLNVAPDTDEGYAYDISLEYQVANSSSG  255

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +LA+PK+N+TLT+LRL IDGN+K YT+Y D  +   W  +F LF
Sbjct  256   GNAILARPKYNSTLTFLRLGIDGNVKLYTYY-DKVDWRAWEVTFTLF  301



>gb|KCW67508.1| hypothetical protein EUGRSUZ_F01237, partial [Eucalyptus grandis]
Length=431

 Score =   347 bits (890),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/289 (60%), Positives = 209/289 (72%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKFVNEGE GPYVVEY  +YR + +FS+PFQLCFYNTTPNA+TLALRM T R
Sbjct  22    AAVPPSAQFKFVNEGEFGPYVVEYDGNYRTISIFSSPFQLCFYNTTPNAFTLALRMATTR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRGKPVR+ A F L  DGNLVLA+ DG+V WQS T NKGVVGF+LL NG
Sbjct  82    SESLFRWVWEANRGKPVRENATFALGADGNLVLANADGQVVWQSRTTNKGVVGFQLLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFD PTDTLLVGQSLR     KLVSRASET N+NGPY++++EP +L
Sbjct  142   NMVLYDSKGNFVWQSFDSPTDTLLVGQSLRAGAVSKLVSRASETDNSNGPYSLVMEPKQL  201

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVA-KSSK  366
               Y  +KNS +P+LY+  +K   +G  SL +V      +T       + L Y  A K+S 
Sbjct  202   SLYYTSKNSPKPLLYYTFAKNMYLGNESLGQVNLETAPETDEGYAYEITLKYAAANKTSG  261

Query  365   LGAH-VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             +G   +LA+PK+N+TLT LRL IDGNL+ YT+Y D  +   W  +F LF
Sbjct  262   MGGGLILARPKYNSTLTILRLGIDGNLRAYTYY-DKVDYRAWEVTFSLF  309



>ref|XP_010060698.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Eucalyptus grandis]
Length=440

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/289 (60%), Positives = 209/289 (72%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKFVNEGE GPYVVEY  +YR + +FS+PFQLCFYNTTPNA+TLALRM T R
Sbjct  22    AAVPPSAQFKFVNEGEFGPYVVEYDGNYRTISIFSSPFQLCFYNTTPNAFTLALRMATTR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRGKPVR+ A F L  DGNLVLA+ DG+V WQS T NKGVVGF+LL NG
Sbjct  82    SESLFRWVWEANRGKPVRENATFALGADGNLVLANADGQVVWQSRTTNKGVVGFQLLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFD PTDTLLVGQSLR     KLVSRASET N+NGPY++++EP +L
Sbjct  142   NMVLYDSKGNFVWQSFDSPTDTLLVGQSLRAGAVSKLVSRASETDNSNGPYSLVMEPKQL  201

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVA-KSSK  366
               Y  +KNS +P+LY+  +K   +G  SL +V      +T       + L Y  A K+S 
Sbjct  202   SLYYTSKNSPKPLLYYTFAKNMYLGNESLGQVNLETAPETDEGYAYEITLKYAAANKTSG  261

Query  365   LGAH-VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             +G   +LA+PK+N+TLT LRL IDGNL+ YT+Y D  +   W  +F LF
Sbjct  262   MGGGLILARPKYNSTLTILRLGIDGNLRAYTYY-DKVDYRAWEVTFSLF  309



>ref|XP_002525645.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative 
[Ricinus communis]
 gb|EEF36763.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative 
[Ricinus communis]
Length=424

 Score =   346 bits (888),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 214/305 (70%), Gaps = 11/305 (4%)
 Frame = -1

Query  1133  MSSPSSYSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFS  957
             M SPS + S L + L+ SI      A VP   TFK++NEGE G Y+VEY A+YRV+D F+
Sbjct  1     MFSPSIHHSFLSLCLIFSIFSFIAQASVPPSATFKYINEGEFGEYIVEYDANYRVLDPFA  60

Query  956   NPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLAD  777
              PFQLCFYNTTPNA+TLALRMGTVRS  RMRWVWEANRG PVR+ A      DGNLVLAD
Sbjct  61    QPFQLCFYNTTPNAFTLALRMGTVRSTSRMRWVWEANRGNPVRENATLTFGTDGNLVLAD  120

Query  776   VDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPK  597
              DGR+AWQ+ TANKGVVGFKLL NGNMVLHD+KG F+WQSFD+PTDTLLVGQSL+L    
Sbjct  121   ADGRIAWQTNTANKGVVGFKLLSNGNMVLHDSKGKFIWQSFDYPTDTLLVGQSLKLGAAF  180

Query  596   KLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFN  417
             KLVSRAS  QN NGPY++++E   L  Y ++ N+ +P+LY   S  FSV    L+ + F 
Sbjct  181   KLVSRASAKQNVNGPYSLVMEENTLAMYYKSPNTPKPLLYFSFSDLFSVANGRLDHITFE  240

Query  416   AKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
             +    L L ++       G+  L +PK+NTTL+YLRLEIDGN + +T Y D  +   W  
Sbjct  241   SG---LTLAFEG------GSLTLRRPKYNTTLSYLRLEIDGNFRIHT-YEDNADISAWEV  290

Query  236   SFKLF  222
             ++ LF
Sbjct  291   TYTLF  295



>ref|XP_007149384.1| hypothetical protein PHAVU_005G065700g [Phaseolus vulgaris]
 gb|ESW21378.1| hypothetical protein PHAVU_005G065700g [Phaseolus vulgaris]
Length=435

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 219/309 (71%), Gaps = 4/309 (1%)
 Frame = -1

Query  1142  LKNMSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV  963
             + ++S P + S  L  L  S   L   A VP   TFKFVN GELGP++VEY  DYR++ +
Sbjct  1     MASLSLPKT-SFLLALLFFSSFTLIVHAIVPQNETFKFVNSGELGPFIVEYGGDYRMISI  59

Query  962   FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVL  783
             F++PFQ+ FYNTTPNA+TLALR+G  RSE   RWVWEANRG PV + A F L  DGNLVL
Sbjct  60    FNSPFQVGFYNTTPNAFTLALRVGLQRSEQLFRWVWEANRGNPVGENATFSLGTDGNLVL  119

Query  782   ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
             AD DGR+ WQ+ T+ +GVV F+LL NGNMVL DA+G FVWQSFDHPTDTLLVGQ LR  G
Sbjct  120   ADADGRIVWQTNTSKRGVVAFRLLPNGNMVLLDAQGKFVWQSFDHPTDTLLVGQYLRAKG  179

Query  602   PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
             P KLVSR SE +N +GPY+++LEP  L  Y ++KNS RPILY  SS WFS+ + SL+ V 
Sbjct  180   PSKLVSRLSEKENVDGPYSLVLEPKGLALYYKSKNSPRPILYWFSSDWFSIQQGSLDNVT  239

Query  422   FNAKTQTLKL--DYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENF  249
             F + +++ ++  DY VA SS  G  +L +P  N+T+TYLRL IDGN+K +T++ D  +  
Sbjct  240   FTSDSESFEIGFDYFVANSSTSGNRILGRPVNNSTITYLRLGIDGNIKFHTYFLDVRDGV  299

Query  248   HWGESFKLF  222
              W  ++ LF
Sbjct  300   -WQVTYTLF  307



>ref|XP_008386250.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=444

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 210/295 (71%), Gaps = 23/295 (8%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVNEGE GPY+VEY  +YR+++V+S+PFQL FYNT+PNA+TLALRMGT R
Sbjct  26    AQVPANQTFKFVNEGEFGPYIVEYDGNYRMLNVYSSPFQLAFYNTSPNAFTLALRMGTTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      DGNLVLAD DGRVAWQ+ TANKGVVGFKLL  G
Sbjct  86    SESLRRWVWEANRGNPVGENATLAFGTDGNLVLADADGRVAWQTNTANKGVVGFKLLPTG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+K NFVWQSFDHPTDTLLVGQSLR     KLVSRASET+N +GPY+I++E   +
Sbjct  146   NMVLHDSKSNFVWQSFDHPTDTLLVGQSLRAXAVNKLVSRASETENKDGPYSIVMESKSI  205

Query  521   GFYNQTKNSARPILYHDSSKWFSV-----GKSSLEEVKFNAKTQT-------LKLDYKVA  378
               Y ++ NS +P+LY      FS+      KS  + V FN   +T       L L ++V 
Sbjct  206   SLYYKSNNSPKPLLYTQ----FSITDVTPAKSVFDRVTFNCAPETDEGHAYDLTLQFEVV  261

Query  377   KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
               +  G H+LA+PK+N+ LT+LRLEIDGN+K YT+    ++N  WG    +F LF
Sbjct  262   NPTLAGGHILARPKYNSMLTFLRLEIDGNVKLYTY----DDNVDWGAWEVTFTLF  312



>ref|XP_008370851.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=444

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 210/295 (71%), Gaps = 23/295 (8%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVNEGE GPY+VEY  +YR+++V+S+PFQL FYNT+PNA+TLALRMGT R
Sbjct  26    AQVPANQTFKFVNEGEFGPYIVEYDGNYRMLNVYSSPFQLAFYNTSPNAFTLALRMGTTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      DGNLVLAD DGRVAWQ+ TANKGVVGFKLL  G
Sbjct  86    SESLRRWVWEANRGNPVGENATLAFGTDGNLVLADADGRVAWQTNTANKGVVGFKLLPTG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+K NFVWQSFDHPTDTLLVGQSLR     KLVSRASET+N +GPY+I++E   +
Sbjct  146   NMVLHDSKSNFVWQSFDHPTDTLLVGQSLRAGAVNKLVSRASETENKDGPYSIVMESKSI  205

Query  521   GFYNQTKNSARPILYHDSSKWFSV-----GKSSLEEVKFNAKTQT-------LKLDYKVA  378
               Y ++ NS +P+LY      FS+      KS  + V FN   +T       L L ++V 
Sbjct  206   SLYYKSNNSPKPLLYTQ----FSITDVTPAKSVFDRVTFNCAPETDEGHAYDLTLQFEVV  261

Query  377   KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
               +  G H+LA+PK+N+ LT+LRLEIDGN+K YT+    ++N  WG    +F LF
Sbjct  262   NPTLAGGHILARPKYNSMLTFLRLEIDGNVKLYTY----DDNVDWGAWEVTFTLF  312



>ref|XP_008386254.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=444

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 210/295 (71%), Gaps = 23/295 (8%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVNEGE GPY+VEY  +YR+++V+S+PFQL FYNT+PNA+TLALRMGT R
Sbjct  26    AQVPANQTFKFVNEGEFGPYIVEYDGNYRMLNVYSSPFQLAFYNTSPNAFTLALRMGTTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      DGNLVLAD DGRVAWQ+ TANKGVVGFKLL  G
Sbjct  86    SESLRRWVWEANRGNPVGENATLAFGTDGNLVLADADGRVAWQTNTANKGVVGFKLLPTG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+K NFVWQSFDHPTDTLLVGQSLR     KLVSRASET+N +GPY+I++E   +
Sbjct  146   NMVLHDSKSNFVWQSFDHPTDTLLVGQSLRARAVNKLVSRASETENKDGPYSIVMESKSI  205

Query  521   GFYNQTKNSARPILYHDSSKWFSV-----GKSSLEEVKFNAKTQT-------LKLDYKVA  378
               Y ++ NS +P+LY      FS+      KS  + V FN   +T       L L ++V 
Sbjct  206   SLYYKSNNSPKPLLYTQ----FSITDVTPAKSVFDRVTFNCAPETDEGHAYDLTLQFEVV  261

Query  377   KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
               +  G H+LA+PK+N+ LT+LRLEIDGN+K YT+    ++N  WG    +F LF
Sbjct  262   NPTLAGGHILARPKYNSMLTFLRLEIDGNVKLYTY----DDNVDWGAWEVTFTLF  312



>ref|XP_011082760.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Sesamum indicum]
Length=428

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 221/307 (72%), Gaps = 11/307 (4%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MS P  ++ + +   +  Q       VP   TF FVNEGE G YVVEY A+YR + VFS+
Sbjct  1     MSLPCFFTLSFLLFCICAQ-----GVVPPSQTFNFVNEGEFGEYVVEYDANYRALSVFSS  55

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQLCFYNTTP AYTLALRMGTVRSE  MRWVWEANRG PV + A F L  +GNLVLA+ 
Sbjct  56    PFQLCFYNTTPGAYTLALRMGTVRSESLMRWVWEANRGNPVGENATFSLGANGNLVLANA  115

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DGRVAWQS TA+KGVVGF+LL NGNMVL+D+ G+FVWQSFD PTDTLLVGQ+LR  GP K
Sbjct  116   DGRVAWQSNTADKGVVGFRLLPNGNMVLYDSNGSFVWQSFDLPTDTLLVGQALRRKGPNK  175

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR SET+N NG Y+++LE      Y  +K S RP+LY D++ + S+GK  L+ + F++
Sbjct  176   LVSRLSETENKNGAYSLVLERRGFALYYTSKKSPRPMLYFDATDYLSLGK--LDVLTFDS  233

Query  413   KTQTLK-LDYKVA-KSSKL-GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHW  243
             + +T     Y++  K +KL GA +L++PK+N+TLTYLRL IDG L+ +TFY D  +   W
Sbjct  234   QPETEDAFAYEIMLKDTKLGGARILSRPKYNSTLTYLRLGIDGGLRAFTFY-DKVDWGAW  292

Query  242   GESFKLF  222
              E+F LF
Sbjct  293   EETFTLF  299



>ref|XP_010644121.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Vitis vinifera]
Length=461

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 215/313 (69%), Gaps = 10/313 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLV-VSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFS  957
             MS PS +  + +FL  +SI      A VP  +TFK+VNEGE GPY+VEY  +YR + +F+
Sbjct  18    MSYPSPFILSFVFLFSISISSFIAQASVPINSTFKYVNEGEFGPYIVEYDGNYRTLPIFA  77

Query  956   NPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLAD  777
             +PFQ CFYNTTPNAYTLALRM T RSE   RWVWEANRGKPV + A      DGNLVLA 
Sbjct  78    SPFQFCFYNTTPNAYTLALRMATTRSESLFRWVWEANRGKPVGENATLTFGTDGNLVLAH  137

Query  776   VDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPK  597
              DGRVAWQ+ TANKGVVG +LL  GN+VL+D+KG F+WQSFD+PTDTLLVGQSLR  G  
Sbjct  138   ADGRVAWQTGTANKGVVGLRLLPTGNLVLYDSKGKFIWQSFDYPTDTLLVGQSLRAGGVT  197

Query  596   KLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFN  417
             KLVSRASE  N++G Y++++EP RL  Y +  NS +PILY  SS WF++ K SL  V   
Sbjct  198   KLVSRASEADNSDGKYSLVMEPKRLAMYYKATNSPKPILYATSSVWFTIDKGSLTNVTLT  257

Query  416   AKTQT-------LKLDYKVAKS-SKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDA  261
                 T       L LDY V+ S +  G  +L +PK+N+TLT LRL IDGN++ YT+Y D 
Sbjct  258   CSPDTDEGYAYNLILDYYVSNSQNPSGNRILVRPKYNSTLTILRLGIDGNIRLYTYY-DK  316

Query  260   EENFHWGESFKLF  222
              +   W  ++ LF
Sbjct  317   VDWRAWEVTYTLF  329



>ref|XP_010675381.1| PREDICTED: LOW QUALITY PROTEIN: epidermis-specific secreted glycoprotein 
EP1-like [Beta vulgaris subsp. vulgaris]
Length=436

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 212/302 (70%), Gaps = 16/302 (5%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNT  927
             +++FL+ S +     A VP  +TFKFVN+G+ G Y+VEY  +YR +DVF++PFQLCFYNT
Sbjct  16    SILFLISSSE-----ANVPPSSTFKFVNQGDFGDYIVEYDGNYRTLDVFNSPFQLCFYNT  70

Query  926   TPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             TPN+YTLALRMG VRSE   RWVWEANRG PVR+ A F L  DGNLVLAD DGR+AWQ+ 
Sbjct  71    TPNSYTLALRMGLVRSESLFRWVWEANRGNPVRENATFSLGTDGNLVLADADGRIAWQTN  130

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQ  567
             T NKGVVGFKLL NGNMVLHDAK  F+WQSFD+PTDTLLVGQSLRL GP KLVSR S   
Sbjct  131   TTNKGVVGFKLLPNGNMVLHDAKDKFIWQSFDYPTDTLLVGQSLRLDGPTKLVSRVSAQL  190

Query  566   NTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-----  402
             N+NGPYT ++EP  L  Y ++ NS +P+LY        + KSSL+EV F+   +      
Sbjct  191   NSNGPYTFVMEPRVLTMYYKSPNSPKPLLYF---SMLDLSKSSLKEVTFSCSPENDDNYA  247

Query  401   --LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
               +   Y+    S  G   +A+PK+N+TL+ LRL IDGNL+ +T YSD  +   W  +F 
Sbjct  248   YDITFAYQSIDGSIGGNAEIARPKYNSTLSILRLGIDGNLRVFT-YSDKVDWAAWEATFT  306

Query  227   LF  222
             LF
Sbjct  307   LF  308



>ref|XP_004489029.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cicer arietinum]
Length=435

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 212/296 (72%), Gaps = 3/296 (1%)
 Frame = -1

Query  1103  LIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTT  924
             L  L +S       + VP   TFKFVN GELGP++VEY ADYR++ +F++PFQ+ FYNTT
Sbjct  12    LTLLFLSFSTFIAHSLVPQNETFKFVNSGELGPFIVEYGADYRMISIFNSPFQVGFYNTT  71

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             PNA+TLALR+G  RSE   RWVWEANRG PV + A F L  DGNLVLA+ DGR+ WQ+ T
Sbjct  72    PNAFTLALRIGLQRSEQLFRWVWEANRGNPVGENATFSLGVDGNLVLANEDGRIVWQTNT  131

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
             +NKGVV F+LL NGN+VL D+KGNFVWQSFDHPTDTLLV Q L+ +GP KL+SR SE +N
Sbjct  132   SNKGVVAFRLLSNGNIVLIDSKGNFVWQSFDHPTDTLLVDQYLKPNGPSKLISRLSEKEN  191

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKL--D  390
              NGPY+++LEP  L  Y +++NS RPILY  SS WFS+ K SLE V   +   T ++  D
Sbjct  192   LNGPYSLVLEPKGLALYYKSQNSPRPILYWFSSDWFSIEKGSLENVTLKSDLDTFEIGFD  251

Query  389   YKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             + VA SS  G  ++ +P  N+TLTYLRL IDGN+K +T++ D  +   W  ++ LF
Sbjct  252   FFVANSSTFGNRIIGRPVNNSTLTYLRLGIDGNIKFHTYFLDVRDGV-WQVTYTLF  306



>ref|XP_008386251.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=440

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 213/311 (68%), Gaps = 8/311 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSSPS   S    +++S+      AQVPA  TFKFVNEGE  P +VEY A YR++ +F++
Sbjct  1     MSSPSLTVSLSSIVIISLFAFIAQAQVPANETFKFVNEGEYWPNIVEYDASYRMLSLFAS  60

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ  FYNTTP+A+TLALRMG  RSE    WVWEANRGKPV   A F    DGNL LAD 
Sbjct  61    PFQFAFYNTTPDAFTLALRMGLRRSESGFYWVWEANRGKPVGQNATFAFGTDGNLALADA  120

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG+VAWQS TANKGVVGFKLL  GN+VL+D+KGNFVWQSF HP+DTLLVGQSLR  G  K
Sbjct  121   DGQVAWQSNTANKGVVGFKLLSTGNIVLYDSKGNFVWQSFHHPSDTLLVGQSLRAGGVSK  180

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +G Y++++EP  L  Y ++KNS RP+LY  SSKW +V K SL  V   A
Sbjct  181   LVSRASEVENKDGSYSLVMEPKGLSLYYKSKNSPRPLLYFTSSKWINVQKGSLNHVTLKA  240

Query  413   KTQT-------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
                T       L LDY    SS  G  +LA+PK+N+T T+LRLEI+GNL+ +T+Y     
Sbjct  241   SPDTHEGFAYDLSLDYVEGNSSTGGNVLLARPKYNSTSTFLRLEINGNLRLHTYYRILRY  300

Query  254   NFHWGESFKLF  222
                W  +F LF
Sbjct  301   G-AWEVTFSLF  310



>ref|XP_008367970.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=440

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 210/311 (68%), Gaps = 8/311 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSSP    S     + S+      A+VPA  TFK+VNEGE GP++ EY A YR++D F++
Sbjct  1     MSSPQLIMSLPCMFIFSLFAFIAQAKVPANQTFKYVNEGEFGPFITEYDASYRMLDPFAS  60

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNA+TLALRMG  RSE +  WVWEANRGKPV + A F    DGNLVLA+ 
Sbjct  61    PFQLAFYNTTPNAFTLALRMGLRRSESQFYWVWEANRGKPVGENATFTFGTDGNLVLANA  120

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DGRVAWQS TANKGVVGF LL  GNMVL+D+KGNFVWQSFD+P++TLLVGQSLR  G  K
Sbjct  121   DGRVAWQSNTANKGVVGFDLLSTGNMVLYDSKGNFVWQSFDYPSNTLLVGQSLRAGGVSK  180

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +G Y++++E   L  Y ++KNS RP LY  SSKW SV K SL  V    
Sbjct  181   LVSRASEAENEDGSYSLVMEAKGLAMYYKSKNSPRPSLYFTSSKWISVQKGSLNHVTLKC  240

Query  413   KTQT-------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
                        L LDY    SS  G  +LA+P +N+T T+LRLE+DGNL+ +T+Y     
Sbjct  241   SPDAHEGFAYDLSLDYVAGNSSSRGNVMLARPNYNSTSTFLRLEMDGNLRLHTYYKVVRY  300

Query  254   NFHWGESFKLF  222
                W  +F LF
Sbjct  301   G-AWEVTFTLF  310



>gb|KCW67506.1| hypothetical protein EUGRSUZ_F01235, partial [Eucalyptus grandis]
Length=432

 Score =   341 bits (875),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 207/289 (72%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKFVNEGE GPY+VEY  +YR   +FS+PFQLCFYNTTPNA+TLALRM T +
Sbjct  18    AAVPPSAQFKFVNEGEFGPYIVEYDGNYRTFGIFSSPFQLCFYNTTPNAFTLALRMATAQ  77

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S   +RWVWEANRGKPVR+ A F L  DGNLVLA+ DG+VAWQS T NKGVVGFKLL NG
Sbjct  78    SNSLLRWVWEANRGKPVRENATFALGADGNLVLANADGQVAWQSRTTNKGVVGFKLLPNG  137

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFD PTDTLLVGQSLR     KLVSRASET N+NGPY++++EP +L
Sbjct  138   NMVLYDSKGNFVWQSFDSPTDTLLVGQSLRARAVSKLVSRASETDNSNGPYSLVIEPKQL  197

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAK--SS  369
               Y  +KNS +P+LY+  ++   +GK S+ +V      +T       + L Y  A   S 
Sbjct  198   SLYYTSKNSPKPLLYYTFAEKMYLGKESVGQVTLETARETDEGYAYEITLKYAAANKTSG  257

Query  368   KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             + G  +LA+PK+N+TLT LRL IDGNL+ YT+Y D      W  +F LF
Sbjct  258   EGGRIILARPKYNSTLTILRLGIDGNLQAYTYY-DKVNYRAWHVTFSLF  305



>ref|XP_009340001.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=444

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 169/295 (57%), Positives = 207/295 (70%), Gaps = 23/295 (8%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VPA  TFKFVNEGE GPY+VEY  +YR + V+S+PFQL FYNT+PNA+TLALRMGT R
Sbjct  26    AHVPANQTFKFVNEGEFGPYIVEYDGNYRTLSVYSSPFQLAFYNTSPNAFTLALRMGTTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      DGNLVLAD DGRVAWQ+ TANKGVVG KLL  G
Sbjct  86    SESLRRWVWEANRGNPVGENATLAFGADGNLVLADADGRVAWQTNTANKGVVGLKLLPTG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KGNFVWQSFDHPTDTLLVGQSLR     KLVSRASET+N +GPY+I++E   +
Sbjct  146   NMVLHDSKGNFVWQSFDHPTDTLLVGQSLRAGAVNKLVSRASETENKDGPYSIVMESKSI  205

Query  521   GFYNQTKNSARPILYHDSSKWFSV-----GKSSLEEVKFNAKTQT-------LKLDYKVA  378
               Y ++ NS +P+LY      FS+      KS  + V FN   +T       L L ++V 
Sbjct  206   SLYYKSNNSPKPLLYTQ----FSITDVTPAKSVFDRVTFNCAPETDEGHAYDLTLQFEVV  261

Query  377   KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
               +  G H+LA+PK+N+ L++LRLE+DGN+K YT+    ++N  WG    +F LF
Sbjct  262   NPTLAGGHILARPKYNSMLSFLRLEMDGNVKIYTY----DDNVEWGAWEVTFTLF  312



>ref|XP_010060697.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Eucalyptus grandis]
Length=436

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 207/289 (72%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKFVNEGE GPY+VEY  +YR   +FS+PFQLCFYNTTPNA+TLALRM T +
Sbjct  18    AAVPPSAQFKFVNEGEFGPYIVEYDGNYRTFGIFSSPFQLCFYNTTPNAFTLALRMATAQ  77

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S   +RWVWEANRGKPVR+ A F L  DGNLVLA+ DG+VAWQS T NKGVVGFKLL NG
Sbjct  78    SNSLLRWVWEANRGKPVRENATFALGADGNLVLANADGQVAWQSRTTNKGVVGFKLLPNG  137

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFD PTDTLLVGQSLR     KLVSRASET N+NGPY++++EP +L
Sbjct  138   NMVLYDSKGNFVWQSFDSPTDTLLVGQSLRARAVSKLVSRASETDNSNGPYSLVIEPKQL  197

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAK--SS  369
               Y  +KNS +P+LY+  ++   +GK S+ +V      +T       + L Y  A   S 
Sbjct  198   SLYYTSKNSPKPLLYYTFAEKMYLGKESVGQVTLETARETDEGYAYEITLKYAAANKTSG  257

Query  368   KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             + G  +LA+PK+N+TLT LRL IDGNL+ YT+Y D      W  +F LF
Sbjct  258   EGGRIILARPKYNSTLTILRLGIDGNLQAYTYY-DKVNYRAWHVTFSLF  305



>ref|XP_009339980.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=440

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 214/311 (69%), Gaps = 8/311 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSSPS   S    +++S+      AQVPA  TFKFVNEGE  P +VEY A YR++D+F++
Sbjct  1     MSSPSLTVSLPSIVIISLFAFIAQAQVPANETFKFVNEGEYWPNIVEYDASYRMLDLFAS  60

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ  FYNTTP+A+TLALRMG  RSE    WVWEANRGKPV   A F    DGNLVLAD 
Sbjct  61    PFQFAFYNTTPDAFTLALRMGLRRSESGFYWVWEANRGKPVGQNATFAFGTDGNLVLADA  120

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG+VAWQS TANKGVVGFKLL  GN+VL+D KGNFVWQSF HP+DTLLVGQSLR  G  K
Sbjct  121   DGQVAWQSNTANKGVVGFKLLSTGNIVLYDPKGNFVWQSFHHPSDTLLVGQSLRAGGVSK  180

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +G Y++++EP  L  Y ++K+S RP+LY  SSKW +V K SL  V   A
Sbjct  181   LVSRASEVENKDGSYSLVMEPKGLSLYYKSKSSPRPLLYFTSSKWINVQKGSLNHVTLKA  240

Query  413   KTQT-------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
                T       L LDY    S+  G  +LA+PK+N+T T+LRLEI+GNL+ +T+Y     
Sbjct  241   SPDTQEGFAYDLSLDYVEGNSTTGGNVLLARPKYNSTSTFLRLEINGNLRLHTYYRILRY  300

Query  254   NFHWGESFKLF  222
                W  +F LF
Sbjct  301   G-AWEVTFSLF  310



>ref|XP_002283208.2| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Vitis vinifera]
Length=444

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 213/311 (68%), Gaps = 9/311 (3%)
 Frame = -1

Query  1130  SSPSSYSSTLIFL-VVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
              SP S+    +FL  + +   T  A VP KNTFK+VNEGE GPY+VEY  DYR + +F++
Sbjct  3     CSPPSFIFPFLFLSFILLSSFTAHASVPIKNTFKYVNEGEFGPYIVEYGGDYRTLPIFAS  62

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ CFYNTTPNAYTLALRM   R+E   RWVWEANRGKPV + A      DGNLVLA+ 
Sbjct  63    PFQFCFYNTTPNAYTLALRMAIQRTEPIYRWVWEANRGKPVGENATLTFGTDGNLVLANA  122

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DGRVAWQ+ TANKGVVG KLL NGN+VLHD+KG F+WQSFD+PTD LLV QSLR+ G  K
Sbjct  123   DGRVAWQTGTANKGVVGLKLLSNGNLVLHDSKGKFIWQSFDYPTDVLLVDQSLRVGGVTK  182

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRAS   N++G Y++++EP RL  Y +  NS +PILY  SS WF++ K SL+ V    
Sbjct  183   LVSRASAADNSDGKYSLVMEPKRLAMYYRGTNSPKPILYATSSVWFTIDKGSLQNVTLTG  242

Query  413   KTQT------LKLDYKVAKSS-KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
                       L L+Y ++ S    G  +L +PK+N+T T+LRL++DGN++ YT++ D  +
Sbjct  243   SPDGLGYAYYLNLNYHLSNSPYPTGGRILVRPKYNSTSTFLRLDMDGNIRLYTYF-DKVD  301

Query  254   NFHWGESFKLF  222
                W  ++ LF
Sbjct  302   YQGWQVTYTLF  312



>ref|XP_008226532.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Prunus mume]
Length=437

 Score =   337 bits (863),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 207/287 (72%), Gaps = 11/287 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVN+GE GPY++EY  +YR++ VF+ PFQL FYNTTPNA+TLALRMG  R
Sbjct  25    AQVPANETFKFVNDGEFGPYIIEYDGNYRMLSVFNAPFQLAFYNTTPNAFTLALRMGLRR  84

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      DGNLVLAD +GRVAWQ+ TANKGVVGFKLL  G
Sbjct  85    SESLFRWVWEANRGNPVGENATLTFGTDGNLVLADANGRVAWQTNTANKGVVGFKLLPTG  144

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFDHPTDTLLVGQSL+     KLVSRASET+N +G Y++++EP  +
Sbjct  145   NMVLYDSKGNFVWQSFDHPTDTLLVGQSLKAGAVNKLVSRASETENKDGAYSLVMEPKGI  204

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++KNS +P+LY   S+  ++ K SL+         T       + LDY+ A SS  
Sbjct  205   FLYYKSKNSPKPLLY---SQVITIDKGSLDHATLKCTPDTDEGYAYDITLDYEAANSSSG  261

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +LA+PK+N+TLT+LRL IDGN+K YT Y+D  +   W  +F LF
Sbjct  262   GNRILARPKYNSTLTFLRLGIDGNVKLYT-YNDKVDWGAWEVTFALF  307



>emb|CAN75015.1| hypothetical protein VITISV_035367 [Vitis vinifera]
Length=444

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 213/311 (68%), Gaps = 9/311 (3%)
 Frame = -1

Query  1130  SSPSSYSSTLIFL-VVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
              SP S+    +FL  + +   T  A VP K+TFK+VNEGE GPY+VEY  DYR + +F++
Sbjct  3     CSPPSFIFPFLFLSFILLSSFTAHASVPIKSTFKYVNEGEFGPYIVEYGGDYRTLPIFAS  62

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ CFYNTTPNAYTLALRM   R+E   RWVWEANRGKPV + A      DGNLVLA+ 
Sbjct  63    PFQFCFYNTTPNAYTLALRMAIQRTEPIYRWVWEANRGKPVGENATLTFGTDGNLVLANA  122

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DGRVAWQ+ TANKGVVG KLL NGN+VLHD+KG F+WQSFD+PTD LLV QSLR+ G  K
Sbjct  123   DGRVAWQTGTANKGVVGLKLLSNGNLVLHDSKGKFIWQSFDYPTDVLLVDQSLRVGGVTK  182

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRAS   N++G Y++++EP RL  Y +  NS +PILY  SS WF++ K SL+ V    
Sbjct  183   LVSRASAADNSDGKYSLVMEPKRLAMYYKGTNSPKPILYATSSVWFTIDKGSLQNVTLTG  242

Query  413   KTQT------LKLDYKVAKSS-KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
                       L L+Y ++ S    G  +L +PK+N+T T+LRL++DGN++ YT++ D  +
Sbjct  243   SPDGLGYAYYLNLNYHLSNSPYPTGGRILVRPKYNSTSTFLRLDMDGNIRLYTYF-DKVD  301

Query  254   NFHWGESFKLF  222
                W  ++ LF
Sbjct  302   YQGWQVTYTLF  312



>gb|AFH57275.1| epidermis-specific secreted glycoprotein EP1-like protein [Gossypium 
hirsutum]
Length=440

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 204/287 (71%), Gaps = 8/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TF+FVN+GE GP++VEY ADYRV+ + + PFQL FYNTTPNA+TLALRM T R
Sbjct  26    AVVPPSETFRFVNDGEFGPFIVEYGADYRVISIANAPFQLAFYNTTPNAFTLALRMATTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PVR+ A F L  DGNLVLAD DGR+AWQS TANK VVGF+LL NG
Sbjct  86    SESLFRWVWEANRGNPVRENATFSLGTDGNLVLADADGRIAWQSNTANKAVVGFQLLPNG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+ G F+WQSFDHPTDTLLVGQSLR  G  KLVSRAS   N NG Y++++EP +L
Sbjct  146   NMVLHDSNGKFIWQSFDHPTDTLLVGQSLRAGGATKLVSRASAQNNVNGAYSLVMEPKQL  205

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT------LKLDYKVAKSS-KL  363
                 +  NS++P++Y  SS W +    +L+ V  N +         + LDY VA SS   
Sbjct  206   VLQYKGMNSSKPLVYFKSSVWPNTQDGTLQTVTLNVEETNDGFAYDVLLDYTVANSSIGT  265

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +L +PK+N+TL+ LRL IDGNL+ +T+Y D  ++  W E+F LF
Sbjct  266   GNLILTRPKYNSTLSILRLGIDGNLRVFTYY-DKVDSQAWEETFTLF  311



>ref|XP_009334044.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=440

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 208/311 (67%), Gaps = 8/311 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSSP    S     + S+      A+VPA  TFK+VNEGE GP++ EY A YR++  F++
Sbjct  1     MSSPQLTMSLPSMFIFSLFAFIAQAKVPANQTFKYVNEGEFGPFITEYDASYRMLAPFAS  60

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNA+TLALRMG  RSE +  WVWEANRGKPV + A F    DGNLVLA+ 
Sbjct  61    PFQLAFYNTTPNAFTLALRMGLRRSESQFYWVWEANRGKPVGENATFTFGTDGNLVLANA  120

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DGRVAWQS TANKGVVGF LL  GNMVL+D+KGNFVWQSF +P++TLLVGQSLR  G  K
Sbjct  121   DGRVAWQSNTANKGVVGFDLLSTGNMVLYDSKGNFVWQSFYYPSNTLLVGQSLRAGGVSK  180

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSRASE +N +G Y++++E   L  Y ++KNS RP LY  SSKW SV K SL  V    
Sbjct  181   LVSRASEAENEDGSYSLVMEAKGLAMYYKSKNSPRPSLYFTSSKWISVQKGSLNHVTLKC  240

Query  413   KTQT-------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
                        L LDY    SS  G  +LA+P +N+T T+LRLEIDGNL+ +T+Y     
Sbjct  241   SPDAHEGFAYDLSLDYVAGNSSSGGNVILARPNYNSTSTFLRLEIDGNLRLHTYYEVVRY  300

Query  254   NFHWGESFKLF  222
                W  +F LF
Sbjct  301   G-AWEVTFTLF  310



>ref|XP_007021733.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding 
domain, putative [Theobroma cacao]
 gb|EOY13258.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding 
domain, putative [Theobroma cacao]
Length=444

 Score =   334 bits (856),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 204/289 (71%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFKFVN+GE GP+VVEY  +YRV+ + + PFQL FYNTTPNA+TLALRM T R
Sbjct  26    AAVPPSATFKFVNQGEFGPFVVEYDGNYRVLSIANAPFQLAFYNTTPNAFTLALRMATTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PVR+ A F L  DGNLVLAD DGR+AWQS TANKGVVGFKLL NG
Sbjct  86    SESLFRWVWEANRGNPVRENATFSLGTDGNLVLADADGRIAWQSNTANKGVVGFKLLPNG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KG F+WQSFDHPTDTLLVGQSL + G  KLVSRAS  +N +G Y++++EP  L
Sbjct  146   NMVLHDSKGKFIWQSFDHPTDTLLVGQSLGIGGATKLVSRASAQKNVDGAYSLVIEPKGL  205

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK--------LDYKVAKSS-  369
                 +  NS +P++Y  SS W S    +L+ V  N K  +          LDY VA SS 
Sbjct  206   VLQYKGLNSPKPLVYFKSSVWPSTQDGTLQSVTLNVKPDSASDGSAYDVLLDYTVANSSF  265

Query  368   KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
               G  +L +PK+N+TL+ LRL +DGNL+ +T++ D  ++  W E+F LF
Sbjct  266   GTGNLILTRPKYNSTLSILRLGVDGNLRVFTYF-DKVDSRAWEETFTLF  313



>ref|XP_006477737.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=429

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 211/294 (72%), Gaps = 8/294 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S L +  +   I +  AQVPA  TFKFVNEGE GPY+ EY A+YR++ +F++
Sbjct  1     MSSSSAIFSLLFYFSLIFSIAS--AQVPANETFKFVNEGEFGPYINEYDANYRMISIFNS  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ+ FYNTTPNAYTLALR+G  R+E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQVGFYNTTPNAYTLALRLGVQRNEPNYRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQS TANKGVVGFKLL NGNMVL DAK NF+WQSFD+PTDTLLVGQSLR+ G  K
Sbjct  119   DGTVVWQSNTANKGVVGFKLLPNGNMVLRDAKSNFIWQSFDYPTDTLLVGQSLRVGGVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY+ ++E  RL  Y ++ N+ RP++Y      F V  S L+ V FN+
Sbjct  179   LVSRLSIKENVDGPYSFVMESNRLSLYYKSSNAPRPVVYFT----FPVQFSGLKNVTFNS  234

Query  413   KTQTLK-LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE  258
               +T +   Y++   SS  G  +LA+PK+N T+++LRL +DGNLK YT+Y   +
Sbjct  235   APETDEAFAYQLTLDSSSGGGLILARPKYNATISFLRLGVDGNLKIYTYYDKVD  288



>ref|XP_008226534.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Prunus mume]
Length=433

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 206/301 (68%), Gaps = 9/301 (3%)
 Frame = -1

Query  1103  LIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTT  924
              IFLV S       AQVPA  TFK+VNEGE G Y+VEY  +YR +D F++PFQL FYNTT
Sbjct  5     FIFLV-SFFAFIAQAQVPANETFKYVNEGEFGQYIVEYDGNYRPLDTFASPFQLAFYNTT  63

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             PNAYTLALRMG  RSE  +RWVWEANRG PV + A F    DGNLVLA+ DGRVAWQ+ T
Sbjct  64    PNAYTLALRMGLRRSESLIRWVWEANRGNPVGENATFTFGTDGNLVLANADGRVAWQTNT  123

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
              NKGVVGFKLL NGNMVL+++KGNFVWQSF +PTDTLLVGQ LR+ G  KLVSRASET+N
Sbjct  124   RNKGVVGFKLLSNGNMVLYNSKGNFVWQSFHYPTDTLLVGQFLRVGGVTKLVSRASETEN  183

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT------  402
              +G Y+ ++EP RL  Y ++KNS +PI+Y  SSK   VG  SLE V  N  T        
Sbjct  184   KDGSYSFVMEPKRLALYYKSKNSPKPIVYFTSSKLIDVGNGSLEHVTLNCYTVNSDDSAY  243

Query  401   -LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKL  225
              L L Y+   S      VLA   +N+T ++LRLEIDGNLK YT+++       W   F L
Sbjct  244   DLALLYEPGNSISGFNLVLATTNYNSTSSFLRLEIDGNLKVYTYFNKVRYG-AWEVPFTL  302

Query  224   F  222
             F
Sbjct  303   F  303



>ref|XP_006477736.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=435

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 206/284 (73%), Gaps = 8/284 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A+VP   TFKFVNEGE GPYV EY A+YR++ +F++PFQL FYNTTPNAYTLALR+G  R
Sbjct  26    AKVPPSETFKFVNEGEFGPYVNEYDANYRMLSIFNSPFQLAFYNTTPNAYTLALRLGLQR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             +E    WVWEANRGKPVR+ A F L  DGNLVLA+ DG V WQ+ TANKGVVGFKLL NG
Sbjct  86    NEPLFLWVWEANRGKPVRENATFSLGTDGNLVLAEADGTVVWQTNTANKGVVGFKLLSNG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KG F+WQSFD+PTDTLL GQSLR+ G  KLVSR S  +N +GPY+ ++EP R 
Sbjct  146   NMVLYDSKGKFIWQSFDYPTDTLLAGQSLRVGGVTKLVSRLSAEENVDGPYSFVMEPKRA  205

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-LDYKVAKSSKLGAHVLA  345
               Y ++ NS RP+LY  S  WF+    SL+ V FN++ +T + + +     S    ++LA
Sbjct  206   AMYYKSSNSPRPVLYFTSYDWFNARDVSLQNVTFNSRPETDEAVAFVQTLDSSANGNILA  265

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
             +PK+++T+++LRL IDGNLK YT+Y   +    WG    +F LF
Sbjct  266   RPKYDSTISFLRLGIDGNLKIYTYYDKVD----WGPTEVTFTLF  305



>ref|XP_006442506.1| hypothetical protein CICLE_v10020247mg [Citrus clementina]
 gb|ESR55746.1| hypothetical protein CICLE_v10020247mg [Citrus clementina]
Length=429

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 210/294 (71%), Gaps = 8/294 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S L +  +   I +  AQVPA  TFKFVNEGE GPY+ EY A+YR++ +F++
Sbjct  1     MSSSSAIFSLLFYFSLIFSISS--AQVPANETFKFVNEGEFGPYINEYDANYRMISIFNS  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ+ FYNTTPNAYTLALR+G  RSE   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQVGFYNTTPNAYTLALRLGVQRSEPNYRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQS TANKGVVGFKLL NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+ G  K
Sbjct  119   DGTVVWQSNTANKGVVGFKLLPNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGGVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY+  +E  R   Y ++ N+ RP++Y      F    S L+ V FNA
Sbjct  179   LVSRLSIKENVDGPYSFAMESNRFPLYYKSSNAPRPVVYFIFPGQF----SGLKNVTFNA  234

Query  413   KTQTLK-LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE  258
               +T + L Y++   SS  G  + A+PK+N T+++LRL +DGNLK YT+Y   +
Sbjct  235   APETDEALAYQLTLDSSSGGGPLSARPKYNATISFLRLGVDGNLKIYTYYDKVD  288



>ref|XP_010263453.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nelumbo nucifera]
Length=447

 Score =   332 bits (851),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 202/288 (70%), Gaps = 9/288 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFK+VN+GE G YVVEY A YRV+DVF+ PFQLCFYNTTP+A+TLALRMGT  
Sbjct  30    ATVPPSKTFKYVNQGEFGEYVVEYDASYRVLDVFTFPFQLCFYNTTPDAFTLALRMGTRH  89

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE  MRWVWEANRG PVR+ A     +DGNLVLAD DGRVAWQ+ TANKG+VGFKLL +G
Sbjct  90    SESIMRWVWEANRGNPVRENATLTFGRDGNLVLADADGRVAWQTATANKGIVGFKLLPSG  149

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             N+VLHD +G FVWQSFDHPTDTLLVGQ LR  GP K+VSR S    + GPY+ +LE  R+
Sbjct  150   NIVLHDKQGRFVWQSFDHPTDTLLVGQELRPGGPTKIVSRVSSVDGSQGPYSFVLEQNRV  209

Query  521   GFYNQTKNSARPILYHDSS-KWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSK  366
               Y ++ NS +P+LY+ S       G+  L  VKFN++  T       LK DY +  SS 
Sbjct  210   ALYLKSNNSPKPLLYYYSELGSGQPGQEPLAYVKFNSEPTTEEAYAFHLKFDYAMINSSS  269

Query  365   LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             + + + A+PK+N T + LR+E DGNLK YT YSD  +   W  +F LF
Sbjct  270   VSSRIWARPKYNATYSMLRVESDGNLKIYT-YSDKVDWGAWEVTFTLF  316



>ref|XP_010279128.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nelumbo nucifera]
Length=445

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 202/287 (70%), Gaps = 10/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFK+VN+GE G YVVEY A YRV+DVF+ PFQLCFYNTTP+A+TLALRMGT R
Sbjct  31    ATVPPSKTFKYVNQGEFGEYVVEYDASYRVLDVFTFPFQLCFYNTTPDAFTLALRMGTRR  90

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE  MRWVWEAN G PVR+ A     +DGNLVLA+ DGRV WQ+ TANKGVVGFKLL +G
Sbjct  91    SESIMRWVWEANLGNPVRENATLTFGRDGNLVLANADGRVVWQTATANKGVVGFKLLPSG  150

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             N+VLHD +G FVWQSFDHPTDTLLVGQ LRL GP K+VSR S    + GPY+++LE  R+
Sbjct  151   NIVLHDKQGRFVWQSFDHPTDTLLVGQELRLGGPTKVVSRVSSVDGSQGPYSLVLEQNRV  210

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ NS +P+LY+        G+  L  VKFN++ +T       L+ DY +  SS +
Sbjct  211   ALYLKSNNSPKPLLYYYDE--LGSGQDPLAYVKFNSEPETEEAYAFDLEFDYAMINSSSV  268

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                + A+PK+N T + LR+E DGNLK YT YSD  +   W  +F LF
Sbjct  269   SRRIWARPKYNATYSMLRVESDGNLKIYT-YSDKVDWGAWEVTFTLF  314



>gb|KDO39421.1| hypothetical protein CISIN_1g013934mg [Citrus sinensis]
Length=433

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 205/284 (72%), Gaps = 8/284 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A+VP   TFKFVNEGE GPYV EY A+YR++ +F++PFQL FYNTTPNAYTLALR+G  R
Sbjct  24    AKVPPSETFKFVNEGEFGPYVNEYDANYRMLSIFNSPFQLAFYNTTPNAYTLALRLGLQR  83

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             +E    WVWEANRGKPVR+ A F L  DGNLVLA+ DG V WQ+ TANKGVVGFKLL NG
Sbjct  84    NEPLFLWVWEANRGKPVRENATFSLGTDGNLVLAEADGTVVWQTNTANKGVVGFKLLSNG  143

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KG F+WQSFD+PTDTLL GQSLR+ G  KLVSR S  +N +GPY+ ++EP R 
Sbjct  144   NMVLYDSKGKFIWQSFDYPTDTLLAGQSLRVGGVTKLVSRLSAEENVDGPYSFVMEPKRA  203

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-LDYKVAKSSKLGAHVLA  345
               Y ++ NS  P+LY  S  WF+    SL+ V FN++ +T + + +     S    ++LA
Sbjct  204   AMYYKSSNSPEPVLYFTSYDWFNARDVSLQNVTFNSRPETDEAVAFVQTLDSSANGNILA  263

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
             +PK+++T+++LRL IDGNLK YT+Y   +    WG    +F LF
Sbjct  264   RPKYDSTISFLRLGIDGNLKIYTYYDKVD----WGPTEVTFTLF  303



>ref|XP_006442507.1| hypothetical protein CICLE_v10020204mg [Citrus clementina]
 gb|ESR55747.1| hypothetical protein CICLE_v10020204mg [Citrus clementina]
Length=435

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 205/284 (72%), Gaps = 8/284 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A+VP   TFKFVNEGE GPYV EY A+YR++ +F++PFQL FYNTTPNAYTLALR+G  R
Sbjct  26    AKVPPSETFKFVNEGEFGPYVNEYDANYRMLSIFNSPFQLAFYNTTPNAYTLALRLGLQR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             +E    WVWEANRGKPVR+ A F L  DGNLVLA+ DG V WQ+ TANKGVVGFKLL NG
Sbjct  86    NEPLFLWVWEANRGKPVRENATFSLGTDGNLVLAEADGTVVWQTNTANKGVVGFKLLSNG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KG F+WQSFD+PTDTLL GQSLR+ G  KLVSR S  +N +GPY+ ++EP R 
Sbjct  146   NMVLYDSKGKFIWQSFDYPTDTLLAGQSLRVGGVTKLVSRLSAEENVDGPYSFVMEPKRA  205

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-LDYKVAKSSKLGAHVLA  345
               Y ++ NS  P+LY  S  WF+    SL+ V FN++ +T + + +     S    ++LA
Sbjct  206   AMYYKSSNSPEPVLYFTSYDWFNARDVSLQNVTFNSRPETDEAVAFVQTLDSSANGNILA  265

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
             +PK+++T+++LRL IDGNLK YT+Y   +    WG    +F LF
Sbjct  266   RPKYDSTISFLRLGIDGNLKIYTYYDKVD----WGPTEVTFTLF  305



>ref|XP_006370152.1| hypothetical protein POPTR_0001s40180g [Populus trichocarpa]
 gb|ERP66721.1| hypothetical protein POPTR_0001s40180g [Populus trichocarpa]
Length=309

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/299 (56%), Positives = 213/299 (71%), Gaps = 5/299 (2%)
 Frame = -1

Query  1109  STLIFL-VVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             S L FL ++S+        VP  +TFK+VNEGE G Y+VEY A+YRV+D F++PFQLCFY
Sbjct  8     SLLAFLSIISLIAQAIAVTVPLSSTFKYVNEGEFGDYIVEYGANYRVLDPFNSPFQLCFY  67

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNA+TLALRMGTVRS   MRWVWEANRG PV + A     +DGNLVLAD DGR+AWQ
Sbjct  68    NTTPNAFTLALRMGTVRSTSTMRWVWEANRGNPVGENATLTFGEDGNLVLADADGRIAWQ  127

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + TANKGVV F++  NGNMVL D KG F+WQSFD+PTDTLLVGQSL   G  +LVSR SE
Sbjct  128   TNTANKGVVHFQVQPNGNMVLQDVKGYFIWQSFDYPTDTLLVGQSLLAGGAARLVSRRSE  187

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-  396
              QN+NG Y++++EP RL  Y ++ +S +P LY+ S + FSV    L+ V F ++  T + 
Sbjct  188   KQNSNGAYSLVMEPKRLAIYYKSPSSPKPKLYYTSDR-FSVKNGRLQYVTFQSEPVTEEG  246

Query  395   LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
               Y +A + S  G  +LA PK+N+TL++LRL +DGN+K YT Y+D  +   W  +F LF
Sbjct  247   FSYDLALEFSTGGNAILATPKYNSTLSFLRLGVDGNVKVYT-YNDKVDIGAWEVTFTLF  304



>gb|AFK45514.1| unknown [Medicago truncatula]
Length=436

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 206/299 (69%), Gaps = 3/299 (1%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             +S L  L  S   L   A VP   TFKFVN G+LG ++VEY  DYR++ +F+ PFQ+ FY
Sbjct  9     TSFLTLLFFSFSTLIAHAIVPQNETFKFVNSGDLGDFIVEYGGDYRMISIFNAPFQVGFY  68

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNA+TLALR+G  RSE   RWVWEANRG PV +   F L  DGNLVLA+ DGR+ WQ
Sbjct  69    NTTPNAFTLALRIGLQRSEQLFRWVWEANRGNPVGENGTFSLGADGNLVLANADGRIVWQ  128

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + T+NKGVV F+LL NGNMVL DAKG FVWQSFDHPTDTLLV Q L+ +GP KLVSR SE
Sbjct  129   TNTSNKGVVAFRLLSNGNMVLIDAKGKFVWQSFDHPTDTLLVDQYLKPNGPSKLVSRLSE  188

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-  396
              +N +GPY+++LEP  L  Y ++ NS RPI Y  SS WFS  K SLE V   +  ++ + 
Sbjct  189   KENVDGPYSLVLEPKGLALYYKSTNSPRPIKYWFSSSWFSFEKGSLENVTLKSDPESFEY  248

Query  395   -LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
               D+ VA S+  G+ ++ +P  N+TLTYLRL IDGN+K +T++ D      W  ++ LF
Sbjct  249   GFDFFVANSTTSGSSIIGRPVNNSTLTYLRLGIDGNIKFHTYFLDVRSGV-WKVTYTLF  306



>gb|KDP32539.1| hypothetical protein JCGZ_14742 [Jatropha curcas]
Length=427

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/280 (59%), Positives = 200/280 (71%), Gaps = 5/280 (2%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFK+VNEG+ G Y+VEY A+YRV+D F+ PFQLCFYNTTPNA+TLALRMGTVR
Sbjct  23    ASVPPSATFKYVNEGDFGEYIVEYDANYRVLDPFAQPFQLCFYNTTPNAFTLALRMGTVR  82

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE  MRWVWEANRG PV + A      DGNL LAD DGR+AWQ+ T+NKGVVGFKL  NG
Sbjct  83    SESLMRWVWEANRGNPVGENATLTFGTDGNLALADADGRIAWQTNTSNKGVVGFKLFSNG  142

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD  G F+WQSFD+PTDTLLVGQSL+L GP KLVSRASE +N NG Y++ +E   L
Sbjct  143   NMVLHDKNGKFIWQSFDYPTDTLLVGQSLKLEGPNKLVSRASEKENKNGAYSLFMEDKTL  202

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQ  342
               Y ++  +++P+LY   +   SV K  L+ V F      L+L+Y+ AKS   G   L +
Sbjct  203   AMYYKSPKASKPLLYFLFNDLLSVAKGPLKRVTF---LSGLELEYEGAKSFG-GTLTLRR  258

Query  341   PKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             PK+N TL+YLRL IDGNLK +T Y D  +   W  ++ LF
Sbjct  259   PKYNMTLSYLRLGIDGNLKIHT-YEDNADWSAWQVTYTLF  297



>ref|XP_010060695.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Eucalyptus grandis]
Length=439

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/287 (56%), Positives = 199/287 (69%), Gaps = 7/287 (2%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKFVNEGE GPY+VEY  +YR+  + +  F +CFYNTTPNA+TLALRM + R
Sbjct  22    AIVPPSAQFKFVNEGEFGPYIVEYDGNYRLTSIGNAVFHICFYNTTPNAFTLALRMASHR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A F L  DGNLVLAD DGRVAWQS TA KGVVG KLL NG
Sbjct  82    SESLFRWVWEANRGNPVHENATFALGGDGNLVLADADGRVAWQSHTAKKGVVGLKLLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KGNFVWQSFD PTDTLLVGQSLR+    KLVSRASE  N+NGPY++++EP +L
Sbjct  142   NMVLHDSKGNFVWQSFDSPTDTLLVGQSLRVGAVSKLVSRASEKDNSNGPYSLVIEPKQL  201

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-------LDYKVAKSSKL  363
               Y  +KNS +P+LY+   +   +    L +V  +++++TL        L Y VA  +  
Sbjct  202   SLYYTSKNSPKPLLYYTFGQHMYLADGLLAQVTLDSRSETLDGSIYDIILKYVVANKTSG  261

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                +L +PK+N+TLT LRL  DGNL+ YT+Y   +  + W  +F LF
Sbjct  262   DGLILRRPKYNSTLTILRLGTDGNLQAYTYYHMTDYLWAWDVTFSLF  308



>emb|CAA61158.1| SIEP1L protein [Beta vulgaris subsp. vulgaris]
Length=391

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 208/306 (68%), Gaps = 20/306 (7%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNT  927
             +++FL+ S Q     A VP  +TFK VN+G+ G Y+VEY  +YR +DVF++PFQLCFYNT
Sbjct  16    SILFLISSSQ-----ANVPPSSTFKIVNQGDFGDYIVEYDGNYRALDVFNSPFQLCFYNT  70

Query  926   TPNAYTLALRMGTVRSELRMRWVWE----ANRGKPVRDGAIFELRQDGNLVLADVDGRVA  759
             TPN+YTLALRM  VRSE   RWVWE    ANRG PV + A F L  DGNLVLAD D R+A
Sbjct  71    TPNSYTLALRMCLVRSESLFRWVWEVRHEANRGNPVGENATFSLGTDGNLVLADADRRIA  130

Query  758   WQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRA  579
             WQ+ T NKGVVGFKLL NGNMVLHDAK  F+WQSFD+PTDTLLVGQSLRL GP KLVSR 
Sbjct  131   WQTNTTNKGVVGFKLLPNGNMVLHDAKDKFIWQSFDYPTDTLLVGQSLRLDGPTKLVSRV  190

Query  578   SETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-  402
             S   N+NGPYT ++EP  L  Y ++ NS +P+LY        + KSSL+EV F+   +  
Sbjct  191   SAKLNSNGPYTFVMEPRVLTMYYKSPNSPKPLLYF---SMLDLSKSSLKEVTFSCSPEND  247

Query  401   ------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
                   +   Y+    S  G   +A+PK+N+TL+ LRL IDGNL+ +T YSD  +   W 
Sbjct  248   DNYAYDITFAYQSIDGSIGGNAEIARPKYNSTLSILRLGIDGNLRVFT-YSDKVDWAAWE  306

Query  239   ESFKLF  222
              +F LF
Sbjct  307   ATFTLF  312



>gb|EYU45021.1| hypothetical protein MIMGU_mgv1a026633mg [Erythranthe guttata]
Length=435

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 207/296 (70%), Gaps = 5/296 (2%)
 Frame = -1

Query  1097  FLVVSIQILTCFAQ--VPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTT  924
             FL + I IL  F Q  VP   TF FVNEG  G Y+VEY A+YRV+ + ++PFQ+CFYNTT
Sbjct  12    FLFIFINILPSFTQGIVPPSQTFNFVNEGSFGDYIVEYNANYRVLSIANSPFQMCFYNTT  71

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             P+AYTLALRMGTVRSE  M WVWEANRG PV + A F L   GNL+LAD  GR+AWQS T
Sbjct  72    PSAYTLALRMGTVRSESLMYWVWEANRGNPVGENATFSLGASGNLLLADAGGRIAWQSNT  131

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
             ANK VVGFKLL NGNMVL+++KGNFVWQSFD PTDTLL+GQSL+L GP KLV R SET+N
Sbjct  132   ANKDVVGFKLLPNGNMVLYNSKGNFVWQSFDSPTDTLLMGQSLKLKGPNKLVGRLSETEN  191

Query  563   TNGPYTIILEPTRLGFYNQTKNSA-RPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDY  387
              NGPY+++LEP R   Y  +KNS  +P+LY+  + + S G   L+ +    +     + +
Sbjct  192   KNGPYSLVLEPKRFAMYYTSKNSPNKPMLYYSLTVFPSSGNQVLDNMTLEVEPDFGDVAF  251

Query  386   KVAKS-SKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             ++  + S  GA VL +PK+N TLTYLRL +DG L  +TFY     N  W  ++ LF
Sbjct  252   EIRLAYSGGGAGVLFRPKYNATLTYLRLGVDGGLTAHTFYDKVFYN-AWEMTYTLF  306



>ref|XP_003596371.1| hypothetical protein MTR_2g076490 [Medicago truncatula]
 gb|AES66622.1| epidermis-specific secreted EP1-like glycoprotein [Medicago truncatula]
Length=492

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 201/286 (70%), Gaps = 2/286 (1%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             +S L  L  S   L   A VP   TFKFVN G+LG ++VEY  DYR++ +F+ PFQ+ FY
Sbjct  9     TSFLTLLFFSFSTLIAHAIVPQNETFKFVNSGDLGDFIVEYGGDYRMISIFNAPFQVGFY  68

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNA+TLALR+G  RSE   RWVWEANRG PV +   F L  DGNLVLA+ DGR+ WQ
Sbjct  69    NTTPNAFTLALRIGLQRSEQLFRWVWEANRGNPVGENGTFSLGADGNLVLANADGRIVWQ  128

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + T+NKGVV F+LL NGNMVL DAKG FVWQSFDHPTDTLLV Q L+ +GP KLVSR SE
Sbjct  129   TNTSNKGVVAFRLLSNGNMVLIDAKGKFVWQSFDHPTDTLLVDQYLKPNGPSKLVSRLSE  188

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-  396
              +N +GPY+++LEP  L  Y ++ NS RPI Y  SS WFS  K SLE V   +  ++ + 
Sbjct  189   KENVDGPYSLVLEPKGLALYYKSTNSPRPIKYWFSSSWFSFEKGSLENVTLKSDPESFEY  248

Query  395   -LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDA  261
               D+ VA S+  G+ ++ +P  N+TLTYLRL IDGN+K +T++ D 
Sbjct  249   GFDFFVANSTTSGSSIIGRPVNNSTLTYLRLGIDGNIKFHTYFLDV  294



>ref|XP_002316859.1| hypothetical protein POPTR_0011s11150g [Populus trichocarpa]
 gb|EEE97471.1| hypothetical protein POPTR_0011s11150g [Populus trichocarpa]
Length=428

 Score =   327 bits (837),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 208/300 (69%), Gaps = 17/300 (6%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTP  921
             + L+ SI   T  A VP  +TFK+VNEGE G Y+ EY  DYR + + ++PFQL FYNTTP
Sbjct  8     LCLLFSIS-FTVHATVPPSSTFKYVNEGEFGEYISEYVPDYRPLPIGTSPFQLIFYNTTP  66

Query  920   NAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETA  741
             NAYTLALRMGTVRSE  MRWVWEANRG PVR+ A   L  DGNLVLAD DGRVAWQ+ TA
Sbjct  67    NAYTLALRMGTVRSESTMRWVWEANRGNPVRENATLTLGGDGNLVLADADGRVAWQTNTA  126

Query  740   NKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNT  561
             NKGVVG +LL NGNMVLHD+KGNF+WQSFD PTDTLLVGQSLR+ G  +LVSRASET N+
Sbjct  127   NKGVVGLQLLSNGNMVLHDSKGNFIWQSFDSPTDTLLVGQSLRVGGVTRLVSRASETHNS  186

Query  560   NGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK-------TQT  402
             +G Y++++EP RL  Y ++ NS +P +Y+D   + SV    L+    N            
Sbjct  187   DGAYSLVMEPKRLAMYYKSPNSPKPYIYYD---FDSVYNGRLQNATLNCAPNGYDDLAND  243

Query  401   LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             L LD          A  LA+PK+N+TL++LR+ IDG+LK YT Y++  +   W E++ LF
Sbjct  244   LTLDLSTGN-----AMTLARPKYNSTLSFLRIGIDGSLKMYT-YNNKVDYQAWEETYTLF  297



>ref|XP_010644111.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Vitis vinifera]
Length=449

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/316 (52%), Positives = 211/316 (67%), Gaps = 14/316 (4%)
 Frame = -1

Query  1130  SSPSSYSSTLIFL-VVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
              SP S++ + IFL  +SI   T  A VP KNTFK+VNEG  GPY+VEY  DYR + +F++
Sbjct  3     CSPPSFTLSFIFLSFISIYSFTVHASVPLKNTFKYVNEGGFGPYIVEYGGDYRGLPIFAS  62

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ CFYNTTPNAYTLALRM   R+E   RWVWEANRGKPV   A      DGNLVL   
Sbjct  63    PFQFCFYNTTPNAYTLALRMAVQRTEPIYRWVWEANRGKPVGQNATLTFGTDGNLVLTHA  122

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG+VAWQ+ T NKGVVG KLL NGN++LHD+ G F+WQSFD+PTD LLVGQSLR+ G  K
Sbjct  123   DGQVAWQTGTGNKGVVGLKLLSNGNLILHDSTGKFIWQSFDYPTDVLLVGQSLRVGGVTK  182

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPIL-----YHDSSKWFSVGKSSLEE  429
             LVSRAS+  N++G Y++++EP RL  Y +  NS  P+L     Y  SS WF++ K SL+ 
Sbjct  183   LVSRASKADNSDGKYSLVMEPKRLAMYYKGSNSPTPMLYAVTTYATSSVWFTIDKGSLQN  242

Query  428   VKFNAKTQT------LKLDYKVAKSS-KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFY  270
             V              L L+Y ++ S    G  +L +PK+N+T T+LRL++DGN++ YT++
Sbjct  243   VTLTGSLDDLGYAYYLNLNYHLSNSPYPTGGAILVRPKYNSTSTFLRLDMDGNIRLYTYF  302

Query  269   SDAEENFHWGESFKLF  222
              D  +   W  ++ LF
Sbjct  303   -DKVDYQGWQVTYTLF  317



>ref|XP_006442504.1| hypothetical protein CICLE_v10020212mg [Citrus clementina]
 gb|ESR55744.1| hypothetical protein CICLE_v10020212mg [Citrus clementina]
Length=434

 Score =   327 bits (837),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 219/306 (72%), Gaps = 9/306 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S  +F + S+      AQVPA   FKFVNEGE GP++ EY ADYR++ +F++
Sbjct  1     MSSSSAIFS--LFFLCSLIFSIANAQVPANERFKFVNEGEFGPFINEYDADYRMIRIFNS  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R+E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAYTLALRWGIQRNEPLYRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             +G V WQS T+NKGVVGFKLL NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+ G  K
Sbjct  119   NGTVVWQSNTSNKGVVGFKLLPNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGGVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY+ ++E  RL  Y ++ N+ RP++Y      F V  S L+ V FN+
Sbjct  179   LVSRLSIKENVDGPYSFVMESDRLLLYYKSSNAPRPVVYFT----FPVQFSGLKNVTFNS  234

Query  413   KTQTLK-LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
               +T +   Y++   SS  G+ +LA+PK+N T+++LRL +DGNL+ +T+Y D  ++    
Sbjct  235   APETDEAFAYQLTLDSSSGGSLILARPKYNATISFLRLGVDGNLRIFTYY-DKVDSQPTE  293

Query  239   ESFKLF  222
             E+F LF
Sbjct  294   ETFTLF  299



>ref|XP_006477738.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=434

 Score =   326 bits (835),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 217/306 (71%), Gaps = 9/306 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S  +F + S+      AQVPA   FKFVNEGE GP++ EY ADYR++ +F++
Sbjct  1     MSSSSAIFS--LFFLCSLIFSIANAQVPANERFKFVNEGEFGPFINEYDADYRMISIFNS  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R+E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAYTLALRWGIQRNEPLYRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             +G V WQS T+NKGVVGFK+L NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+ G  K
Sbjct  119   NGTVVWQSNTSNKGVVGFKVLPNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGGVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY+ ++E  RL  Y ++ N  RP++Y      F V  S L+ V FN+
Sbjct  179   LVSRLSIKENVDGPYSFVMESDRLSLYYKSSNVPRPVVYFT----FPVQFSGLKNVTFNS  234

Query  413   KTQTLK-LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
               +T +   Y++   SS  G  +LA+PK+N T+++LRL +DGNL+ +T+Y D  ++    
Sbjct  235   APETDEAFAYQLTLDSSSGGGLILARPKYNATISFLRLGVDGNLRIFTYY-DKVDSQPTE  293

Query  239   ESFKLF  222
             E+F LF
Sbjct  294   ETFTLF  299



>ref|XP_004294120.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Fragaria vesca subsp. vesca]
Length=429

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 201/284 (71%), Gaps = 13/284 (5%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVV-DVFSNPFQLCFYNTTPNAYTLALRMGTV  885
             AQVPA  TF  VNEGE GPYVVEY  DYR++  VF++PFQL FYNTTPNA+TLA+RMG  
Sbjct  25    AQVPANETFTLVNEGEFGPYVVEYFGDYRMLPQVFASPFQLGFYNTTPNAFTLAIRMGLT  84

Query  884   RSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQN  705
             RSE  MRWVWEANRG PV + A F LR DGNLVLA+ DGRVAWQ+ T+NKGVVGF LL  
Sbjct  85    RSESLMRWVWEANRGNPVGENATFSLRTDGNLVLAEADGRVAWQTNTSNKGVVGFTLLPT  144

Query  704   GNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTR  525
             GNMVL DA GNFVWQSFD PTDTLLVGQSLR  G  KLVSRASE +N +GPY+++LEP  
Sbjct  145   GNMVLCDANGNFVWQSFDSPTDTLLVGQSLRAGGVSKLVSRASEKENKDGPYSLVLEPKG  204

Query  524   LGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ---TLKLDYKVAKSSKLGAH  354
             L  Y ++  S + +LY   S++  + + +LE V  N+ T       L +  +  + L   
Sbjct  205   LFLYYKSSISKKSLLY---SQFTDIQQGTLENVTLNSATDDGCVWDLSFLTSGGNNL---  258

Query  353   VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
              LA+PKFN TLTYLRL IDGN+K YT+Y   +    W ++F LF
Sbjct  259   YLARPKFNGTLTYLRLGIDGNIKLYTYYGQVDS---WEQTFTLF  299



>ref|XP_004294118.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Fragaria vesca subsp. vesca]
Length=434

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 203/287 (71%), Gaps = 8/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQ+PA  TFKFVN GE  PY+VEY A YR++D+F++PFQL FYNTTP+++TLALRMG  +
Sbjct  18    AQIPANETFKFVNSGEFWPYIVEYDASYRMLDLFASPFQLAFYNTTPDSFTLALRMGLKK  77

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A F L  +GN+VLAD DGRVAWQS TANKG V FKLL+NG
Sbjct  78    SESYYRWVWEANRGNPVGENATFSLGTNGNIVLADGDGRVAWQSNTANKGAVRFKLLRNG  137

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+++KG  VWQSFD PTDTL+  QSL      KLVSRASET+N +GPY++++EP  L
Sbjct  138   NMVLYNSKGKSVWQSFDSPTDTLVASQSLGAGTVSKLVSRASETENKDGPYSLVVEPKGL  197

Query  521   GFYNQTKNSARPILYHDSSKWFSVGK-SSLEEVKFNA------KTQTLKLDYKVAKSSKL  363
               Y  +KNS +P+LY+ SSKW SV K SSL  +  NA          L L++ V  S+  
Sbjct  198   AMYYNSKNSPKPLLYYRSSKWISVPKGSSLRHITLNAAPVEGGHAYDLTLEFLVGNSTSG  257

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +LA+PK+N+T T LRL IDGNL  YT+Y  A     W  +F LF
Sbjct  258   GNLILARPKYNSTSTCLRLGIDGNLNLYTYYDKARYG-AWETTFTLF  303



>ref|XP_009339992.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=434

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 202/287 (70%), Gaps = 8/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFK+VNEGE GP++ EY A YR++D F+ PFQL FYNTTPNA+TLALRMG  R
Sbjct  18    AQVPADQTFKYVNEGEFGPFITEYDASYRMLDPFAAPFQLAFYNTTPNAFTLALRMGLRR  77

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      +GNLVLA  +G+VAWQ+ TANKGVVGFKLL NG
Sbjct  78    SESLFRWVWEANRGNPVGENATLTFGTNGNLVLAHANGKVAWQTNTANKGVVGFKLLPNG  137

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLH++KG F+WQSFD+PTDTLLVGQSLR     KLVSRASE +N +GPY++++EP  L
Sbjct  138   NMVLHNSKGKFIWQSFDYPTDTLLVGQSLRAGAVSKLVSRASEKENKDGPYSLVMEPKGL  197

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ NS +P LY   S+   +  +SL  V  N+  +T       L L+Y+ A SS  
Sbjct  198   ALYYKSSNSPKPQLYFSFSQRIPIQMNSLVLVTLNSAPETDEGHAYDLTLEYQEANSSSS  257

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G   L +PK+N+T T+LRL IDGN+K YT Y+D  +   W  +F LF
Sbjct  258   GTVFLGRPKYNSTSTFLRLGIDGNVKLYT-YNDKVDIGAWEVTFALF  303



>ref|XP_003596378.1| hypothetical protein MTR_2g076590 [Medicago truncatula]
 gb|AES66629.1| epidermis-specific secreted EP1-like glycoprotein [Medicago truncatula]
Length=438

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 202/299 (68%), Gaps = 3/299 (1%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             +S L  L  S   L   A VP   TFKFVN G+LG ++VEY  DYR++ +F+ PFQ+ FY
Sbjct  9     TSFLTLLFFSFSTLIAHAIVPQNETFKFVNSGDLGDFIVEYGGDYRMISIFNAPFQVGFY  68

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNA+TLALR+G  RSE   RWVWEANRG PV +   F L  DGNLVLA+ DGR+ WQ
Sbjct  69    NTTPNAFTLALRIGLQRSEQLFRWVWEANRGNPVGENGTFSLGADGNLVLANADGRIVWQ  128

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + T+NKGVV F+LL NGNMVL DAK  FVWQSFDHPTDTLLV Q L+ +GP KLVSR SE
Sbjct  129   TNTSNKGVVAFRLLSNGNMVLIDAKDKFVWQSFDHPTDTLLVDQYLKPNGPSKLVSRLSE  188

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-  396
              +N +GPY+++LEP  L  Y ++ NS RP  Y  SS WFS  K SLE V   +  ++ + 
Sbjct  189   KENVDGPYSLVLEPKGLALYYRSTNSPRPSKYWFSSSWFSFEKGSLENVTLKSDPESFEF  248

Query  395   -LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
               D+ V  S+  G  ++ +P  N+TLTYLRL IDGN++ +T++ D      W  +F LF
Sbjct  249   GFDFHVTNSTTSGNSIIGRPVNNSTLTYLRLGIDGNIQFHTYFLDVRSGV-WKVTFTLF  306



>ref|XP_004294119.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Fragaria vesca subsp. vesca]
 gb|AHL16606.1| mannose binding lectin [Fragaria x ananassa subsp. ananassa]
Length=442

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 201/286 (70%), Gaps = 7/286 (2%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVPA  TFKFVN+ E GPY+VEY   YR++ +F++PFQ  FYNTTPNA+TLALRMG  R
Sbjct  26    AQVPANETFKFVNDQEFGPYIVEYDGSYRMLSIFASPFQFAFYNTTPNAFTLALRMGLTR  85

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A      +GNLVLAD DGRVAWQ+ TANKGVVG KLL  G
Sbjct  86    SESLFRWVWEANRGNPVGENATLTFGTNGNLVLADADGRVAWQTNTANKGVVGLKLLPTG  145

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             N+VL+++KG FVWQSFD+PTDTLLVGQSL+  G  KLVSR SE++N +GPY++++EP  L
Sbjct  146   NLVLYNSKGVFVWQSFDYPTDTLLVGQSLKAGGVNKLVSRLSESENKDGPYSLVMEPKGL  205

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ------TLKLDYKVAKSSKLG  360
               Y ++ NS +P+LY       +V   +L+ V  N           + LDY++A S+  G
Sbjct  206   AMYYKSPNSPKPLLYFSFYDRITVQTGTLDHVTLNVADTDDGFAYDITLDYQIANSTNSG  265

Query  359   AHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
               +LA+PK+N T T+LRL IDGN+K YT Y+D  +   W  +F+LF
Sbjct  266   TLILARPKYNATSTFLRLGIDGNVKFYT-YNDKVDYGAWEVTFRLF  310



>gb|AFY98639.1| epidermis-specific secreted glycoprotein EP1-like protein [Phaseolus 
vulgaris]
Length=431

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 209/309 (68%), Gaps = 4/309 (1%)
 Frame = -1

Query  1142  LKNMSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV  963
             + ++S P + S  L  L  S   L   A VP   TFKFVN GELGP++VEY  DYR++ +
Sbjct  1     MASLSLPKT-SFLLALLFFSSFTLIVQAIVPQNETFKFVNSGELGPFIVEYGGDYRMISI  59

Query  962   FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVL  783
             F++PFQ+ FYNTTPNA+TLALR+G  RSE   RWVWEANRG PV + A F L  DGNLVL
Sbjct  60    FNSPFQVGFYNTTPNAFTLALRVGLQRSEQLFRWVWEANRGNPVGENATFSLGTDGNLVL  119

Query  782   ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
             AD DGR+ WQ+ T+ +GVV F+LL NGNMVL DA+G FVWQSFDHPTDTLLVGQ LR   
Sbjct  120   ADADGRIVWQTNTSKRGVVAFRLLPNGNMVLLDAQGKFVWQSFDHPTDTLLVGQYLRAKR  179

Query  602   PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
             P KLV++ S+ +N NGPY+++LEP RL  Y ++KNS RPILY     WF++ + SLE+  
Sbjct  180   PSKLVNKLSKKENVNGPYSLVLEPKRLALYYKSKNSPRPILYGFPPDWFTIQQGSLEKAT  239

Query  422   FNAKTQTLKLD--YKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENF  249
             F    +T +L   Y VA S      +L +   N+ +TYLR+ IDGN+K  T++ D  +  
Sbjct  240   FTFDPETFELGFIYYVAISPPGNNRILGRAGNNSPITYLRVGIDGNIKFPTYFLDVGDGV  299

Query  248   HWGESFKLF  222
              W  ++ LF
Sbjct  300   -WQVTYTLF  307



>ref|XP_010060694.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Eucalyptus grandis]
Length=440

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/289 (56%), Positives = 199/289 (69%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKF+N+GE  PY VEY  DYR   +  +PFQLCFYNTTPNA+TL+LRM T R
Sbjct  22    AVVPPSAQFKFINQGEFRPYGVEYGGDYRTTTIVKSPFQLCFYNTTPNAFTLSLRMATRR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PVR+ A F LR +GNL+LA+ DGRVAWQS TANKGVVGF+LL NG
Sbjct  82    SESLFRWVWEANRGNPVRENATFALRANGNLILAEADGRVAWQSRTANKGVVGFELLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFD PTDTLLVGQSLR+ G  KLVSRAS   N++GPY++++EP  L
Sbjct  142   NMVLYDSKGNFVWQSFDSPTDTLLVGQSLRVGGVSKLVSRASVEDNSDGPYSLVIEPKEL  201

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ---------TLKLDYKVAKSS  369
               Y  +KNS +P+LY   +   ++  +SL EV  +++ +         TLKL      S 
Sbjct  202   ALYYTSKNSPKPLLYFALTPHITLADNSLTEVTLDSQPENDEGHAYEITLKLGVANTTSY  261

Query  368   KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                   + +PK+N+TLT LRL IDGNL+ YT Y+D      W  +F LF
Sbjct  262   PYIPVTVGRPKYNSTLTMLRLGIDGNLRAYT-YNDHVFYRAWEITFTLF  309



>gb|KCW67504.1| hypothetical protein EUGRSUZ_F01233, partial [Eucalyptus grandis]
Length=436

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/289 (56%), Positives = 199/289 (69%), Gaps = 10/289 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKF+N+GE  PY VEY  DYR   +  +PFQLCFYNTTPNA+TL+LRM T R
Sbjct  22    AVVPPSAQFKFINQGEFRPYGVEYGGDYRTTTIVKSPFQLCFYNTTPNAFTLSLRMATRR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PVR+ A F LR +GNL+LA+ DGRVAWQS TANKGVVGF+LL NG
Sbjct  82    SESLFRWVWEANRGNPVRENATFALRANGNLILAEADGRVAWQSRTANKGVVGFELLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL+D+KGNFVWQSFD PTDTLLVGQSLR+ G  KLVSRAS   N++GPY++++EP  L
Sbjct  142   NMVLYDSKGNFVWQSFDSPTDTLLVGQSLRVGGVSKLVSRASVEDNSDGPYSLVIEPKEL  201

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ---------TLKLDYKVAKSS  369
               Y  +KNS +P+LY   +   ++  +SL EV  +++ +         TLKL      S 
Sbjct  202   ALYYTSKNSPKPLLYFALTPHITLADNSLTEVTLDSQPENDEGHAYEITLKLGVANTTSY  261

Query  368   KLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                   + +PK+N+TLT LRL IDGNL+ YT Y+D      W  +F LF
Sbjct  262   PYIPVTVGRPKYNSTLTMLRLGIDGNLRAYT-YNDHVFYRAWEITFTLF  309



>ref|XP_011016210.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=428

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 207/302 (69%), Gaps = 18/302 (6%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNT  927
             +L FL+ SI  +   A VP   TFK+VNEGE G Y+ EY  DYR + + ++PFQL FYNT
Sbjct  7     SLCFLL-SISFIA-HATVPPSATFKYVNEGEFGEYISEYFPDYRPLPISTSPFQLIFYNT  64

Query  926   TPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             TPNAYTLALRMGTVRSE  MRWVWEANRG PVR+ A   L +DGNLVLAD DGRVAWQ+ 
Sbjct  65    TPNAYTLALRMGTVRSESTMRWVWEANRGNPVRENATLTLVEDGNLVLADADGRVAWQTN  124

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQ  567
             TANKGVVG +LL NGNMVLHD+KG F+WQSFD PTDTLLVGQSLR+ G  +LVSRASET 
Sbjct  125   TANKGVVGLQLLSNGNMVLHDSKGKFIWQSFDSPTDTLLVGQSLRVGGVTRLVSRASETH  184

Query  566   NTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK-------T  408
             N++G Y++++EP RL  Y ++ NS +P +Y+    + SV K  L+    N          
Sbjct  185   NSDGAYSLVMEPKRLAMYYKSPNSPKPYIYY---AFDSVYKGRLQNATLNCAPNGYDEVA  241

Query  407   QTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
               L LD             LA+PK+N+TL++LR+ IDG+LK YT Y++  +   W  ++ 
Sbjct  242   NDLTLDLSTGN-----GLTLARPKYNSTLSFLRIGIDGSLKIYT-YNNKVDYQAWEVTYT  295

Query  227   LF  222
             LF
Sbjct  296   LF  297



>ref|XP_007025376.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding 
domain, putative [Theobroma cacao]
 gb|EOY27998.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding 
domain, putative [Theobroma cacao]
Length=442

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 206/304 (68%), Gaps = 17/304 (6%)
 Frame = -1

Query  1103  LIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTT  924
             L F++ S  +    A+VP   TFK++NEG+LG Y VEY ADYR + ++  PFQLCFYNTT
Sbjct  16    LFFILCSSNVAN--AKVPPSRTFKYINEGDLGEYSVEYFADYRALPIYLFPFQLCFYNTT  73

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             PNAYTLALRMG  RSE  MRWVWEANRG+PV + A   L  +GNLVLAD DG V WQ+ T
Sbjct  74    PNAYTLALRMGHRRSESIMRWVWEANRGRPVGENATLTLGSEGNLVLADADGTVVWQTGT  133

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
             A KGVVG KLL NGN+VL+D KG F+WQSFDHPTDTLLVGQ+LR +GP KLVSR S    
Sbjct  134   AIKGVVGLKLLANGNLVLYDKKGKFIWQSFDHPTDTLLVGQALRSNGPNKLVSRTSTADG  193

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT------  402
             + GP++ ++E   L  Y ++K S  P+LY+ S + F  G+ SL  +KF +  +T      
Sbjct  194   SEGPHSFVMEQRYLKLYYKSKYSPSPLLYYRSDE-FGNGQGSLANLKFYSMPETEQAYAF  252

Query  401   -LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG---ES  234
              L   + +  SS  G H+L++PK+N+T + LR+E DGNLK YTF     EN  WG    +
Sbjct  253   ELGFTFDMNNSSSSGTHILSRPKYNSTYSMLRVESDGNLKIYTF----NENVDWGAWENT  308

Query  233   FKLF  222
             FKLF
Sbjct  309   FKLF  312



>ref|XP_011029573.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=428

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 206/302 (68%), Gaps = 18/302 (6%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNT  927
             +L FL+ SI  +   A VP   TFK+VNEGE G Y+ EY  DYR + + ++PFQL FYNT
Sbjct  7     SLCFLL-SISFIA-HATVPPSATFKYVNEGEFGEYISEYFPDYRPLPISTSPFQLIFYNT  64

Query  926   TPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             TPNAYTLALRMGTVRSE  MRWVWEANRG PVR+ A   L  DGNLVLAD DGRVAWQ+ 
Sbjct  65    TPNAYTLALRMGTVRSESTMRWVWEANRGNPVRENATLTLVGDGNLVLADADGRVAWQTN  124

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQ  567
             TANKGVVG +LL NGNMVLHD+KG F+WQSFD PTDTLLVGQSLR+ G  +LVSRASET 
Sbjct  125   TANKGVVGLQLLSNGNMVLHDSKGKFIWQSFDSPTDTLLVGQSLRVGGVTRLVSRASETH  184

Query  566   NTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK-------T  408
             N++G Y++++EP RL  Y ++ NS +P +Y+    + SV K  L+    N          
Sbjct  185   NSDGAYSLVMEPKRLAMYYKSPNSPKPYIYY---AFDSVYKGRLQNATLNCAPNGYDEVA  241

Query  407   QTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
               L LD             LA+PK+N+TL++LR+ IDG+LK YT Y++  +   W  ++ 
Sbjct  242   NDLTLDLSTGN-----GLTLARPKYNSTLSFLRIGIDGSLKIYT-YNNKVDYQAWEVTYT  295

Query  227   LF  222
             LF
Sbjct  296   LF  297



>ref|XP_010108237.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
 gb|EXC18477.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
Length=431

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/300 (54%), Positives = 205/300 (68%), Gaps = 11/300 (4%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             SS     ++S+ +    AQVP   TFKFVNEGELGPY+VEY   YR++ VF++PFQL FY
Sbjct  11    SSLFSLFILSLTLSIAQAQVPENATFKFVNEGELGPYIVEYDGSYRMLSVFNSPFQLAFY  70

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNA+TLALRMG  RSE R  WVWEANRG PV + A      DGNLVLAD DGRVAWQ
Sbjct  71    NTTPNAFTLALRMGLRRSEFR--WVWEANRGNPVGENATLTFGTDGNLVLADADGRVAWQ  128

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + TANKGVVGF+LL NGN+VLHD+KGNF+WQSFD+PTDTLLVGQ+LR     KLVSR S 
Sbjct  129   TNTANKGVVGFQLLPNGNIVLHDSKGNFIWQSFDYPTDTLLVGQTLR----NKLVSRLSA  184

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT---  402
              +N +GPY+ ++EP     Y Q KNS +P+ Y   ++ FS  + +L+ V   A  +T   
Sbjct  185   ERNKDGPYSFVIEPKGFSLYYQGKNSNKPLKYFSLAERFSPVQGTLKNVTLQASPETDEG  244

Query  401   LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                D K+  S+  G++ + +PK+N T + LRL IDGN+K YT Y+D  +   W   F +F
Sbjct  245   YAYDVKLELSTG-GSYYVGRPKYNGTSSLLRLGIDGNVKVYT-YNDKVDTQAWEVVFSIF  302



>sp|Q39688.1|EP1G_DAUCA RecName: Full=Epidermis-specific secreted glycoprotein EP1; AltName: 
Full=52/54 kDa medium protein; Flags: Precursor [Daucus 
carota]
 gb|AAA33136.1| N-glycosylation sites: (130..138), (244..252), (352..360), (734..742), 
(748..756), (865..873) [Daucus carota]
Length=389

 Score =   309 bits (792),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 206/303 (68%), Gaps = 9/303 (3%)
 Frame = -1

Query  1106  TLIFLVVSIQ-ILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYN  930
             TL  L+  IQ I  C   VPA  TFKFVNEGELG Y+ EY  DYR +D F++PFQLCFYN
Sbjct  8     TLTILLFFIQRIDFCHTLVPANETFKFVNEGELGQYISEYFGDYRPLDPFTSPFQLCFYN  67

Query  929   TTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQS  750
              TP A+TLALRMG  R+E  MRWVWEANRG PV + A      DGNLVLA  +G+VAWQ+
Sbjct  68    QTPTAFTLALRMGLRRTESLMRWVWEANRGNPVDENATLTFGPDGNLVLARSNGQVAWQT  127

Query  749   ETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASET  570
              TANKGVVG K+L NGNMVL+D+KG F+WQSFD PTDTLLVGQSL++    KLVSRAS  
Sbjct  128   STANKGVVGLKILPNGNMVLYDSKGKFLWQSFDTPTDTLLVGQSLKMGAVTKLVSRASPG  187

Query  569   QNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKS-SLEEVKF-----NAKT  408
             +N NGPY++++EP  L  Y +   S +PI Y+  S +  + K+ SL+ V F     N + 
Sbjct  188   ENVNGPYSLVMEPKGLHLYYKPTTSPKPIRYYSFSLFTKLNKNESLQNVTFEFENENDQG  247

Query  407   QTLKLDYKVAKSSKL-GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESF  231
                 L  K   S+ L GA +L + K+NTTL++LRLEIDGN+K YT Y+D  +   W  ++
Sbjct  248   FAFLLSLKYGTSNSLGGASILNRIKYNTTLSFLRLEIDGNVKIYT-YNDKVDYGAWEVTY  306

Query  230   KLF  222
              LF
Sbjct  307   TLF  309



>ref|XP_002317462.2| curculin-like lectin family protein [Populus trichocarpa]
 gb|EEE98074.2| curculin-like lectin family protein [Populus trichocarpa]
Length=430

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/300 (53%), Positives = 205/300 (68%), Gaps = 18/300 (6%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTP  921
             + L++SI  +   + VP  +TFKFVNEGE GPY+ EY  DYR + + ++PFQL FYNTTP
Sbjct  7     LCLLLSIFFIA-HSTVPPSSTFKFVNEGEFGPYISEYVPDYRPLPIGTSPFQLMFYNTTP  65

Query  920   NAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETA  741
             NAYTLALRMGT RSE   RWVWEANRG PVR+ A     +DGNLVLAD DGRVAWQ+ TA
Sbjct  66    NAYTLALRMGTRRSESLTRWVWEANRGNPVRENATLTFGKDGNLVLADADGRVAWQTNTA  125

Query  740   NKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNT  561
             NKGV GF++L NGNMVLHD+KGNF+WQSFD PTDTLLVGQSLR+ G  +LVSRAS+ +N+
Sbjct  126   NKGVAGFEVLPNGNMVLHDSKGNFIWQSFDSPTDTLLVGQSLRVGGATRLVSRASQKENS  185

Query  560   NGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------  402
             +G Y++++E  RL  Y ++ NS +   Y+     F+  +  L+ V  N    +       
Sbjct  186   DGAYSLVMESKRLVMYYKSPNSPKQYFYYT----FNTLQDRLQNVTLNCNPDSYDNSASE  241

Query  401   LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             + LD      S  G  V A+PKFN TL++LR+ IDGNL+ Y+ Y++  +   W  SF LF
Sbjct  242   VTLDL-----SSGGWSVHARPKFNATLSFLRIGIDGNLRIYS-YNNKVDYMAWDVSFNLF  295



>ref|XP_010279124.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nelumbo nucifera]
Length=443

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 194/287 (68%), Gaps = 9/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFKFVN+G+LG + VEY ADYR + +   PF LCFYNTTPNA+TLALRMG   
Sbjct  27    ASVPPSKTFKFVNQGDLGEFSVEYLADYRPLSIVQFPFTLCFYNTTPNAFTLALRMGDRH  86

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             +E  MRWVWEANRG PV + A     +DGNL+LA  DGRVAWQ+ TAN+GV G KLL NG
Sbjct  87    TESIMRWVWEANRGNPVGENATLTFGRDGNLILAHADGRVAWQTGTANRGVTGLKLLPNG  146

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             N+VLHD +G FVWQSFDHPTDTLLVGQSL L GP KLVSR S    + GPY+  +E  RL
Sbjct  147   NLVLHDKRGGFVWQSFDHPTDTLLVGQSLLLGGPTKLVSRVSAKDGSEGPYSYGMEGRRL  206

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++KNS +P+LY+ S + F  G+ +L  + F +  ++       LK  + +  S   
Sbjct  207   VMYYKSKNSGKPLLYYQSDE-FGDGRGALAHLNFTSAPESDTAFAFELKYGFDMINSPSF  265

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             G  +L++PK+NTT ++LR+  DGNL+ YTFY D  +   W  ++ LF
Sbjct  266   GTFILSRPKYNTTYSFLRVGFDGNLRIYTFY-DKVDWGPWEVTYTLF  311



>ref|XP_006370153.1| hypothetical protein POPTR_0001s40200g, partial [Populus trichocarpa]
 gb|ERP66722.1| hypothetical protein POPTR_0001s40200g, partial [Populus trichocarpa]
Length=387

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 201/280 (72%), Gaps = 7/280 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             + VP+ +TFK VN GE    + EY +D+R +D+ ++ FQ+CFYNTTPNA+TLA+RMGT R
Sbjct  21    STVPSNSTFKKVNTGEWSEAISEYSSDFRALDISASVFQVCFYNTTPNAFTLAIRMGTRR  80

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S    R+VWEANRG PV + A     +DGNL+LAD DGRVAWQ+ TA+KGVVG ++L NG
Sbjct  81    SPAVRRFVWEANRGNPVGEDATLTFGEDGNLILADADGRVAWQTNTADKGVVGLQMLPNG  140

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+ G  +LVSRAS+ +NTNG Y+++LEP R+
Sbjct  141   NMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGGVTRLVSRASDKKNTNGAYSLVLEPKRI  200

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQ  342
               Y ++ NS +P +Y+ +S  FS+ K  L+ V+       L L +        G  +L++
Sbjct  201   AMYYKSPNSPKPYIYY-TSDLFSIQKGRLQYVRLINSANELSLQFSTG-----GGPLLSK  254

Query  341   PKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             P FN+TL++LRL +DGNL+ Y+F ++ E +  W  +F LF
Sbjct  255   PNFNSTLSFLRLGVDGNLRVYSF-NNQETSASWDVTFTLF  293



>ref|XP_006442512.1| hypothetical protein CICLE_v10023808mg [Citrus clementina]
 gb|ESR55752.1| hypothetical protein CICLE_v10023808mg [Citrus clementina]
 gb|KDO44631.1| hypothetical protein CISIN_1g041743mg [Citrus sinensis]
Length=440

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 207/305 (68%), Gaps = 10/305 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S   F ++++      AQVPA  TFKFVNEG LG Y  EY A+YR+  ++++
Sbjct  1     MSSSSALVS--FFFLLTLIFAVANAQVPANETFKFVNEGGLGEYFNEYNANYRMSGIYND  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNA+TLALR+G  + E   RWVWEANRGKPVR+ A+F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAFTLALRLGIKKQEPVFRWVWEANRGKPVRENAVFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQS TANKGV+GF L  NGNMVLHD+KGNF+WQ FD+PTDTLLVGQSLR+    K
Sbjct  119   DGTVVWQSNTANKGVLGFGLFPNGNMVLHDSKGNFIWQIFDYPTDTLLVGQSLRVGRVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY  ++EP RL FY ++ N  RPILY+     F    + L+ +   +
Sbjct  179   LVSRLSVKENVDGPYRFVMEPRRLAFYYKSSNVPRPILYYT----FPFSYAGLKNLTLKS  234

Query  413   KTQTLKLDYKVAKSSKLG-AHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               +T    YK+   S  G + ++ +PK+N+T+++LRL IDGNL+ +T YS   +     E
Sbjct  235   SPETRH--YKLTLDSSDGDSFIMDRPKYNSTISFLRLGIDGNLRVFT-YSQEVDFLPEEE  291

Query  236   SFKLF  222
              F LF
Sbjct  292   RFTLF  296



>ref|XP_007149387.1| hypothetical protein PHAVU_005G066000g [Phaseolus vulgaris]
 gb|ESW21381.1| hypothetical protein PHAVU_005G066000g [Phaseolus vulgaris]
Length=444

 Score =   306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 195/295 (66%), Gaps = 21/295 (7%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFKF N GE GPY+ EY A YR+ D+FS+PFQ+ FYNTTPNA+TLALRMG  R
Sbjct  27    AIVPQNETFKFENSGEFGPYITEYDASYRMQDIFSSPFQVAFYNTTPNAFTLALRMGLRR  86

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + A F L  DGNLVLA+ DGR+AWQ+ TANKGVV FKLL NG
Sbjct  87    SEQLFRWVWEANRGNPVGENATFSLGTDGNLVLAEADGRIAWQTNTANKGVVAFKLLPNG  146

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL DA+G FVWQSFD+PTDTLL+ Q LR  GP KLVSR SE  N +GPY+++LEP RL
Sbjct  147   NMVLLDAQGKFVWQSFDYPTDTLLIDQYLRAKGPSKLVSRLSERDNVDGPYSLVLEPKRL  206

Query  521   GFYNQTKNSARPILYHDSSKWFSV--GKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAH--  354
               Y ++KNS RP  Y     W+ +   + S+E +   +   T ++++  A SS    +  
Sbjct  207   ALYYKSKNSPRPNPY-----WYRIFTQQGSVENITLTSYPDTFEVEFTYALSSSTSDYRT  261

Query  353   -----------VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                        VL  P  N+TL+YLRL IDGN++ +T++ +      W  ++ LF
Sbjct  262   MAEPLNNIPVGVLGMPVNNSTLSYLRLGIDGNIRLHTYFLNVRSGV-WEVTYTLF  315



>ref|XP_011005512.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=431

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 200/280 (71%), Gaps = 7/280 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             + VP+ +TFK VN GE    + EY +D+R +D+ ++ FQ+CFYNTTPNA+TLA+RMGT R
Sbjct  27    STVPSNSTFKKVNTGEWSEAISEYSSDFRALDISASVFQVCFYNTTPNAFTLAIRMGTRR  86

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S    R+VWEANRG PV + A     +DGNL+LAD DGRVAWQ+ TANKGVVG ++L NG
Sbjct  87    SPAVRRFVWEANRGNPVGEDATLTFGEDGNLILADADGRVAWQTNTANKGVVGLQMLTNG  146

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+    KLVSR S+ +NTNG Y+++LEP R+
Sbjct  147   NMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGAVTKLVSRVSDKKNTNGAYSLVLEPKRI  206

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQ  342
               Y ++ NS +P +Y+ +S  FS+ K  L+ V+  +    L L +        G  +L++
Sbjct  207   AMYYKSPNSPKPYVYY-TSDLFSIQKGRLQYVRLVSSANDLSLQFSTG-----GGPLLSK  260

Query  341   PKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             P FN+TL++LRL +DGNL+ Y+F ++ E +  W  +F LF
Sbjct  261   PNFNSTLSFLRLGVDGNLRVYSF-NNQETSPSWVVTFTLF  299



>ref|XP_011013507.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=431

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 200/280 (71%), Gaps = 7/280 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             + VP+ +TFK VN GE    + EY +D+R +D+ ++ FQ+CFYNTTPNA+TLA+RMGT R
Sbjct  27    STVPSNSTFKKVNTGEWSEAISEYSSDFRALDISASVFQVCFYNTTPNAFTLAIRMGTRR  86

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S    R+VWEANRG PV + A     +DGNL+LAD DGRVAWQ+ TANKGVVG ++L NG
Sbjct  87    SPAVRRFVWEANRGNPVGEDATLTFGEDGNLILADADGRVAWQTNTANKGVVGLQMLPNG  146

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+    +LVSR S+ +NTNG Y+++LEP R+
Sbjct  147   NMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGAVTRLVSRVSDKKNTNGAYSLVLEPKRI  206

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQ  342
               Y ++ NS +P +Y+ +S  FS+ K  L+ V+  +    L L +        G  +L++
Sbjct  207   AMYYKSPNSPKPYVYY-TSDLFSIQKGRLQYVRLVSSANDLSLQFSTG-----GGPLLSK  260

Query  341   PKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             P FN+TL++LRL +DGNL+ Y+F ++ E +  W  +F LF
Sbjct  261   PNFNSTLSFLRLGVDGNLRVYSF-NNQETSPSWVVTFTLF  299



>ref|XP_004137240.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cucumis sativus]
Length=440

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 189/271 (70%), Gaps = 9/271 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP+  TFKFVNEG+ G + VEY   YR + + ++PFQL FYNTTPNAYTLALRM  +R
Sbjct  22    AIVPSNETFKFVNEGDFGDFAVEYDGTYRPLSISNSPFQLMFYNTTPNAYTLALRMAILR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG+PVR+ A   L  DGNLVLA+ DG V WQ+ TANKGVV   LL NG
Sbjct  82    SESAKRWVWEANRGRPVRENATLSLGSDGNLVLAEADGTVVWQTNTANKGVVKLDLLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL D+ G FVWQSFD PTDTLLVGQSLR+ G  KLVSRASE  N NGPY+ ++E   +
Sbjct  142   NMVLLDSNGKFVWQSFDSPTDTLLVGQSLRIGGVTKLVSRASEKLNVNGPYSFVMERNAM  201

Query  521   GFYNQTKNSARPILYH-DSSKWFSVGKSSLEEVKFNAKTQ-------TLKLDYKVAKSSK  366
               Y ++ NS +P+ Y   SS WF++ K SL  V   A+          L L+Y+VA +  
Sbjct  202   SLYYKSPNSPKPMRYFAGSSNWFTIQKGSLARVTLRAEVDPDQGFATELTLNYEVAGTEN  261

Query  365   LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              G  +L++PK+N+TLT+LRL IDGNL+ +T+
Sbjct  262   -GGPILSRPKYNSTLTFLRLGIDGNLRLFTY  291



>gb|KGN53561.1| hypothetical protein Csa_4G082380 [Cucumis sativus]
Length=440

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 189/271 (70%), Gaps = 9/271 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP+  TFKFVNEG+ G + VEY   YR + + ++PFQL FYNTTPNAYTLALRM  +R
Sbjct  22    AIVPSNETFKFVNEGDFGDFAVEYDGTYRPLSISNSPFQLMFYNTTPNAYTLALRMAILR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG+PVR+ A   L  DGNLVLA+ DG V WQ+ TANKGVV   LL NG
Sbjct  82    SESAKRWVWEANRGRPVRENATLSLGSDGNLVLAEADGTVVWQTNTANKGVVKLDLLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL D+ G FVWQSFD PTDTLLVGQSLR+ G  KLVSRASE  N NGPY+ ++E   +
Sbjct  142   NMVLLDSNGKFVWQSFDSPTDTLLVGQSLRIGGVTKLVSRASEKLNVNGPYSFVMERNAM  201

Query  521   GFYNQTKNSARPILYH-DSSKWFSVGKSSLEEVKFNAKTQ-------TLKLDYKVAKSSK  366
               Y ++ NS +P+ Y   SS WF++ K SL  V   A+          L L+Y+VA +  
Sbjct  202   SLYYKSPNSPKPMRYFAGSSNWFTIQKGSLARVTLRAEVDPDQGFATELTLNYEVAGTEN  261

Query  365   LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              G  +L++PK+N+TLT+LRL IDGNL+ +T+
Sbjct  262   -GGPILSRPKYNSTLTFLRLGIDGNLRLFTY  291



>ref|XP_004156509.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cucumis sativus]
Length=440

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 189/271 (70%), Gaps = 9/271 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP+  TFKFVNEG+ G + VEY   YR + + ++PFQL FYNTTPNAYTLALRM  +R
Sbjct  22    AIVPSNETFKFVNEGDFGDFAVEYDGTYRPLSISNSPFQLMFYNTTPNAYTLALRMAILR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG+PVR+ A   L  DGNLVLA+ DG V WQ+ TANKGVV   LL NG
Sbjct  82    SESAKRWVWEANRGRPVRENATLSLGSDGNLVLAEADGTVVWQTNTANKGVVKLDLLPNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL D+ G FVWQSFD PTDTLLVGQSLR+ G  KLVSRASE  N NGPY+ ++E   +
Sbjct  142   NMVLLDSNGKFVWQSFDSPTDTLLVGQSLRIGGVTKLVSRASEKLNVNGPYSFVMERKAV  201

Query  521   GFYNQTKNSARPILYH-DSSKWFSVGKSSLEEVKFNAKTQ-------TLKLDYKVAKSSK  366
               Y ++ NS +P+ Y   SS WF++ K SL  V   A+          L L+Y+VA +  
Sbjct  202   SLYYKSPNSPKPMRYFAGSSNWFTIQKGSLARVTLRAEVDPDQGFATELTLNYEVAGTEN  261

Query  365   LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              G  +L++PK+N+TLT+LRL IDGNL+ +T+
Sbjct  262   -GGPILSRPKYNSTLTFLRLGIDGNLRLFTY  291



>ref|XP_006442513.1| hypothetical protein CICLE_v10023807mg [Citrus clementina]
 gb|ESR55753.1| hypothetical protein CICLE_v10023807mg [Citrus clementina]
Length=435

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 207/304 (68%), Gaps = 8/304 (3%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S   F ++S+      AQVPA  TFKFVNEG LG Y  EY A+YR+  ++++
Sbjct  1     MSSSSALVS--FFFLLSLVFAIANAQVPANETFKFVNEGGLGEYFNEYNANYRMSGIYND  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNA+TLALR+G  + E   RWVWEANRGK VR+ A+F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAFTLALRLGIKKQEPVFRWVWEANRGKLVRENAVFSLGADGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQS TANKGVVGF+LL NGNMVL D+KGNF+WQSFD+PTDTLLVGQSLR+    K
Sbjct  119   DGTVVWQSNTANKGVVGFELLPNGNMVLRDSKGNFIWQSFDYPTDTLLVGQSLRVGRVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GP++ ++EP RL FY ++ ++ RPILY+     F +  + L+ +   +
Sbjct  179   LVSRLSVKENVDGPHSFVMEPKRLAFYYKSSSAPRPILYYT----FPISYNGLKSLTLKS  234

Query  413   KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGES  234
                 +  +  +  SS     +  +PK+++T+++LRL IDGNL+ +T YS   +     E 
Sbjct  235   SPGKMH-ELTLVDSSGDNGFIFDRPKYDSTISFLRLGIDGNLRVFT-YSQEVDWLPEEER  292

Query  233   FKLF  222
             F LF
Sbjct  293   FTLF  296



>gb|KDO47017.1| hypothetical protein CISIN_1g048464mg [Citrus sinensis]
Length=423

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 205/305 (67%), Gaps = 18/305 (6%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S  +F + S+      AQVPA   FKFVNEGE GP++ EY ADYR++ +F++
Sbjct  1     MSSSSAIFS--LFFLCSLIFSIANAQVPANERFKFVNEGEFGPFINEYDADYRMIRIFNS  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQL FYNTTPNAYTLALR G  R+E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQLGFYNTTPNAYTLALRWGIQRNEPLYRWVWEANRGKPVRENATFSLGTDGNLVLAEA  118

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             +G V WQS T+NKGVVGFKLL NGNMVLHD+KGNF+WQSFD+PTDTLLVGQSLR+ G  K
Sbjct  119   NGTVVWQSNTSNKGVVGFKLLPNGNMVLHDSKGNFIWQSFDYPTDTLLVGQSLRVGGVTK  178

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY+ ++E  RL  Y ++ N+ RP++Y      F V  S L+ V FN+
Sbjct  179   LVSRLSIKENVDGPYSFVMESDRLSLYYKSSNAPRPVVYFT----FPVQFSGLKNVTFNS  234

Query  413   KTQTLK-LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               +T +   Y++   S  G  +  Q +           +DGNL+ +T+Y D  ++    E
Sbjct  235   APETDEAFAYQLTLDSSSGGVLFWQGQ----------RVDGNLRIFTYY-DKVDSQPTEE  283

Query  236   SFKLF  222
             +F LF
Sbjct  284   TFTLF  288



>ref|XP_004233063.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Solanum lycopersicum]
Length=436

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 191/301 (63%), Gaps = 13/301 (4%)
 Frame = -1

Query  1121  SSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQL  942
             SSYSS L+    S+ I+T  A VP   TFK+ NEG  G Y VEY ADYRV+D+ + PF L
Sbjct  2     SSYSSLLVITFCSLFIVT-LANVPPSKTFKYTNEGSFGEYSVEYFADYRVLDIVNFPFTL  60

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CF+N+TPN + L LRMG  RSE  MRWVWEANRG PVR+ A      DGNLVL DVDG V
Sbjct  61    CFFNSTPNTFILGLRMGHRRSESIMRWVWEANRGNPVRENATLTFGIDGNLVLTDVDGTV  120

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
             AW + TANKGV G KLL NGN+VLHD    FVWQSFDHPTDTLLVGQSLR +GP KLVSR
Sbjct  121   AWHTNTANKGVTGLKLLPNGNLVLHDKNDLFVWQSFDHPTDTLLVGQSLRATGPYKLVSR  180

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ-  405
              S  +  +GPY+ +LE      Y  + NS +P+ Y  S   F  GK SL    F  + + 
Sbjct  181   MSSKEPVDGPYSFVLEGRHWAMYYTSVNSQKPLPYFKSDD-FGNGKGSLANFDFYCEPEY  239

Query  404   ----TLKLDYKV--AKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHW  243
                   +L +++    SS  G  +  +PK+N+T T  R+++DGNL+ YT+    E N  W
Sbjct  240   GENYAFELGFRINMTNSSSSGTSIFTRPKYNSTYTMFRVDMDGNLRMYTY----EPNVDW  295

Query  242   G  240
             G
Sbjct  296   G  296



>ref|XP_010108236.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
 gb|EXC18476.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
Length=430

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 201/302 (67%), Gaps = 16/302 (5%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             SS     ++S+ +    AQVP   TFKFVNEGELGPY+VEY   YR++ VF++PFQL FY
Sbjct  11    SSLFSLFILSLTLSIAQAQVPENATFKFVNEGELGPYIVEYDGSYRMLSVFNSPFQLAFY  70

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNA+TLALRMG  RSE   RW   ANRG PV + A      DGNLVLAD DGRVAWQ
Sbjct  71    NTTPNAFTLALRMGLRRSESLFRW---ANRGNPVGENATLTFGTDGNLVLADADGRVAWQ  127

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + TANKGVVGF+LL NGN+VLHD+KGNFVWQSFD+PTDTLLVGQ+LR     KLVSR S 
Sbjct  128   TNTANKGVVGFQLLPNGNIVLHDSKGNFVWQSFDYPTDTLLVGQTLR----NKLVSRLSA  183

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKL  393
              +N +GPY+ ++E      Y Q KNS +P+ Y   ++ FS  + +L+ V   A  +T   
Sbjct  184   EENKDGPYSFVIERKGFSLYYQRKNSNKPLKYFSLAERFSPVQGTLKNVTLTASPET---  240

Query  392   DYKVAKSSKL-----GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
             D   A   KL     G++ + +PK+N T ++LRL IDGN+K YT Y+D  +   W   F 
Sbjct  241   DEGYAYIVKLELSTGGSYYVGRPKYNGTSSFLRLGIDGNVKVYT-YNDKVDTQAWEVVFS  299

Query  227   LF  222
             +F
Sbjct  300   IF  301



>ref|XP_008451767.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cucumis melo]
Length=472

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 188/271 (69%), Gaps = 9/271 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP   TFKFVNEG+ G + VEY   YR + + ++PFQL FYNTTPNAYTLALRM  +R
Sbjct  54    AIVPPNETFKFVNEGDFGDFAVEYDGTYRPLSISNSPFQLMFYNTTPNAYTLALRMAILR  113

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG+PVR+ A   L  DGNLVLA+ DG V WQ+ TANKGVV   LL NG
Sbjct  114   SESAKRWVWEANRGRPVRENATLSLGSDGNLVLAEADGTVVWQTNTANKGVVKLDLLPNG  173

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL D+ G FVWQSFD PTDTLLVGQSLR+ G  KLVSRASE  N NGPY+ ++E   +
Sbjct  174   NMVLLDSNGKFVWQSFDSPTDTLLVGQSLRIGGVTKLVSRASEKLNVNGPYSFVMERKAV  233

Query  521   GFYNQTKNSARPILYH-DSSKWFSVGKSSLEEVKFNAKTQ-------TLKLDYKVAKSSK  366
               Y ++ NS +P+ Y   SS WF++ K +L  V   A+          L L+Y+VA +  
Sbjct  234   SLYYKSPNSPKPMRYFAGSSNWFTIQKGTLARVTLRAEVDPGQGFATELTLNYEVAGTEN  293

Query  365   LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              G  +L++PK+N+TLT+LRL IDGNL+ +T+
Sbjct  294   -GGPILSRPKYNSTLTFLRLGIDGNLRLFTY  323



>ref|XP_006377749.1| hypothetical protein POPTR_0011s11160g [Populus trichocarpa]
 gb|ERP55546.1| hypothetical protein POPTR_0011s11160g [Populus trichocarpa]
Length=415

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/282 (52%), Positives = 198/282 (70%), Gaps = 12/282 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             + VP  + FK VN G+    + EY +D+R +D+  + FQLCFYNTTPNA+TLA+RMGT R
Sbjct  12    STVPPSSRFKEVNTGDFAEALSEYSSDFRGLDLSVSIFQLCFYNTTPNAFTLAIRMGTRR  71

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S    R+VWEANRG PV + A     +DGNL+LAD DGRVAWQ+ TANKGVVG ++L NG
Sbjct  72    SPAMRRFVWEANRGNPVGEDATLTFGEDGNLILADADGRVAWQTNTANKGVVGLQMLTNG  131

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLHD+KGNF+WQSFD+PTDTLLVGQ LR+ G  +LVSRAS+ QNTNG Y+++LEP RL
Sbjct  132   NMVLHDSKGNFIWQSFDYPTDTLLVGQPLRVGGVTRLVSRASDKQNTNGAYSLVLEPERL  191

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFN--AKTQTLKLDYKVAKSSKLGAHVL  348
               Y ++ NS +P +Y+     FS  K  L+ V+ +    +Q L L++     +     +L
Sbjct  192   AMYYKSPNSPKPYVYYT----FSKQKGRLQYVRLSKTPNSQALSLEFSTGART-----LL  242

Query  347   AQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             ++PKFN+T+++LRL +DGNL+ YTF +D   +  W  +F LF
Sbjct  243   SRPKFNSTMSFLRLGVDGNLRVYTF-NDKLTSASWEVTFTLF  283



>ref|XP_004156508.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cucumis sativus]
Length=440

 Score =   298 bits (763),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 193/284 (68%), Gaps = 13/284 (5%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTP  921
              F  +S+ +    A VP+  T KFVN+G+ G + VEY A YR + + ++PFQL FYNTTP
Sbjct  13    FFFFISLSL----ALVPSNQTIKFVNQGDFGEFSVEYEATYRPLPISNSPFQLMFYNTTP  68

Query  920   NAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETA  741
             NAYTLA+RM   RSE  +RWVWEANRG+PVR+ A   L  DGNLVLA  DG + WQS TA
Sbjct  69    NAYTLAIRMAIRRSESTIRWVWEANRGRPVRENATLSLGTDGNLVLAQSDGTLIWQSNTA  128

Query  740   NKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNT  561
             NKGVV  K+L NGNMVL D+ G FVWQSFD PTD+LLVGQSLRL G  KLVSRAS   N 
Sbjct  129   NKGVVRLKMLPNGNMVLLDSNGKFVWQSFDSPTDSLLVGQSLRLGGVTKLVSRASAKLNV  188

Query  560   NGPYTIILEPTRLGFYNQTKNSARPILYHDS-SKWFSVGKSSLEEVKFNAKTQ-------  405
             NGPY+ ++EP  +  Y ++ NS +P+ Y    S WF+V K +L  V   A+         
Sbjct  189   NGPYSFVMEPNAMSLYYKSPNSPKPMRYFAGFSNWFTVEKGTLTRVTLRAEVDPRQGFAT  248

Query  404   TLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              L L+Y+VA +   G  +L++PK+N+TLT+LRL IDGNL+ +T+
Sbjct  249   ELTLNYEVAGTEN-GGPILSRPKYNSTLTFLRLGIDGNLRLFTY  291



>ref|XP_006487521.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=702

 Score =   305 bits (781),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 201/296 (68%), Gaps = 6/296 (2%)
 Frame = -1

Query  1109  STLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYN  930
             S   F ++S+      AQVPA  TFKFVNEG LG Y  EY A+YR+  ++++PFQL FYN
Sbjct  272   SVSFFFLLSLIFAIANAQVPANETFKFVNEGGLGEYFNEYNANYRMSGIYNDPFQLGFYN  331

Query  929   TTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQS  750
             TTPNA+TLALR+G  + E   RWVWEANRGKPVR+ A+F L  DGNLVLA+ DG V WQS
Sbjct  332   TTPNAFTLALRLGIKKQEPVFRWVWEANRGKPVRENAVFSLGADGNLVLAEADGTVVWQS  391

Query  749   ETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASET  570
              TANKG+VGF+LL NGNMVL D+KG F+WQSFD+PTDTLLVGQSLR+    KLVSR S  
Sbjct  392   NTANKGIVGFELLPNGNMVLRDSKGKFIWQSFDYPTDTLLVGQSLRVGRVTKLVSRLSVK  451

Query  569   QNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLD  390
             +N +GPY+ ++EP RL FY +  N  RPILY+     F    + L+ +   +   T   +
Sbjct  452   ENVDGPYSFVMEPRRLAFYYKRSNVPRPILYYT----FPFSYTGLKNLTLKSSPGTRHYE  507

Query  389   YKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
               +  SS     ++ +PK+N+T+++LR++IDGNL+ +T YS   +     E F LF
Sbjct  508   LTL-DSSDGNNFIMDRPKYNSTISFLRIDIDGNLRVFT-YSQEVDFLPEEERFTLF  561



>ref|XP_011029572.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=424

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 204/293 (70%), Gaps = 9/293 (3%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTP  921
             + L++SI  L   + VP  + FK VN G+    + EY +D+R +D+  + FQLCFYNTTP
Sbjct  9     LLLLISIYNLA-QSTVPPSSRFKEVNTGDFAEALSEYSSDFRGLDLSVSIFQLCFYNTTP  67

Query  920   NAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETA  741
             NA+TLA+RMGT RS    R+VWEANRG PV + A     +DGNL+LAD DGRVAWQ++T 
Sbjct  68    NAFTLAIRMGTRRSPAMRRFVWEANRGNPVGEDATLTFGEDGNLILADADGRVAWQTKTG  127

Query  740   NKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNT  561
             N+GVVG ++L NGNMVLHD+KGNF+WQSFD+PTDTLLVGQ LR+ G  +LVSRAS+ QNT
Sbjct  128   NRGVVGLQMLTNGNMVLHDSKGNFIWQSFDYPTDTLLVGQPLRIGGVTRLVSRASDKQNT  187

Query  560   NGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKV  381
             NG Y+++LEP RL  Y ++ NS +P +Y+     FS  K  L+ V+ +    +  L  + 
Sbjct  188   NGAYSLVLEPERLAMYYKSPNSPKPYVYYT----FSKQKGRLQYVRLSKTPNSEDLSLEF  243

Query  380   AKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             +  ++    +L++PKFN+T+++LRL +DGNL+ YTF +D   +  W  +F LF
Sbjct  244   STGART---LLSRPKFNSTMSFLRLGVDGNLRVYTF-NDKLTSASWEVTFTLF  292



>ref|XP_006362412.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Solanum tuberosum]
Length=433

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 189/298 (63%), Gaps = 13/298 (4%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             SS L+  + S+ I+T  A VP   TFK++NEG  G Y VEY ADYRV+D+ + PF LCF+
Sbjct  2     SSLLVITLCSLFIVT-LANVPPSKTFKYINEGSFGEYSVEYFADYRVLDIVNFPFTLCFF  60

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             N+TPN + L LRMG  RSE  MRWVWEANRGKPVR+ A      +GNLVL DVDG VAW 
Sbjct  61    NSTPNTFILGLRMGHRRSESIMRWVWEANRGKPVRENATLTFGTNGNLVLTDVDGTVAWH  120

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + TANKGV G KLL NGN+VLHD    FVWQSFDHPTDTLLVGQSLR  GP KLVSR S 
Sbjct  121   TNTANKGVTGLKLLPNGNLVLHDKNDRFVWQSFDHPTDTLLVGQSLRAKGPSKLVSRKSS  180

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ----  405
              +  +GPY+ +LE      Y  + NS +P+ Y  S   F  GK SL    F  + +    
Sbjct  181   KEPVDGPYSFVLEGRHWAMYYISVNSQKPLPYFKSDD-FGNGKGSLANFDFYCEPEYGEN  239

Query  404   -TLKLDYKV--AKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
                +L +++    S   G  +  +PK+N+T T  R+++DGNL+ YT+    E N  WG
Sbjct  240   YAFELGFRINMTNSPSSGTSIFTRPKYNSTYTMFRVDMDGNLRMYTY----EPNVDWG  293



>gb|KGN53560.1| hypothetical protein Csa_4G082370 [Cucumis sativus]
Length=440

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 192/284 (68%), Gaps = 13/284 (5%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTP  921
              F  +S+ +    A VP+  T KFVN+G+ G + VEY A YR + + ++PFQL FYNTTP
Sbjct  13    FFFFISLSL----ALVPSNQTIKFVNQGDFGEFSVEYEATYRPLPISNSPFQLMFYNTTP  68

Query  920   NAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETA  741
             NAYTLA+RM   RSE  +RWVWEANRG+PVR+ A   L  DGNLVLA  DG + WQS TA
Sbjct  69    NAYTLAIRMAIRRSESTIRWVWEANRGRPVRENATLSLGTDGNLVLAQSDGTLIWQSNTA  128

Query  740   NKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNT  561
             NKGVV  K+L NGNMVL D+ G FVWQSFD PTD+LLVGQSLRL G  KLVSRAS   N 
Sbjct  129   NKGVVRLKMLPNGNMVLLDSNGKFVWQSFDSPTDSLLVGQSLRLGGVTKLVSRASAKLNV  188

Query  560   NGPYTIILEPTRLGFYNQTKNSARPILYHDS-SKWFSVGKSSLEEVKFNAKTQ-------  405
             NGPY+ ++E   +  Y ++ NS +P+ Y    S WF+V K +L  V   A+         
Sbjct  189   NGPYSFVMERNAMSLYYKSPNSPKPMRYFAGFSNWFTVEKGTLTRVTLRAEVDPRQGFAT  248

Query  404   TLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              L L+Y+VA +   G  +L++PK+N+TLT+LRL IDGNL+ +T+
Sbjct  249   ELTLNYEVAGTEN-GGPILSRPKYNSTLTFLRLGIDGNLRLFTY  291



>ref|XP_006442505.1| hypothetical protein CICLE_v10020396mg [Citrus clementina]
 gb|ESR55745.1| hypothetical protein CICLE_v10020396mg [Citrus clementina]
Length=409

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 198/294 (67%), Gaps = 28/294 (10%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSN  954
             MSS S+  S   +L+V   I    AQVPA  TFKFVNEGE GP++ EY ADYR++ +F++
Sbjct  1     MSSSSAIFSLFFYLLVIFSIAN--AQVPADETFKFVNEGEFGPFINEYDADYRMISIFNS  58

Query  953   PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
             PFQ                    ++E   RWVWEANRGKPVR+ A F L  DGNLVLA+ 
Sbjct  59    PFQ--------------------QNEPNYRWVWEANRGKPVRENATFSLGSDGNLVLAEA  98

Query  773   DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
             DG V WQS TANKGVVGFKLL NGN+VLHD+KGNF+W+SFD+PTDTLLVGQSLR+ G  K
Sbjct  99    DGTVVWQSNTANKGVVGFKLLPNGNVVLHDSKGNFIWRSFDYPTDTLLVGQSLRVGGVTK  158

Query  593   LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
             LVSR S  +N +GPY+ ++E  RL  Y ++ N+ RP++Y      F V  +SL+ V FNA
Sbjct  159   LVSRLSVKENVDGPYSFVMESNRLSLYYKSSNAPRPVVYFT----FPVQFNSLKNVTFNA  214

Query  413   KTQTLK-LDYKVAKSSKLGAH-VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE  258
              ++T +   Y++   S  G + +LA+PK+N T+++LRL I+GNL+ +T+Y   +
Sbjct  215   ASETDEAFAYQLTLDSSSGGNLILARPKYNATISFLRLSIEGNLRIFTYYDKVD  268



>ref|XP_011029571.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=426

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 196/303 (65%), Gaps = 20/303 (7%)
 Frame = -1

Query  1109  STLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYN  930
             S  +FL +        + VP  +TF++VNEGE G Y  EY  DYR + + ++PFQL FYN
Sbjct  6     SLCLFLSI---FFIAHSTVPPSSTFQYVNEGEFGFYSSEYAPDYRPLPLVTSPFQLMFYN  62

Query  929   TTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQS  750
             TT NAYTLAL MGT RSE   RWVWEANRG PVR+ A     +DGNLVLAD DGRVAWQ+
Sbjct  63    TTSNAYTLALLMGTRRSESTRRWVWEANRGNPVRENATLTFGKDGNLVLADADGRVAWQT  122

Query  749   ETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASET  570
              TANKGV GF++L NGNMVLHD+KGNF+WQSFD PTDTLLVGQSLR+ G  +LVSRAS+ 
Sbjct  123   NTANKGVAGFEVLPNGNMVLHDSKGNFIWQSFDSPTDTLLVGQSLRVGGATRLVSRASQK  182

Query  569   QNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFN-------AK  411
             +N++G Y++++E  RL  Y ++ NS +   Y+     F   +  L+    N         
Sbjct  183   ENSDGAYSLVMESKRLVMYYKSPNSPKQYFYYT----FDTRQDRLQNATLNWYPDPYDNS  238

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESF  231
                + LD      S  G  V A+PKFN TL++LR+ IDGNL+ Y+ Y++  +   W  SF
Sbjct  239   ASEVSLDL-----SSGGWSVHARPKFNATLSFLRIGIDGNLRIYS-YNNKVDYMAWDVSF  292

Query  230   KLF  222
              LF
Sbjct  293   NLF  295



>gb|AAO15899.1| secreted glycoprotein [Linum usitatissimum]
Length=430

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 184/286 (64%), Gaps = 18/286 (6%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    F F N GE G Y+VEY A+YRV+ + + PFQ+CFYNTTP  YTLALRMGTVR
Sbjct  22    ATVPPSARFSFSNSGEFGDYIVEYGANYRVLSLATTPFQMCFYNTTPGQYTLALRMGTVR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE  MRWVWEANRG PV + A F L  +GNLVLA  DGR+AWQS TANKGV GF++L NG
Sbjct  82    SESLMRWVWEANRGNPVGENATFSLGANGNLVLAHSDGRMAWQSNTANKGVTGFRILNNG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVL DA+G FVWQSFD PTDTLLVGQSLR+ G  KL SRAS   N NG Y+ +LEP  L
Sbjct  142   NMVLVDARGGFVWQSFDSPTDTLLVGQSLRIGGVTKLTSRASVELNHNGAYSFVLEPKDL  201

Query  521   GFYNQTKNSA--RPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVL  348
               Y    N    R   +  +   F   +S+L+ V F++     +L ++       G   L
Sbjct  202   ALYFTGANRTPYRYFSFAGARSLFIPNQSTLQNVTFSS-----ELGFE-------GVTTL  249

Query  347   AQPKFNTTLTYLRLEIDGNLKTYTFY----SDAEENFHWGESFKLF  222
               P+FNTTL+Y RLEIDGNLK +TF     ++  E   W  S  +F
Sbjct  250   KNPRFNTTLSYFRLEIDGNLKIHTFIIANDTEGSEFQRWETSVTVF  295



>ref|XP_010108235.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
 gb|EXC18475.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
Length=429

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 187/268 (70%), Gaps = 15/268 (6%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYV-VEYRADYRVV-DVFSNPFQLCFYNTTPNAYTLALRMG-  891
             A+VP   TF+F NEG  G ++ +EY A YR   D+F +PF +CFYNTTPNAYTLALRMG 
Sbjct  26    AKVPPNATFQFKNEGYYGDFLYIEYGATYRFFSDIFVSPFTICFYNTTPNAYTLALRMGL  85

Query  890   TVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLL  711
             T      +RWVWEANRG PV + A F    DGNLVLA+ DGRVAWQS TANKGVVGFKLL
Sbjct  86    TDTRRTTLRWVWEANRGNPVGENATFTFGGDGNLVLANADGRVAWQSNTANKGVVGFKLL  145

Query  710   QNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEP  531
               GNMVLHD+KGNFVWQSFD+PTDT+LVGQSLR+ GP KLVSR SE +N +GPY++++E 
Sbjct  146   PTGNMVLHDSKGNFVWQSFDYPTDTILVGQSLRVGGPNKLVSRLSEKENKDGPYSLVIES  205

Query  530   T-RLGFYNQTKNSARPILYHDSSKWFSVGKSSLE-EVKFNAKTQTLKLDYKVAKSSKLGA  357
                +  Y ++KNS +P+LY+ S  +  +   + E E    A    L+ +           
Sbjct  206   KGSMSLYYKSKNSPKPLLYYTSGNFVDINNVTFEFEEDVEAGAYFLRFN----------P  255

Query  356   HVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
             +++A+  +N +LT++RLEIDGN+K YT+
Sbjct  256   YIIARTFYNASLTFIRLEIDGNIKLYTY  283



>ref|XP_002316857.2| curculin-like lectin family protein [Populus trichocarpa]
 gb|EEE97469.2| curculin-like lectin family protein [Populus trichocarpa]
Length=459

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 193/304 (63%), Gaps = 18/304 (6%)
 Frame = -1

Query  1109  STLIFLVVSIQIL-TCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFY  933
             S L  L V + I     + VP  +TF++VNEGE G Y  EY  DYR +   ++PFQL FY
Sbjct  35    SKLFSLCVLLSIFFIAHSTVPPSSTFQYVNEGEFGYYSSEYAPDYRPLPQGTSPFQLMFY  94

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNAYTLAL MGT RSE   RWVWEANRG PVR+ A     +DGNLVLAD DGRVAWQ
Sbjct  95    NTTPNAYTLALLMGTRRSESTRRWVWEANRGNPVRENATLTFGKDGNLVLADADGRVAWQ  154

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + TANKGV GF++L NGNMVL D+ G F+WQSFD PTDTLLVGQSLR+ G  +LVSRAS 
Sbjct  155   TNTANKGVAGFEVLPNGNMVLRDSTGKFIWQSFDSPTDTLLVGQSLRVGGATRLVSRASR  214

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT---  402
              +N++G Y++++E  RL  Y ++ NS +   Y+     F   +  L+    N    +   
Sbjct  215   EENSDGAYSLVMESKRLVMYYKSPNSPKQYFYYT----FGTRQDRLQNATLNCNPDSYDN  270

Query  401   ----LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGES  234
                 + LD      S  G  V A+PKFN TL+ LR+ IDGNL+ Y+F ++  +   W  S
Sbjct  271   SASEVTLDL-----SSGGWSVYARPKFNATLSLLRIGIDGNLRIYSF-NNKVDYMAWDVS  324

Query  233   FKLF  222
             F LF
Sbjct  325   FNLF  328



>ref|XP_010279127.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Nelumbo nucifera]
Length=445

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 190/289 (66%), Gaps = 12/289 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFS-NPFQLCFYNTTPNAYTLALRMGTV  885
             A VP   TFKFVNEGE G + VEY ADYR++ + + +PF LCFY + P+ YTLA+RMG  
Sbjct  23    AIVPPSKTFKFVNEGEFGQHYVEYYADYRLLPLAAPSPFALCFYTSVPHKYTLAMRMGVN  82

Query  884   RSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQN  705
                  MRWVWEANRG PV +GA      DGNLVLAD DGR+AWQ+ TANKGVV  ++L N
Sbjct  83    TEGEPMRWVWEANRGNPVGEGATLTFGADGNLVLADADGRIAWQTGTANKGVVDLQVLPN  142

Query  704   GNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTR  525
             GN+VL D +  FVWQSFDHPTDTL +GQ LR  GP KLVSRAS   N+ GPY+++LE  R
Sbjct  143   GNLVLLDRRRRFVWQSFDHPTDTLFIGQLLRPGGPNKLVSRASIEDNSEGPYSLVLEEKR  202

Query  524   LGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA------KTQTLKLDYKVAKSS-K  366
             L  Y ++ NSA PILY+ S     V   SL +V F +      +   L+LD  V  S+  
Sbjct  203   LALYLKSNNSANPILYYTSED-LGVQDGSLTKVAFTSSPTFKVREYELRLDIDVDNSTVH  261

Query  365   LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFH-WGESFKLF  222
             +   +LA PK+N+TL+ LRLE DGNL+ +T+Y  +   FH W  S  LF
Sbjct  262   VMNTILATPKYNSTLSILRLEWDGNLRVHTYYDLSR--FHAWELSLALF  308



>ref|XP_008812087.1| PREDICTED: epidermis-specific secreted glycoprotein EP1 [Phoenix 
dactylifera]
Length=430

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 188/274 (69%), Gaps = 5/274 (2%)
 Frame = -1

Query  1040  TFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRW  861
             TF +VNEGE GPY+ EY A+YRV+ + ++PFQ+ FYNTTPNA+ LALRMGT RSE   RW
Sbjct  30    TFSYVNEGEFGPYITEYDANYRVLPIAASPFQMAFYNTTPNAFYLALRMGTTRSESTFRW  89

Query  860   VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
             VWEANRG+PVR+ A F L  DGNLVLAD + RV W + TANKGVVG K+L +GN+VL++A
Sbjct  90    VWEANRGRPVRENATFSLLSDGNLVLADAERRVVWSTGTANKGVVGLKILPSGNIVLYNA  149

Query  680   KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             KG F+WQSFDHPTDTLLVGQSL + GP KLVSR S T  + G Y ++LE   L  Y    
Sbjct  150   KGRFLWQSFDHPTDTLLVGQSLYVGGPTKLVSRKSTTDGSFGNYILVLESGGLAMYINDL  209

Query  500   NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-LDYKVAKSSKLGAHVLAQPKFNTT  324
              + +P+ Y++ S    +   S   VK  ++ +T     Y+V      G  +LA+PK+N T
Sbjct  210   -TPKPLPYYNYSD--GILGFSGNSVKLESEPETEDAFAYEVRLVENQGTIILARPKYNAT  266

Query  323   LTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             L++LRL++DGNL  YT+Y D  +   W E+F  F
Sbjct  267   LSFLRLDVDGNLVVYTYY-DPVDYRAWEETFAFF  299



>gb|KCW67507.1| hypothetical protein EUGRSUZ_F01236 [Eucalyptus grandis]
Length=409

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 191/289 (66%), Gaps = 23/289 (8%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             A VP    FKFVNEGE GPYVVEY  +YR   + ++PFQLCFYNTTPNA+TLALRM T +
Sbjct  22    ATVPPSAQFKFVNEGEFGPYVVEYGGNYRTTSIANSPFQLCFYNTTPNAFTLALRMATTQ  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   RWVWEANRG PV + + F L  DGNLVLA+ +G+VAWQS TANKGVVGF+LL   
Sbjct  82    SESLFRWVWEANRGNPVGENSTFALGADGNLVLAEANGQVAWQSRTANKGVVGFRLLP--  139

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
                        +   FD PTDTLLVGQSLR     KLVSRASE  N+NGPY +++EP +L
Sbjct  140   -----------MATCFDSPTDTLLVGQSLRAGPVSKLVSRASEKDNSNGPYRLVIEPKQL  188

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVA-KSSK  366
               Y  +KNS +P+LY+  ++   +GK SL +V   +  +T       + L Y+ A KSS 
Sbjct  189   SLYYTSKNSPKPLLYYTFAENMFLGKESLGQVTLESAPETDEGYAYEITLKYEAANKSSD  248

Query  365   LGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             +G  + LA+PK+N+T T LRL IDGNL+ Y++Y D  +   W  +F LF
Sbjct  249   VGGGLTLARPKYNSTFTILRLGIDGNLQAYSYY-DKVDYRTWEVTFSLF  296



>ref|XP_010916746.1| PREDICTED: epidermis-specific secreted glycoprotein EP1 [Elaeis 
guineensis]
Length=430

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 190/275 (69%), Gaps = 7/275 (3%)
 Frame = -1

Query  1040  TFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRW  861
             TF +VNEGE GPY+ EY A+YRV+ + ++PFQ+ FYNTTP+A+ LALRMGT RSE   RW
Sbjct  30    TFTYVNEGEFGPYITEYDANYRVLPIATSPFQMAFYNTTPDAFYLALRMGTTRSESTFRW  89

Query  860   VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
             VWEANRG+PVR+ A F L  DGNLVLAD D RV W + TANKGVVG K+L +GN+VL++A
Sbjct  90    VWEANRGRPVRENATFSLLSDGNLVLADADRRVVWSTATANKGVVGLKILPDGNIVLYNA  149

Query  680   KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             KG F+WQSFDHPTDTLLV QSL + GP KLVSR S T  + G Y+++LE   L  Y    
Sbjct  150   KGRFLWQSFDHPTDTLLVDQSLYVGGPTKLVSRKSTTDGSFGIYSLVLESGGLAMYINDL  209

Query  500   NSARPILYHD-SSKWFSVGKSSLEEVKFNAKTQTLK-LDYKVAKSSKLGAHVLAQPKFNT  327
              + +P+ Y++ S   FS   +S   VK  ++ +T     Y+V      G  +LA+PK+N 
Sbjct  210   -TPKPLPYYNYSDGIFSFSGNS---VKLESEPETEDAFAYEVRLVEDQGTIILARPKYNA  265

Query  326   TLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             TL++LRL++DGNL  YT+Y D  +   W E+F  F
Sbjct  266   TLSFLRLDVDGNLVVYTYY-DPVDYRAWEETFAFF  299



>ref|XP_008359357.1| PREDICTED: LOW QUALITY PROTEIN: epidermis-specific secreted glycoprotein 
EP1-like [Malus domestica]
Length=470

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 190/287 (66%), Gaps = 8/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVP   TFK+VNEGE G  + EY A +R++D F+ PFQL FYNTT NA+TLAL MG   
Sbjct  57    AQVPVDQTFKYVNEGEFGXXITEYDASHRMLDPFAXPFQLAFYNTTSNAFTLALCMGLRW  116

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   R VWEANRG PV + A      +GNLVLA  +G+VAWQ+ TANKGVVGFKLL NG
Sbjct  117   SESLFRCVWEANRGNPVCENATLTFGTNGNLVLAHANGKVAWQTNTANKGVVGFKLLPNG  176

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLH++KG  +WQSFD+PT+TLLVGQSLR     KLVSRAS+ +N +GPY++++EP  L
Sbjct  177   NMVLHNSKGKCIWQSFDYPTNTLLVGQSLRAGVVSKLVSRASKKENKDGPYSLVMEPKGL  236

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ N  +P LY   S+   +  +SL  V  N+  +T       L L+Y+ A SS  
Sbjct  237   ALYYKSSNYPKPQLYFSFSQRIPIQMNSLILVTLNSAPETDEGHAYDLTLEYQEANSSSS  296

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                 L +PK+N+T T L L IDGN+K YT Y+D  +   W  +F LF
Sbjct  297   ETFFLGRPKYNSTSTLLGLGIDGNVKLYT-YNDKVDTGAWEVTFSLF  342



>dbj|BAD24818.1| cell attachment protein in somatic embryogenesis [Daucus carota]
 dbj|BAD72577.1| cell attachment protein in somatic embryogenesis [Daucus carota]
Length=443

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 198/300 (66%), Gaps = 18/300 (6%)
 Frame = -1

Query  1103  LIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTT  924
             LI ++  I I +  A VPA  TFK+ NEGELG Y+VEY A YR + +   PFQ CFYNTT
Sbjct  11    LISVLFVISISSAQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTT  70

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             P A+ L LRMG   SE  MRWVW+ANR KPVR+ A      DGNLVLADVDG VAW++ T
Sbjct  71    PTAFILGLRMGNRHSESTMRWVWDANRAKPVREKATLTFGTDGNLVLADVDGTVAWETGT  130

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
             ANK VV  +LL NGN+VL D+KG FVWQSFDHPTDTLLVGQSL  SG  K+VSR S+ + 
Sbjct  131   ANKDVVRLELLTNGNLVLIDSKGKFVWQSFDHPTDTLLVGQSLVSSGANKIVSRLSDVEA  190

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKF------NAKTQT  402
             ++GPY+ ++E ++L  Y +  N   PILY  +   F  GK +L +++F      N ++ T
Sbjct  191   SDGPYSYVMEKSQLSLYYKPANVKTPILYDQTV--FGTGKDTLTKIQFTIDPFTNIESDT  248

Query  401   L-----KLDYKVAKSSK-LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
             +      L+  +  S++  G+ VL++ K+NTT + LR++ DGNL+ YT+    EE+  +G
Sbjct  249   VWANEFHLESFMNNSTESSGSAVLSRAKYNTTYSMLRVDSDGNLRVYTY----EEHVDYG  304



>ref|XP_009404508.1| PREDICTED: epidermis-specific secreted glycoprotein EP1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 186/273 (68%), Gaps = 6/273 (2%)
 Frame = -1

Query  1040  TFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRW  861
             TF +VNEGE GPY+ EY A YRV+ + S+PFQ  FYNTTP+A+ LALRMGTVRSE  +RW
Sbjct  37    TFTYVNEGEFGPYITEYDASYRVLPIASSPFQFAFYNTTPDAFYLALRMGTVRSESILRW  96

Query  860   VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
             VWEANRG+PVR+ A F L   GNLVLA+ DGRV W + T NKGVVG K+L NGN+VL+DA
Sbjct  97    VWEANRGRPVRENATFSLLPSGNLVLAEADGRVVWTTNTTNKGVVGLKVLPNGNVVLYDA  156

Query  680   KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             KG FVWQSFD+PTDTLLVGQSLRL GP KLVSR S    + G Y+++  P  +  Y  + 
Sbjct  157   KGRFVWQSFDYPTDTLLVGQSLRLRGPNKLVSRKSAVDGSFGIYSLVFGPGGITMYINSV  216

Query  500   NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
              S +P+ Y++ S          + V F  + +T   +   A   KL  + L++PK+N TL
Sbjct  217   AS-KPLAYYNYSDGLLSFSGPGDSVTFVCEPET---EDNFAWECKLIIN-LSRPKYNATL  271

Query  320   TYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             ++LRL+IDGNL  YT+Y D  +   W ++F  F
Sbjct  272   SFLRLDIDGNLAVYTYY-DPVDYRAWEKTFAFF  303



>gb|KDO39539.1| hypothetical protein CISIN_1g043457mg, partial [Citrus sinensis]
Length=423

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 196/289 (68%), Gaps = 16/289 (6%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGP-YVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTV  885
             AQVPA  TFKFVN+GELG  Y  EY AD+R+  ++++ F L FYNTTPNAYTLAL  G++
Sbjct  2     AQVPANETFKFVNKGELGSFYYNEYNADHRMSGIYNDLFNLGFYNTTPNAYTLALLFGSM  61

Query  884   RSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQN  705
               +   RWVWEANRGKPVR+ A+     DGNLVLA+ DG V WQS TANKGVV F+LL +
Sbjct  62    DRKAVFRWVWEANRGKPVRENAVLSFGTDGNLVLAEADGTVVWQSNTANKGVVRFELLSS  121

Query  704   GNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTR  525
             GNMVL D+KG F+WQSFD+PTDTLLVGQSLR+S   KL+SR S  +N +GP++ ++EP R
Sbjct  122   GNMVLRDSKGKFIWQSFDYPTDTLLVGQSLRVSRVTKLISRLSIKENVDGPHSFVMEPKR  181

Query  524   LGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLG-AHVL  348
             L  Y ++ N  RP++Y+     F +    L+ +   +  +T+   YK+   S  G + VL
Sbjct  182   LALYYKSSNGPRPVVYYT----FPISYKGLKNLTLKSSPETM---YKLTLVSSDGNSLVL  234

Query  347   AQPKFNTTLTYLRLEIDGNLKTYTFYSDA----EENFHW---GESFKLF  222
              +PK+++T+++LRL +DGNL+ +TF  +     EE   W    E F LF
Sbjct  235   DRPKYDSTISFLRLSMDGNLRIFTFPREVDWLPEEGRFWLPEEERFTLF  283



>ref|XP_006442511.1| hypothetical protein CICLE_v10024064mg [Citrus clementina]
 gb|ESR55751.1| hypothetical protein CICLE_v10024064mg [Citrus clementina]
Length=446

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 195/289 (67%), Gaps = 16/289 (6%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGP-YVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTV  885
             AQVP   TFKFVN+GELG  Y  EY AD+R+  ++++ F L FYNTTPNAYTLAL  G++
Sbjct  25    AQVPGNETFKFVNKGELGSFYYNEYNADHRMSGIYNDLFNLGFYNTTPNAYTLALLFGSM  84

Query  884   RSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQN  705
               +   RWVWEANRGKPVR  A+     DGNLVLA+ DG V WQS TANKGVV F+LL +
Sbjct  85    DRKTVFRWVWEANRGKPVRANAVLSFGTDGNLVLAEADGTVVWQSNTANKGVVRFELLSS  144

Query  704   GNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTR  525
             GNMVL D+KG F+WQSFD+PTDTLLVGQSLR+S   KL+SR S  +N +GP++ ++EP R
Sbjct  145   GNMVLRDSKGKFIWQSFDYPTDTLLVGQSLRVSRVTKLISRLSIKENVDGPHSFVMEPKR  204

Query  524   LGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLG-AHVL  348
             L  Y ++ N+ RP++Y+     F +    L+ +   +  +T+   YK+   S  G + VL
Sbjct  205   LALYYKSSNAPRPLVYYT----FPISYKGLKNLTLKSSPETM---YKLTLDSSDGNSLVL  257

Query  347   AQPKFNTTLTYLRLEIDGNLKTYTFYSDA----EENFHW---GESFKLF  222
              +PK+++T+++LRL +DGNL+ +TF  +     EE   W    E F LF
Sbjct  258   DRPKYDSTISFLRLSMDGNLRVFTFPREVDWLPEEGRFWLPEEERFTLF  306



>ref|XP_006487520.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Citrus sinensis]
Length=446

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 195/289 (67%), Gaps = 16/289 (6%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGP-YVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTV  885
             AQVPA  T KFVN+GELG  Y  EY AD+R+  ++++ F L FYNTTPNAYTLAL  G++
Sbjct  25    AQVPANETVKFVNKGELGSFYYNEYNADHRMSGIYNDLFNLGFYNTTPNAYTLALLFGSM  84

Query  884   RSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQN  705
               +   RWVWEANRGKPVR+ A+     DGNLVLA+ DG V WQS TANKGVV F+LL +
Sbjct  85    DRKAVFRWVWEANRGKPVRENAVLSFGTDGNLVLAEADGTVVWQSNTANKGVVRFELLSS  144

Query  704   GNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTR  525
             GNMVL D+KG F+WQSFD+PTDTLLVGQSLR+S   KL+SR S  +N +GP++ ++EP R
Sbjct  145   GNMVLRDSKGKFIWQSFDYPTDTLLVGQSLRVSRVTKLISRLSIKENVDGPHSFVMEPKR  204

Query  524   LGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLG-AHVL  348
             L  Y ++ N  RP++Y+     F +    L+ +   +  +T+   YK+   S  G + VL
Sbjct  205   LALYYKSSNGPRPVVYYT----FPISYKGLKNLTLKSSPETM---YKLTLVSSDGNSLVL  257

Query  347   AQPKFNTTLTYLRLEIDGNLKTYTFYSDA----EENFHW---GESFKLF  222
              +PK+++T+++LRL +DGNL+ +TF  +     EE   W    E F LF
Sbjct  258   DRPKYDSTISFLRLSMDGNLRIFTFPREVDWLPEEGRFWLPEEERFTLF  306



>ref|XP_010108233.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
 gb|EXC18473.1| Epidermis-specific secreted glycoprotein EP1 [Morus notabilis]
Length=431

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 184/269 (68%), Gaps = 17/269 (6%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYV-VEYRADYRV---VDVFSNPFQLCFYNTTPNAYTLALRM  894
             A+VP   TF+F NEG  G ++ VEY A YR    + V S PF +CFYNTTPNAYTLALRM
Sbjct  26    AKVPPNATFQFKNEGYFGEFLYVEYGATYRFFSEIFVSSAPFTICFYNTTPNAYTLALRM  85

Query  893   GTVRSE-LRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
             G   +  + +RWVWEANRG PV + A F    DGNLVLA+ DGRVAWQS TANKGVVGF+
Sbjct  86    GRTDTRWMTLRWVWEANRGNPVGENATFTFGGDGNLVLANADGRVAWQSNTANKGVVGFR  145

Query  716   LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIIL  537
             LL  GNMVLH++KGNFVWQSFD+PTDT+LVGQSLR+ GP KLVSR SE +N +GPY++++
Sbjct  146   LLPTGNMVLHNSKGNFVWQSFDYPTDTILVGQSLRVGGPNKLVSRLSEKENKDGPYSLVI  205

Query  536   EPT-RLGFYNQTKNSARPILYHDSSKWFSVGKSSLE-EVKFNAKTQTLKLDYKVAKSSKL  363
             E    +  Y ++K S +P LY+ S  +  +   + E E    A    L+ +         
Sbjct  206   ESKGSMSLYYKSKTSPKPRLYYTSGNFVDINNVTFEFEEDVEAGAYFLRFN---------  256

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYT  276
               +++A+  +N +LT++RLE+DGN+K YT
Sbjct  257   -PYIIARTFYNASLTFIRLEMDGNIKLYT  284



>ref|XP_011013506.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=262

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/242 (57%), Positives = 173/242 (71%), Gaps = 4/242 (2%)
 Frame = -1

Query  941  CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             FYNTTPNA+TLALRMGTVRS   MRWVWEANRG PV + A     +DGNLVLAD DGR+
Sbjct  18   VFYNTTPNAFTLALRMGTVRSTSTMRWVWEANRGNPVGENATLTFGEDGNLVLADADGRI  77

Query  761  AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
            AWQ+ TANKGVV F++  NGNMVL D KG F+WQSFD+PTDTLLVGQSLR  G  +LVSR
Sbjct  78   AWQTNTANKGVVHFQVQPNGNMVLQDVKGYFIWQSFDYPTDTLLVGQSLRAGGAARLVSR  137

Query  581  ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT  402
             SE QN+NG Y++++EP RL  Y ++ +S +P LY+ S + FSV    L+ V F +K  T
Sbjct  138  RSEKQNSNGAYSLVMEPKRLAIYYKSPSSPKPKLYYTSDR-FSVKNGRLQYVTFQSKPVT  196

Query  401  LK-LDYKVA-KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
             +   Y +A + S  G  +LA PK+N+TL++LRL +DGN+K YT Y+D  +   W  +F 
Sbjct  197  EEGFSYDLALEFSTGGNAILATPKYNSTLSFLRLGVDGNVKVYT-YNDKVDIGAWEVTFT  255

Query  227  LF  222
            LF
Sbjct  256  LF  257



>ref|XP_010540152.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010540153.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   272 bits (695),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 189/287 (66%), Gaps = 9/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTV  885
             A+VP    F+F N+G    Y  +EY A  R     ++ F+L FYNTTPNAYTLALRMG  
Sbjct  22    AKVPPAEQFQFTNKGGFLDYSPIEYGATVRGFLPVNDNFRLSFYNTTPNAYTLALRMGNR  81

Query  884   RSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQN  705
               E  +RWVWEANRG PVR+ A+    +DGNLVLA+V+GRVAWQ+ TANKGVVG K+L+N
Sbjct  82    AQESTLRWVWEANRGNPVRENAVLTFGEDGNLVLAEVNGRVAWQTNTANKGVVGIKVLEN  141

Query  704   GNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTR  525
             GNMVL+DAKGNFVWQSFD PTDTLLVGQSL+ +G  KLVSR S + N +GPY++++EP R
Sbjct  142   GNMVLYDAKGNFVWQSFDFPTDTLLVGQSLKANGRNKLVSRLSRSVNVDGPYSLVMEPKR  201

Query  524   LGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKL------  363
             L  Y  T  + +PI Y++  ++F+   +  E + F  K       Y ++   K+      
Sbjct  202   LVLYYTTNMTQKPIAYYE-YEFFTKINTRFESMTFKVKEDAFDTTYGMSFEGKIQGSQFN  260

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
              +  L++PK N TL+++RLE DGN++ Y+ YS A     W  ++  F
Sbjct  261   ASAFLSRPKHNATLSFIRLESDGNVRVYS-YSTAATATAWDVTYTAF  306



>ref|XP_008386344.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103448865 
[Malus domestica]
Length=1433

 Score =   285 bits (729),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 190/287 (66%), Gaps = 8/287 (3%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             AQVP   TFK+VNEGE G  + EY A +R++D F+ PFQL FYNTT NA+TLAL MG   
Sbjct  1020  AQVPVDQTFKYVNEGEFGXXITEYDASHRMLDPFAXPFQLAFYNTTSNAFTLALCMGLRW  1079

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             SE   R VWEANRG PV + A      +GNLVLA  +G+VAWQ+ TANKGVVGFKLL NG
Sbjct  1080  SESLFRCVWEANRGNPVCENATLXFGTNGNLVLAHANGKVAWQTNTANKGVVGFKLLPNG  1139

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             NMVLH++KG  +WQSFD+PT+TLLVGQSLR     KLVSRAS+ +N +GPY++++EP  L
Sbjct  1140  NMVLHNSKGKCIWQSFDYPTNTLLVGQSLRAGVVSKLVSRASKKENKDGPYSLVMEPKGL  1199

Query  521   GFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKL  363
               Y ++ N  +P LY   S+   +  +SL  V  N+  +T       L L+Y+ A SS  
Sbjct  1200  ALYYKSSNYPKPQLYFSFSQRIPIQMNSLILVTLNSAPETDEGHAYDLTLEYQEANSSSS  1259

Query  362   GAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
                 L +PK+N+T T L L IDGN+K YT Y+D  +   W  +F LF
Sbjct  1260  ETFFLGRPKYNSTSTLLGLGIDGNVKLYT-YNDKVDTGAWEVTFSLF  1305



>emb|CDY62606.1| BnaCnng40530D [Brassica napus]
Length=419

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 195/303 (64%), Gaps = 11/303 (4%)
 Frame = -1

Query  1109  STLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCFY  933
             ++ + L +SI ++   A+VP    F+ VNEG    Y  +EY  D R    F++ F+LCFY
Sbjct  6     TSALCLTLSIFLIGAQAKVPVDEQFRVVNEGGYTDYSPIEYNPDVRGFQPFNDNFRLCFY  65

Query  932   NTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQ  753
             NTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+ WQ
Sbjct  66    NTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRMVWQ  125

Query  752   SETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASE  573
             + TANKG VG K+L+NGNMV++D KG F+WQSFD PTDTLLVGQSL+L+G  KLVSR S 
Sbjct  126   TNTANKGAVGIKILENGNMVIYDNKGKFIWQSFDSPTDTLLVGQSLKLNGRNKLVSRRSP  185

Query  572   TQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAK-----T  408
             + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A+     T
Sbjct  186   SVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYNYE--FFSKITQLQSITFQAQEDSDTT  243

Query  407   QTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESF  231
               L ++  V   SK      L++PK N TL+++RLE DGN++ ++ YS A     W  ++
Sbjct  244   WGLHME-GVDSGSKFNVSTFLSRPKHNATLSFIRLESDGNVRVWS-YSTAATATAWDVTY  301

Query  230   KLF  222
               F
Sbjct  302   TAF  304



>ref|XP_006301909.1| hypothetical protein CARUB_v10022385mg [Capsella rubella]
 gb|EOA34807.1| hypothetical protein CARUB_v10022385mg [Capsella rubella]
Length=441

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/287 (49%), Positives = 190/287 (66%), Gaps = 7/287 (2%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +F  +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSITLGLFFTLSIFLIGALAKVPVDDQFQVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGRV
Sbjct  63    CFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRV  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTL VGQSL+L G  KLVSR
Sbjct  123   VWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLHVGQSLKLDGRNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDS---SKWFSVGKSSLEEVKFNAK  411
              S + N NGPY++++E  +L  Y  T  + +PI Y++    +K   +   + + VK +  
Sbjct  183   LSPSVNENGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYEFFTKITQLQSMTFQAVKDSDT  242

Query  410   TQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTF  273
             T  L ++  V   SK      L++PK N TL++LRLE DGN++ +++
Sbjct  243   TWGLHME-GVDSGSKFNVSTFLSRPKHNATLSFLRLESDGNIRVWSY  288



>ref|XP_010472718.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=441

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 196/305 (64%), Gaps = 10/305 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSVTLALCFTLSITLIGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGRV
Sbjct  63    CFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRV  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+++G  KLVSR
Sbjct  123   VWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKVNGQNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA----  414
              S + N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A    
Sbjct  183   LSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFGAVEDS  240

Query  413   -KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               T  L ++   + S    +  L++PK N TL++LRLE DGN++ ++ YS A     W  
Sbjct  241   DTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWS-YSTAATATAWDV  299

Query  236   SFKLF  222
             ++  F
Sbjct  300   TYTAF  304



>ref|XP_002889216.1| hypothetical protein ARALYDRAFT_895785 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65475.1| hypothetical protein ARALYDRAFT_895785 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 197/306 (64%), Gaps = 12/306 (4%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL + L +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSITLALCLTLSIFLIGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGRV
Sbjct  63    CFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRV  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKG VG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L+G  KLVSR
Sbjct  123   VWQTNTANKGAVGIKILENGNMVIYDSSGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA----  414
              S + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A    
Sbjct  183   LSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFQAVEDS  240

Query  413   -KTQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
               T  L ++  V   SK      L++PK N TL+++RLE DGN++ ++ YS    +  W 
Sbjct  241   DTTWGLHME-GVDSGSKFNVSTFLSRPKHNATLSFIRLESDGNIRVWS-YSTLATSTAWD  298

Query  239   ESFKLF  222
              ++  F
Sbjct  299   VTYTAF  304



>ref|XP_010417494.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=443

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 196/305 (64%), Gaps = 10/305 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSVTLALCFTLSITLIGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTT NAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGRV
Sbjct  63    CFYNTTSNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRV  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L+G  KLVSR
Sbjct  123   VWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA----  414
              S + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A    
Sbjct  183   LSPSANTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFGAVEDS  240

Query  413   -KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               T  L ++   + S    +  L++PK N TL++LRLE DGN++ ++ YS    +  W  
Sbjct  241   DTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWS-YSTLASSTAWDV  299

Query  236   SFKLF  222
             ++  F
Sbjct  300   TYTAF  304



>ref|NP_178007.1| curculin-like (mannose-binding) lectin family protein [Arabidopsis 
thaliana]
 gb|AAC83024.1| Strong similarity to glycoprotein EP1 gb|L16983 Daucus carota 
and a member of S locus glycoprotein family PF|00954. EST gb|AA720110 
comes from this gene [Arabidopsis thaliana]
 gb|AEE36163.1| curculin-like (mannose-binding) lectin family protein [Arabidopsis 
thaliana]
Length=443

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 197/305 (65%), Gaps = 10/305 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S+TL +F  +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSTTLALFFTLSIFLVGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTT NAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGRV
Sbjct  63    CFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRV  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L+G  KLVSR
Sbjct  123   VWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA----  414
              S + N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A    
Sbjct  183   LSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIGYYEYE--FFTKIAQLQSMTFQAVEDA  240

Query  413   -KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               T  L ++   + S    +  L++PK N TL++LRLE DGN++ ++ YS    +  W  
Sbjct  241   DTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWS-YSTLATSTAWDV  299

Query  236   SFKLF  222
             ++  F
Sbjct  300   TYTAF  304



>ref|XP_009104565.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Brassica rapa]
Length=439

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 193/305 (63%), Gaps = 12/305 (4%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCF  936
             S++++ L +S  ++   A+VP    F+ VNEG    Y  +EY  D R    F++ F+LCF
Sbjct  5     STSVLCLTLSFFLIGAQAKVPVDEQFRVVNEGGYTDYSPIEYNPDVRGFQPFNDNFRLCF  64

Query  935   YNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAW  756
             YNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+ W
Sbjct  65    YNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRMVW  124

Query  755   QSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRAS  576
             Q+ TANKG VG K+L+NGNMV++D  G F+WQSFD PTDTLLVGQSL+LSG  KLVSR S
Sbjct  125   QTNTANKGAVGIKILENGNMVIYDKNGKFIWQSFDSPTDTLLVGQSLKLSGRNKLVSRRS  184

Query  575   ETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA------  414
              + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A      
Sbjct  185   PSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYNYE--FFSKITQLQSITFKAVEDIFD  242

Query  413   KTQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
              T  L ++  V   SK      L+ PK N TL+++RLE DGN++ ++ YS A     W  
Sbjct  243   STWGLHME-GVDSGSKFNVSTFLSIPKHNATLSFIRLESDGNVRVWS-YSTAATATAWDV  300

Query  236   SFKLF  222
             ++  F
Sbjct  301   TYTAF  305



>ref|XP_010429745.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=443

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 196/305 (64%), Gaps = 10/305 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP  + FK VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSVTLALCFTLSIILIGAQAKVPVDDQFKVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTT NAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+
Sbjct  63    CFYNTTSNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLSFGEDGNLVLAESDGRL  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+++G  KLVSR
Sbjct  123   VWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDTPTDTLLVGQSLKVNGQNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA----  414
              S + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A    
Sbjct  183   LSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFGAVEDS  240

Query  413   -KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               T  L ++   + S    +  L++PK N TL++LRLE DGN++ ++ YS A     W  
Sbjct  241   DTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWS-YSTAATATAWDV  299

Query  236   SFKLF  222
             ++  F
Sbjct  300   TYTAF  304



>ref|XP_009106600.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Brassica rapa]
Length=441

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 195/303 (64%), Gaps = 6/303 (2%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP    F+ VN+G    Y  +EY  D R    F++ F+L
Sbjct  3     FSITLSLCFTLSIFLIGAQAKVPVDEQFRVVNDGGYTDYSPIEYNPDVRGFQPFNDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLAD DGR+
Sbjct  63    CFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLADADGRL  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKG VG K+L+NGNMV++DA G F+WQSFD PTDTLLVGQSL+ +G  KLVSR
Sbjct  123   VWQTNTANKGAVGIKILENGNMVIYDANGKFIWQSFDSPTDTLLVGQSLKRNGRNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDS---SKWFSVGKSSLEEVKFNAK  411
              S + NTNGPY++++E  +L  Y  T  + +PI+Y+D    SK   +   + + V+ +  
Sbjct  183   LSRSVNTNGPYSLVMEDKKLVLYYTTSKTPKPIVYYDYEFFSKITQLQSMTFQAVEDSDT  242

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESF  231
             T  L ++   + S    +  L++PK N TL+++RLE DGN++ ++ YS       W  ++
Sbjct  243   TWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFIRLESDGNVRVWS-YSTLATATAWDVTY  301

Query  230   KLF  222
               F
Sbjct  302   TAF  304



>ref|XP_006378040.1| hypothetical protein POPTR_0010s00810g, partial [Populus trichocarpa]
 gb|ERP55837.1| hypothetical protein POPTR_0010s00810g, partial [Populus trichocarpa]
Length=423

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/308 (48%), Positives = 187/308 (61%), Gaps = 18/308 (6%)
 Frame = -1

Query  1139  KNMSSPSSYSS--TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD  966
             + MSSP    S  +L  L  SI  L   A VP    F+   +   G Y VEY A+YR++ 
Sbjct  2     RKMSSPLLEVSLLSLCLLYGSIFSLIAQASVPPSARFQIPVDTFFGVYSVEYGANYRLIG  61

Query  965   VFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLV  786
             + + PFQL FYNTTP+A+TLALRMG   +  +M +VWEANRGKPVR  A   L +DGNLV
Sbjct  62    IDNYPFQLGFYNTTPDAFTLALRMGNPLASPKMYFVWEANRGKPVRVNATLTLGEDGNLV  121

Query  785   LADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLS  606
             LADVDG +AWQ+ TA KGVVG +LL NGNMVLHD+KGNFVWQSFDHPTDTLLVGQSLR+ 
Sbjct  122   LADVDGSIAWQTYTAQKGVVGLQLLPNGNMVLHDSKGNFVWQSFDHPTDTLLVGQSLRVE  181

Query  605   GPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEV  426
             G  +L               ++LEP RL  Y ++ +S RP LY+   K  S  K  +   
Sbjct  182   GTARL---------------LVLEPKRLAMYYKSPSSPRPYLYYTPDK-LSESKGRIHNA  225

Query  425   KFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFH  246
                ++ +     Y  A S+     +L    +N TL++LRL IDGNL+ +TFY  A  N  
Sbjct  226   TLYSRGEVDGFYYDFALSTPFQDAILTTVNYNNTLSFLRLGIDGNLRIHTFYDKANSNDG  285

Query  245   WGESFKLF  222
             +  +F LF
Sbjct  286   FQVTFTLF  293



>ref|XP_010429744.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=441

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 195/306 (64%), Gaps = 12/306 (4%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP  + FK VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSVTLALCFTLSIILIGAQAKVPVDDQFKVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTT NAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGRV
Sbjct  63    CFYNTTSNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRV  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+ +G  KLVSR
Sbjct  123   VWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDTPTDTLLVGQSLKRNGRTKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA----  414
              S + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A    
Sbjct  183   LSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFGAVEDS  240

Query  413   -KTQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
               T  L ++  V   SK      L++PK N TL+++RLE DGN++ ++ YS A     W 
Sbjct  241   DTTWGLHME-GVDSGSKFNVSTFLSRPKHNATLSFIRLESDGNIRVWS-YSTAATATAWD  298

Query  239   ESFKLF  222
              ++  F
Sbjct  299   VTYTAF  304



>ref|XP_010417493.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=441

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 196/307 (64%), Gaps = 12/307 (4%)
 Frame = -1

Query  1118  SYSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQ  945
             ++S TL +   +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+
Sbjct  2     NFSITLALCFTLSIILIGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFR  61

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             LCFYNTT NAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR
Sbjct  62    LCFYNTTSNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGR  121

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+ +G  KLVS
Sbjct  122   VVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKRNGRTKLVS  181

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA---  414
             R S + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A   
Sbjct  182   RLSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFGAVED  239

Query  413   --KTQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHW  243
                T  L ++  V   SK      L++PK N TL++LRLE DGN++ ++ YS A     W
Sbjct  240   SDTTWGLHME-GVDSGSKFNVSTFLSRPKHNATLSFLRLESDGNIRVWS-YSTAATATAW  297

Query  242   GESFKLF  222
               ++  F
Sbjct  298   DVTYTAF  304



>emb|CDX87429.1| BnaA07g34440D [Brassica napus]
Length=441

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 194/303 (64%), Gaps = 6/303 (2%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP    F  VNEG    Y  +EY  D R    F++ F+L
Sbjct  3     FSITLSLCFTLSIFLIGAQAKVPVDEQFLVVNEGGYTDYSPIEYNPDVRGFQPFNDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLAD DGR+
Sbjct  63    CFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLADADGRL  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKG VG K+L+NGNMV++DA G F+WQSFD PTDTLLVGQSL+ +G  KLVSR
Sbjct  123   VWQTNTANKGAVGIKILENGNMVIYDANGKFIWQSFDSPTDTLLVGQSLKRNGRNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDS---SKWFSVGKSSLEEVKFNAK  411
              S + NTNGPY++++E  +L  Y  T  + +PI+Y+D    SK   +   + + V+ +  
Sbjct  183   LSRSVNTNGPYSLVMEDKKLVLYYTTSKTPKPIVYYDYEFFSKITQLQSMTFQAVEDSDT  242

Query  410   TQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESF  231
             T  L ++   + S    +  L++PK N TL+++RLE DGN++ ++ YS       W  ++
Sbjct  243   TWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFIRLESDGNVRVWS-YSTLATATAWDVTY  301

Query  230   KLF  222
               F
Sbjct  302   TAF  304



>emb|CDY57940.1| BnaA07g38400D [Brassica napus]
Length=439

 Score =   264 bits (675),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 193/305 (63%), Gaps = 12/305 (4%)
 Frame = -1

Query  1112  SSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCF  936
             S++++ L +S  ++   A+VP    F+ VNEG    Y  +EY  D R    F++ F+LCF
Sbjct  5     STSVLCLTLSFFLIGAQAKVPVDEQFRVVNEGGYTDYSPIEYNPDVRGFQPFNDNFRLCF  64

Query  935   YNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAW  756
             YNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+ W
Sbjct  65    YNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRLVW  124

Query  755   QSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRAS  576
             Q+ TANKG VG K+L+NGNMV++D  G F+WQSFD PTDTLLVGQSL+L+G  KLVSR S
Sbjct  125   QTNTANKGAVGIKILENGNMVIYDKNGKFIWQSFDSPTDTLLVGQSLKLNGRNKLVSRRS  184

Query  575   ETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA------  414
              + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A      
Sbjct  185   PSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYNYE--FFSKITQLQSITFKAVEDIFD  242

Query  413   KTQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
              T  L ++  V   SK      L+ PK N TL+++RLE DGN++ +T YS A     W  
Sbjct  243   STWGLHME-GVDSGSKFNVSTFLSIPKHNATLSFIRLESDGNVRVWT-YSTAATATAWDV  300

Query  236   SFKLF  222
             ++  F
Sbjct  301   TYTAF  305



>emb|CDX88484.1| BnaC06g39280D [Brassica napus]
Length=441

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 192/305 (63%), Gaps = 10/305 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP    F  VN+G    Y  +EY  D R    F++ F+L
Sbjct  3     FSITLSLCFTLSIFLIGAQAKVPVDEQFLVVNKGGYTDYSPIEYNPDVRGFQPFNDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLADVDGR+
Sbjct  63    CFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLADVDGRL  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKG VG K+L+NGNMV++D  G F+WQSFD PTDTLLVGQSL+ +G  KLVSR
Sbjct  123   VWQTNTANKGAVGIKILENGNMVIYDTNGKFIWQSFDSPTDTLLVGQSLKRNGRNKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA---K  411
              S + NTNGPY++++E  +L  Y  T  + +PI Y+D    F    + L+ + F A    
Sbjct  183   LSRSVNTNGPYSLVMEDKKLVLYYTTSKTPKPIAYYDYE--FFSKITQLQSMTFQAGEDS  240

Query  410   TQTLKLDYK-VAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
               T  LD + V   S+      L++PK N TL+++RLE DGN++ ++ YS       W  
Sbjct  241   DSTWGLDMEGVDSGSQFNVSTFLSRPKHNATLSFIRLESDGNVRVWS-YSTLATATAWDV  299

Query  236   SFKLF  222
             ++  F
Sbjct  300   TYTAF  304



>gb|AAN31898.1| putative glycoprotein (EP1) [Arabidopsis thaliana]
Length=441

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 195/304 (64%), Gaps = 8/304 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSITLALCFTLSIFLIGSQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+
Sbjct  63    CFYNTTPNAYTLALRIGNRVQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRL  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKG VG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L+G  KLVSR
Sbjct  123   VWQTNTANKGAVGIKILENGNMVIYDSSGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDS---SKWFSVGKSSLEEVKFNAK  411
              S + NTNGPY++++E  +L  Y  T  + +PI Y +    +K       + + V+ +  
Sbjct  183   LSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYFEYEFFTKITQFQSMTFQAVEDSDT  242

Query  410   TQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGES  234
             T  L ++  V   SK      L++PK N TL+++RLE DGN++ ++ YS    +  W  +
Sbjct  243   TWGLVME-GVDSGSKFNVSTFLSRPKHNATLSFIRLESDGNIRVWS-YSTLATSTAWDVT  300

Query  233   FKLF  222
             +  F
Sbjct  301   YTAF  304



>ref|NP_178006.1| curculin-like (mannose-binding) lectin family protein [Arabidopsis 
thaliana]
 gb|AAC83025.1| Strong similarity to glycoprotein EP1 gb|L16983 Daucus carota 
and a member of S locus glycoprotein family PF|00954. ESTs 
gb|F13813, gb|T21052, gb|R30218 and gb|W43262 come from this 
gene [Arabidopsis thaliana]
 gb|AAK96692.1| Strong similarity to glycoprotein EP1 [Arabidopsis thaliana]
 gb|AEE36162.1| curculin-like (mannose-binding) lectin family protein [Arabidopsis 
thaliana]
Length=441

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 195/304 (64%), Gaps = 8/304 (3%)
 Frame = -1

Query  1115  YSSTL-IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQL  942
             +S TL +   +SI ++   A+VP  + F+ VNEG    Y  +EY  D R    FS+ F+L
Sbjct  3     FSITLALCFTLSIFLIGSQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRL  62

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+
Sbjct  63    CFYNTTPNAYTLALRIGNRVQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRL  122

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKG VG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L+G  KLVSR
Sbjct  123   VWQTNTANKGAVGIKILENGNMVIYDSSGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSR  182

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDS---SKWFSVGKSSLEEVKFNAK  411
              S + NTNGPY++++E  +L  Y  T  + +PI Y +    +K       + + V+ +  
Sbjct  183   LSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYFEYEFFTKITQFQSMTFQAVEDSDT  242

Query  410   TQTLKLDYKVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGES  234
             T  L ++  V   SK      L++PK N TL+++RLE DGN++ ++ YS    +  W  +
Sbjct  243   TWGLVME-GVDSGSKFNVSTFLSRPKHNATLSFIRLESDGNIRVWS-YSTLATSTAWDVT  300

Query  233   FKLF  222
             +  F
Sbjct  301   YTAF  304



>ref|XP_006389952.1| hypothetical protein EUTSA_v10018565mg [Eutrema salsugineum]
 gb|ESQ27238.1| hypothetical protein EUTSA_v10018565mg [Eutrema salsugineum]
Length=441

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/288 (47%), Positives = 180/288 (63%), Gaps = 19/288 (7%)
 Frame = -1

Query  1085  SIQILTCF----------AQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLC  939
             SI +  CF          A+VP    F+ VNEG    Y  +EY  D R    F++ F+LC
Sbjct  4     SITLALCFTLSGFLIGAHAKVPLDEQFRVVNEGGYTDYSPIEYNPDVRGFQPFTDNFRLC  63

Query  938   FYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVA  759
             FYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+ 
Sbjct  64    FYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRLV  123

Query  758   WQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRA  579
             WQ+ TANKG VG K+L NGNMV++D+ G F+WQSFD PTDTLLVGQSL+L+G  KLVSR 
Sbjct  124   WQTNTANKGAVGIKILDNGNMVIYDSNGKFIWQSFDSPTDTLLVGQSLKLNGRNKLVSRR  183

Query  578   SETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTL  399
             S + NTNGPY++++E  RL  Y  T  + +PI Y++    F    + L+ + F A   + 
Sbjct  184   SPSVNTNGPYSLVMEAKRLVLYYTTNKTPKPIAYYEYE--FFSKITQLQSMTFKAVEDSF  241

Query  398   KLDY-----KVAKSSKLGAHV-LAQPKFNTTLTYLRLEIDGNLKTYTF  273
                +      V   SK      L+ PK N TL+++RLE DGN++ +++
Sbjct  242   DTTWGLSMEGVDSGSKFNVSTFLSSPKHNATLSFIRLESDGNVRVWSY  289



>ref|XP_009794707.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like, 
partial [Nicotiana sylvestris]
Length=168

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-VFSNP  951
             SPS  ++ +  L +  QI +  AQVP +NTFKFVNEGELGP+VVEY+ADYRV   +F+NP
Sbjct  2     SPSLPTTLVASLFLFCQIFSSIAQVPVENTFKFVNEGELGPFVVEYQADYRVFSGIFTNP  61

Query  950   FQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVD  771
             FQ CFYNTTPNA+TLALRMGTVRSE  MRWVWEANRG PV++ A F L  DGNLVLA+ +
Sbjct  62    FQFCFYNTTPNAWTLALRMGTVRSESLMRWVWEANRGNPVKENATFSLGTDGNLVLAEAN  121

Query  770   GRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLL  630
             GR+AWQ+ TA KGV GFKLL NGN VLH++KG F+WQSFDHPTDTLL
Sbjct  122   GRIAWQTNTAKKGVTGFKLLPNGNFVLHNSKGKFIWQSFDHPTDTLL  168



>ref|XP_009118161.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Brassica rapa]
 emb|CDY34818.1| BnaA09g47440D [Brassica napus]
Length=445

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 183/281 (65%), Gaps = 9/281 (3%)
 Frame = -1

Query  1100  IFLVVSIQILT-CFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCFYNT  927
             IFL +SI  LT   A+VP    F+ VNEG+   Y  +EY AD R    F++ F+LCFYNT
Sbjct  9     IFLTLSIFSLTGAQAKVPIDEQFRVVNEGDYTDYSPIEYNADVRGFRPFNDNFRLCFYNT  68

Query  926   TPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             TPNAYTLALR+G    E  +RWVWEANR  PV++ A     +DGNLVLA+ DGRV WQ+ 
Sbjct  69    TPNAYTLALRIGNRAQESTLRWVWEANRDSPVKEDATLTFGEDGNLVLAEADGRVVWQTN  128

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQ  567
             TANK  VG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+ +G  KLVSR S + 
Sbjct  129   TANKNAVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKANGQNKLVSRRSPSV  188

Query  566   NTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQT  402
             N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A      T  
Sbjct  189   NANGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWG  246

Query  401   LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTY  279
             L ++   + S    +  L++PK N TL++LRLE DGN++ +
Sbjct  247   LHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNVRVW  287



>ref|XP_004170214.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cucumis sativus]
Length=449

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 185/319 (58%), Gaps = 38/319 (12%)
 Frame = -1

Query  1109  STLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV-----DVFSNPFQ  945
             ST++F  ++ +     AQVPA  TF F+N+GE G  ++EY A YRV+       ++ PF+
Sbjct  16    STILFAAIATK-----AQVPANETFHFINQGEFGDRIIEYDASYRVIRNNVYTFYTFPFR  70

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             LCFYNTTPN++  A+R G  R E  MRWVW+ANR  PVR+ A      DGN VLADVDGR
Sbjct  71    LCFYNTTPNSFIFAIRAGIPRDESLMRWVWDANRNDPVRENATLTFGTDGNFVLADVDGR  130

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             + WQ+ T NKGV G K+L NGN+VLHD  G F+WQSFD+PTDTLLVGQSLR+ G  KL+S
Sbjct  131   IVWQTNTKNKGVTGIKMLPNGNLVLHDKNGKFIWQSFDYPTDTLLVGQSLRIGGRSKLIS  190

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKF-----  420
             R SE   ++GPY++IL  T L  +     S + + Y     W   G + L  V F     
Sbjct  191   RKSEIDGSDGPYSLILSRTGLTMF--LTYSGQRLTY---GGW---GDTDLNSVTFTVEPE  242

Query  419   -------------NAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTY  279
                          N  TQ  +L  +V      GA  L +  +N T ++LRL  DGNL+ +
Sbjct  243   NENATAYELLLSLNRDTQRRRL-LQVRPIRSGGALNLNKLNYNATYSFLRLGEDGNLRAF  301

Query  278   TFYSDAEENFHWGESFKLF  222
             T+Y D      W ESF  F
Sbjct  302   TYY-DGTSYLKWEESFAFF  319



>ref|XP_006417289.1| hypothetical protein EUTSA_v10007630mg [Eutrema salsugineum]
 gb|ESQ35642.1| hypothetical protein EUTSA_v10007630mg [Eutrema salsugineum]
Length=446

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 193/306 (63%), Gaps = 9/306 (3%)
 Frame = -1

Query  1121  SSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQ  945
             +S +  L F +  + ++   A+VP    F+ VNEG+   Y  +EY AD R     ++ F+
Sbjct  3     TSITLALCFTLSILFLIGAQAKVPVDKQFRAVNEGDYTDYTPMEYNADVRGFQPVNDNFR  62

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             LCFYNTTPNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR
Sbjct  63    LCFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAESDGR  122

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANK  VG K+L+NGNMV++D+   F+WQSFD PTDTLLVGQSL+ +G  KLVS
Sbjct  123   VVWQTNTANKNAVGIKILENGNMVIYDSNEKFLWQSFDSPTDTLLVGQSLKANGRNKLVS  182

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA---  414
             R S + NTNGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + F A   
Sbjct  183   RRSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTEITRLQSMTFQAVED  240

Query  413   --KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
                T  L ++   + S    +  L++PK N TL++LRLE DGN++ ++ YS A  +  W 
Sbjct  241   SDTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWS-YSTAASSTAWD  299

Query  239   ESFKLF  222
              ++  F
Sbjct  300   VTYTAF  305



>ref|XP_004146093.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Cucumis sativus]
 gb|KGN55072.1| hypothetical protein Csa_4G627220 [Cucumis sativus]
Length=449

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 185/319 (58%), Gaps = 38/319 (12%)
 Frame = -1

Query  1109  STLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV-----DVFSNPFQ  945
             ST++F  ++ +     AQVPA  TF F+N+GE G  ++EY A YRV+       ++ PF+
Sbjct  16    STILFAAIATK-----AQVPANETFHFINQGEFGDRIIEYDASYRVIRNNVYTFYTFPFR  70

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             LCFYNTTP+++  A+R G  R E  MRWVW+ANR  PVR+ A      DGN VLADVDGR
Sbjct  71    LCFYNTTPDSFIFAIRAGIPRDESLMRWVWDANRNDPVRENATLTFGTDGNFVLADVDGR  130

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             + WQ+ T NKGV G K+L NGN+VLHD  G F+WQSFD+PTDTLLVGQSLR+ G  KL+S
Sbjct  131   IVWQTNTKNKGVTGIKMLPNGNLVLHDKNGKFIWQSFDYPTDTLLVGQSLRIGGRNKLIS  190

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKF-----  420
             R SE   ++GPY++IL  T L  +     S + + Y     W   G + L  V F     
Sbjct  191   RKSEIDGSDGPYSLILSRTGLTMF--LTYSGQRLTY---GGW---GDTDLNSVTFTVEPE  242

Query  419   -------------NAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTY  279
                          N  TQ  +L  +V      GA  L +  +N T ++LRL  DGNL+ +
Sbjct  243   NENATAYELLLSLNRDTQRRRL-LQVRPIRSGGALNLNKLNYNATYSFLRLGADGNLRAF  301

Query  278   TFYSDAEENFHWGESFKLF  222
             T+Y D      W ESF  F
Sbjct  302   TYY-DGTSYLKWEESFAFF  319



>ref|XP_010540151.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Tarenaya hassleriana]
Length=443

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 179/281 (64%), Gaps = 8/281 (3%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPY-VVEYRADYRVVDVFSNPFQLCFYNTT  924
                V S+ I+   A+VP    F++VNEGE       EY AD R +  F+ PF LCFYN T
Sbjct  14    FLFVSSVNIVLAQAKVPPSEQFQYVNEGEFDTEDPAEYGADTRCLP-FARPFALCFYNVT  72

Query  923   PNAYTLALRMGTVRSELRMR-WVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             PN +TLA+RMGT   +  +R WVWEAN G PV+D A    RQDGNLVLA VDGRVAWQ+ 
Sbjct  73    PNEFTLAIRMGTHDVDFILRRWVWEANVGNPVKDNATLTFRQDGNLVLAHVDGRVAWQTG  132

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLR-LSGPKKLVSRASET  570
             TANKGVVGF++L NGNMVL+D+KG +VWQSFD P +TLLVGQSLR  +GP KLVSR+  +
Sbjct  133   TANKGVVGFRILDNGNMVLYDSKGKYVWQSFDSPRNTLLVGQSLRPKTGPYKLVSRSLSS  192

Query  569   QNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLD  390
              + NGPYT+ILEP RL       N  +P++Y+     F    +   +      TQ L L 
Sbjct  193   PDGNGPYTLILEPKRLVLQYTAPNLDKPVVYYVIENTFEPYATLFAKPAEGTSTQ-LGL-  250

Query  389   YKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYS  267
               V   +    +   +PK+N TL++LRLE +GNL  YT+Y 
Sbjct  251   --VTPGTNPIEYDFDRPKYNATLSFLRLESNGNLVVYTYYD  289



>gb|KHN36884.1| Epidermis-specific secreted glycoprotein EP1 [Glycine soja]
Length=346

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 169/251 (67%), Gaps = 12/251 (5%)
 Frame = -1

Query  974  VVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDG  795
            ++ +F++PF + FYNTTPNA+TLALRMG  RSE   RWVWEANRG PV +   F L  DG
Sbjct  1    MISIFNSPFHVGFYNTTPNAFTLALRMGLRRSEQLFRWVWEANRGNPVGENTTFSLGTDG  60

Query  794  NLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSL  615
            NLVLA+ DGR+AWQ+ TANKGVV F+LL NGNMVL DA+G F+W+SFDHPTDTLL  Q L
Sbjct  61   NLVLAEADGRIAWQTNTANKGVVAFRLLPNGNMVLLDAQGKFLWRSFDHPTDTLLNDQYL  120

Query  614  RLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSL  435
            R  GP KL+SR SE +N +GPY+++LEP RL  Y ++KNS +PILY    K F+   SS 
Sbjct  121  RPKGPSKLISRLSEKENVDGPYSLVLEPKRLALYYKSKNSPKPILYW--YKLFTQQGSSS  178

Query  434  EEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEE  255
               +F    +T+   +       +   V+  P  N+TLTYLRL IDGN++ +T++     
Sbjct  179  STNEF----RTMATGF-----GNIPVGVMGMPVNNSTLTYLRLGIDGNIRLHTYFLGVRS  229

Query  254  NFHWGESFKLF  222
               W  ++ LF
Sbjct  230  GV-WQVTYTLF  239



>gb|KFK42262.1| hypothetical protein AALP_AA2G232400 [Arabis alpina]
Length=440

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/298 (45%), Positives = 194/298 (65%), Gaps = 7/298 (2%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCFYNTT  924
             +FL + + ++   A+VP  + F  +N+G    Y  +EY  D R     ++ F+LCFYNTT
Sbjct  9     LFLTLFVFLIRAQAKVPVDDQFHVINQGGYTDYSPIEYNPDVRGFQPSNDNFRLCFYNTT  68

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             PNAYTLALR+G    E  +RWVWEANRG PV++ A     +DGNLVLA+ DGR+ WQ+ T
Sbjct  69    PNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATVTFGEDGNLVLAESDGRLVWQTNT  128

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
             ANK VVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+++G  KLVSR S + N
Sbjct  129   ANKNVVGIKILENGNMVIYDSAGKFVWQSFDSPTDTLLVGQSLKVNGRNKLVSRRSPSVN  188

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGK---SSLEEVKFNAKTQTLKL  393
             TNGPY++++E  +L  Y  T  + +P+ Y++   +  + +    +L+ V+ +  T  L +
Sbjct  189   TNGPYSLVMEAKKLVVYYTTNKTPKPVAYYEYEFFTKISQFQSMTLQAVEDSDTTWGLAM  248

Query  392   DYKVAKSSKLG-AHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             +  V   SK   +  L++PK N TL+++RLE DGN++ ++ YS       W  ++ LF
Sbjct  249   E-GVDSGSKFNISTFLSRPKHNATLSFIRLESDGNIRVWS-YSTLATATAWDVTYTLF  304



>gb|KCW67505.1| hypothetical protein EUGRSUZ_F01234 [Eucalyptus grandis]
Length=363

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 158/232 (68%), Gaps = 7/232 (3%)
 Frame = -1

Query  896  MGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
            M + RSE   RWVWEANRG PV + A F L  DGNLVLAD DGRVAWQS TA KGVVG K
Sbjct  1    MASHRSESLFRWVWEANRGNPVHENATFALGGDGNLVLADADGRVAWQSHTAKKGVVGLK  60

Query  716  LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIIL  537
            LL NGNMVLHD+KGNFVWQSFD PTDTLLVGQSLR+    KLVSRASE  N+NGPY++++
Sbjct  61   LLPNGNMVLHDSKGNFVWQSFDSPTDTLLVGQSLRVGAVSKLVSRASEKDNSNGPYSLVI  120

Query  536  EPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK-------LDYKVA  378
            EP +L  Y  +KNS +P+LY+   +   +    L +V  +++++TL        L Y VA
Sbjct  121  EPKQLSLYYTSKNSPKPLLYYTFGQHMYLADGLLAQVTLDSRSETLDGSIYDIILKYVVA  180

Query  377  KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
              +     +L +PK+N+TLT LRL  DGNL+ YT+Y   +  + W  +F LF
Sbjct  181  NKTSGDGLILRRPKYNSTLTILRLGTDGNLQAYTYYHMTDYLWAWDVTFSLF  232



>ref|XP_006301927.1| hypothetical protein CARUB_v10022403mg [Capsella rubella]
 gb|EOA34825.1| hypothetical protein CARUB_v10022403mg [Capsella rubella]
Length=456

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 143/321 (45%), Positives = 190/321 (59%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL  ++ S+ ++   AQVP +  F+ VNEGE G Y+ EY A YR ++      F++PFQL
Sbjct  10    TLALVIASVSVV--IAQVPPEKQFRVVNEGEFGQYITEYDASYRFIESSNQSFFTSPFQL  67

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  68    LFYNTTPGAYVLALRVGLRRDESLMRWIWDANRNSPVGENATLSLGRNGNLVLAEADGRV  127

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GFK+L NGNMVLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  128   KWQTNTANKGVTGFKILPNGNMVLHDKNGKFVWQSFDHPTDTLLNGQSLKVNGVNKLVSR  187

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGKS------  441
              S+   ++GPY+++L+   L  Y     +  P++Y     HD   +  F+V +       
Sbjct  188   TSDVDGSDGPYSMVLDTKGLTMY--VNKTGTPLVYGGWTDHDFRGTVTFAVTRELDNLTE  245

Query  440   -SLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  246   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  305

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  306   AYSYFP-AATYLKWEESFSFF  325



>gb|AAN60345.1| unknown [Arabidopsis thaliana]
Length=451

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 193/317 (61%), Gaps = 27/317 (9%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   AQVP +  F+ VNEGE G Y+ EY A YR ++      F++PFQL
Sbjct  9     TLALAIATVSVV--IAQVPPEKQFRVVNEGEFGEYITEYDASYRFIESSNQSFFTSPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  67    LFYNTTPSAYILALRVGLRRDESTMRWIWDANRNNPVGENATLSLGRNGNLVLAEADGRV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGN+VLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFQILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGKSSLEEVK  423
              S++  ++GPY+++L+   L  Y     +  P++Y     HD   +  F+V +      +
Sbjct  187   TSDSNGSDGPYSMVLDKKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLTE  244

Query  422   FNAKTQTLKLDYKVAKSSKL----------GAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
              +A    L+   +   + +L          G   L +  +N T++YLRL  DG+LK Y++
Sbjct  245   PSAYELLLEPAPQPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLKAYSY  304

Query  272   YSDAEENFHWGESFKLF  222
             +  A     W ESF  F
Sbjct  305   FP-AATYLKWEESFSFF  320



>ref|XP_006389953.1| hypothetical protein EUTSA_v10018557mg [Eutrema salsugineum]
 gb|ESQ27239.1| hypothetical protein EUTSA_v10018557mg [Eutrema salsugineum]
Length=444

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 194/314 (62%), Gaps = 24/314 (8%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQLCF  936
             I L +++ I T  AQVP +  F+ VNEGE G Y+ EY A YR ++      F++PFQL F
Sbjct  6     ILLSLTLAIATVSAQVPPEKQFRVVNEGEFGEYITEYDASYRFINSPNASFFTSPFQLLF  65

Query  935   YNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAW  756
             YNTTP+AY LALR+G  R E  MRW+W+ANR  PV + +   L +DGNLVLA+ +GRV W
Sbjct  66    YNTTPSAYVLALRVGLRRQESLMRWIWDANRNNPVGENSTLSLGRDGNLVLAESNGRVKW  125

Query  755   QSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRAS  576
             Q+ TANKGV GF++L NGN+VLHD  G F+WQSFDHPTDTLL GQSL+++G  KLVSR S
Sbjct  126   QTNTANKGVTGFQILPNGNIVLHDKNGKFIWQSFDHPTDTLLTGQSLKVNGVNKLVSRKS  185

Query  575   ETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGKSS  438
             +   ++GPY+++L+   L  Y     + +P++Y     HD         + ++ ++ + S
Sbjct  186   DMDGSDGPYSMVLDNKGLTMY--VNKTGQPLVYGGWPNHDFRGTVTFAVTREFDNLTEPS  243

Query  437   LEEVKFNAKTQT--LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSD  264
               E+      Q+   +L       +  G   L +  +N T++YLRL  DG+LK Y++Y+ 
Sbjct  244   AYELLLEPAPQSNNRRLLQTRPIGNGGGTLNLNKINYNGTISYLRLGSDGSLKAYSWYAP  303

Query  263   AEENFHWGESFKLF  222
             +     W ESF  F
Sbjct  304   STY-LAWEESFSFF  316



>ref|XP_007211483.1| hypothetical protein PRUPE_ppa007630mg [Prunus persica]
 gb|EMJ12682.1| hypothetical protein PRUPE_ppa007630mg [Prunus persica]
Length=361

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 157/232 (68%), Gaps = 8/232 (3%)
 Frame = -1

Query  896  MGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
            MG  RSE  +RWVWEANRG PV + A F    DGNLVLA+ DGRVAWQ+ T NKGVVGFK
Sbjct  1    MGLRRSESLIRWVWEANRGNPVGEKATFTFGTDGNLVLANADGRVAWQTNTRNKGVVGFK  60

Query  716  LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIIL  537
            LL NGNMVL+++KGNFVWQSF +PTDTLLVGQSLR+ G  KLVSRASET+N +G Y+ ++
Sbjct  61   LLSNGNMVLYNSKGNFVWQSFHYPTDTLLVGQSLRVGGVTKLVSRASETENKDGSYSFVM  120

Query  536  EPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA-------KTQTLKLDYKVA  378
            EP RL  Y ++KNS +PI+Y  SSK   VGK SLE V  N         +  L L Y+  
Sbjct  121  EPKRLALYYKSKNSPKPIVYFTSSKLIDVGKGSLEHVTLNCYPVSSDDSSYDLALMYEPG  180

Query  377  KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             S      VLA  K+N T ++LRLEIDGNLK YT+Y+       W   F LF
Sbjct  181  NSISGFNLVLATTKYNGTSSFLRLEIDGNLKVYTYYNKVRYG-AWEVPFTLF  231



>ref|XP_010537731.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Tarenaya hassleriana]
Length=453

 Score =   254 bits (649),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 138/323 (43%), Positives = 183/323 (57%), Gaps = 34/323 (11%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-----FSNPFQLCF  936
             IF+ ++  I    AQVP   TF FVNEGE G Y++EY A YR ++       S PF+LCF
Sbjct  6     IFVTLAAVISATLAQVPPDKTFTFVNEGEFGEYIIEYDASYRWIETPTQSFSSRPFRLCF  65

Query  935   YNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAW  756
             YNTTP+AY  A+R G    E  MRWVW+ANR  PV D +   L +DGNLVLA+ DGRV W
Sbjct  66    YNTTPSAYVFAIRAGLPNDESLMRWVWDANRNSPVGDNSTLSLGRDGNLVLAEADGRVKW  125

Query  755   QSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRAS  576
             Q+ TANKGV G ++L  GN+VLHD  G FVWQSFDHPTDTLLVGQSL++ G  KLVSR S
Sbjct  126   QTNTANKGVTGMRMLPTGNLVLHDKNGKFVWQSFDHPTDTLLVGQSLKVGGVNKLVSRKS  185

Query  575   ETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK  396
             +   ++GPY+++L+ T L  Y     +  P++Y   +     G ++  EV+      TL 
Sbjct  186   DLDGSDGPYSMVLDSTGLTMY--INKTGTPLVYGGWTNRDWRGSATF-EVQPENDNSTLP  242

Query  395   LDYKV-------------------------AKSSKLGAHVLAQPKFNTTLTYLRLEIDGN  291
             + Y++                            +  G   L +  +N T ++LRL  DG 
Sbjct  243   VAYELILTPGPHPPTPSPTNEHGRRLLQVRPIGNGFGTVNLNKVNYNATTSFLRLGSDGT  302

Query  290   LKTYTFYSDAEENFHWGESFKLF  222
             LK YT++ D      W E+F  F
Sbjct  303   LKAYTYF-DNVRYLKWEETFSFF  324



>ref|XP_007021734.1| Curculin-like (mannose-binding) lectin family protein [Theobroma 
cacao]
 gb|EOY13259.1| Curculin-like (mannose-binding) lectin family protein [Theobroma 
cacao]
Length=459

 Score =   254 bits (649),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 146/335 (44%), Positives = 191/335 (57%), Gaps = 37/335 (11%)
 Frame = -1

Query  1133  MSSP-SSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV--DV  963
             M+SP SS     IFL +     T  A+VPA  TF+FVN+GE G  ++EY A YRV+  DV
Sbjct  1     MASPISSLFLHFIFLSLFALATTALAKVPANQTFRFVNQGEFGDRIIEYDASYRVIRNDV  60

Query  962   FSN---PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGN  792
             ++    PF+LCFYNTTP+A+  A+R G    E  MRWVW+ANR  PVR+ A     +DGN
Sbjct  61    YTFLAIPFRLCFYNTTPDAFIFAIRAGFPNDESLMRWVWDANRNDPVRENATLTFGEDGN  120

Query  791   LVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLR  612
              VLAD DGRV WQ+ TANKGV G KLL NGN+VL D  G FVWQSFD+PTDTLLVGQS++
Sbjct  121   FVLADADGRVVWQTNTANKGVTGIKLLTNGNLVLFDKNGKFVWQSFDYPTDTLLVGQSVK  180

Query  611   LSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLE  432
             ++G  KLV R S+   ++GPY++IL+  R GF     NS + ++Y            + +
Sbjct  181   INGRNKLVCRTSDMDGSDGPYSMILD--RNGFIMYLNNSGQLLIYGGWPIKDFGDIVTFD  238

Query  431   EVKFNAKTQTLKLDYKVAKSSKLGAH-------------------------VLAQPKFNT  327
              V  N      +L   V +++ L AH                          L +  +N 
Sbjct  239   AVPENDNATAYEL---VLRTTTLQAHQGGSLPGNGRRRLLQVRPIGGGGEKFLNKLNYNA  295

Query  326   TLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             T ++LRL  DGNL+ YT+Y D      W ESF  F
Sbjct  296   TSSFLRLGSDGNLRAYTYY-DPVSYLKWEESFAFF  329



>ref|NP_565191.1| curculin-like (mannose-binding) lectin-like protein [Arabidopsis 
thaliana]
 gb|AAL16208.1|AF428439_1 At1g78830/F9K20_12 [Arabidopsis thaliana]
 gb|AAC83028.1| Strong similarity to glycoprotein EP1 gb|L16983 Daucus carota 
and a member of S locus glycoprotein family PF|00954. ESTs 
gb|AA067487, gb|Z35737, gb|Z30815, gb|Z35350, gb|AA713171, gb|AI100553, 
gb|Z34248, gb|AA728536, gb|Z30816 and gb|Z35351 
come from this gene [Arabidopsis thaliana]
 gb|AAN12959.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36160.1| curculin-like (mannose-binding) lectin-like protein [Arabidopsis 
thaliana]
Length=455

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 192/321 (60%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   AQVP +  F+ VNEGE G Y+ EY A YR ++      F++PFQL
Sbjct  9     TLALAIATVSVV--IAQVPPEKQFRVVNEGEFGEYITEYDASYRFIESSNQSFFTSPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  67    LFYNTTPSAYILALRVGLRRDESTMRWIWDANRNNPVGENATLSLGRNGNLVLAEADGRV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGN+VLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFQILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S++  ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDSNGSDGPYSMVLDKKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  305   AYSYFP-AATYLKWEESFSFF  324



>gb|AAL38777.1| unknown protein [Arabidopsis thaliana]
Length=455

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 192/321 (60%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   AQVP +  F+ VNEGE G Y+ EY A YR ++      F++PFQL
Sbjct  9     TLALAIATVSVV--IAQVPPEKQFRVVNEGEFGEYITEYDASYRFIESSNQSFFTSPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  67    LFYNTTPSAYILALRVGLRRDESTMRWIWDANRNNPVGENATLSLGRNGNLVLAEADGRV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGN+VLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFQILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S++  ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDSNGSDGPYSMVLDKKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGILNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  305   AYSYFP-AATYLKWEESFSFF  324



>ref|XP_010429723.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=455

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 190/321 (59%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   AQVP    F+ VNEGE G Y+ EY A YR ++      F++PFQL
Sbjct  9     TLALAIATVSVVK--AQVPPAKQFRVVNEGEFGEYITEYDASYRFIESSNQSFFTSPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  67    LFYNTTPSAYVLALRVGLRRDESLMRWIWDANRNNPVGENATLSLGRNGNLVLAEADGRV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFRILPNGNMVLHDKNGKFVWQSFDHPTDTLLNGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDVDGSDGPYSMVLDTKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  305   AYSYFP-AATYLKWEESFSFF  324



>ref|XP_010417491.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=455

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 191/321 (60%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   AQVP +  F+FVN+GE G Y+ EY A YR ++      F++PFQL
Sbjct  9     TLALAIATVSVV--IAQVPPEKQFRFVNDGEFGEYITEYDASYRFIESSNQSFFTSPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  67    LFYNTTPSAYVLALRVGLRRDESLMRWIWDANRNSPVGENATLSLGRNGNLVLAEADGRV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLL GQSL+++   KLVSR
Sbjct  127   KWQTNTANKGVTGFRILPNGNMVLHDKNGKFVWQSFDHPTDTLLNGQSLKVNAVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDVDGSDGPYSMVLDTKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  305   AYSYFP-AATYLKWEESFSFF  324



>ref|XP_008367995.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=457

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 193/336 (57%), Gaps = 40/336 (12%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQI-LTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV--  963
             M++ +S S+  +F  ++I   +   AQVP   TFKF+N+GELG  +VEY A YRV+    
Sbjct  1     MATKTSLSAVFLFSFIAILFAIPIQAQVPTNQTFKFINQGELGGGIVEYHATYRVIQTNS  60

Query  962   ---FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGN  792
                +++PF LCFYNTTP++Y LA+R G  + E+R  WVW+ANR  PVR+ A   L ++GN
Sbjct  61    HTFYTHPFGLCFYNTTPDSYILAIRAGVPKDEVR--WVWDANRNHPVREKATLSLGREGN  118

Query  791   LVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLR  612
             LVL + DG V WQ+ TANKGV G KLL NGN+VLHD  G F+WQSFD+PTDTLL+GQS+ 
Sbjct  119   LVLGEADGTVVWQTNTANKGVTGIKLLGNGNLVLHDKNGRFIWQSFDYPTDTLLLGQSVT  178

Query  611   LSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLE  432
              +G  KLVSR S+T  ++GPY+I+L+ T  GF     ++ + ++Y     W      S  
Sbjct  179   TNGRNKLVSRKSDTDGSDGPYSIVLDHT--GFTMYLNDTGQRLIY---GGWTGTDYGSTV  233

Query  431   EVKFN---------AKTQTLKLDYKVAKSSKL---------------GAHVLAQPK--FN  330
                F+         A    L ++  +                      AH +   K  +N
Sbjct  234   TFDFDIMDGFDDGIAYELVLNVNQDINAPPPPPPQSHRHLLQVRPIGNAHQINLNKLNYN  293

Query  329   TTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
              T T+LRL  DGNLK YT+Y D   N  W ESF  F
Sbjct  294   ATYTFLRLGSDGNLKAYTYY-DKVRNMKWEESFAFF  328



>emb|CDP06010.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 192/328 (59%), Gaps = 31/328 (9%)
 Frame = -1

Query  1121  SSYSSTLIFLVVSIQILTCF-----AQVPAKNTFKFVNEGELGPYVVEYRADYRVV--DV  963
             SS+S +    + S+ IL  F     AQVPA  TFK +NEGE G Y+ EY A YRV+  D 
Sbjct  2     SSWSFSFSVCLSSLLILYFFTASTVAQVPANATFKIINEGEFGDYITEYDAGYRVISNDF  61

Query  962   FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVL  783
             F+ PF LCFYNTTP  + L +R G  R E  MRWVW+ANR  PV++ A     +DGNLVL
Sbjct  62    FAFPFSLCFYNTTPGEFILGMRAGIPRDEDLMRWVWDANRNHPVKENATLSFGRDGNLVL  121

Query  782   ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
             ADVDG VAWQ+ TANKGV G KLL NGN+VL+D KG F+WQSFDHP DTLLVG S++ +G
Sbjct  122   ADVDGTVAWQTNTANKGVTGIKLLPNGNLVLYDKKGKFIWQSFDHPVDTLLVGMSVKKNG  181

Query  602   PKKLVSRASETQNTNGPYTIILEPT----------RLGFYNQTKNSA--------RPILY  477
               +LVSR SE    +G Y+++L+ +          +L  YN  + SA         PI  
Sbjct  182   --RLVSRTSEADGRDGRYSLVLDNSGFSLYLNNSGQLVNYNGWQGSAYSSVRFNTTPIDE  239

Query  476   HDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAH---VLAQPKFNTTLTYLRL  306
                S  + +   + E+ K            ++ +S  +G+    +L +  +N TL++LRL
Sbjct  240   DPKSAGWELLLQTFEDSKSPPTPSPTPSGRRLLQSFPVGSANTVILRKVNYNATLSFLRL  299

Query  305   EIDGNLKTYTFYSDAEENFHWGESFKLF  222
             + DGN+K +T++ D      W E+F  F
Sbjct  300   QSDGNVKVFTYF-DKVPYLRWSETFAFF  326



>emb|CBI20194.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 156/233 (67%), Gaps = 9/233 (4%)
 Frame = -1

Query  896  MGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
            M T RSE   RWVWEANRGKPV + A      DGNLVLA  DGRVAWQ+ TANKGVVG +
Sbjct  1    MATTRSESLFRWVWEANRGKPVGENATLTFGTDGNLVLAHADGRVAWQTGTANKGVVGLR  60

Query  716  LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIIL  537
            LL  GN+VL+D+KG F+WQSFD+PTDTLLVGQSLR  G  KLVSRASE  N++G Y++++
Sbjct  61   LLPTGNLVLYDSKGKFIWQSFDYPTDTLLVGQSLRAGGVTKLVSRASEADNSDGKYSLVM  120

Query  536  EPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVA  378
            EP RL  Y +  NS +PILY  SS WF++ K SL  V       T       L LDY V+
Sbjct  121  EPKRLAMYYKATNSPKPILYATSSVWFTIDKGSLTNVTLTCSPDTDEGYAYNLILDYYVS  180

Query  377  KSSK-LGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             S    G  +L +PK+N+TLT LRL IDGN++ YT+Y D  +   W  ++ LF
Sbjct  181  NSQNPSGNRILVRPKYNSTLTILRLGIDGNIRLYTYY-DKVDWRAWEVTYTLF  232



>ref|XP_010472717.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=456

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 191/321 (60%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   A VP +  F+ VN+GE G Y+ EY A YR ++      F++PFQL
Sbjct  10    TLALAIATVSVV--IAHVPPEKQFRVVNDGEFGEYITEYDASYRFIESSNQSFFTSPFQL  67

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+G  R E  MRW+W+ANR  PV + A   L ++GNLVLA+ DGRV
Sbjct  68    LFYNTTPSAYVLALRVGLRRDESLMRWIWDANRNSPVGENATLSLGRNGNLVLAEADGRV  127

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  128   KWQTNTANKGVTGFRILPNGNMVLHDKNGKFVWQSFDHPTDTLLNGQSLKVNGVNKLVSR  187

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGKSSLEEVK  423
              S+   ++GPY+++L+   L  Y     +  P++Y     HD   +  F+V +      +
Sbjct  188   TSDVDGSDGPYSMVLDTKGLTMY--VNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLTE  245

Query  422   FNAKTQTLKLDYKVAKS--------------SKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              +A    L+   + A S              S  G   L +  +N T++YLRL  DG+LK
Sbjct  246   PSAYELLLEPAPQPATSSGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  305

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  306   AYSYFP-AATYLKWEESFSFF  325



>ref|XP_009334041.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=456

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 194/335 (58%), Gaps = 39/335 (12%)
 Frame = -1

Query  1133  MSSPSSYSSTLIFLVVSIQI-LTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV--  963
             M++ +S+S+  +F  ++I   +   AQVP   TFKF+N+GELG  +VEY A YRV+    
Sbjct  1     MATKTSHSAVFLFSFIAILFAIPIQAQVPTNQTFKFINQGELGGGIVEYHATYRVIQTNS  60

Query  962   ---FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGN  792
                +++PF LCFYNTTP++Y  A+R G  + E+R  WVW+ANR  PVR+ A     ++GN
Sbjct  61    HTFYTHPFGLCFYNTTPHSYIFAIRAGVPKDEVR--WVWDANRNHPVREKATLSFGREGN  118

Query  791   LVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLR  612
             LVL + DG V WQ+ TANKGV G KLL NGN+VLHD  G F+WQSFD+PTDTLL+GQS+ 
Sbjct  119   LVLGEADGTVVWQTNTANKGVTGIKLLGNGNLVLHDKNGRFIWQSFDYPTDTLLLGQSVT  178

Query  611   LSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLE  432
              +G  KLVSR S+   ++GPY+I+L+ T  GF     N+ + ++Y   S W      S  
Sbjct  179   TNGRNKLVSRKSDIDGSDGPYSIVLDHT--GFTMYLNNNGQRLIY---SGWTGTDYGSTV  233

Query  431   EVKF---NAKTQTLKLDYKVAKSSKLGA---------HVL-AQP------------KFNT  327
                F   N     +  +  +  +  + A         H+L  +P             +N 
Sbjct  234   TFDFDIMNGFDDGIAYELVLTVNQDINAPPPPPQSRRHLLQVRPIGNGQQINLNKLNYNA  293

Query  326   TLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             T T+LRL  DGNLK YT+Y D   N  W ESF  F
Sbjct  294   TYTFLRLGSDGNLKAYTYY-DKVRNMKWEESFAFF  327



>gb|KFK42261.1| hypothetical protein AALP_AA2G232300 [Arabis alpina]
Length=458

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 192/324 (59%), Gaps = 34/324 (10%)
 Frame = -1

Query  1100  IFLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             IFL ++  I T     +QVP +  FK +NE    PY+ EY A YR ++      F+ PFQ
Sbjct  6     IFLCLAFAISTVSVVISQVPPEKQFKVLNEPSYAPYITEYDASYRFIESENQSFFTRPFQ  65

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+GT R     RW+W+ANR  PV D + F L ++GNLVLA++DG+
Sbjct  66    LLFYNTTPSAYILALRVGTRRDMDFNRWIWDANRNNPVGDNSTFSLGRNGNLVLAELDGQ  125

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANKGV GF++L NGNMVLHD  GNF+WQSFDHPTDTLLVGQSL+L+G  KLVS
Sbjct  126   VKWQTNTANKGVTGFQILPNGNMVLHDKNGNFIWQSFDHPTDTLLVGQSLKLNGVNKLVS  185

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVG  447
             R S+   ++GPY+++L+   L  Y     +  P+ Y     HD         + ++ ++ 
Sbjct  186   RTSDMDGSDGPYSMVLDNKGLTMY--VNKTGTPLAYGGWPDHDFRGTVTFAVTREFDNLT  243

Query  446   KSSLEEVKFNAKTQTL---------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDG  294
             + S  E+      Q +         +L       S  G   L +  +N T++YLRL  DG
Sbjct  244   EPSAYELLLEPAPQPITTASPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDG  303

Query  293   NLKTYTFYSDAEENFHWGESFKLF  222
             +LK ++++ DA     W ESF  F
Sbjct  304   SLKAFSYFPDATY-LEWEESFAFF  326



>ref|XP_002283150.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Vitis vinifera]
Length=451

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 180/317 (57%), Gaps = 27/317 (9%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV--DV---FSNPFQLCF  936
             IF+++ +      A VPA  TFKFVN+GE G  ++EY A YRV+  DV   F+ PF+LCF
Sbjct  8     IFILLILFPFAALALVPANQTFKFVNQGEFGDRIIEYDASYRVIRNDVYTFFTFPFRLCF  67

Query  935   YNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAW  756
             YNTTP+ Y  A+R G    E  MRWVW+ANR  P  + +     +DGN VLA+ DGRV W
Sbjct  68    YNTTPDNYIFAIRAGVPGDESLMRWVWDANRNNPAHENSTLTFGRDGNFVLAEADGRVVW  127

Query  755   QSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRAS  576
             Q+ TANKGV G KLL NGN+VLHD  G F+WQSFD+PTDTLLVGQ LR+ G  KLVSR S
Sbjct  128   QTNTANKGVTGIKLLPNGNLVLHDKNGKFIWQSFDYPTDTLLVGQLLRIKGRNKLVSRVS  187

Query  575   ETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-------------------HDSSKWFS  453
             E   ++G Y+++ +   L  Y    NS + + Y                   +D++  F 
Sbjct  188   EMDGSDGKYSLVFDKKGLTMY--INNSGKLLQYGGWPGDDFGNIVSFEAIPENDNATAFE  245

Query  452   VGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTF  273
             +  S+ EE          +   +V   S  G   L +  +N T ++LRL  DGNL+ YT+
Sbjct  246   LVLSAYEETTPTPPPPGRRRLLQVRPISSGGQRNLNKLNYNATYSFLRLSHDGNLRAYTY  305

Query  272   YSDAEENFHWGESFKLF  222
             Y D      W E+F  F
Sbjct  306   Y-DQVSYLKWDETFAFF  321



>ref|XP_002889215.1| hypothetical protein ARALYDRAFT_477046 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65474.1| hypothetical protein ARALYDRAFT_477046 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 190/321 (59%), Gaps = 31/321 (10%)
 Frame = -1

Query  1106  TLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
             TL   + ++ ++   AQVP +  F+ VN+GE G Y+ EY A YR ++      F++PFQL
Sbjct  9     TLALAIATVSVV--IAQVPPEKQFRVVNDGEFGQYITEYDASYRFIESSNQSFFTSPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY L LR+G  R E  MRW+W+ANR  PV + +   L ++GNLVLA+ DGRV
Sbjct  67    LFYNTTPSAYILGLRVGLRRDESTMRWIWDANRNNPVGENSTLSLGRNGNLVLAEADGRV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLL GQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFRILPNGNMVLHDKNGKFVWQSFDHPTDTLLNGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDLNGSDGPYSMVLDNKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              Y+++  A     W ESF  F
Sbjct  305   AYSYFPPATY-LKWEESFSFF  324



>ref|XP_007211490.1| hypothetical protein PRUPE_ppa007720mg [Prunus persica]
 gb|EMJ12689.1| hypothetical protein PRUPE_ppa007720mg [Prunus persica]
Length=358

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 159/232 (69%), Gaps = 11/232 (5%)
 Frame = -1

Query  896  MGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
            MG  RSE   RWVWEANRG PV + A      DGNLVLA+ DGRVAWQ+ TANKGVVGFK
Sbjct  1    MGLRRSESLFRWVWEANRGNPVGENATLTFGTDGNLVLAEADGRVAWQTNTANKGVVGFK  60

Query  716  LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIIL  537
            LL  GNMVL+D+KGNFVWQSFDHPTDTLLV QSL+     KLVSRASET+N +G Y++++
Sbjct  61   LLPTGNMVLYDSKGNFVWQSFDHPTDTLLVDQSLKAGAVNKLVSRASETENKDGAYSLVM  120

Query  536  EPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVA  378
            EP  +  Y ++KNS +P+LY   S+  ++ K SL+         T       + L+Y+ A
Sbjct  121  EPKGIFLYYKSKNSPKPLLY---SQVITIDKGSLDHATLKCTPDTDEGYAYDITLNYEAA  177

Query  377  KSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             SS  G  +LA+PK+N+TLT+LRL IDGN+K YT Y+D  +   W  +F LF
Sbjct  178  NSSSGGNRILARPKYNSTLTFLRLGIDGNVKLYT-YNDKVDWGAWEVTFTLF  228



>ref|XP_008386253.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Malus domestica]
Length=455

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 196/333 (59%), Gaps = 34/333 (10%)
 Frame = -1

Query  1133  MSSPSSYSSTLIF--LVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-  963
             M+S +S+S+ L+   L+  +  +   AQVPA  TFKF+N+G+LG   +EY A YRV+   
Sbjct  1     MASKTSHSAVLLLFSLIAFLFAIPIQAQVPANLTFKFINQGKLGDGNIEYHATYRVIQTN  60

Query  962   ----FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDG  795
                 ++NPF LCFYNTTP++Y  A+R G    E+R  WVW+ANR  PV + A     ++G
Sbjct  61    SHTFYTNPFGLCFYNTTPDSYIFAIRAGVPNDEVR--WVWDANRNHPVHEKATLSFGKEG  118

Query  794   NLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSL  615
             NLVL + DG V WQ+ TANKGV G KLLQNGN+VLHD  G F+WQSFD+PTDTLLVGQS+
Sbjct  119   NLVLGEADGTVVWQTNTANKGVTGIKLLQNGNLVLHDKNGRFIWQSFDYPTDTLLVGQSI  178

Query  614   RLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-------HDSSKWF  456
             R +G  KLVSR S+T +++G Y+++L+ T  G Y    N+ + ++Y       + S+  F
Sbjct  179   RTNGRNKLVSRKSDTDSSDGSYSMVLDKTGFGMY--LNNAGQRLIYGGWTGTDYGSTVTF  236

Query  455   SVGKSS------LEEVKFNAKT---------QTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
                 ++        E+ FN            Q+ +   +V          L +  +N T 
Sbjct  237   DCQTTNGFEDAIAYELVFNVNQDINAPPPPPQSKRRLLQVRPVGSATQINLNKLNYNATY  296

Query  320   TYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             ++LRL  DGNLK YT+Y     + +W ESF  F
Sbjct  297   SFLRLGSDGNLKAYTYYXKV-NSMNWEESFAFF  328



>ref|XP_002532023.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative 
[Ricinus communis]
 gb|EEF30362.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative 
[Ricinus communis]
Length=257

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 159/254 (63%), Gaps = 6/254 (2%)
 Frame = -1

Query  1103  LIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTT  924
             L+FL   I +    A VP   TF++VN    G Y  EY A YR   + + PF+LCFYNTT
Sbjct  7     LLFLFTVI-VFQAQALVPKDKTFEYVNNDVFGHYPQEYDASYRFTGLLNRPFKLCFYNTT  65

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
              NA+TLAL +GT +    M WVWEANRG PV + A      DGNLVL   DGR+AWQ+ T
Sbjct  66    SNAFTLALGLGTQKEATPMNWVWEANRGNPVGENAKLTFETDGNLVLTHSDGRIAWQTNT  125

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
              N+GVVG ++L NGNMVL+D KG F+WQSFD+PTDTLLVGQSLRL    KLVSRAS+ +N
Sbjct  126   VNRGVVGLEILPNGNMVLYDKKGKFIWQSFDYPTDTLLVGQSLRLGATTKLVSRASQKEN  185

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGK--SSLEEVKFNAKTQTLKLD  390
              NGPY+++++   L  Y ++ NS  P  Y   S W +V +    L+ V   +    L L 
Sbjct  186   VNGPYSLVMDAKTLALYYKSPNSPIPFQYFSFSFWATVMEVDGPLQSVTLESN---LTLS  242

Query  389   YKVAKSSKLGAHVL  348
             ++ A SS   + +L
Sbjct  243   FQGAHSSSRESAIL  256



>ref|XP_010429721.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=455

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 189/322 (59%), Gaps = 32/322 (10%)
 Frame = -1

Query  1100  IFLVVSIQI---LTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV-----DVFSNPFQ  945
             I L+ ++ I   L   AQVP +  F+ +NE    PY+ EY A YR +       F+NPFQ
Sbjct  6     ILLITALAISSVLVVMAQVPPEKQFRVLNEPAYAPYITEYDASYRFLASPNQSFFTNPFQ  65

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+GT R     RW+W+ANR  PV D +   L +DGNLVLA+++G+
Sbjct  66    LMFYNTTPSAYVLALRVGTRRDLSFTRWIWDANRNNPVGDNSTLSLGRDGNLVLAELNGQ  125

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANKGV GF++L NGNMVLHD  G F+WQSFDHPTDTLLVGQSL+++G  KLVS
Sbjct  126   VKWQTNTANKGVTGFRILPNGNMVLHDKNGKFIWQSFDHPTDTLLVGQSLKVNGVNKLVS  185

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGKSSLEEV  426
             R S    ++GPY+++L+   L  Y     +  P++Y     HD   +  F+V +      
Sbjct  186   RTSAANGSDGPYSMVLDTKGLTMY--VNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLT  243

Query  425   KFNAKTQTLKLDYKVAKS--------------SKLGAHVLAQPKFNTTLTYLRLEIDGNL  288
             + +A    L+   + A S              S  G   L +  +N T++YLRL  DG+L
Sbjct  244   EPSAYELLLEPAPQPATSSGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGYDGSL  303

Query  287   KTYTFYSDAEENFHWGESFKLF  222
             K ++++  A     W ESF  F
Sbjct  304   KAFSYFP-AATYLEWEESFAFF  324



>ref|XP_009339971.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Pyrus x bretschneideri]
Length=455

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 190/327 (58%), Gaps = 43/327 (13%)
 Frame = -1

Query  1103  LIFLVVSIQI-LTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-----FSNPFQL  942
             L+F +++ Q  +   AQVPA  TFKF+N+G+LG   +EY A YRV+       ++NPF L
Sbjct  12    LLFFLIAFQFAIPIQAQVPANQTFKFINQGKLGDGNIEYHATYRVIQTNSHTFYTNPFGL  71

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
             CFYNTTP++Y  A+R G    E+R  WVW+ANR  PV + A     ++GNLVL + DG V
Sbjct  72    CFYNTTPDSYIFAIRAGVPNDEVR--WVWDANRNHPVHEKATLSFGKEGNLVLGEADGTV  129

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV G KLL+NGN+VLHD  G F+WQSFD+PTDTLLVGQS+R +G  KLVSR
Sbjct  130   VWQTNTANKGVTGIKLLENGNLVLHDKNGRFIWQSFDYPTDTLLVGQSIRTNGRNKLVSR  189

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT  402
              S+T +++G Y+++L+ T  GF     N+ + ++Y     W   G      V F+ +T  
Sbjct  190   KSDTDSSDGSYSMVLDKT--GFAMYLNNAGQRLIY---GGW--TGTDYGSTVTFDCQTTN  242

Query  401   LKLDY------------------------KVAKSSKLGAHV---LAQPKFNTTLTYLRLE  303
                D                         ++ +   +G+     L +  +N T ++LRL 
Sbjct  243   GFEDAIAYELVFNVNQDISAPPPPPQSKRRLLQVRPIGSATQINLNKLNYNATYSFLRLG  302

Query  302   IDGNLKTYTFYSDAEENFHWGESFKLF  222
              DGNLK YT+Y D   + +W ESF  F
Sbjct  303   SDGNLKAYTYY-DKVNSMNWEESFAFF  328



>emb|CDX87431.1| BnaA07g34420D [Brassica napus]
Length=454

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 194/325 (60%), Gaps = 34/325 (10%)
 Frame = -1

Query  1103  LIFLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVV-----DVFSNPF  948
             L F+VV++ I T     AQVP    F+ VN  E G Y+ EY A YR +       F+ PF
Sbjct  2     LRFIVVALAIATVSVVTAQVPPAKQFRVVNNDEFGDYITEYDASYRFITSPNASFFTRPF  61

Query  947   QLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDG  768
             QL FYNTTP+AY LALR+G    E  MRW+W+ANR  PV + A   L ++GNLVLA+ +G
Sbjct  62    QLLFYNTTPSAYVLALRVGLRSEESLMRWIWDANRNNPVGENATLSLGRNGNLVLAESNG  121

Query  767   RVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLV  588
             +V WQ+ TANKGV GF++L NGN+VLHD  G FVWQSFDHPTDTLL GQSL+++G  KLV
Sbjct  122   QVKWQTNTANKGVTGFEILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGANKLV  181

Query  587   SRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGK-----  444
             SR S+   +NGPY+++L+   L  Y     + +P++Y     HD   +  F+V +     
Sbjct  182   SRKSDMDGSNGPYSMVLDNKGLTMY--VNKTGQPLVYGGWPNHDFRGTVTFAVRREFDNL  239

Query  443   ---SSLEEVKFNAKTQTLKL----DYKVAKSSKLGAHV----LAQPKFNTTLTYLRLEID  297
                S+ E +   A  QT       + ++ +S  +G+      L +  +N T++YLRL  D
Sbjct  240   TEPSAYELLLEPAPQQTTTTNPGNNRRLLQSRPIGSGDGTLNLNKINYNGTISYLRLGSD  299

Query  296   GNLKTYTFYSDAEENFHWGESFKLF  222
             G+LK ++++ D      W ESF  F
Sbjct  300   GSLKAFSWF-DPATYLTWEESFSFF  323



>gb|AFP82244.1| mannose-binding protein 2 [Malus domestica]
Length=455

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 194/333 (58%), Gaps = 34/333 (10%)
 Frame = -1

Query  1133  MSSPSSYSSTLIF--LVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-  963
             M+S +S+S+ L+   L+  +  +   AQVPA  TFKF+N+G+LG   +EY A YRV+   
Sbjct  1     MASKTSHSAVLLLFSLIAFLFAIPIQAQVPANLTFKFINQGKLGDGNIEYHATYRVIQTN  60

Query  962   ----FSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDG  795
                 ++NPF LCFYNTTP++Y  A+R G    E+R  WVW+ANR  PV + A     ++G
Sbjct  61    SHTFYTNPFGLCFYNTTPDSYIFAIRAGVPNDEVR--WVWDANRNHPVHEKATLSFGKEG  118

Query  794   NLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSL  615
              LVL + DG V WQ+ TANKGV G KLLQNGN+VLHD  G F+WQSFD+PTDTLLVGQS+
Sbjct  119   KLVLGEADGTVVWQTNTANKGVTGIKLLQNGNLVLHDKNGRFIWQSFDYPTDTLLVGQSI  178

Query  614   RLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-------HDSSKWF  456
             R +G  KLVSR S+T +++G Y+++L+ T  G Y    N+ + ++Y       + S+  F
Sbjct  179   RTNGRNKLVSRKSDTDSSDGSYSMVLDKTGFGMY--LNNAGQRLIYGGWTGTDYGSTVTF  236

Query  455   SVGKSS------LEEVKFNAKT---------QTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
                 ++        E+ FN            Q+ +   +V          L +  +N T 
Sbjct  237   DCQTTNGFEDAIAYELVFNVNQDINAPPPPPQSKRRLLQVRPVGSATQINLNKLNYNATY  296

Query  320   TYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             ++LRL  DGNLK YT+Y     + +W ES   F
Sbjct  297   SFLRLGSDGNLKAYTYYEKV-NSMNWEESLAFF  328



>emb|CDX88481.1| BnaC06g39250D [Brassica napus]
Length=454

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 191/325 (59%), Gaps = 34/325 (10%)
 Frame = -1

Query  1103  LIFLVVSIQILT---CFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPF  948
             L FL+V++ I T     AQVP +  FK VN  E G Y+ EY A YR +       F+ PF
Sbjct  2     LRFLIVALAIATVSVATAQVPPEKQFKVVNNDEFGDYITEYDASYRFISSPNASFFTRPF  61

Query  947   QLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDG  768
             QL FYNTTP+AY LALR+G    E  MRW+W+ANR  PV + A   L ++GNLVLA+ +G
Sbjct  62    QLLFYNTTPSAYVLALRVGLRSEESLMRWIWDANRNNPVGENATLSLGRNGNLVLAESNG  121

Query  767   RVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLV  588
             +V WQ+ TANKGV GF++L NGN+VLHD  G FVWQSFDHPTDTLL GQSL+++G  KLV
Sbjct  122   QVKWQTNTANKGVTGFEILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGANKLV  181

Query  587   SRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGKSS---  438
             SR S+   ++GPY+++L+   L  Y     + +P++Y     HD   +  F+V +     
Sbjct  182   SRKSDMDGSDGPYSMVLDNKGLTMY--VNKTGQPLVYGGWPNHDFRGTVTFAVRREFDNL  239

Query  437   ---------LEEVKFNAKTQTLKLDYKVAKSSKLGAHV----LAQPKFNTTLTYLRLEID  297
                      LE       T     + ++ +S  +G+      L +  +N T++YLRL  D
Sbjct  240   TEPSAYELLLEPAPQPTTTTNPGNNRRLLQSRPIGSGDGTLNLNKINYNGTISYLRLGSD  299

Query  296   GNLKTYTFYSDAEENFHWGESFKLF  222
             G+LK ++++ D      W ESF  F
Sbjct  300   GSLKAFSWF-DPATYLTWEESFSFF  323



>ref|XP_010417490.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=455

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 188/322 (58%), Gaps = 32/322 (10%)
 Frame = -1

Query  1100  IFLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             I L+ ++ I +     AQVP +  F+ +NE    PY+ EY A YR +D      F+ PFQ
Sbjct  6     ILLITALAISSVSVVMAQVPPEKQFRVLNEPAYAPYITEYDASYRFLDSPNQSFFTFPFQ  65

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+GT R     RW+W+ANR  PV D +   L +DGNLVLA+++G+
Sbjct  66    LMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSLGRDGNLVLAELNGQ  125

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLLVGQSL+++G  KLVS
Sbjct  126   VKWQTNTANKGVTGFRILPNGNMVLHDKNGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVS  185

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVG  447
             R S    ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ 
Sbjct  186   RTSAANGSDGPYSMVLDNKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLT  243

Query  446   KSSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNL  288
             + S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+L
Sbjct  244   EPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGYDGSL  303

Query  287   KTYTFYSDAEENFHWGESFKLF  222
             K ++++  A     W ESF  F
Sbjct  304   KAFSYFP-AATYLEWEESFAFF  324



>emb|CDY57939.1| BnaA07g38390D [Brassica napus]
Length=452

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 191/319 (60%), Gaps = 31/319 (10%)
 Frame = -1

Query  1100  IFLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             I L  ++ I T     AQVP +  F+ +NE    PY+ EY A YR +       F+ PFQ
Sbjct  7     ILLATALAIATVSVVIAQVPPEKQFRVLNEPSYAPYITEYDAGYRFLSSENQSFFTLPFQ  66

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+G+ R     RW+W+ANR  PV D +   L +DGNLVLA++DG+
Sbjct  67    LMFYNTTPSAYVLALRVGSRRDLDYTRWIWDANRNNPVGDNSTLSLGRDGNLVLAELDGQ  126

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             + WQ+ TANKGV GFK+L NGNMVLHD    F+WQSFDHPTDTLLVGQSL+L+G  KLVS
Sbjct  127   IKWQTNTANKGVTGFKILPNGNMVLHDKNDKFIWQSFDHPTDTLLVGQSLKLNGVNKLVS  186

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-------HDSSKWFSVGK------  444
             R S+   ++GPY+++L    L  Y     + +P+ Y       +  +  F+V +      
Sbjct  187   RTSDMDGSDGPYSMVLGNKGLTMY--VNKTGQPLAYGGWPSQDYRGTVTFTVRREFDNLT  244

Query  443   --SSLEEVKFNAKTQTLK---LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTY  279
               S+ E +   A  QT      + ++ +S  LG  +L++  +N T++YLRL  DG+LK +
Sbjct  245   EPSAYELLLEPAPQQTTTNPGNNRRLLQSRPLG--ILSKVNYNCTISYLRLGSDGSLKAF  302

Query  278   TFYSDAEENFHWGESFKLF  222
             +++  A     W E+F  F
Sbjct  303   SYFP-AATYLEWEETFAFF  320



>ref|XP_010472716.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=455

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 188/322 (58%), Gaps = 32/322 (10%)
 Frame = -1

Query  1100  IFLVVSIQI---LTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             I L+ ++ I   L   AQVP +  F+ +NE    PY+ EY A YR +D      F+ PFQ
Sbjct  6     ILLITALAISSVLVVMAQVPPEKQFRVLNEPAYAPYITEYDASYRFLDSPNQSFFTFPFQ  65

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+GT R     RW+W+ANR  PV D +   L +DGNLVLA+++G+
Sbjct  66    LMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSLGRDGNLVLAELNGQ  125

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V W + TANKGV GF++L +GNMVLHD  G FVWQSFDHPTDTLLVGQSL+++G  KLVS
Sbjct  126   VKWHTNTANKGVTGFQILPSGNMVLHDKNGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVS  185

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVG  447
             R S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ 
Sbjct  186   RTSDVDGSDGPYSMVLDTKGLTMY--VNKTGTPLVYGGWPDHDFRGTVTFAVTREFDNLT  243

Query  446   KSSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNL  288
             + S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+L
Sbjct  244   EPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGYDGSL  303

Query  287   KTYTFYSDAEENFHWGESFKLF  222
             K ++++  A     W ESF  F
Sbjct  304   KAFSYFP-AATYLEWEESFAFF  324



>ref|XP_010498030.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=454

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 193/329 (59%), Gaps = 33/329 (10%)
 Frame = -1

Query  1127  SPSSYSSTLIFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV------D  966
             SP ++  TL+ +  +  I+   AQVP+  TFK +N+GE G Y+ EY A+YR++      +
Sbjct  2     SPLNFFLTLLLMSTTRTIV---AQVPSNKTFKIINQGEFGDYITEYNANYRIIHTESQSN  58

Query  965   VFSN-PFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNL  789
             +FS+ PFQL FYNTTPNAY LA+R G  + E  MRWVW+ANR  PV + +   L +DGNL
Sbjct  59    IFSSGPFQLFFYNTTPNAYILAIRAGHPKDESLMRWVWDANRNNPVGEKSTLSLNRDGNL  118

Query  788   VLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRL  609
             VLA+ +GRV WQ+ T NKGV G +L+ NGN+VLHD  G FVWQSFDHPTDTLL GQSL+ 
Sbjct  119   VLAESNGRVKWQTNTVNKGVTGLRLIPNGNLVLHDKNGGFVWQSFDHPTDTLLTGQSLKT  178

Query  608   SGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-------HDSSKWFSV  450
                 KLVSR S+T  ++GPYT++L+   L  Y     + + + Y        + S  F V
Sbjct  179   VRVNKLVSRKSDTDGSDGPYTMVLDNKGLTMY--VNKTGKSLAYGGWTERDFNGSVTFDV  236

Query  449   GKSSLEEVKFNAKTQTLKLD----------YKVAKSSKLGAHV---LAQPKFNTTLTYLR  309
              +        +A    LKL            ++ +  K+G  V   L +  ++ T ++LR
Sbjct  237   TREIDNVTVPSAYEIVLKLGSADENPGNKRRRLLQVRKIGNAVTIILNKINYDGTTSFLR  296

Query  308   LEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             L  DG+LK +T++  A     W E+F  F
Sbjct  297   LGSDGSLKAFTYFERATY-LKWEETFAFF  324



>ref|XP_009106596.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Brassica rapa]
Length=454

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 191/325 (59%), Gaps = 34/325 (10%)
 Frame = -1

Query  1103  LIFLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVV-----DVFSNPF  948
             L FL+V++ I T     AQVP +  F+ VN  E G Y+ EY A YR +       F+ PF
Sbjct  2     LRFLIVALAIATVSVVTAQVPPEKQFRVVNNDEFGDYITEYDASYRFITSPNASFFTRPF  61

Query  947   QLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDG  768
             QL FYNTTP+AY LALR+G    E  MRW+W+ANR  PV + A   L ++GNLVLA+ +G
Sbjct  62    QLLFYNTTPSAYVLALRVGLRSEESLMRWIWDANRNNPVGENATLSLGRNGNLVLAESNG  121

Query  767   RVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLV  588
             +V WQ+ TANKGV GF++L NGN+VLHD  G FVWQSFDHPTDTLL GQSL+++G  KLV
Sbjct  122   QVKWQTNTANKGVTGFEILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGVNKLV  181

Query  587   SRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD--SSKWFSVGKSS---  438
             SR S+   ++GPY+++L+   L  Y     + +P++Y     HD   +  F+V +     
Sbjct  182   SRKSDMDGSDGPYSMVLDNKGLTMY--VNKTGQPLVYGGWPNHDFRGTVTFAVRREFDNL  239

Query  437   ---------LEEVKFNAKTQTLKLDYKVAKSSKLGAHV----LAQPKFNTTLTYLRLEID  297
                      LE       T     + ++ +S  +G+      L +  +N T++YLRL  D
Sbjct  240   TEPSAYELLLEPAPQPTTTTNPGNNRRLLQSRPIGSGDGTLNLNKINYNGTISYLRLGSD  299

Query  296   GNLKTYTFYSDAEENFHWGESFKLF  222
             G+LK ++++ D      W ESF  F
Sbjct  300   GSLKAFSWF-DPATYLTWEESFSFF  323



>ref|XP_002889214.1| hypothetical protein ARALYDRAFT_895783 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65473.1| hypothetical protein ARALYDRAFT_895783 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 188/322 (58%), Gaps = 33/322 (10%)
 Frame = -1

Query  1097  FLVVSIQILT----CFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             FLV++   ++      AQVP +  F+ +NE    PY+ EY A YR +D      F+ PFQ
Sbjct  6     FLVITALAISTVSVVMAQVPPEKQFRVLNEPSYAPYITEYDASYRFLDSPNQDFFTFPFQ  65

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+G+ R     RW+W+ANR  PV D +   L ++GNLVLA+++G 
Sbjct  66    LMFYNTTPSAYVLALRVGSRRDMSFTRWIWDANRNNPVGDNSTLSLGRNGNLVLAELNGH  125

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLLVGQSL+++G  KLVS
Sbjct  126   VKWQTNTANKGVTGFEILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVS  185

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVG  447
             R S    ++GPY+++LE   L  Y     + +P++Y     HD         + ++ ++ 
Sbjct  186   RTSAMNGSDGPYSMVLENKGLTMY--VNRTGKPLVYGGWPDHDFRGTVTFAVTREFDNLT  243

Query  446   KSSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNL  288
             + S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+L
Sbjct  244   EPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSL  303

Query  287   KTYTFYSDAEENFHWGESFKLF  222
             K Y+++  A     W ESF  F
Sbjct  304   KAYSYFPVATY-LEWEESFSFF  324



>ref|XP_006300474.1| hypothetical protein CARUB_v10020275mg [Capsella rubella]
 gb|EOA33372.1| hypothetical protein CARUB_v10020275mg [Capsella rubella]
Length=455

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 191/322 (59%), Gaps = 32/322 (10%)
 Frame = -1

Query  1100  IFLVVSIQILTCF---AQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             I L+ ++ I + F   AQVP +  F+ +NE    PY++EY A YR ++      F+ PFQ
Sbjct  6     ILLITALAISSVFVVMAQVPPEKQFRVLNEPSYAPYIMEYDASYRFLESPNQSFFTFPFQ  65

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+G+ R     RW+W+ANR  PV D +     ++GNLVLA+++G+
Sbjct  66    LMFYNTTPSAYVLALRVGSRRDMDFPRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQ  125

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             V WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLLVGQSL+++G  KLVS
Sbjct  126   VKWQTNTANKGVTGFEILPNGNMVLHDKNGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVS  185

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVG  447
             R S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ +V 
Sbjct  186   RTSDMNGSDGPYSMVLDNKGLTMY--VNKTGTPLVYGGWTDHDFRGTVTFAITREFDNVT  243

Query  446   KSSLEEVKFNAKTQTLKLDYKVAK-------SSKLGAHVLAQPKFNTTLTYLRLEIDGNL  288
             + S  E+      QT     K  +        S  G   L +  +N T+++LRL  DG+L
Sbjct  244   EPSAYELLLEPAPQTATNQGKNRRLLQVRPIGSGGGTINLNKINYNGTISFLRLGSDGSL  303

Query  287   KTYTFYSDAEENFHWGESFKLF  222
             K ++++  A     W ESF  F
Sbjct  304   KAFSYFP-AATYLEWEESFAFF  324



>ref|XP_009104566.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Brassica rapa]
Length=452

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 188/319 (59%), Gaps = 31/319 (10%)
 Frame = -1

Query  1100  IFLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQ  945
             I L  ++ I T     AQVP +  F+ +NE    PY+ EY A YR +       F+ PFQ
Sbjct  7     ILLATALAIATVSVVIAQVPPEKQFRVLNEPSYAPYITEYDAGYRFLSSENQSFFTLPFQ  66

Query  944   LCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             L FYNTTP+AY LALR+G+ R     RW+W+ANR  PV D +   L +DGNLVLA++DG+
Sbjct  67    LMFYNTTPSAYVLALRVGSRRDLDYTRWIWDANRNNPVGDNSTLSLGRDGNLVLAELDGQ  126

Query  764   VAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             + WQ+ TANKGV GFK+L NGNMVLHD    F+WQSFD+PTDTLLVGQSL+L+G  KLVS
Sbjct  127   IKWQTNTANKGVTGFKILPNGNMVLHDKNDKFIWQSFDYPTDTLLVGQSLKLNGVNKLVS  186

Query  584   RASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-------HDSSKWFSVGKS-----  441
             R S+   ++GPY+++L    L  Y     + +P+ Y       +  +  F+V +      
Sbjct  187   RTSDVDGSDGPYSMVLGNKGLTMY--VNKTGQPLAYGGWPSQDYRGTVTFTVRREFDNLT  244

Query  440   --SLEEVKFNAKTQTLKL----DYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTY  279
               S  E+      Q        + ++ +S  LG  +L++  +N T++YLRL  DG+LK +
Sbjct  245   EPSAYELLLEPAPQPTTTNPGNNRRLLQSRPLG--ILSKVNYNCTISYLRLGSDGSLKAF  302

Query  278   TFYSDAEENFHWGESFKLF  222
             +++  A     W E+F  F
Sbjct  303   SYFP-AATYLEWEETFAFF  320



>ref|XP_010459247.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
isoform X1 [Camelina sativa]
Length=361

 Score =   233 bits (595),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 181/307 (59%), Gaps = 30/307 (10%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVV------DVFSN-PFQLCFYNTTPNAYTLA  903
             AQVP+  TFK +N+ E G Y+ EY A+YR++      ++FS+ PFQL FYN+TPNAY LA
Sbjct  21    AQVPSNKTFKIINQDEFGDYITEYNANYRIIQTESQTNIFSSGPFQLFFYNSTPNAYILA  80

Query  902   LRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVG  723
             +R G  + E  MRWVW+ANR  PV + +   L +DGNLVLA+ +GRV WQ+ T NKGV G
Sbjct  81    IRAGHPKDESLMRWVWDANRNNPVGEKSTLSLNRDGNLVLAESNGRVKWQTNTVNKGVTG  140

Query  722   FKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTI  543
              +L+ NGN+VLHD  G FVWQSFDHPTDTLL GQSL+     KLVSR S+T  ++GPYT+
Sbjct  141   LRLMPNGNLVLHDKNGGFVWQSFDHPTDTLLTGQSLKTVRVNKLVSRKSDTDGSDGPYTM  200

Query  542   ILEPTRLGFYNQTKNSARPILY-------HDSSKWFSVGKSSLEEVKFNAKTQTLKLD--  390
             +L+   L  Y     + + + Y        + S  F V +        +A    LKL   
Sbjct  201   VLDNKGLTMY--VNKTGKSLAYGGWTERDFNGSVTFDVTREIDNVTVPSAYELVLKLGSA  258

Query  389   --------YKVAKSSKLGAHV---LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHW  243
                      ++ +  K+G  V   L +  ++ T ++LRL  DG+LK +T++  A     W
Sbjct  259   DANPGNKRRRLLQLRKIGNAVTIILNKINYDGTTSFLRLGSDGSLKAFTYFERATY-LKW  317

Query  242   GESFKLF  222
              E+F  F
Sbjct  318   EETFAFF  324



>ref|XP_010459248.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
isoform X2 [Camelina sativa]
Length=361

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 181/307 (59%), Gaps = 30/307 (10%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVV------DVFSN-PFQLCFYNTTPNAYTLA  903
             AQVP+  TFK +N+ E G Y+ EY A+YR++      ++FS+ PFQL FYN+TPNAY LA
Sbjct  21    AQVPSNKTFKIINQDEFGDYITEYNANYRIIQTESQTNIFSSGPFQLFFYNSTPNAYILA  80

Query  902   LRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVG  723
             +R G  + E  MRWVW+ANR  PV + +   L +DGNLVLA+ +GRV WQ+ T NKGV G
Sbjct  81    IRAGHPKDESLMRWVWDANRNNPVGEKSTLSLNRDGNLVLAESNGRVKWQTNTVNKGVTG  140

Query  722   FKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTI  543
              +L+ NGN+VLHD  G FVWQSFDHPTDTLL GQSL+     KLVSR S+T  ++GPYT+
Sbjct  141   LRLMPNGNLVLHDKNGGFVWQSFDHPTDTLLTGQSLKTVRVNKLVSRKSDTDGSDGPYTM  200

Query  542   ILEPTRLGFYNQTKNSARPILY-------HDSSKWFSVGKSSLEEVKFNAKTQTLKLD--  390
             +L+   L  Y     + + + Y        + S  F V +        +A    LKL   
Sbjct  201   VLDNKGLTMY--VNKTGQSLAYGGWTERDFNGSVTFDVTREIDNVTVPSAYELVLKLGSA  258

Query  389   --------YKVAKSSKLGAHV---LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHW  243
                      ++ +  K+G  V   L +  ++ T ++LRL  DG+LK +T++  A     W
Sbjct  259   DANPGNKRRRLLQLRKIGNAVTIILNKINYDGTTSFLRLGSDGSLKAFTYFERATY-LKW  317

Query  242   GESFKLF  222
              E+F  F
Sbjct  318   EETFAFF  324



>ref|XP_010531929.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Tarenaya hassleriana]
Length=425

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 174/278 (63%), Gaps = 22/278 (8%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYV-VEYRADYRVVDVFSNPFQLCFYNTT  924
             + + +SI  L   A+VP  + F+ VN+G    Y  +EY    R    F++ F+L FYNTT
Sbjct  11    LCITLSILFLGSQAKVPLSDQFRVVNQGGFLDYSPIEYDPTVRGFVPFNDNFRLSFYNTT  70

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSET  744
             PNAYTLALR+G    E  +RWVWEANRG PVR+ A     +DGNLVLAD DGRV WQ+ T
Sbjct  71    PNAYTLALRIGNRAQESTLRWVWEANRGNPVRENATLTFGEDGNLVLADADGRVVWQTNT  130

Query  743   ANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQN  564
             ANKGVVG K+L+NGNMVL+D+KG FVWQSFD PTDTLLVGQSL+++G  +LVSR SE+ N
Sbjct  131   ANKGVVGIKVLENGNMVLYDSKGVFVWQSFDSPTDTLLVGQSLKVNGRNRLVSRLSESVN  190

Query  563   TNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTL  399
              +               + T  + +PI Y++   +F+  K+  E + F+       T  +
Sbjct  191   VD---------------DTTNKTQKPIAYYEYD-FFTKIKTRFESMTFDVVEDSDTTYGM  234

Query  398   KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
                 +V  S    +  LA+PK N TL+++RLE DGN++
Sbjct  235   SFVGEVQGSQFNVSAFLARPKHNATLSFIRLESDGNVR  272



>ref|NP_178003.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding 
domain [Arabidopsis thaliana]
 gb|AAC83044.1| Strong similarity to glycoprotein EP1 gb|L16983 Daucus carota 
and a member of S locus glycoprotein family PF|00954 [Arabidopsis 
thaliana]
 gb|AAK59621.1| putative glycoprotein EP1 [Arabidopsis thaliana]
 gb|AAL07195.1| putative glycoprotein EP1 [Arabidopsis thaliana]
 gb|AAL32786.1| Strong similarity to glycoprotein EP1 [comment= [Arabidopsis 
thaliana]
 gb|AAM13366.1| strong similarity to glycoprotein EP1 [Arabidopsis thaliana]
 gb|AEE36159.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding 
domain [Arabidopsis thaliana]
Length=455

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 187/321 (58%), Gaps = 32/321 (10%)
 Frame = -1

Query  1097  FLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
              L+ ++ I T     AQVP +  F+ +NE    PY+ EY A YR ++      F+ PFQL
Sbjct  7     LLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITEYDASYRFLNSPNQNFFTIPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+GT R     RW+W+ANR  PV D +     ++GNLVLA+++G+V
Sbjct  67    MFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLLVGQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDMNGSDGPYSMVLDNKGLTMY--VNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              ++++  A     W E+F  F
Sbjct  305   AFSYFP-AATYLEWEETFAFF  324



>ref|XP_003596383.1| hypothetical protein MTR_2g076650 [Medicago truncatula]
 gb|AES66634.1| epidermis-specific secreted EP1-like glycoprotein [Medicago truncatula]
Length=243

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 151/235 (64%), Gaps = 16/235 (7%)
 Frame = -1

Query  995  EYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAI  816
            EY  +YR++++F+ PFQ+ FYNTTPNA+TLALRMG  RSE    WVWEANRG PV + A 
Sbjct  15   EYGGNYRMINIFNAPFQVGFYNTTPNAFTLALRMGLQRSEQLFWWVWEANRGSPVDENAT  74

Query  815  FELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDT  636
            F L  D NLVLA+ DGR+ WQ+ T+NK ++                G FVWQSFDHPTDT
Sbjct  75   FSLEVDENLVLANADGRIIWQTNTSNKVLLPL--------------GKFVWQSFDHPTDT  120

Query  635  LLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWF  456
            LLV Q L+ +GP KLVSR SE +N +GPY+++ +P  L  Y ++KNS RPI Y +SS W+
Sbjct  121  LLVDQYLKANGPSKLVSRLSEKENVDGPYSLVFDPKGLTLYYKSKNSPRPIPYWNSSNWY  180

Query  455  SV--GKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEID  297
            S    K SLE V   +    + ++      + LG  V ++P  N+TLTY RL ID
Sbjct  181  SFEYEKLSLENVTLISNPFEIGMEIFFVNVAFLGMKVFSEPVNNSTLTYPRLGID  235



>gb|AAM53294.1| putative glycoprotein EP1 [Arabidopsis thaliana]
Length=455

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 187/321 (58%), Gaps = 32/321 (10%)
 Frame = -1

Query  1097  FLVVSIQILTC---FAQVPAKNTFKFVNEGELGPYVVEYRADYRVVD-----VFSNPFQL  942
              L+ ++ I T     AQVP +  F+ +NE    PY+ +Y A YR ++      F+ PFQL
Sbjct  7     LLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITKYDASYRFLNSPNQNFFTIPFQL  66

Query  941   CFYNTTPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRV  762
              FYNTTP+AY LALR+GT R     RW+W+ANR  PV D +     ++GNLVLA+++G+V
Sbjct  67    MFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQV  126

Query  761   AWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSR  582
              WQ+ TANKGV GF++L NGNMVLHD  G FVWQSFDHPTDTLLVGQSL+++G  KLVSR
Sbjct  127   KWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSR  186

Query  581   ASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HD---------SSKWFSVGK  444
              S+   ++GPY+++L+   L  Y     +  P++Y     HD         + ++ ++ +
Sbjct  187   TSDMNGSDGPYSMVLDNKGLTMY--VNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLTE  244

Query  443   SSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLK  285
              S  E+      Q         +L       S  G   L +  +N T++YLRL  DG+LK
Sbjct  245   PSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLK  304

Query  284   TYTFYSDAEENFHWGESFKLF  222
              ++++  A     W E+F  F
Sbjct  305   AFSYFP-AATYLEWEETFAFF  324



>emb|CDP06008.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   232 bits (591),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 175/302 (58%), Gaps = 31/302 (10%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPY-----VVEYRADYRVV-----DVFSNPFQLCFYNTTPNAY  912
             AQVPA NTFK VN G LG +       EY A YR++     D ++ PF+LCFYNTTP ++
Sbjct  77    AQVPANNTFKIVNTGPLGEFQNFVPTAEYGATYRIITNDVYDFYTFPFRLCFYNTTPTSF  136

Query  911   TLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKG  732
              L +R+G    E  MRWVW+ANR  PV++ A     +DGNLVLAD DG + WQ+ TANKG
Sbjct  137   VLGIRVGIPDDEGLMRWVWDANRNHPVKENATLSFGRDGNLVLADSDGGLVWQTNTANKG  196

Query  731   VVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGP  552
             V G KLLQNGN+VL+D KG F+WQSFD+P D+LLVGQSLR SG  KLVSR S+   ++G 
Sbjct  197   VTGIKLLQNGNLVLYDTKGKFIWQSFDYPVDSLLVGQSLRESGVNKLVSRTSDVDGSDGK  256

Query  551   YTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK--------  396
             Y+++L    L       N+ + + Y+     F         V+FN +  T +        
Sbjct  257   YSLVLGDDGL--LLYLNNAGQQVRYNGWPGNFG------STVRFNTQPSTWEPTPIAWNL  308

Query  395   ----LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
                  +    K    G   L++  +N T ++LRLE DGN+K YT+Y     +  W +++ 
Sbjct  309   IFEIFESPAPKPQVDGIQQLSKINYNATYSFLRLETDGNVKAYTYYDKVRFD-RWMQTYT  367

Query  227   LF  222
              F
Sbjct  368   FF  369



>gb|EYU43334.1| hypothetical protein MIMGU_mgv1a009006mg [Erythranthe guttata]
Length=356

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 148/218 (68%), Gaps = 13/218 (6%)
 Frame = -1

Query  869  MRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVL  690
            MRWVW+ANRG PV + A   L  DGNLVLA+ +G V WQ+ TANKGVVG ++L  GN+VL
Sbjct  1    MRWVWDANRGSPVHENATISLGPDGNLVLAEANGTVVWQTNTANKGVVGLEILPEGNIVL  60

Query  689  HDAKGNFVWQSFDHPTDTLLVGQSLRLS-GPKKLVSRASETQNTNGPYTIILEPTRLGFY  513
            +D+ G +VWQSFDHPTDTLLVGQSLR + GP +LVSR SE +  NGPY+ ++E      Y
Sbjct  61   YDSAGRYVWQSFDHPTDTLLVGQSLRATGGPTRLVSRLSEAEPLNGPYSFVMEQRHWALY  120

Query  512  NQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKLGAH  354
             QTKN+ +P++YH SS+ F VGK +L+   F    ++       +   Y ++KS   G H
Sbjct  121  YQTKNTQKPMMYHKSSE-FGVGKGALDFFGFYTAPESEGSSAFEVGFGYNMSKSESSGTH  179

Query  353  VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
            +L +PK+NTT + LR++ DGNL+ YT+    +EN  WG
Sbjct  180  ILTRPKYNTTYSMLRIDTDGNLRIYTY----DENVDWG  213



>ref|NP_001077549.2| curculin-like (mannose-binding) lectin-like protein [Arabidopsis 
thaliana]
 dbj|BAC42448.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29519.1| curculin-like (mannose-binding) lectin-like protein [Arabidopsis 
thaliana]
Length=423

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 174/282 (62%), Gaps = 12/282 (4%)
 Frame = -1

Query  1058  QVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRS  879
             QVP    F+F+N G+ G   VEY A YR + V  N F+LCF+NTTPNA+TLA+ MGT  S
Sbjct  23    QVPPMEQFRFLNNGDFGESTVEYGASYRDLGVIRNQFRLCFFNTTPNAFTLAIGMGTGSS  82

Query  878   ELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGN  699
             +  +RWVW+AN  KPV++ A      +GNLVLA  DGRV WQ+ T NKGV+G  + +NGN
Sbjct  83    DSIIRWVWQANPQKPVQEEASLSFGPEGNLVLAQPDGRVVWQTMTENKGVIGLTMNENGN  142

Query  698   MVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPK-KLVSRASETQNTNGPYTIILEPTRL  522
             +VL D  G  VWQSF+ PTDTLLVGQSL L G K KLVSR       NG Y++ILEP RL
Sbjct  143   LVLFDDGGWPVWQSFEFPTDTLLVGQSLTLDGSKNKLVSR------NNGSYSLILEPDRL  196

Query  521   GFYNQT-KNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLA  345
                    +++ + ++YH     F +  ++L   K    T  L L     +      H LA
Sbjct  197   VLNRLIPRSNNKSLVYHIIEGRF-IPSATLYSAKDQGTTTQLGLATPGLRPEFPYKHFLA  255

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENF-HWGESFKLF  222
             +P+FN + ++LRL+ DGNL+ Y+F  D++  F  W  +F+LF
Sbjct  256   RPRFNASQSFLRLDADGNLRIYSF--DSKVTFLAWEVTFELF  295



>ref|XP_007211596.1| hypothetical protein PRUPE_ppa005448mg [Prunus persica]
 gb|EMJ12795.1| hypothetical protein PRUPE_ppa005448mg [Prunus persica]
Length=461

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/313 (41%), Positives = 172/313 (55%), Gaps = 45/313 (14%)
 Frame = -1

Query  1091  VVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-----FSNPFQLCFYNT  927
             V+ IQ     +QVPA  TFKF+N+GE     VEY + YRV+       +  PF+LCFYNT
Sbjct  23    VIPIQ-----SQVPANQTFKFINQGEFEDGNVEYHSTYRVIQTNAYTFYRYPFRLCFYNT  77

Query  926   TPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             TP++Y  A+R G  R    MRWVW+ANR  PV + A     +DGNLVL + DG V WQ+ 
Sbjct  78    TPDSYVFAIRAGVPRDLGLMRWVWDANRNHPVHEKATLSFGRDGNLVLGEADGTVVWQTN  137

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQ  567
             TANKGV G KLL NGN+VLHD  G F+WQSFD+PTDTLL+GQS++ +G  KLVSR S+  
Sbjct  138   TANKGVTGIKLLGNGNLVLHDKNGKFIWQSFDYPTDTLLLGQSVKTNGRNKLVSRKSDAD  197

Query  566   NTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ------  405
              ++GPY+++L+    GF     NS + ++Y     W      S+  V F+ +T+      
Sbjct  198   GSDGPYSLLLD--HKGFAMYLNNSGKLLVY---GGWRGSDYGSI--VTFDVETEIGFDDV  250

Query  404   -------TLKLDYKVAKSSKLGAHV---------------LAQPKFNTTLTYLRLEIDGN  291
                    T+  D          +H                L +  +N T + LRL  DG+
Sbjct  251   IYYELVLTVNQDVNAPPPPPPQSHRHLLQVRPIGNAHQINLNKLNYNATYSLLRLGSDGS  310

Query  290   LKTYTFYSDAEEN  252
             LK YT+Y     N
Sbjct  311   LKAYTYYDKVSSN  323



>ref|XP_008226535.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Prunus mume]
Length=461

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 169/311 (54%), Gaps = 41/311 (13%)
 Frame = -1

Query  1091  VVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-----FSNPFQLCFYNT  927
             V+ IQ     +QVPA  TFKF+N+GE     VEY + YRV+       +  PF+LCFYNT
Sbjct  23    VIPIQ-----SQVPANQTFKFINQGEFEDGNVEYHSTYRVIQTNAYTFYRYPFRLCFYNT  77

Query  926   TPNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSE  747
             TP++Y  A+R G  R    MRWVW+ANR  PV + A     +DGNLVL + DG V WQ+ 
Sbjct  78    TPDSYVFAIRSGVPRDLGLMRWVWDANRNHPVHEKATLSFGRDGNLVLGEADGTVVWQTN  137

Query  746   TANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQ  567
             TANKGV G KLL NGN+VLHD  G F+WQSFD+PTDTLL+GQS++ +G  KLVSR S+  
Sbjct  138   TANKGVTGIKLLGNGNLVLHDKNGRFIWQSFDYPTDTLLLGQSVKTNGRNKLVSRKSDAD  197

Query  566   NTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ------  405
              ++GPY+++L+    GF     NS + ++Y     W      S+    F+ +        
Sbjct  198   GSDGPYSLVLD--HKGFAMYLNNSGKLLVY---GGWRGSDYGSIVTFDFDTEIGFDDFIY  252

Query  404   -----TLKLDYKVAKSSKLGAHV---------------LAQPKFNTTLTYLRLEIDGNLK  285
                  T+  D          +H                L +  +N T + LRL  DG+LK
Sbjct  253   YELVLTINQDVHAPPPPPPQSHRHLLQVRPIGNGQQINLNKLNYNATYSLLRLGSDGSLK  312

Query  284   TYTFYSDAEEN  252
              YT+Y     N
Sbjct  313   AYTYYDKVSSN  323



>ref|XP_002317422.2| hypothetical protein POPTR_0011s07370g, partial [Populus trichocarpa]
 gb|EEE98034.2| hypothetical protein POPTR_0011s07370g, partial [Populus trichocarpa]
Length=371

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 147/226 (65%), Gaps = 15/226 (7%)
 Frame = -1

Query  869  MRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVL  690
            MRWVW+ANRGKPV + A    ++DGNL+L D DG +AWQ+ TANKGVVG  LL +GN+VL
Sbjct  19   MRWVWDANRGKPVHENATLSFKRDGNLILTDFDGTIAWQTGTANKGVVGLNLLPDGNLVL  78

Query  689  HDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYN  510
            +D +G F+WQSFDHPTDTLLVGQ+LR SGP +LVSR S    + GPY+ ++E      Y 
Sbjct  79   YDQRGKFIWQSFDHPTDTLLVGQNLRSSGPNRLVSRVSNMDGSLGPYSFVMEQRYWALYY  138

Query  509  QTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQ-------TLKLDYKVAKSSKLGAHV  351
            + KNS +P+LY+ S + F  G+ SL  + F  K +        +   Y +  S   G ++
Sbjct  139  KVKNSPKPLLYYKSDE-FGNGQGSLAHLNFYCKPEYEQAYAFEVGFTYDMNNSPSSGTYI  197

Query  350  LAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE---SFKLF  222
            L +PK+N+T + LRLE DGNLK YT+     EN  WG    +FKLF
Sbjct  198  LTRPKYNSTYSMLRLESDGNLKIYTY----NENVDWGAWDLTFKLF  239



>emb|CDP06009.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 173/302 (57%), Gaps = 31/302 (10%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPY-----VVEYRADYRVV-----DVFSNPFQLCFYNTTPNAY  912
             AQVP  NTFK VN G LG +       EY A YR++     D ++ PF+LCFYNTTP ++
Sbjct  27    AQVPTNNTFKIVNTGPLGEFQNFVPTAEYGATYRIITNDVYDFYTFPFRLCFYNTTPTSF  86

Query  911   TLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKG  732
              L +R+G    E  MRWVW+ANR  PV++ A     +DGNLVLAD DG + WQ+ TANKG
Sbjct  87    VLGIRVGIPDDEGLMRWVWDANRNHPVKENATLSFGRDGNLVLADSDGSLVWQTNTANKG  146

Query  731   VVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGP  552
             V G KLLQNGN+VL+D KG F+WQSFD+P D+LLVGQSLR SG  KLVSR S+   ++  
Sbjct  147   VTGIKLLQNGNLVLYDTKGKFIWQSFDYPVDSLLVGQSLRGSGVNKLVSRTSDVDGSDRK  206

Query  551   YTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK--------  396
             Y+++L    L       N+ + + Y+     F         V+FN +  T +        
Sbjct  207   YSLVLGDDGL--LLYLNNAGQQVRYNGWPGNFG------STVRFNTQPSTWEPTPTAWNL  258

Query  395   ----LDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFK  228
                  +    K    G   L++  +N T ++LRLE DGN+K YT Y+D      W +++ 
Sbjct  259   IFEIFESPAPKPQVDGIQQLSKINYNATYSFLRLETDGNVKAYT-YNDKVRFDRWMQTYT  317

Query  227   LF  222
              F
Sbjct  318   FF  319



>ref|XP_004294121.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Fragaria vesca subsp. vesca]
Length=455

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 182/303 (60%), Gaps = 34/303 (11%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDV-----FSNPFQLCFYNTTPNAYTLALR  897
             AQVPA  TF FVN+GELG  + E++A Y V+       +++PF+LCFYNTTP++Y  A+R
Sbjct  27    AQVPANQTFIFVNQGELGDRIAEFKASYLVIQTKAHTFYTHPFRLCFYNTTPDSYFFAIR  86

Query  896   MGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
             MG    E  MRWVW+ANR  PV + A   L +DGNL+LAD DG V+WQ+ TANKGV G K
Sbjct  87    MGVPNDEGLMRWVWDANRNHPVHEKATLSLGRDGNLILADADGTVSWQTNTANKGVTGIK  146

Query  716   LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLR-LSGPKKLVSRASETQNTNGPYTII  540
             LL NGN+VLHD  G F+WQSFD+P DTLL+GQS++ ++G  KL+SR S+   ++G Y++ 
Sbjct  147   LLPNGNLVLHDKNGRFIWQSFDYPHDTLLLGQSVKNITGHNKLISRKSDADGSDGQYSLA  206

Query  539   LEPTRLGFYNQTKNSARPILY-------HDSSKWFSVGKSS-LEEV-----------KFN  417
             L+  R GF     NS + + Y         S+  F +  ++  ++V             +
Sbjct  207   LD--RSGFTMYLNNSGQLLTYGGWPNTNFGSTVTFDLDTANGFDDVILYELVLKGNQNID  264

Query  416   AKTQTLKLDYKVAKSSKLG-AHVLAQPKFNTTLTY--LRLEIDGNLKTYTFYSDAEENFH  246
             A  Q  +   ++ ++  +G A+ L   K N    Y  LRL  DG+LK YT+Y++   N  
Sbjct  265   AAPQNRR---RLLQTRPIGNANTLNLNKLNHDAKYSFLRLGSDGSLKAYTYYNEV-SNQK  320

Query  245   WGE  237
             W E
Sbjct  321   WDE  323



>gb|AAF99842.1|AC051629_9 Hypothetical protein [Arabidopsis thaliana]
Length=397

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 171/275 (62%), Gaps = 12/275 (4%)
 Frame = -1

Query  1037  FKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWV  858
             F+F+N G+ G   VEY A YR + V  N F+LCF+NTTPNA+TLA+ MGT  S+  +RWV
Sbjct  4     FRFLNNGDFGESTVEYGASYRDLGVIRNQFRLCFFNTTPNAFTLAIGMGTGSSDSIIRWV  63

Query  857   WEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAK  678
             W+AN  KPV++ A      +GNLVLA  DGRV WQ+ T NKGV+G  + +NGN+VL D  
Sbjct  64    WQANPQKPVQEEASLSFGPEGNLVLAQPDGRVVWQTMTENKGVIGLTMNENGNLVLFDDG  123

Query  677   GNFVWQSFDHPTDTLLVGQSLRLSGPK-KLVSRASETQNTNGPYTIILEPTRLGFYNQT-  504
             G  VWQSF+ PTDTLLVGQSL L G K KLVSR       NG Y++ILEP RL       
Sbjct  124   GWPVWQSFEFPTDTLLVGQSLTLDGSKNKLVSR------NNGSYSLILEPDRLVLNRLIP  177

Query  503   KNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTT  324
             +++ + ++YH     F +  ++L   K    T  L L     +      H LA+P+FN +
Sbjct  178   RSNNKSLVYHIIEGRF-IPSATLYSAKDQGTTTQLGLATPGLRPEFPYKHFLARPRFNAS  236

Query  323   LTYLRLEIDGNLKTYTFYSDAEENF-HWGESFKLF  222
              ++LRL+ DGNL+ Y+F  D++  F  W  +F+LF
Sbjct  237   QSFLRLDADGNLRIYSF--DSKVTFLAWEVTFELF  269



>ref|XP_007212712.1| hypothetical protein PRUPE_ppa018756mg, partial [Prunus persica]
 gb|EMJ13911.1| hypothetical protein PRUPE_ppa018756mg, partial [Prunus persica]
Length=253

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 152/256 (59%), Gaps = 25/256 (10%)
 Frame = -1

Query  1001  VVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTV--RSELRMRWVWEANRGKPVR  828
             + EY A YRV++V + PFQLC YNT PN +TL L+MG     S+  + WVWE NRG PV 
Sbjct  11    LAEYDATYRVLNVSNYPFQLCLYNTIPNTFTLGLQMGNFFKYSKPPLHWVWEPNRGNPVG  70

Query  827   DGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDH  648
             + A      DGNLVL D DGRVAWQ+ T NKGVVG KLL    MVL+++K NF+WQS D+
Sbjct  71    ENATLAFETDGNLVLVDADGRVAWQTNTENKGVVGLKLLPTSKMVLYNSKANFIWQSVDY  130

Query  647   PTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDS  468
             PTDTLLVGQSL++    KL+S             ++LEP  L  Y ++KNS +P+ Y + 
Sbjct  131   PTDTLLVGQSLKVRSKHKLIS-------------LVLEPKGLVMYYKSKNSPKPLPYLNM  177

Query  467   SKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKLGAHVLAQPKFNTTLTYLR  309
                 S    S + +  N    T       + L    A SS     +LA+PK+N+ L++ R
Sbjct  178   K---SDMTGSWDHMTLNCTPDTYEGHAYDINLHQVQANSSYATKFLLARPKYNSILSFFR  234

Query  308   LEIDGNLKTYTFYSDA  261
             LEIDGNL+ Y +Y D 
Sbjct  235   LEIDGNLRIYIYYDDV  250



>ref|XP_010498022.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=420

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/282 (44%), Positives = 173/282 (61%), Gaps = 12/282 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             +QVP    F+F+N G+ G   VEY A YR + V  N F+LCF+NTTPN +TL + MGT R
Sbjct  22    SQVPPLEQFRFLNNGDFGESTVEYGASYRDLGVIRNQFRLCFFNTTPNEFTLGIGMGTGR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S+  +RWVW+AN   PV++ A      +GNLVLA  +G+V WQ++T NKGV+G  + +NG
Sbjct  82    SDSIIRWVWQANPQNPVQEEASLSFGPEGNLVLAQPNGKVVWQTKTENKGVIGLTMNENG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             N+VL +  G  VWQSFD PTDTLLV QSL L GP KL+SR       N  +++ILEP RL
Sbjct  142   NLVLFNDGGWPVWQSFDFPTDTLLVVQSLTLDGPNKLISR-------NNRFSLILEPDRL  194

Query  521   GF-YNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLA  345
                ++  K++ + +LY+     F +  ++L   K       L L     +      HVLA
Sbjct  195   VLSHSIPKSNNKSVLYYAIEGRF-IPTATLYAAKDQGTATQLGLAIPGLRPEFPYKHVLA  253

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENF-HWGESFKLF  222
             +P+FN + ++LRL+ DGNL+ YTF  D +  F  W  +F+LF
Sbjct  254   RPRFNASQSFLRLDADGNLRIYTF--DFKVTFLPWEVTFELF  293



>ref|XP_002892928.1| sugar binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69187.1| sugar binding protein [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/282 (45%), Positives = 173/282 (61%), Gaps = 12/282 (4%)
 Frame = -1

Query  1058  QVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRS  879
             QVP+   F+F+N G+ G   V+Y A YR + V  N F+LCF+NTTPNA+TLA+ MGT  S
Sbjct  23    QVPSLEQFRFLNNGDFGESTVDYGASYRDLGVIRNQFRLCFFNTTPNAFTLAIGMGTGSS  82

Query  878   ELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGN  699
             +  +RWVW+AN   PV++ A      +GNLVLA  DG V WQ+ T NKGV+G  + +NGN
Sbjct  83    DSIIRWVWQANPQNPVQEEASLSFGPEGNLVLAQPDGTVVWQTMTENKGVIGLTMNENGN  142

Query  698   MVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPK-KLVSRASETQNTNGPYTIILEPTRL  522
             +VL D  G  VWQSFD PTDTLLVGQSL L G K KLVSR       NG +++ILEP RL
Sbjct  143   LVLFDDGGWPVWQSFDFPTDTLLVGQSLTLDGSKNKLVSR------NNGAFSLILEPDRL  196

Query  521   GFYNQT-KNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLA  345
                +   +++ + ++Y+     F +  ++L   K    T  L L     +      H LA
Sbjct  197   VLNHLVPRSNNKSVVYYVIEGRF-IPSATLYAAKDQGTTTQLGLSTPGLRPEFPYKHFLA  255

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENF-HWGESFKLF  222
             +P+FN + ++LRL+ DGNL+ YTF  D +  F  W  +F+LF
Sbjct  256   RPRFNASQSFLRLDADGNLRIYTF--DFKVTFLAWEVTFELF  295



>ref|XP_010459246.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Camelina sativa]
Length=420

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 172/282 (61%), Gaps = 12/282 (4%)
 Frame = -1

Query  1061  AQVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVR  882
             +QVP    F+F+N G+ G   VEY A YR + V  N F+LCF+NTTPN +TL + MGT R
Sbjct  22    SQVPPLEQFRFLNNGDFGESTVEYGASYRDLGVIRNQFRLCFFNTTPNEFTLGIGMGTGR  81

Query  881   SELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
             S+  +RWVW+AN   PV++ A      +GNLVLA  +G+V WQ++T NKGV+G  + +NG
Sbjct  82    SDSIIRWVWQANPQNPVQEEASLSFGPEGNLVLAQPNGKVVWQTKTENKGVIGLTMNENG  141

Query  701   NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRL  522
             N+VL + +G  VW+SFD P DTLLVGQSL L GP KLVSR       N  + +ILEP RL
Sbjct  142   NLVLFNDRGWPVWKSFDFPKDTLLVGQSLTLDGPNKLVSR-------NNRFNLILEPDRL  194

Query  521   GF-YNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLA  345
                ++ +K + + +LY+     F +  ++    K       L L     +      H LA
Sbjct  195   VLSHSISKRNNKSVLYYAIEGRF-IPSATFYAAKDQGTATQLGLATPGLRPEFPYKHFLA  253

Query  344   QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENF-HWGESFKLF  222
             +P+FN + ++LRL+ DGNL+ YTF  D + +F  W  +F+LF
Sbjct  254   RPRFNASQSFLRLDADGNLRIYTF--DFKVSFLAWEVTFELF  293



>gb|EYU43333.1| hypothetical protein MIMGU_mgv1a026460mg [Erythranthe guttata]
Length=356

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 145/218 (67%), Gaps = 13/218 (6%)
 Frame = -1

Query  869  MRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVL  690
            MRWVW+ANRG PVR+ A   L  DGN VLA+ +G + WQ+ TANKGVVG   L NGN+VL
Sbjct  1    MRWVWDANRGSPVRENATISLGSDGNFVLAEANGTIVWQTNTANKGVVGLDTLPNGNIVL  60

Query  689  HDAKGNFVWQSFDHPTDTLLVGQSLRLS-GPKKLVSRASETQNTNGPYTIILEPTRLGFY  513
            +D+ G +VWQSFDHPTDTLLVGQ LR + GP +LVSR SE +  NGPY+ ++E      Y
Sbjct  61   YDSTGRYVWQSFDHPTDTLLVGQFLRATGGPTRLVSRLSEAEPLNGPYSFVMEQRHWAMY  120

Query  512  NQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKLGAH  354
             QTKN+ +P++Y+ SS+ F  GK +L  + F +  +        L   Y ++KS   G  
Sbjct  121  YQTKNTQKPMMYYKSSE-FGNGKGALAFLGFYSAPENDGNYAFELGFVYNMSKSDSSGTS  179

Query  353  VLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWG  240
            +L++PK+NTT + LR++ DGNL+ YT+    +EN  WG
Sbjct  180  ILSRPKYNTTYSMLRVDADGNLRIYTY----DENVDWG  213



>ref|XP_006416761.1| hypothetical protein EUTSA_v10007731mg [Eutrema salsugineum]
 gb|ESQ35114.1| hypothetical protein EUTSA_v10007731mg [Eutrema salsugineum]
Length=420

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 167/281 (59%), Gaps = 11/281 (4%)
 Frame = -1

Query  1058  QVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRS  879
             QV      +F+N GE G   VEY A YR V V  N F+LC +NTTPNA+ LA+ MGT  S
Sbjct  23    QVDPSQQLQFINRGEFGESTVEYGASYRDVGVIRNLFRLCLFNTTPNAFILAIGMGTGSS  82

Query  878   ELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGN  699
             +  +RWVW+AN   PV++ A      DGNLVLA  DGRV WQ++T NKGV+G  + +NGN
Sbjct  83    DSIIRWVWQANPQNPVQEEASLSFGPDGNLVLAQPDGRVVWQTKTENKGVIGLGMNENGN  142

Query  698   MVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLG  519
             + L D  G  VWQSFD PTDTLLVGQSL L GP KLV+      +  G Y++ILEP RL 
Sbjct  143   LELFDNGGWPVWQSFDFPTDTLLVGQSLTLDGPNKLVT------HDKGSYSLILEPDRLV  196

Query  518   FYNQT-KNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQ  342
               ++  ++S + ++Y+     F +  ++    K       L L     +      H LA+
Sbjct  197   LSHEIPRSSNKSVVYYVMEGRF-IPSTTFYAAKDQGTATQLGLATPALRPEFPYKHFLAR  255

Query  341   PKFNTTLTYLRLEIDGNLKTYTFYSDAEENF-HWGESFKLF  222
             P+FN + ++LRL+ DG L+ YTF  D + +F  W  +F+LF
Sbjct  256   PRFNASKSFLRLDSDGYLRIYTF--DFKVSFLAWEVTFELF  294



>gb|AFR61756.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61758.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61759.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61760.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61762.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61763.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61764.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61770.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61774.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61776.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61778.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61779.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61781.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61782.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61785.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61786.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61787.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61790.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61791.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61793.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61794.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61795.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61796.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61797.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61798.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61799.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61801.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61804.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61809.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61810.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61813.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61815.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61816.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61817.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61818.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61819.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61820.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61821.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61822.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61823.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61824.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61825.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61826.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61827.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61828.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61829.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61830.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61831.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61832.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61833.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61834.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61835.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61836.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61837.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61838.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61839.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61840.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61841.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61842.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61843.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61844.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61845.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61919.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61920.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61921.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61922.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61923.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61924.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61925.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61932.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61933.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61935.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61937.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61938.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61939.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61942.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61943.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61944.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61946.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61947.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61949.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61950.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61955.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 136/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61789.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61805.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61811.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 136/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMETKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61726.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61727.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61728.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61730.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61731.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61732.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61733.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61734.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61735.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61736.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61737.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61738.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61739.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61740.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61741.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61742.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61743.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61744.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61745.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61746.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61747.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61748.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61749.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61750.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61751.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61752.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61753.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61754.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61755.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 136/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKLTQLQSMTFQATEVSDTTWGLYME-GVDSGSKFNVSTSLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61846.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61848.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61849.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61850.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61852.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61854.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61856.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61858.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61859.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61860.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61862.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61864.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61865.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61866.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61868.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61870.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61871.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61872.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61876.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61877.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61961.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61963.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61971.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61973.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61977.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61978.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61979.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61980.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61981.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61989.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61993.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62003.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62009.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62011.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62015.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 137/202 (68%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A+    +DGNLVLA+ +GRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENAMLTFGEDGNLVLAEAEGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61757.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61767.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61768.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61769.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61772.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61773.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61775.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61780.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61847.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61853.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61855.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61857.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61861.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61863.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61873.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61874.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61958.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61959.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61960.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61966.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61967.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61968.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61974.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61982.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61984.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61985.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61990.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61991.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61994.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61996.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61997.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61998.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62000.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62004.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62006.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62007.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62008.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62010.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62012.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62013.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62014.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D 
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDP  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61875.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D 
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDP  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMESKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61761.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61765.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61766.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61771.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61777.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61783.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61851.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61867.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61869.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61918.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61926.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61927.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61928.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61929.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61930.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61931.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61934.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61936.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61940.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61941.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61948.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61951.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61952.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61954.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61956.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61957.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61962.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61964.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61965.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61969.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61970.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61972.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61975.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61976.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61983.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61986.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61987.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61988.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61992.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61995.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61999.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62001.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62002.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR62005.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 136/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ +GRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEAEGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61945.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
 gb|AFR61953.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + N NGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNINGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61729.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. petraea]
Length=207

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 136/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ +GRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEAEGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKLTQLQSMTFQATEVSDTTWGLYME-GVDSGSKFNVSTSLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AFR61784.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61788.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61792.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61800.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61802.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61803.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61806.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61807.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61808.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61812.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61814.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61878.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61879.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61880.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61881.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61882.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61883.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61884.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61885.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61886.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61887.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61888.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61889.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61890.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61891.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61892.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61893.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61894.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61895.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61896.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61897.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61898.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61899.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61900.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61901.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61902.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61903.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61904.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61905.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61906.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61907.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61908.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61909.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61910.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61911.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61912.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61913.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61914.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61915.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61916.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
 gb|AFR61917.1| curculin-like mannose-binding lectin family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VWEANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D+
Sbjct  1    VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDS  60

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
             G FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L     T 
Sbjct  61   SGKFVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLCYTTN  120

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQP  339
             + +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++P
Sbjct  121  KTPKPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRP  177

Query  338  KFNTTLTYLRLEIDGNLKTYTF  273
            K N TL+++RLE DGN++ +++
Sbjct  178  KHNATLSFIRLESDGNIRVWSY  199



>gb|AAT72501.1| AT1G78850 [Arabidopsis lyrata subsp. petraea]
Length=196

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 133/199 (67%), Gaps = 9/199 (5%)
 Frame = -1

Query  851  ANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGN  672
            ANRG PV++ A     +DGNLVLA+ DGRV WQ+ TANKG VG K+L+NGNMV++D+ G 
Sbjct  1    ANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGAVGIKILENGNMVIYDSSGK  60

Query  671  FVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSA  492
            FVWQSFD PTDTLLVGQSL+L+G  KLVSR S + NTNGPY++++E  +L  Y  T  + 
Sbjct  61   FVWQSFDSPTDTLLVGQSLKLNGRTKLVSRLSPSVNTNGPYSLVMEAKKLVLYYTTNKTP  120

Query  491  RPILYHDSSKWFSVGKSSLEEVKFNA-----KTQTLKLDYKVAKSSKLGAHV-LAQPKFN  330
            +PI Y++    F    + L+ + F A      T  L ++  V   SK      L++PK N
Sbjct  121  KPIAYYEYE--FFTKITQLQSMTFQAVEDSDTTWGLHME-GVDSGSKFNVSTFLSRPKHN  177

Query  329  TTLTYLRLEIDGNLKTYTF  273
             TL+++RLE DGN++ +++
Sbjct  178  ATLSFIRLESDGNIRVWSY  196



>ref|XP_010673067.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Beta vulgaris subsp. vulgaris]
Length=452

 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 151/262 (58%), Gaps = 14/262 (5%)
 Frame = -1

Query  1037  FKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRSELRMRWV  858
             F F+N+G+    + E+ +  R V + S  F LCFY  T +++TL + M         +WV
Sbjct  43    FLFINQGDFDDNIGEFDSYVRPVGIHSPKFSLCFYTNTHDSFTLGIGM-----NWPYKWV  97

Query  857   WEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAK  678
             W ANR   VR+GA   L +DGNLVLADVDGRV WQ+ TANKGVVG K+L NGN+VL+DAK
Sbjct  98    WAANRNNLVREGASLLLGKDGNLVLADVDGRVVWQTNTANKGVVGLKMLDNGNLVLYDAK  157

Query  677   GNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKN  498
              +F+WQSFD+P+DTLL GQSL+     KLVSRAS T +  G YT+ +    +  Y ++  
Sbjct  158   NDFIWQSFDYPSDTLLAGQSLKAGLTNKLVSRASPTSDFEGNYTLEMSLENVSLYYKSNK  217

Query  497   SARPILYHDSSKWFSVGKSSLEEVKFNAKTQTL-------KLDYKVAKSSKLGAHVLAQP  339
             +  P+ Y+   + +  G +  +E K+               + Y            L + 
Sbjct  218   NPTPLPYYRIEQRY--GSTPSKEFKYYVGVTNFVSHFTFQAIQYITTDWMSSSNQQLVET  275

Query  338   KFNTTLTYLRLEIDGNLKTYTF  273
              +N+T ++LRL+ DG L+TY+ 
Sbjct  276   WYNSTYSFLRLDYDGKLRTYSL  297



>ref|XP_003596380.1| Epidermis-specific secreted glycoprotein EP1 [Medicago truncatula]
 gb|AES66631.1| epidermis-specific secreted EP1-like glycoprotein [Medicago truncatula]
Length=298

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 132/218 (61%), Gaps = 23/218 (11%)
 Frame = -1

Query  869  MRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVL  690
             RWVWEANRG PV + A F L  DGNLV A+ DGR+ WQ+ T+NKGVV   L        
Sbjct  20   FRWVWEANRGNPVDENATFSLGVDGNLVWANDDGRIVWQTNTSNKGVVALSL--------  71

Query  689  HDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYN  510
                        DHPTDTLLV Q L+ +GP KL SR SE +N +GPY++ILEP  L  Y 
Sbjct  72   ------------DHPTDTLLVDQYLKPNGPSKLASRLSEKENVDGPYSLILEPKGLALYY  119

Query  509  QTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLK--LDYKVAKSSKLGAHVLAQPK  336
            +++ S  PI Y  SS WFS  K SLE V   +  ++ +   D+ VA S+  G+ ++ +P 
Sbjct  120  KSEISPMPIKYWFSSSWFSFEKGSLENVTLKSDPESFEFGFDFFVANSTTSGSSIIGRPV  179

Query  335  FNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             N+TLTYLRL IDGN++ YT++ D ++   W  ++ LF
Sbjct  180  KNSTLTYLRLGIDGNIRFYTYFLDVQDGV-WKVTYTLF  216



>gb|KFK43890.1| hypothetical protein AALP_AA1G187200 [Arabis alpina]
Length=826

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = -1

Query  1058  QVPAKNTFKFVNEGELGPYVVEYRADYRVVDVFSNPFQLCFYNTTPNAYTLALRMGTVRS  879
             Q+P  + F+F+N G+ G   VEY A YR + V  N F+LCF+NTTPNA+TLA+ MG   S
Sbjct  23    QIPPLDQFRFLNNGDFGESAVEYGASYRELGVVRNHFRLCFFNTTPNAFTLAIGMGIGSS  82

Query  878   ELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGN  699
             +  +RWVW+AN   PV++ A     Q+GNLV A  DGRV WQ++TANK V+G  + +N N
Sbjct  83    DSIIRWVWQANTRNPVQEEASLSFGQEGNLVFAQPDGRVVWQTKTANKDVIGLTMNENSN  142

Query  698   MVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVS  585
             +VL D  G  VWQSFD P+DTLLVGQSL L G  KLV+
Sbjct  143   LVLFDDGGWPVWQSFDFPSDTLLVGQSLSLEGHNKLVT  180



>ref|XP_006442510.1| hypothetical protein CICLE_v10024219mg [Citrus clementina]
 gb|ESR55750.1| hypothetical protein CICLE_v10024219mg [Citrus clementina]
Length=292

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 118/203 (58%), Gaps = 33/203 (16%)
 Frame = -1

Query  851  ANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGN  672
            A  GK V     F L  DGNLVLA+ DG V  QS TANKGVVGFKLL NGNMVLHD+KGN
Sbjct  2    AKTGKQVCGKPTFSLGSDGNLVLAEADGTVVCQSNTANKGVVGFKLLPNGNMVLHDSKGN  61

Query  671  FVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSA  492
            F+WQSFD PTDTLLVGQSL            S  +N     + ++EP R   Y +  NS 
Sbjct  62   FIWQSFDCPTDTLLVGQSL-----------LSVKENV----SFVMEPKRFTLYYKGSNSP  106

Query  491  RPILYHDSSKWFSVGKSSLEEVKFNAKTQT-----LKLDYKVAKSSKLGAHVLAQPKFNT  327
            +P+LY            S++ + FN++ +T      KL   ++ S   G+ +LA+PK+N 
Sbjct  107  QPVLY----------DPSVQNLTFNSRPETDEAFAFKLTLDISDS---GSDILARPKYNI  153

Query  326  TLTYLRLEIDGNLKTYTFYSDAE  258
              ++LRL + GNLK YT Y   +
Sbjct  154  RSSFLRLGMHGNLKIYTHYDKVD  176



>gb|KDO44630.1| hypothetical protein CISIN_1g047082mg, partial [Citrus sinensis]
Length=263

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 116/198 (59%), Gaps = 33/198 (17%)
 Frame = -1

Query  836  PVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQS  657
            PV     F L  DGNLVLA+ DG V  QS TANKGVVGFKLL NGNMVLHD+KGNF+WQS
Sbjct  17   PVCGKPTFSLGSDGNLVLAEADGTVVCQSNTANKGVVGFKLLPNGNMVLHDSKGNFIWQS  76

Query  656  FDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY  477
            FD PTDTLLVGQSL            S  +N     + ++EP R   Y +  NS +P+LY
Sbjct  77   FDCPTDTLLVGQSL-----------LSVKENV----SFVMEPKRFTLYYKGSNSPQPVLY  121

Query  476  HDSSKWFSVGKSSLEEVKFNAKTQT-----LKLDYKVAKSSKLGAHVLAQPKFNTTLTYL  312
                        S++ + FN++ +T      KL   ++ S   G+ +LA+PK+N   ++L
Sbjct  122  ----------DPSVQNLTFNSRPETDEAFAFKLTLDISDS---GSDILARPKYNIRSSFL  168

Query  311  RLEIDGNLKTYTFYSDAE  258
            RL + GNLK YT Y   +
Sbjct  169  RLGMHGNLKIYTHYDKVD  186



>ref|XP_007214451.1| hypothetical protein PRUPE_ppa024445mg, partial [Prunus persica]
 gb|EMJ15650.1| hypothetical protein PRUPE_ppa024445mg, partial [Prunus persica]
Length=118

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -1

Query  1100  IFLVVSIQILTCFAQVPAKNTFKFVNEGELGPYVVEYRADYRVV-DVFSNPFQLCFYNTT  924
             +    SI  +   AQVPA  TFK VNEGE GPYVVEY  DYR++ DVF++PFQL FYNTT
Sbjct  6     LLFFFSIFCIIAQAQVPANETFKLVNEGEFGPYVVEYFGDYRMLPDVFNSPFQLGFYNTT  65

Query  923   PNAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGR  765
             PNA+TLALRMG VRSE  MRWVWEANRG PV + A      DGNLVLAD DGR
Sbjct  66    PNAFTLALRMGLVRSESLMRWVWEANRGNPVGENATLTFGTDGNLVLADADGR  118



>gb|AFK43600.1| unknown [Lotus japonicus]
Length=287

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 6/161 (4%)
 Frame = -1

Query  698  MVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLG  519
            MVL DA G FVWQSFDHPTDT+LVGQ LR  GP++LVSR SE +N NGPY+++LE   LG
Sbjct  1    MVLLDANGKFVWQSFDHPTDTILVGQYLRAGGPRELVSRLSEKENVNGPYSLVLESKGLG  60

Query  518  FYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKL--DYKVAKSSKLGAHVLA  345
             Y + KN+ +PI Y   S    V K SLE V F + +++ ++  DY VA SS  G  +L 
Sbjct  61   LYYKPKNAPKPIRYWSES---YVEKGSLENVTFTSDSESFEIGFDYFVANSSNFGNRILG  117

Query  344  QPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
            +P  N+TLTYLRL IDGN+K  T++ D  +   W  ++ LF
Sbjct  118  RPVNNSTLTYLRLGIDGNIKFNTYFLDVRDGV-WKVTYTLF  157



>ref|XP_007212643.1| hypothetical protein PRUPE_ppa018111mg [Prunus persica]
 gb|EMJ13842.1| hypothetical protein PRUPE_ppa018111mg [Prunus persica]
Length=223

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 121/212 (57%), Gaps = 39/212 (18%)
 Frame = -1

Query  896  MGTVRSELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFK  717
            MG  R ++    VW+ANRG PV + A      DGN +LAD DGRVAWQ+ TANK  V   
Sbjct  1    MGHARYDVYR--VWDANRGNPVGENATLAFGTDGNRLLADADGRVAWQTNTANKDAV---  55

Query  716  LLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRL-SGPKKLVSRASETQNTNGPYTII  540
                   VLH +KGNFVWQSF++PTDTLLVGQ+LR  S   KLV  ASE  N+NGPY ++
Sbjct  56   -------VLHCSKGNFVWQSFNYPTDTLLVGQALRAGSMSNKLVIWASEKDNSNGPYILV  108

Query  539  LEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLG  360
            L+   L F        +P    D +  FS+   SL++ +                SS +G
Sbjct  109  LDNVALSF--------QPTSELDEAYAFSI---SLKQTRM---------------SSLIG  142

Query  359  AHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSD  264
              +LA+PK+++T ++ RL  DGNL+ YT  SD
Sbjct  143  PEILARPKYHSTFSFFRLGFDGNLRVYTCRSD  174



>gb|ABR18243.1| unknown [Picea sitchensis]
Length=422

 Score =   152 bits (383),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 133/245 (54%), Gaps = 30/245 (12%)
 Frame = -1

Query  869  MRWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVL  690
            MR+VW ANR   VR+ A  +   DGNL+L+D DGR  W + T+ KGVVG +L  NGN+VL
Sbjct  42   MRFVWTANRNDLVRENATLKYGTDGNLLLSDADGRAVWSTNTSKKGVVGIELRNNGNLVL  101

Query  689  HDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPT------  528
            +D K   VWQSFDH TD+LLVGQSL + G KKLVSR S+   + GPY++ +E        
Sbjct  102  YDKKNKTVWQSFDHATDSLLVGQSLNIGGVKKLVSRVSDKDGSEGPYSLAMEAGGFALYA  161

Query  527  ---------RLGFYNQTKN-------SARPI--LYHDSSKWFSVGKSSLEEVK---FNA-  414
                      L FY   K+         +P+  +   S+     G S + E++   F A 
Sbjct  162  SFPKPLPYWTLSFYEGIKDIFAITHTCKKPVSSITFQSNTEAENGYSQMMEMRLANFTAP  221

Query  413  -KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGE  237
             + +  +L    +  +    +    P+FNTTL++LRL+ DG+L+ YT+    E N  W  
Sbjct  222  PELRAPELCKLTSDQTTSALYSFNTPRFNTTLSFLRLDSDGDLRMYTYSPGIEFN-TWDI  280

Query  236  SFKLF  222
            +++ F
Sbjct  281  TYQKF  285



>gb|ACN57418.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57420.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57421.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57424.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57432.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIAYYE  104



>gb|ACN57417.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57419.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57422.1| At1g78850-like protein [Capsella grandiflora]
 gb|ACN57423.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIXYYE  104



>gb|ACN57425.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYDSXGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + 
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIXYYEYE--FFTKITQLQSMT  118

Query  422  FNA  414
            F A
Sbjct  119  FQA  121



>gb|ACN57401.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57402.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57403.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57404.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57405.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57406.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57407.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57408.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57409.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57410.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57411.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57412.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57413.1| At1g78850-like protein [Capsella rubella]
 gb|ACN57414.1| At1g78850-like protein [Capsella rubella]
Length=150

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L+G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNKNGPYSLVMEAKKLVLYYTTNKTPKPIAYYE  104



>gb|ACN57415.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++++ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYBSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIXYYE  104



>gb|ACN57416.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++++ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYBSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIAYYE  104



>gb|ACN57429.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV +D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVXYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIAYYE  104



>gb|ACN57431.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
              KL SR S + N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + 
Sbjct  61   RNKLXSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIXYYEYE--FFTKITQLQSMT  118

Query  422  FNA  414
            F A
Sbjct  119  FQA  121



>gb|ACN57428.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+N NMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENXNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + 
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMT  118

Query  422  FNA  414
            F A
Sbjct  119  FQA  121



>gb|ACN57426.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+N NMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENXNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
              KLVSR S + N NGPY++++E  +L  Y  T  + +PI Y++    F    + L+ + 
Sbjct  61   RNKLVSRLSPSVNXNGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYE--FFTKITQLQSMT  118

Query  422  FNA  414
            F A
Sbjct  119  FQA  121



>gb|ACN57427.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++++ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYBSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHD  471
              KLVSR S + N NG Y++++E  +L  Y  T  + +PI Y++
Sbjct  61   RNKLVSRLSPSVNXNGXYSLVMEAKKLVLYYTTNKTPKPIXYYE  104



>gb|ACN57430.1| At1g78850-like protein [Capsella grandiflora]
Length=150

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = -1

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
            A+ DGRV WQ+ TANKGVVG K+L+NGNMV++D+ G FVWQSFD PTDTLLVGQSL+L G
Sbjct  1    AEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLBG  60

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVK  423
              KL SR S + N NGPY++++   +L  Y  T  + +PI Y++    F    + L+ + 
Sbjct  61   RNKLXSRLSPSVNXNGPYSLVMXAKKLVLYYTTNKTPKPIXYYEYE--FFTKITQLQSMT  118

Query  422  FNA  414
            F A
Sbjct  119  FQA  121



>ref|XP_007212663.1| hypothetical protein PRUPE_ppa018303mg, partial [Prunus persica]
 gb|EMJ13862.1| hypothetical protein PRUPE_ppa018303mg, partial [Prunus persica]
Length=292

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 98/155 (63%), Gaps = 13/155 (8%)
 Frame = -1

Query  665  WQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARP  486
            WQSFD PTDTLLVGQSLR     KLVSRASE +N +G Y++++EP  L  Y ++KNS + 
Sbjct  14   WQSFDSPTDTLLVGQSLRAGAVSKLVSRASEKENKDGAYSLVMEPKGLFLYYKSKNSPKS  73

Query  485  ILYHDSSKWFSVGKSSLEEVKFNAKTQT-------LKLDYKVAKSSKLGAHVLAQPKFNT  327
            +LY   S+  ++ + SL+ V  N+  +T       L L+Y+ A SS  G   L  PKFN+
Sbjct  74   LLY---SQLITIQEGSLDHVTLNSNPETDEGYVYDLTLEYQAANSSTGGNIFLDVPKFNS  130

Query  326  TLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
            TLTYLRL IDGN+K YT+Y        W ++F LF
Sbjct  131  TLTYLRLGIDGNIKLYTYYDKVNS---WEQTFTLF  162



>ref|XP_011007075.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Populus euphratica]
Length=154

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 94/159 (59%), Gaps = 27/159 (17%)
 Frame = -1

Query  698  MVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLG  519
            MVLHD+KG FVWQSFDHPTDTLL+GQSLR+ G  +LVSRASE +N++GPY+++LEP RL 
Sbjct  1    MVLHDSKGGFVWQSFDHPTDTLLLGQSLRVEGTARLVSRASEKENSDGPYSLVLEPKRLA  60

Query  518  FYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQP  339
             Y+++ +S RP+    S K        L E K   +  TL                    
Sbjct  61   MYSKSPSSPRPLSSLHSDK--------LSESKGRVQNVTL-------------------V  93

Query  338  KFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
             +N TL++LRL IDGNL+ +T Y  A  N  +  +F L 
Sbjct  94   NYNNTLSFLRLGIDGNLRVHTIYDKASRNDGFQATFILL  132



>ref|XP_002985869.1| hypothetical protein SELMODRAFT_123124, partial [Selaginella 
moellendorffii]
 gb|EFJ13046.1| hypothetical protein SELMODRAFT_123124, partial [Selaginella 
moellendorffii]
Length=366

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 123/244 (50%), Gaps = 13/244 (5%)
 Frame = -1

Query  950  FQLCFYNTTPNAYTLALRMGTVRS-ELRMRWVWEANRGKPVRDGAIFELRQDGNLVLADV  774
            + L F N+TP  YTLAL +    S E   R +WEANR  PV   A   L  DGNLVL D 
Sbjct  10   YNLGFANSTPGRYTLALALNVDPSLESTSRLIWEANRDDPVGFNASLTLGADGNLVLRDA  69

Query  773  DGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKK  594
            DGR  W ++TANKG    ++L+ GN V+  +    +WQSFDHP+DTL+V Q        K
Sbjct  70   DGRFVWSTDTANKGATHAEILKTGNFVVR-SNNTILWQSFDHPSDTLMVSQIFEPG--MK  126

Query  593  LVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVGKSSLEEVKFNA  414
            L SR + + ++ G Y++++EP  L  Y+    S  P  Y   S +     S       + 
Sbjct  127  LQSRTTLSNSSLGVYSLVMEPGGLVLYSNVSGSQEP--YSVRSYYGQDTLSGALRTCDSL  184

Query  413  KTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAEENFHWGES  234
                ++ +      + L A+V A        +++RLE DGNL+ YT     E    W + 
Sbjct  185  VAAVMEGNGLNLNLNLLLANVSAAAN---NQSFIRLEPDGNLRAYTL----ETLNKWDDP  237

Query  233  FKLF  222
            ++LF
Sbjct  238  YQLF  241



>gb|EMT14318.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=848

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 149/304 (49%), Gaps = 24/304 (8%)
 Frame = -1

Query  1109  STLIFLVVSI--QILT----CFAQVPAKN--TFKFVNEGEL-GPYVVE---YRADYRVVD  966
             + L+F++V++  Q+L+     F + P  N  T    NE    GP+V++   Y        
Sbjct  4     ANLLFIIVAVSAQLLSEAWLNFTEYPTANLSTSWTNNESSFTGPHVLQTLFYDGSAVRSL  63

Query  965   VFSNP-------FQLCFYNTTP-NAYTLALRMGTVRSELRMRWVWEANRGKPVRDGAIFE  810
             V S+P       F   F+  +P N +  A+ +  +RS+ +   VW ANR +PVR+GA  E
Sbjct  64    VLSSPQPILGPYFGAGFFCASPCNVFLFAIYIFHIRSDTKPHMVWSANRARPVREGATIE  123

Query  809   LRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLL  630
             L  DGNLVL D DG + W S ++ + V G  + ++ N+VL D +   VWQSFDHP+D LL
Sbjct  124   LTIDGNLVLRDADGSLVWSSGSSERSVAGMVITEDCNLVLFDRRNGTVWQSFDHPSDVLL  183

Query  629   VGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK--NSARPILYHDSSKWF  456
              GQSL L G + + + A+     N  Y  +L     G+        S    LY+  S W 
Sbjct  184   PGQSL-LEGTRLVANTAATNWTENQVYMTVLPRGTNGYTGLYGYVGSTPSQLYYAFSAWV  242

Query  455   SVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYT  276
             S   +     K      +L L  +  + S    H ++ P   +T  Y+RLE DG+L+ Y 
Sbjct  243   SENDTGNGPTKVTFLNSSLSLLVQTRQPSNPRMHNISLPAAKST-QYVRLESDGHLRLYE  301

Query  275   FYSD  264
             +  D
Sbjct  302   WSED  305



>ref|XP_009778430.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana sylvestris]
Length=834

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 124/243 (51%), Gaps = 26/243 (11%)
 Frame = -1

Query  941  CFYNTTPNAYTLALRMGTVRSELRM------RW-----VWEANRGKPVRDGAIFELRQDG  795
            C + +     +    +G VR  LR       RW     VW ANR +PV +    +L QDG
Sbjct  83   CGFASNGEDDSFVFSVGVVR--LRQDSVGIRRWSDLELVWFANRNQPVHENGTLQLLQDG  140

Query  794  NLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSL  615
            +LVL DVDG + W + T NK V G K+++ GN+VLHD     VWQSFDHPTDTLL GQ L
Sbjct  141  DLVLKDVDGTLVWSTSTTNKFVSGIKMMETGNLVLHDMYNETVWQSFDHPTDTLLPGQKL  200

Query  614  RLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVG-KSS  438
            R    ++LV+R S +  T G Y   L  T  G +     S +P +Y    K+   G + S
Sbjct  201  R--AGQRLVARVSSSNWTEGNY--FLSVTNQGLF-AFYISNKPQMYF---KFLVTGERDS  252

Query  437  LEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE  258
              E    A   TL L Y  +        V ++P   + + +LR + DG+L++Y   SD +
Sbjct  253  FNESYVKAVNGTLAL-YICSTEPNEPNAVFSRP---SRMNFLRYDYDGHLRSYAEGSDQQ  308

Query  257  ENF  249
             NF
Sbjct  309  TNF  311



>ref|XP_009620921.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=834

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 126/243 (52%), Gaps = 26/243 (11%)
 Frame = -1

Query  941  CFYNTTPNAYTLALRMGTVRSELRM------RW-----VWEANRGKPVRDGAIFELRQDG  795
            C +++     +    +G VR  LR       RW     VW A R  P+R+    +L QDG
Sbjct  83   CGFSSNGEDDSFVFSIGIVR--LRQDSVGIRRWSDLELVWFAKRNHPIRENGTLQLLQDG  140

Query  794  NLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSL  615
            +LVL DVDG + W + TANK V G K+++ GN+VLHD     VWQSFDHPTDTLL GQ L
Sbjct  141  DLVLKDVDGTLVWSTSTANKFVSGIKMMETGNLVLHDMHNQTVWQSFDHPTDTLLPGQKL  200

Query  614  RLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILYHDSSKWFSVG-KSS  438
            R    ++LV+R S +  T G +   L  T  G +     S +P +Y    K+   G + S
Sbjct  201  R--AGQRLVARVSSSNWTEGNF--FLSVTNQGLF-AFHISNKPQMYF---KFLVTGERDS  252

Query  437  LEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEIDGNLKTYTFYSDAE  258
              E    A   TL L     + ++  A V ++P   + + +LR + DG+L++Y   SD +
Sbjct  253  FNESYVKAVNGTLALYISSTEPNEPNA-VFSRP---SRMKFLRYDYDGHLRSYAEGSDQQ  308

Query  257  ENF  249
             + 
Sbjct  309  TDI  311



>ref|XP_002987876.1| hypothetical protein SELMODRAFT_126716, partial [Selaginella 
moellendorffii]
 gb|EFJ11179.1| hypothetical protein SELMODRAFT_126716, partial [Selaginella 
moellendorffii]
Length=377

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 125/255 (49%), Gaps = 15/255 (6%)
 Frame = -1

Query  962  FSNPFQLCFYNTTPNAYTLALRMGTVRS-ELRMRWVWEANRGKPVRDGAIFELRQDGNLV  786
            FS  + L F N+TP+ YTLA+ M          R +WEANR  PV   A   L  DG+LV
Sbjct  5    FSGVYNLGFVNSTPDRYTLAVLMNVDSGFPTTQRIIWEANREDPVGLNATLSLASDGDLV  64

Query  785  LADVDGRVAWQSETANKGVVGFKLL-QNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRL  609
            L D DGR+ W + TAN+G    +++ + GN+V+       +WQSFD PTDTL+ GQ LR 
Sbjct  65   LRDRDGRLVWSTGTANRGATRVEVVRETGNLVVF-RNNTILWQSFDRPTDTLMAGQVLRP  123

Query  608  SGPKKLVSRASETQNTNGPYTIILEPTRLGFY-NQTKNSARPIL---YHDSSKWFSVGKS  441
                +L SR S T  + G Y++++EP  L  Y N +     P     YH      +  ++
Sbjct  124  G--MRLQSRRSRTDPSPGFYSLVMEPGGLVLYSNFSGTRQEPYWIRGYHGVDTLTAARQA  181

Query  440  SLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNT--TLTYLRLEIDGNLKTYTFYS  267
             L  +  N    +      +   +  G  +L +   NT    +++RLE DG+L  YT   
Sbjct  182  LLNMMLSNDTAPSGTRSQALCGLNATGGLLLTRSSANTPRNQSFIRLEFDGDLHAYTL--  239

Query  266  DAEENFHWGESFKLF  222
              E    W +S+ L 
Sbjct  240  --ESLLVWSDSYNLL  252



>ref|XP_002990448.1| hypothetical protein SELMODRAFT_131652, partial [Selaginella 
moellendorffii]
 gb|EFJ08541.1| hypothetical protein SELMODRAFT_131652, partial [Selaginella 
moellendorffii]
Length=377

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 125/255 (49%), Gaps = 15/255 (6%)
 Frame = -1

Query  962  FSNPFQLCFYNTTPNAYTLALRMGTVRS-ELRMRWVWEANRGKPVRDGAIFELRQDGNLV  786
            FS  + L F N+TP+ YTLA+ M          R +WEANR  PV   A   L  DG+LV
Sbjct  5    FSGVYNLGFVNSTPDRYTLAVLMNVDSGFPTTQRIIWEANREDPVGLNATLSLASDGDLV  64

Query  785  LADVDGRVAWQSETANKGVVGFKLL-QNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRL  609
            L D DGR+ W + TAN+G    +++ + GN+V+       +WQSFD PTDTL+ GQ LR 
Sbjct  65   LRDRDGRLVWSTGTANRGATRVEVVRETGNLVVF-RNNTILWQSFDRPTDTLMAGQVLRP  123

Query  608  SGPKKLVSRASETQNTNGPYTIILEPTRLGFY-NQTKNSARPIL---YHDSSKWFSVGKS  441
                +L SR S T  + G Y++++EP  L  Y N +     P     YH      +  ++
Sbjct  124  G--MRLQSRRSRTDPSPGFYSLVMEPGGLVLYSNFSGTRQEPYWIRGYHGVDTLTAARQA  181

Query  440  SLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNT--TLTYLRLEIDGNLKTYTFYS  267
             L  +  N    +      +   +  G  +L +   NT    +++RLE +G+L  YT   
Sbjct  182  LLNMMLSNDTAPSGTRSQALCGLNATGGLLLTRSSANTPRNQSFIRLEFEGDLHAYTL--  239

Query  266  DAEENFHWGESFKLF  222
              E    W +S+ L 
Sbjct  240  --ENLLIWSDSYNLL  252



>gb|KDO44632.1| hypothetical protein CISIN_1g0184022mg, partial [Citrus sinensis]
Length=285

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 95/152 (63%), Gaps = 6/152 (4%)
 Frame = -1

Query  677  GNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKN  498
            GNF+WQSFD+PTDTLLVGQSLR+    KLVSR S  +N +GP++ ++EP RL FY ++ +
Sbjct  1    GNFIWQSFDYPTDTLLVGQSLRVGRVTKLVSRLSVKENVDGPHSFVMEPKRLAFYYKSSS  60

Query  497  SARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLT  318
            + RPILY+     F +  + L+ +   +    +  +  +  SS     +  +PK+++T++
Sbjct  61   APRPILYYT----FPISYNGLKSLTLKSSPGKMH-ELTLVDSSGDNGFIFDRPKYDSTIS  115

Query  317  YLRLEIDGNLKTYTFYSDAEENFHWGESFKLF  222
            +LRL IDGNL+ +T YS   +     E F LF
Sbjct  116  FLRLGIDGNLRVFT-YSQEVDWLPEEERFTLF  146



>ref|XP_006358140.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=833

 Score =   123 bits (308),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 113/208 (54%), Gaps = 20/208 (10%)
 Frame = -1

Query  866  RW-----VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNG  702
            RW     VW ANR  P+ +    +L QDG+LVL DVDG + W + TANK V G K++  G
Sbjct  112  RWTDLELVWFANRNHPIHENGTLQLLQDGDLVLKDVDGTLVWSTGTANKFVSGIKMMDTG  171

Query  701  NMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTI-ILEPTR  525
            N+VLHD     VWQSFDHPTD LL GQ LR SG ++L +R S +  + G Y I +     
Sbjct  172  NLVLHDMYNQTVWQSFDHPTDALLPGQKLR-SG-QRLAARVSSSNWSEGNYYISVTNQGL  229

Query  524  LGFYNQTKNSARPILYHDSSKWFSVG-KSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVL  348
              FY     S +P +Y    K+   G + S +E    A   TL L     + ++  A V 
Sbjct  230  FAFY----ISDKPQMYF---KFLVSGERDSFDESYVKAVNGTLALYISSTEPNEPNA-VF  281

Query  347  AQPKFNTTLTYLRLEIDGNLKTYTFYSD  264
            ++P   + + YLR + DG+L+ YT  SD
Sbjct  282  SRP---SRMKYLRYDYDGHLRAYTEGSD  306



>ref|XP_002984805.1| hypothetical protein SELMODRAFT_121264, partial [Selaginella 
moellendorffii]
 gb|EFJ14055.1| hypothetical protein SELMODRAFT_121264, partial [Selaginella 
moellendorffii]
Length=447

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 89/265 (34%), Positives = 121/265 (46%), Gaps = 29/265 (11%)
 Frame = -1

Query  950  FQLCFYNTTPNAYTLALRMGTVRS----ELRMRWVWEANRGKPVRDGAIFELRQDGNLVL  783
            + L F N+TP  YTLAL +    S        R +WEANR  PV   A   L  DGNLVL
Sbjct  67   YNLGFANSTPGRYTLALVLNADLSYSGPSYTSRLIWEANREDPVGFNASLTLGADGNLVL  126

Query  782  ADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQSFDHPTDTLLVGQSLRLSG  603
             D DGR  W ++TANKG    ++L  GN V+  +    +WQSFDHP+DTL+V Q      
Sbjct  127  RDADGRSVWSTDTANKGATHAEILPTGNFVVR-SNNTILWQSFDHPSDTLMVSQIFEPG-  184

Query  602  PKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPILY-----HDSSKWFSVGKSS  438
              KL SR + + ++ G Y++++EP  L  Y+    S +P         D+         S
Sbjct  185  -MKLQSRTTLSNSSLGVYSLVMEPGGLVLYSNFSGSQQPYWVRSYYGQDTLSGALRTCDS  243

Query  437  LEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTT-------------LTYLRLEID  297
            L           L LD K   S+            N T              +++RLE D
Sbjct  244  LVAAVLEGDGPGLLLDLKTNGSAAANLKSQTLCSLNATEPLQLKNSNTWQNQSFIRLEPD  303

Query  296  GNLKTYTFYSDAEENFHWGESFKLF  222
            GNL+ YT  S    N  W + ++LF
Sbjct  304  GNLRAYTLGS---MNL-WEDPYQLF  324



>gb|EAY93506.1| hypothetical protein OsI_15301 [Oryza sativa Indica Group]
Length=863

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 109/194 (56%), Gaps = 13/194 (7%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW ANR +PVR+ A  EL  +GNLVL+D DG + W S ++ + V G ++   GN+VL D 
Sbjct  140  VWSANRARPVRENATLELTYNGNLVLSDADGSLVWSSGSSGRSVAGMEITDTGNLVLFDQ  199

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
            +   VWQSFDHPTDTLL GQSL + G  KL + ++ T +T     + ++P  L  Y +  
Sbjct  200  RNVTVWQSFDHPTDTLLPGQSL-MEG-MKLRANSTTTNSTENQVYMAVQPDGLFAYVE--  255

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
             S  P LY+  S   +  KS  +  K      +L +  +  + S      ++ P+ ++T 
Sbjct  256  -STPPQLYYSHS--VNTNKSGKDPTKVTFTNGSLSIFVQSTQPSN-----ISLPQASST-  306

Query  320  TYLRLEIDGNLKTY  279
             Y+RLE DG+L+ Y
Sbjct  307  QYMRLEFDGHLRLY  320



>emb|CAH66217.1| OSIGBa0157N01.3 [Oryza sativa Indica Group]
Length=838

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 109/194 (56%), Gaps = 13/194 (7%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW ANR +PVR+ A  EL  +GNLVL+D DG + W S ++ + V G ++   GN+VL D 
Sbjct  115  VWSANRARPVRENATLELTYNGNLVLSDADGSLVWSSGSSGRSVAGMEITDTGNLVLFDQ  174

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
            +   VWQSFDHPTDTLL GQSL + G  KL + ++ T +T     + ++P  L  Y +  
Sbjct  175  RNVTVWQSFDHPTDTLLPGQSL-MEG-MKLRANSTTTNSTENQVYMAVQPDGLFAYVE--  230

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
             S  P LY+  S   +  KS  +  K      +L +  +  + S      ++ P+ ++T 
Sbjct  231  -STPPQLYYSHS--VNTNKSGKDPTKVTFTNGSLSIFVQSTQPSN-----ISLPQASST-  281

Query  320  TYLRLEIDGNLKTY  279
             Y+RLE DG+L+ Y
Sbjct  282  QYMRLEFDGHLRLY  295



>gb|AFW71183.1| putative D-mannose binding lectin receptor-like protein kinase 
family protein [Zea mays]
Length=825

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 111/211 (53%), Gaps = 23/211 (11%)
 Frame = -1

Query  866  RWVWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLH  687
            R +W ANR +PV++ A  +  +DG+LVL D+DG + W + T+   VVG  L + GN++L 
Sbjct  117  RIIWTANRYRPVKENASLQFSKDGDLVLRDLDGSLVWSTATSGSSVVGMNLAETGNLILF  176

Query  686  DAKGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRAS-ETQNTNGPYTIILEPTRLGFYN  510
            D  G  VW+SF HPTDTLL+GQSL     K+L S AS ET +T G + + L  T  G Y 
Sbjct  177  DVMGKTVWESFAHPTDTLLIGQSLWQG--KRLSSTASTETNSTQGQFYLTLLGT--GLYA  232

Query  509  QTKNSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFN  330
             T ++  P LY+   K F+V  + L + K N  +   K     A  S L     A   FN
Sbjct  233  FTDDADPPQLYY--QKGFNVTDAILVQSKRNVSSDQAK--NSTAYVSFLQGSFSAFLSFN  288

Query  329  TTLT--------------YLRLEIDGNLKTY  279
            +T                ++ LE DG+L+ Y
Sbjct  289  STAIKLFDISLPLPSSAQFMSLEDDGHLRVY  319



>gb|KDO39293.1| hypothetical protein CISIN_1g040039mg, partial [Citrus sinensis]
Length=274

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 99/196 (51%), Gaps = 6/196 (3%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW ANR  PVR  A  EL  DGNLVL D DG +AW + T+ K VVG  L   GN+VL D 
Sbjct  40   VWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDK  99

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
                VWQSFDHPTD+L+ GQ L L G KKL +  S T  T+G     L  T  G +   +
Sbjct  100  NNAAVWQSFDHPTDSLVPGQKL-LEG-KKLTASVSTTNWTDGGL-FSLSVTNEGLFAFIE  156

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
            ++   I Y+   K     K+S E         +L      ++  +    V   P  ++  
Sbjct  157  SNNTSIRYYALVK---ATKTSKEPSHARYLNGSLAFFINSSEPREPDGAVPVPPASSSPG  213

Query  320  TYLRLEIDGNLKTYTF  273
             Y+RL  DG+L+ Y +
Sbjct  214  QYMRLWPDGHLRVYEW  229



>ref|XP_006492266.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X1 [Citrus sinensis]
 ref|XP_006492267.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X2 [Citrus sinensis]
 ref|XP_006492268.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X3 [Citrus sinensis]
Length=845

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 100/194 (52%), Gaps = 6/194 (3%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW ANR  PVR  A  EL  DGNLVL D DG +AW + T+ K VVG  L   GN+VL D 
Sbjct  110  VWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDK  169

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
                VWQSFDHPTD+L+ GQ L L G KKL +  S T  T+G   + L  T  G +   +
Sbjct  170  NKAAVWQSFDHPTDSLVPGQKL-LEG-KKLTASVSTTNWTDGGL-LSLSVTNEGLFAFIE  226

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
            ++   + Y+   K  +  K+S E        ++L L    ++  +    V   P      
Sbjct  227  SNNTSVPYY---KLLTASKTSKEPSHARYLNRSLALFINTSEPREPDGEVFLHPALLFPG  283

Query  320  TYLRLEIDGNLKTY  279
             Y+RL  DG+L+ Y
Sbjct  284  QYMRLWPDGHLRVY  297



>ref|XP_006448031.1| hypothetical protein CICLE_v10014464mg [Citrus clementina]
 gb|ESR61271.1| hypothetical protein CICLE_v10014464mg [Citrus clementina]
Length=697

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 117/247 (47%), Gaps = 24/247 (10%)
 Frame = -1

Query  965  VFSNPFQL--------C--FYNTTPNAYTLALRMGTVRSELRM--------RWVWEANRG  840
            +FS PF          C  F N T ++Y  A+ +    S   +          VW ANR 
Sbjct  15   IFSTPFSCLVDAQRYACGFFCNGTCDSYLFAVFIVQTNSVSNIVSPAFGFPHVVWSANRN  74

Query  839  KPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDAKGNFVWQ  660
             PVR  A  EL  DGNLVL D DG +AW + T+ K VVG  L   GN+VL D     VWQ
Sbjct  75   NPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNKAAVWQ  134

Query  659  SFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTKNSARPIL  480
            SFDHPTD+L+ GQ L L G KKL +  S T  T+G   + L  T  G +   +++   + 
Sbjct  135  SFDHPTDSLVPGQKL-LEG-KKLTASVSTTNWTDGGL-LSLSVTNEGLFAFIESNNTSVP  191

Query  479  YHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTLTYLRLEI  300
            Y+   K  +  K+S E        ++L L    ++  +    V   P       Y+RL  
Sbjct  192  YY---KLLTASKTSKEPSHARYLNRSLALFINTSEPREPDGEVFLHPALLFPGQYMRLWP  248

Query  299  DGNLKTY  279
            DG+L+ Y
Sbjct  249  DGHLRVY  255



>ref|XP_010038762.1| PREDICTED: epidermis-specific secreted glycoprotein EP1-like 
[Eucalyptus grandis]
Length=287

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 97/192 (51%), Gaps = 10/192 (5%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW AN   PV + A  EL  +G+L+L D DG VAW ++T  + VVG KL   GN+VL D 
Sbjct  105  VWSANWTHPVGNQATLELTVEGDLILKDADGSVAWSTQTCGESVVGMKLTDTGNLVLFDK  164

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
                VWQS DHPTDTLL+GQ LR+ G K   S  +   N  G Y++ L  T  G + Q +
Sbjct  165  NNAVVWQSIDHPTDTLLLGQKLRV-GQKLTPSNIATNMNEQGLYSLSL--TTEGLFAQVE  221

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
                P +Y+ S   F    S    V+F      L L+Y    S   G    A  +F    
Sbjct  222  TDP-PQVYYASRINFPDTSSGSNYVEFTQGHLELFLNYTRNGSLFSGYVSTAAVQF----  276

Query  320  TYLRLEIDGNLK  285
              L+ E DG+L+
Sbjct  277  --LKFESDGHLR  286



>gb|EAZ30147.1| hypothetical protein OsJ_14201 [Oryza sativa Japonica Group]
Length=863

 Score =   114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 110/194 (57%), Gaps = 13/194 (7%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW ANR +PVR+ A  EL  +GNLVL+D DG + W S ++++ V G ++   GN+VL D 
Sbjct  140  VWSANRARPVRENATLELTYNGNLVLSDADGSLVWSSGSSSRSVAGMEITDTGNLVLFDQ  199

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
            +   VWQSFDHPTDTLL GQSL + G  KL + ++ T +T     + ++P  L  Y +  
Sbjct  200  RNVTVWQSFDHPTDTLLPGQSL-MEG-MKLRANSTTTNSTENQVYMAVQPDGLFAYVE--  255

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
             S  P LY+  S   +  KS  +  K      +L +  +  + S      ++ P+ ++T 
Sbjct  256  -STPPQLYYSHS--VNTNKSGKDPTKVTFTNGSLSIFVQSTQPSN-----ISLPQASST-  306

Query  320  TYLRLEIDGNLKTY  279
             Y+RLE DG+L+ Y
Sbjct  307  QYMRLEFDGHLRLY  320



>emb|CAE05335.2| OSJNBa0079M09.4 [Oryza sativa Japonica Group]
Length=838

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 110/194 (57%), Gaps = 13/194 (7%)
 Frame = -1

Query  860  VWEANRGKPVRDGAIFELRQDGNLVLADVDGRVAWQSETANKGVVGFKLLQNGNMVLHDA  681
            VW ANR +PVR+ A  EL  +GNLVL+D DG + W S ++++ V G ++   GN+VL D 
Sbjct  115  VWSANRARPVRENATLELTYNGNLVLSDADGSLVWSSGSSSRSVAGMEITDTGNLVLFDQ  174

Query  680  KGNFVWQSFDHPTDTLLVGQSLRLSGPKKLVSRASETQNTNGPYTIILEPTRLGFYNQTK  501
            +   VWQSFDHPTDTLL GQSL + G  KL + ++ T +T     + ++P  L  Y +  
Sbjct  175  RNVTVWQSFDHPTDTLLPGQSL-MEG-MKLRANSTTTNSTENQVYMAVQPDGLFAYVE--  230

Query  500  NSARPILYHDSSKWFSVGKSSLEEVKFNAKTQTLKLDYKVAKSSKLGAHVLAQPKFNTTL  321
             S  P LY+  S   +  KS  +  K      +L +  +  + S      ++ P+ ++T 
Sbjct  231  -STPPQLYYSHS--VNTNKSGKDPTKVTFTNGSLSIFVQSTQPSN-----ISLPQASST-  281

Query  320  TYLRLEIDGNLKTY  279
             Y+RLE DG+L+ Y
Sbjct  282  QYMRLEFDGHLRLY  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3025133731368