BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8578_g1_i2 len=2530 path=[2508:0-1996 4505:1997-2059
4568:2060-2529]

Length=2530
                                                                      Score     E

ref|XP_009596740.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    658   0.0      
ref|XP_010321210.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    657   0.0      
ref|XP_006342779.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    653   0.0      
ref|XP_009763391.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    649   0.0      
ref|XP_011090847.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    646   0.0      
ref|XP_002276628.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    622   0.0      Vitis vinifera
ref|XP_006489151.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    616   0.0      
ref|XP_007222603.1|  hypothetical protein PRUPE_ppa006294mg             613   0.0      
ref|XP_006419664.1|  hypothetical protein CICLE_v10005043mg             612   0.0      
gb|KDP40021.1|  hypothetical protein JCGZ_02019                         611   0.0      
ref|XP_010241367.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    611   0.0      
emb|CDO98913.1|  unnamed protein product                                609   0.0      
ref|XP_011013337.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    607   0.0      
ref|XP_002311844.1|  isoflavone reductase-related family protein        606   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010105025.1|  hypothetical protein L484_008466                   605   0.0      
ref|XP_007035487.1|  NAD(P)-binding Rossmann-fold superfamily pro...    600   0.0      
gb|EYU43897.1|  hypothetical protein MIMGU_mgv1a018558mg                594   0.0      
ref|XP_008223105.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    591   0.0      
ref|XP_008438802.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    590   0.0      
ref|XP_004134186.1|  PREDICTED: uncharacterized protein LOC101218189    589   0.0      
ref|XP_009369106.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    589   0.0      
ref|XP_010524762.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    588   0.0      
ref|XP_003546097.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    588   0.0      
ref|XP_003542917.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    587   0.0      
ref|XP_004296795.1|  PREDICTED: uncharacterized protein ycf39-like      587   0.0      
ref|XP_010024569.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    586   0.0      
ref|XP_004159826.1|  PREDICTED: uncharacterized LOC101218189            585   0.0      
ref|XP_009352212.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    583   0.0      
ref|XP_007147868.1|  hypothetical protein PHAVU_006G161600g             582   0.0      
ref|XP_009345803.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    580   0.0      
gb|KDO75077.1|  hypothetical protein CISIN_1g043385mg                   578   0.0      
ref|XP_008390783.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    578   0.0      
ref|XP_010675087.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    576   0.0      
ref|XP_006400418.1|  hypothetical protein EUTSA_v10013668mg             575   0.0      
ref|XP_004486059.1|  PREDICTED: protein TIC 62, chloroplastic-like      573   0.0      
ref|XP_010492887.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    571   0.0      
ref|XP_008353235.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    571   0.0      
ref|XP_002873908.1|  pale-green and chlorophyll B reduced 2             570   0.0      
ref|NP_197367.1|  3,8-divinyl protochlorophyllide                       568   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420646.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    566   0.0      
ref|XP_003593996.1|  hypothetical protein MTR_2g020160                  565   0.0      
ref|XP_010454119.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    565   0.0      
gb|AAM62911.1|  unknown                                                 565   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41829.1|  unknown protein                                        564   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85481.1|  unknown                                                 563   0.0      Medicago truncatula
ref|XP_006289483.1|  hypothetical protein CARUB_v10003017mg             563   0.0      
emb|CDY13910.1|  BnaC09g39160D                                          562   0.0      
ref|XP_009120951.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    560   0.0      
ref|XP_010921737.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    554   0.0      
gb|EPS66272.1|  hypothetical protein M569_08504                         551   0.0      
ref|XP_007035488.1|  NAD(P)-binding Rossmann-fold superfamily pro...    552   0.0      
emb|CDX92592.1|  BnaA10g16310D                                          553   0.0      
ref|XP_008812306.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    542   0.0      
ref|XP_006855435.1|  hypothetical protein AMTR_s00057p00165960          533   1e-177   
gb|ABR17729.1|  unknown                                                 529   1e-176   Picea sitchensis
emb|CAN63393.1|  hypothetical protein VITISV_001886                     522   9e-175   Vitis vinifera
ref|XP_009414186.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    518   1e-172   
dbj|BAJ85154.1|  predicted protein                                      491   2e-162   
ref|XP_003557853.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    488   3e-161   
ref|NP_001050115.1|  Os03g0351200                                       487   5e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984383.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    483   8e-159   
ref|XP_002465274.1|  hypothetical protein SORBIDRAFT_01g035390          480   2e-158   Sorghum bicolor [broomcorn]
gb|AFR53112.1|  divinyl reductase                                       477   3e-157   
ref|XP_001771287.1|  predicted protein                                  478   3e-157   
ref|NP_001148282.1|  divinyl chlorophyllide a 8-vinyl-reductase, ...    476   6e-157   Zea mays [maize]
ref|XP_005649981.1|  NAD(P)-binding protein                             459   5e-151   
ref|XP_002516871.1|  conserved hypothetical protein                     459   7e-151   Ricinus communis
ref|XP_005850169.1|  hypothetical protein CHLNCDRAFT_56043              432   1e-140   
ref|XP_002953959.1|  hypothetical protein VOLCADRAFT_76013              434   3e-140   
ref|WP_012474793.1|  oxidoreductase                                     421   3e-136   
ref|WP_028951847.1|  oxidoreductase                                     420   7e-136   
ref|WP_038544377.1|  oxidoreductase                                     419   1e-135   
ref|WP_011127828.1|  oxidoreductase                                     417   1e-134   
ref|XP_001690168.1|  3,8-divinyl protochlorophyllide a 8-vinyl re...    417   7e-134   Chlamydomonas reinhardtii
gb|AHF63388.1|  hypothetical protein Syncc8109_1014                     412   9e-133   
gb|AII45521.1|  oxidoreductase                                          411   1e-132   
gb|KFM25948.1|  Uncharacterized protein ycf39                           412   2e-132   
ref|WP_011360161.1|  oxidoreductase                                     411   2e-132   
ref|WP_009789553.1|  oxidoreductase                                     410   3e-132   
ref|WP_012502262.1|  oxidoreductase                                     410   6e-132   
tpg|DAA45366.1|  TPA: hypothetical protein ZEAMMB73_163548              411   6e-132   
ref|WP_011364574.1|  oxidoreductase                                     409   9e-132   
ref|WP_012507930.1|  oxidoreductase                                     408   2e-131   
ref|WP_010932741.1|  oxidoreductase                                     406   1e-130   
ref|XP_002976331.1|  hypothetical protein SELMODRAFT_55147              405   3e-130   
ref|XP_002987313.1|  hypothetical protein SELMODRAFT_45092              404   1e-129   
ref|XP_006651376.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    397   2e-128   
ref|WP_038554329.1|  oxidoreductase                                     399   9e-128   
ref|WP_011889777.1|  oxidoreductase                                     397   8e-127   
ref|WP_006852306.1|  oxidoreductase                                     393   1e-125   
ref|WP_012505780.1|  oxidoreductase                                     392   4e-125   
ref|XP_001421306.1|  predicted protein                                  392   1e-124   Ostreococcus lucimarinus CCE9901
ref|XP_007515010.1|  NmrA family protein                                392   3e-124   
ref|WP_011357234.1|  oxidoreductase                                     387   3e-123   
ref|XP_002505345.1|  3,8-divinyl protochlorophyllide a 8-vinyl re...    387   2e-122   Micromonas commoda
emb|CEG01792.1|  NAD(P)-binding domain                                  386   2e-122   
ref|XP_003083332.1|  Predicted dehydrogenase (ISS)                      386   2e-122   
ref|WP_011618948.1|  oxidoreductase                                     385   7e-122   
ref|WP_011362086.1|  oxidoreductase                                     382   1e-121   
ref|WP_006366632.1|  oxidoreductase                                     381   4e-121   
ref|XP_005823840.1|  8-vinyl reductase                                  375   1e-117   
ref|XP_003060270.1|  3,8-divinyl protochlorophyllide a 8-vinyl re...    374   2e-117   
emb|CCC15097.1|  3,8-divinyl protochlorophyllide a 8-vinyl reductase    363   8e-113   
ref|WP_034416297.1|  oxidoreductase                                     347   3e-108   
gb|EMS52423.1|  hypothetical protein TRIUR3_02709                       327   3e-102   
ref|WP_035526307.1|  epimerase                                          323   1e-98    
ref|WP_035516132.1|  hypothetical protein                               320   1e-97    
ref|WP_034492161.1|  epimerase                                          318   3e-97    
ref|WP_029059232.1|  epimerase                                          316   2e-96    
ref|WP_023411876.1|  hypothetical protein                               313   1e-94    
ref|WP_007197007.1|  epimerase                                          311   3e-94    
ref|WP_010467713.1|  epimerase                                          308   2e-93    
ref|WP_009030287.1|  epimerase                                          306   8e-93    
ref|WP_012162873.1|  epimerase                                          306   2e-92    
ref|WP_006517457.1|  putative nucleoside-diphosphate sugar epimerase    305   3e-92    
ref|WP_026849060.1|  epimerase                                          304   1e-91    
ref|WP_029140308.1|  epimerase                                          303   3e-91    
gb|EIZ82844.1|  NAD-dependent epimerase/dehydratase                     301   6e-91    
ref|WP_023075391.1|  epimerase                                          301   8e-91    
ref|WP_019905757.1|  epimerase                                          301   8e-91    
ref|WP_009550096.1|  epimerase                                          301   1e-90    
ref|WP_040844167.1|  epimerase                                          301   1e-90    
gb|EXJ16439.1|  Divinyl protochlorophyllide a 8-vinyl-reductase         300   2e-90    
ref|WP_011925529.1|  epimerase                                          300   3e-90    
ref|WP_006613377.1|  epimerase                                          299   3e-90    
ref|WP_039332943.1|  epimerase                                          298   1e-89    
ref|WP_011910783.1|  epimerase                                          298   1e-89    
ref|WP_031447776.1|  epimerase                                          298   2e-89    
ref|WP_008964061.1|  epimerase                                          296   3e-89    
ref|WP_015133448.1|  NAD-dependent epimerase/dehydratase                296   1e-88    
ref|WP_008028070.1|  epimerase                                          295   3e-88    
ref|WP_026190588.1|  epimerase                                          295   4e-88    
ref|WP_019428305.1|  hypothetical protein                               294   4e-88    
ref|WP_028641859.1|  epimerase                                          293   6e-88    
ref|WP_040706521.1|  epimerase                                          293   1e-87    
gb|EMS40737.1|  hypothetical protein MmSR116_4255                       293   1e-87    
ref|WP_039903678.1|  epimerase                                          292   2e-87    
ref|WP_026605224.1|  epimerase                                          292   3e-87    
ref|WP_012332942.1|  epimerase                                          291   6e-87    
ref|WP_015668184.1|  hypothetical protein                               288   9e-87    
ref|WP_033921385.1|  epimerase                                          291   1e-86    
gb|EMS66826.1|  hypothetical protein TRIUR3_34906                       286   2e-86    
ref|WP_012042991.1|  epimerase                                          289   3e-86    
ref|WP_039894310.1|  epimerase                                          288   3e-86    
ref|WP_009827978.1|  epimerase                                          288   4e-86    
ref|WP_008191018.1|  epimerase                                          287   2e-85    
ref|WP_011339018.1|  epimerase                                          287   3e-85    
ref|WP_007812089.1|  epimerase                                          286   4e-85    
emb|CBJ30364.1|  3,8-divinyl protochlorophyllide a 8-vinyl reduct...    287   4e-85    
gb|AIQ92467.1|  Glucose/sorbosone dehydrogenase-like protein            284   5e-85    
ref|WP_009561256.1|  Divinyl protochlorophyllide a 8-vinyl-reductase    285   1e-84    
ref|WP_011842660.1|  epimerase                                          282   2e-83    
ref|WP_029940970.1|  epimerase                                          282   2e-83    
ref|WP_002723534.1|  epimerase                                          282   3e-83    
ref|WP_039683909.1|  epimerase                                          278   3e-82    
gb|EMT13025.1|  hypothetical protein F775_24683                         275   4e-82    
ref|WP_028794171.1|  epimerase                                          278   5e-82    
gb|EAU39711.1|  hypothetical protein FP2506_13289                       276   2e-81    Fulvimarina pelagi HTCC2506
ref|WP_040489836.1|  epimerase                                          276   3e-81    
sp|A2PZE5.2|CSPL1_IPONI  RecName: Full=CASP-like protein IN26; Al...    270   7e-81    Ipomoea nil [qian niu]
ref|WP_026352699.1|  epimerase                                          274   8e-81    
gb|EGV32173.1|  3,8-divinyl protochlorophyllide a 8-vinyl reducta...    273   9e-81    
gb|AHM03217.1|  Divinyl protochlorophyllide a 8-vinyl-reductase         273   2e-80    
ref|XP_010027034.1|  PREDICTED: divinyl chlorophyllide a 8-vinyl-...    268   8e-80    
ref|WP_038650876.1|  epimerase                                          270   2e-79    
gb|EKE78069.1|  hypothetical protein P24_03550                          269   3e-79    
ref|WP_009817942.1|  epimerase                                          270   3e-79    
ref|WP_023920211.1|  epimerase                                          269   1e-78    
ref|WP_029310694.1|  epimerase                                          266   5e-78    
gb|ETD80575.1|  epimerase                                               266   6e-78    
ref|WP_023915621.1|  epimerase                                          266   8e-78    
ref|WP_013068957.1|  epimerase                                          266   1e-77    
ref|WP_037118243.1|  epimerase                                          264   5e-77    
ref|WP_036801180.1|  epimerase                                          263   1e-76    
ref|WP_034952092.1|  epimerase                                          262   4e-76    
ref|XP_002288833.1|  predicted protein                                  265   3e-75    Thalassiosira pseudonana CCMP1335
gb|EWM24553.1|  NAD(P)-binding domain protein                           261   8e-75    
gb|EJK64133.1|  hypothetical protein THAOC_15156                        263   1e-74    
ref|WP_037272836.1|  epimerase                                          258   2e-74    
ref|WP_037969244.1|  hypothetical protein                               256   2e-74    
gb|EEC75257.1|  hypothetical protein OsI_11570                          250   4e-74    Oryza sativa Indica Group [Indian rice]
ref|WP_007165227.1|  epimerase                                          254   2e-73    
gb|KIN64281.1|  3,8-divinyl protochlorophyllide a 8-vinyl reductase     253   2e-73    
ref|WP_017666291.1|  hypothetical protein                               252   6e-73    
gb|KEO90062.1|  epimerase                                               249   1e-71    
ref|XP_002184654.1|  predicted protein                                  251   2e-71    Phaeodactylum tricornutum CCAP 1055/1
gb|AII88479.1|  hypothetical protein, NmrA-like protein                 249   2e-71    
ref|WP_040811554.1|  epimerase                                          249   3e-71    
gb|EAW41560.1|  hypothetical protein MGP2080_02665                      248   3e-71    marine gamma proteobacterium HTCC2080
ref|WP_025064323.1|  epimerase                                          248   4e-71    
gb|AAM48668.1|  conserved hypothetical protein                          248   4e-71    uncultured proteobacterium
gb|KIN74828.1|  putative nucleoside-diphosphate sugar epimerase         249   4e-71    
ref|WP_034960028.1|  epimerase                                          247   5e-71    
gb|EDM32385.1|  hypothetical protein RTM1035_13053                      244   9e-70    Roseovarius sp. TM1035
ref|WP_037297544.1|  epimerase                                          244   9e-70    
ref|XP_002294048.1|  predicted protein                                  243   3e-69    Thalassiosira pseudonana CCMP1335
ref|WP_034906302.1|  epimerase                                          241   2e-68    
ref|WP_036180499.1|  epimerase                                          239   6e-68    
ref|WP_009159694.1|  epimerase                                          237   3e-67    
ref|WP_040362266.1|  epimerase                                          238   4e-67    
dbj|BAF46307.1|  integral membrane family protein                       226   3e-65    Ipomoea nil [qian niu]
ref|WP_040808521.1|  epimerase                                          232   3e-65    
ref|XP_005768361.1|  hypothetical protein EMIHUDRAFT_464355             232   3e-64    
gb|EAQ99341.2|  Acyl-CoA dehydrogenase                                  236   5e-63    Congregibacter litoralis KT71
ref|WP_027442586.1|  epimerase                                          225   5e-63    
gb|EED32746.1|  NAD-dependent epimerase/dehydratase                     216   4e-60    gamma proteobacterium NOR5-3
ref|WP_022573870.1|  putative nucleoside-diphosphate sugar epimerase    216   2e-59    
ref|XP_009033859.1|  hypothetical protein AURANDRAFT_20831              209   1e-56    
gb|EJK67755.1|  hypothetical protein THAOC_11173                        166   2e-42    
ref|XP_009596742.1|  PREDICTED: CASP-like protein 1                     150   2e-37    
gb|AFK37564.1|  unknown                                                 141   9e-35    
ref|XP_009763390.1|  PREDICTED: CASP-like protein 1                     140   5e-34    
ref|XP_011071479.1|  PREDICTED: CASP-like protein 1                     139   2e-33    
ref|XP_006342778.1|  PREDICTED: CASP-like protein IN26-like             138   3e-33    
ref|XP_004229219.1|  PREDICTED: CASP-like protein 1                     131   7e-31    
emb|CDO98910.1|  unnamed protein product                                130   5e-30    
ref|XP_011090848.1|  PREDICTED: CASP-like protein 1                     129   7e-30    
sp|Q20BM9.1|CSPL1_PANGI  RecName: Full=CASP-like protein 1              122   3e-28    Panax ginseng [Chinese ginseng]
gb|EYU43898.1|  hypothetical protein MIMGU_mgv1a025880mg                123   4e-28    
ref|XP_011081169.1|  PREDICTED: CASP-like protein 1                     120   6e-27    
ref|XP_002312755.2|  hypothetical protein POPTR_0008s20950g             114   5e-25    Populus trichocarpa [western balsam poplar]
emb|CBI26108.3|  unnamed protein product                                112   8e-25    
ref|XP_011013338.1|  PREDICTED: CASP-like protein 1D1                   112   2e-24    
gb|KDP40020.1|  hypothetical protein JCGZ_02018                         110   2e-23    
ref|XP_007035489.1|  CASP-like protein RCOM_0679870, putative           110   2e-23    
ref|XP_003628900.1|  Caffeic acid 3-O-methyltransferase                 114   2e-23    
ref|XP_002276229.1|  PREDICTED: CASP-like protein 1D1                   110   3e-23    Vitis vinifera
emb|CBI26109.3|  unnamed protein product                                108   3e-23    
ref|XP_009419511.1|  PREDICTED: CASP-like protein MA4_106O17.52         107   2e-22    
ref|XP_003542918.1|  PREDICTED: CASP-like protein 7-like isoform X1     105   7e-22    
ref|XP_010241335.1|  PREDICTED: CASP-like protein 1D1                   105   7e-22    
ref|XP_010666392.1|  PREDICTED: CASP-like protein Ni6                   105   7e-22    
ref|XP_010245386.1|  PREDICTED: CASP-like protein 1D1                   105   7e-22    
gb|EYU29828.1|  hypothetical protein MIMGU_mgv1a016414mg                102   1e-21    
ref|XP_007154229.1|  hypothetical protein PHAVU_003G101100g             104   1e-21    
ref|XP_006419661.1|  hypothetical protein CICLE_v10005986mg             104   2e-21    
sp|D2KQI6.1|CSPL1_BETVM  RecName: Full=CASP-like protein Ni6; Alt...    103   4e-21    Beta vulgaris subsp. maritima [sea beet]
ref|XP_002516872.1|  conserved hypothetical protein                     103   6e-21    Ricinus communis
ref|XP_010548920.1|  PREDICTED: CASP-like protein 1D1                   102   7e-21    
ref|XP_006489150.1|  PREDICTED: CASP-like protein RCOM_0679870-like   99.8    7e-20    
gb|KHN03003.1|  CASP-like protein 7                                   99.0    1e-19    
gb|KDO75080.1|  hypothetical protein CISIN_1g029779mg                 99.0    1e-19    
ref|XP_008390731.1|  PREDICTED: CASP-like protein VIT_05s0020g01830   99.0    1e-19    
ref|NP_001237481.1|  CASP-like protein 1D1                            98.6    2e-19    
gb|KHN03390.1|  CASP-like protein 8                                   98.2    2e-19    
ref|NP_001238662.1|  CASP-like protein 1D2                            97.4    4e-19    
ref|XP_010024567.1|  PREDICTED: CASP-like protein 1                   97.4    5e-19    
ref|XP_010036808.1|  PREDICTED: CASP-like protein 1D1                 97.4    7e-19    
ref|WP_020588900.1|  hypothetical protein                             98.6    8e-19    
ref|WP_026738272.1|  NAD-dependent dehydratase                        97.8    1e-18    
ref|XP_004508310.1|  PREDICTED: CASP-like protein 7-like              95.1    3e-18    
ref|XP_007147869.1|  hypothetical protein PHAVU_006G161700g           95.9    3e-18    
ref|XP_009352214.1|  PREDICTED: CASP-like protein VIT_05s0020g01830   93.2    1e-17    
ref|XP_004296796.1|  PREDICTED: CASP-like protein 7-like              92.4    2e-17    
dbj|GAL31855.1|  oxidoreductase                                       94.0    3e-17    
ref|XP_004159824.1|  PREDICTED: CASP-like protein 8-like              92.0    3e-17    
ref|XP_009399245.1|  PREDICTED: CASP-like protein MA4_106O17.52       92.0    3e-17    
ref|XP_003609582.1|  hypothetical protein MTR_4g118800                92.0    3e-17    
sp|Q1EPG6.2|CSPL2_MUSAC  RecName: Full=CASP-like protein 1D1; Sho...  92.0    3e-17    Musa acuminata [banana]
gb|AFK39780.1|  unknown                                               91.3    5e-17    
ref|XP_010105026.1|  hypothetical protein L484_008467                 91.7    5e-17    
ref|XP_006419662.1|  hypothetical protein CICLE_v10006955mg           90.1    6e-17    
ref|WP_009095603.1|  NmrA family protein                              92.0    9e-17    
ref|XP_008223106.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   90.5    1e-16    
ref|XP_009369105.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   90.5    1e-16    
ref|XP_006414480.1|  hypothetical protein EUTSA_v10026308mg           90.1    1e-16    
ref|XP_008799290.1|  PREDICTED: CASP-like protein MA4_106O17.52       90.5    1e-16    
ref|XP_006489266.1|  PREDICTED: CASP-like protein RCOM_0679870-like   90.1    1e-16    
ref|XP_007225850.1|  hypothetical protein PRUPE_ppa011684mg           90.1    2e-16    
ref|WP_037231460.1|  epimerase                                        90.9    2e-16    
gb|EFJ78433.1|  TrkA N-terminal domain protein                        90.5    3e-16    
ref|WP_007093546.1|  hypothetical protein                             89.4    7e-16    
ref|WP_025865961.1|  hypothetical protein                             89.4    7e-16    
ref|XP_010904771.1|  PREDICTED: CASP-like protein 1D1                 88.2    7e-16    
emb|CDY09750.1|  BnaC07g33110D                                        87.8    8e-16    
ref|WP_009235063.1|  hypothetical protein                             89.0    1e-15    
ref|XP_009136704.1|  PREDICTED: CASP-like protein ARALYDRAFT_915236   87.0    2e-15    
ref|WP_020529879.1|  hypothetical protein                             87.8    2e-15    
ref|XP_002870226.1|  integral membrane family protein                 86.3    2e-15    
ref|XP_008438804.1|  PREDICTED: CASP-like protein VIT_05s0020g01830   86.3    3e-15    
ref|XP_006407952.1|  hypothetical protein EUTSA_v10021548mg           86.3    3e-15    
ref|XP_008799291.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   85.9    3e-15    
ref|WP_028581098.1|  NAD-dependent dehydratase                        87.0    4e-15    
gb|EEX34360.1|  oxidoreductase                                        86.7    5e-15    
ref|WP_039951371.1|  NAD-dependent dehydratase                        86.7    5e-15    
ref|WP_039443004.1|  NAD-dependent dehydratase                        86.7    5e-15    
ref|WP_031444232.1|  NAD-dependent dehydratase                        86.7    6e-15    
ref|WP_035483145.1|  hypothetical protein                             86.3    7e-15    
ref|WP_019274896.1|  epimerase                                        86.3    8e-15    
ref|WP_012499165.1|  NAD-dependent epimerase/dehydratase              85.9    8e-15    
ref|WP_039463336.1|  NAD-dependent dehydratase                        85.9    9e-15    
ref|XP_006284566.1|  hypothetical protein CARUB_v10005787mg           84.3    1e-14    
ref|WP_035544497.1|  hypothetical protein                             85.5    1e-14    
ref|XP_010024568.1|  PREDICTED: CASP-like protein 1                   84.3    1e-14    
ref|WP_006062985.1|  NAD dependent epimerase/dehydratase family p...  85.5    1e-14    
ref|WP_018967535.1|  NmrA family protein                              85.5    1e-14    
ref|WP_023924525.1|  hypothetical protein                             85.5    1e-14    
ref|WP_025797827.1|  NAD-dependent dehydratase                        85.1    2e-14    
gb|KGE85047.1|  NAD-dependent dehydratase                             85.1    2e-14    
ref|NP_187290.1|  uncharacterized protein                             84.0    2e-14    
ref|XP_009129665.1|  PREDICTED: CASP-like protein At3g06390           84.0    2e-14    
ref|WP_039438048.1|  NAD-dependent dehydratase                        85.1    2e-14    
emb|CDX76993.1|  BnaC04g37880D                                        84.0    2e-14    
ref|XP_004134470.1|  PREDICTED: CASP-like protein VIT_05s0020g018...  82.8    2e-14    
ref|WP_024992408.1|  NAD-dependent dehydratase                        84.7    2e-14    
ref|WP_006887404.1|  epimerase                                        84.7    2e-14    
ref|WP_023407377.1|  hypothetical protein                             84.7    2e-14    
ref|WP_009229201.1|  NAD dependent epimerase/dehydratase family p...  84.7    2e-14    
emb|CDY05260.1|  BnaC05g45430D                                        83.6    2e-14    
ref|WP_037237124.1|  epimerase                                        84.7    2e-14    
ref|WP_039427253.1|  NAD-dependent dehydratase                        84.7    2e-14    
ref|WP_038899308.1|  NAD-dependent dehydratase                        84.3    2e-14    
ref|WP_005469358.1|  epimerase                                        84.3    3e-14    
ref|NP_001239666.1|  CASP-like protein 1E1                            82.8    3e-14    
ref|WP_015465045.1|  NAD-dependent epimerase/dehydratase              84.3    3e-14    
gb|AIV07711.1|  NAD-dependent dehydratase                             84.0    4e-14    
ref|WP_036829251.1|  NAD-dependent dehydratase                        84.0    4e-14    
ref|WP_009161874.1|  NAD dependent epimerase/dehydratase family p...  83.6    5e-14    
ref|WP_029788281.1|  NAD-dependent dehydratase                        83.6    5e-14    
ref|WP_040122411.1|  NAD-dependent dehydratase                        83.6    5e-14    
gb|AIW22797.1|  NAD-dependent dehydratase                             83.6    6e-14    
ref|WP_020534954.1|  hypothetical protein                             83.2    6e-14    
ref|XP_010105027.1|  hypothetical protein L484_008468                 84.0    6e-14    
gb|AAG40073.2|AF324722_1  AT4g15610                                   81.3    6e-14    
ref|WP_011745509.1|  3-beta hydroxysteroid dehydrogenase              83.2    6e-14    
ref|WP_027878797.1|  NAD-dependent dehydratase                        83.2    7e-14    
ref|WP_018626669.1|  hypothetical protein                             82.8    9e-14    
ref|XP_010449919.1|  PREDICTED: CASP-like protein 1D1                 81.6    1e-13    
ref|XP_010440275.1|  PREDICTED: CASP-like protein 1D1                 81.6    1e-13    
ref|WP_009216838.1|  NAD dependent epimerase/dehydratase family p...  82.4    1e-13    
ref|NP_567472.1|  uncharacterized protein                             81.3    1e-13    
ref|WP_009697937.1|  epimerase                                        82.4    1e-13    
ref|XP_010546916.1|  PREDICTED: CASP-like protein 1D2                 80.9    2e-13    
gb|EKM32974.1|  NAD dependent epimerase/dehydratase family protein    81.6    2e-13    
ref|WP_017818456.1|  epimerase                                        81.6    2e-13    
ref|WP_009706414.1|  epimerase                                        81.6    2e-13    
gb|KIF25217.1|  NAD-dependent dehydratase                             81.3    2e-13    
ref|XP_003546096.2|  PREDICTED: CASP-like protein 6-like              80.5    3e-13    
ref|WP_038879571.1|  NAD-dependent dehydratase                        80.9    3e-13    
ref|WP_006958461.1|  epimerase                                        80.9    3e-13    
ref|WP_007961375.1|  NAD-dependent epimerase/dehydratase              80.9    3e-13    
ref|XP_002884576.1|  integral membrane family protein                 80.1    4e-13    
gb|KFK38097.1|  hypothetical protein AALP_AA3G069100                  80.1    4e-13    
gb|EAZ03696.1|  hypothetical protein OsI_25828                        80.1    4e-13    
ref|XP_010434941.1|  PREDICTED: CASP-like protein 1D1                 79.7    4e-13    
ref|WP_017189637.1|  epimerase                                        80.9    4e-13    
ref|WP_014200653.1|  putative nucleoside-diphosphate sugar epimerase  80.5    4e-13    
ref|WP_006949226.1|  3-beta hydroxysteroid dehydrogenase/isomerase    80.5    5e-13    
ref|NP_001059526.1|  Os07g0442900                                     79.7    5e-13    
ref|XP_006342777.1|  PREDICTED: CASP-like protein 5-like              78.6    1e-12    
dbj|GAK21369.1|  oxidoreductase                                       79.3    1e-12    
ref|WP_026426271.1|  epimerase                                        79.3    1e-12    
ref|WP_013660583.1|  NAD-dependent epimerase/dehydratase              79.3    1e-12    
ref|XP_008353263.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   77.0    1e-12    
ref|XP_009352215.1|  PREDICTED: CASP-like protein 1                   78.2    2e-12    
ref|WP_006229118.1|  epimerase                                        79.0    2e-12    
ref|WP_011221558.1|  epimerase                                        79.0    2e-12    
ref|WP_038885539.1|  NAD-dependent dehydratase                        79.0    2e-12    
ref|XP_003563200.1|  PREDICTED: CASP-like protein 1D1                 77.8    2e-12    
ref|XP_009345800.1|  PREDICTED: CASP-like protein 1                   77.4    2e-12    
ref|WP_006961701.1|  epimerase                                        78.6    2e-12    
ref|WP_039840485.1|  NAD-dependent dehydratase                        78.6    2e-12    
ref|WP_036754390.1|  NAD-dependent dehydratase                        78.2    2e-12    
ref|XP_008390732.1|  PREDICTED: CASP-like protein 1                   77.4    2e-12    
ref|XP_004229217.1|  PREDICTED: CASP-like protein 1E2                 77.0    3e-12    
ref|WP_007463093.1|  hypothetical protein                             77.8    4e-12    
ref|WP_038869123.1|  NAD-dependent dehydratase                        77.4    4e-12    
ref|WP_039977517.1|  NAD-dependent dehydratase                        77.4    5e-12    
ref|WP_040281694.1|  hypothetical protein                             77.4    5e-12    
ref|WP_013134979.1|  NmrA family protein                              77.0    5e-12    
ref|WP_015151069.1|  putative nucleoside-diphosphate sugar epimerase  77.0    6e-12    
ref|XP_010464210.1|  PREDICTED: CASP-like protein 1D2                 76.3    6e-12    
ref|WP_028975267.1|  hypothetical protein                             77.0    6e-12    
ref|WP_018997619.1|  hypothetical protein                             77.0    6e-12    
ref|WP_018477749.1|  hypothetical protein                             77.0    7e-12    
gb|KHN33122.1|  CASP-like protein 6                                   76.3    7e-12    
ref|WP_038227303.1|  NAD-dependent dehydratase                        76.6    7e-12    
ref|WP_010453136.1|  epimerase                                        76.6    8e-12    
ref|XP_010486147.1|  PREDICTED: CASP-like protein 1D2                 75.9    9e-12    
emb|CED59650.1|  putative uncharacterized protein, NAD dependent ...  76.6    9e-12    
ref|WP_017547680.1|  hypothetical protein                             76.6    9e-12    
ref|WP_005523772.1|  epimerase                                        76.6    9e-12    
ref|WP_017653725.1|  oxidoreductase                                   76.3    1e-11    
ref|WP_012502198.1|  3-beta hydroxysteroid dehydrogenase              76.3    1e-11    
ref|XP_007154230.1|  hypothetical protein PHAVU_003G101200g           75.1    1e-11    
ref|WP_012500959.1|  NmrA family protein                              76.3    1e-11    
ref|WP_005527132.1|  epimerase                                        75.9    1e-11    
ref|WP_005869649.1|  epimerase                                        75.5    2e-11    
ref|WP_005861958.1|  hypothetical protein                             75.1    2e-11    
ref|WP_012630244.1|  3-beta hydroxysteroid dehydrogenase              75.9    2e-11    
ref|XP_010904772.1|  PREDICTED: CASP-like protein 1D1                 74.3    3e-11    
ref|WP_023603363.1|  epimerase                                        75.1    3e-11    
ref|WP_014847089.1|  epimerase                                        75.1    3e-11    
gb|EMS67341.1|  hypothetical protein TRIUR3_17102                     73.9    3e-11    
ref|WP_017022789.1|  hypothetical protein                             74.3    4e-11    
ref|WP_028773707.1|  NAD-dependent dehydratase                        74.3    4e-11    
ref|WP_006530345.1|  putative nucleoside-diphosphate sugar epimerase  74.3    5e-11    
emb|CDO98909.1|  unnamed protein product                              73.2    5e-11    
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                 73.2    5e-11    
ref|NP_001236009.1|  CASP-like protein 1E2                            72.8    7e-11    
ref|WP_008688212.1|  NmrA family protein                              73.9    7e-11    
ref|XP_010439402.1|  PREDICTED: CASP-like protein 1D2                 72.8    7e-11    
ref|WP_029917463.1|  NAD-dependent dehydratase                        73.6    7e-11    
ref|XP_009352216.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   72.8    8e-11    
ref|XP_006414479.1|  hypothetical protein EUTSA_v10026349mg           72.8    8e-11    
ref|WP_012467128.1|  3-beta hydroxysteroid dehydrogenase              73.6    1e-10    
ref|WP_013405744.1|  NAD-dependent epimerase/dehydratase              73.2    1e-10    
gb|EMT27366.1|  hypothetical protein F775_32968                       71.6    2e-10    
tpg|DAA39419.1|  TPA: membrane protein 4                              71.6    2e-10    
ref|XP_004956013.1|  PREDICTED: CASP-like protein Sb02g009660-like    71.6    2e-10    
ref|NP_001151672.1|  CASP-like protein 1D1                            71.6    2e-10    
ref|WP_012505793.1|  3-beta hydroxysteroid dehydrogenase              72.4    2e-10    
ref|WP_012474837.1|  3-beta hydroxysteroid dehydrogenase              72.0    3e-10    
ref|XP_010548921.1|  PREDICTED: CASP-like protein 1E2                 70.9    3e-10    
emb|CDY09749.1|  BnaC07g33120D                                        70.9    3e-10    
gb|KDP40019.1|  hypothetical protein JCGZ_02017                       70.9    3e-10    
ref|WP_006198675.1|  oxidoreductase                                   71.6    4e-10    
ref|WP_012167660.1|  3-beta hydroxysteroid dehydrogenase              72.0    4e-10    
ref|WP_011612984.1|  oxidoreductase                                   71.6    4e-10    
ref|WP_017194335.1|  epimerase                                        71.6    4e-10    
ref|XP_010036846.1|  PREDICTED: CASP-like protein 1E1                 70.5    4e-10    
gb|KHG13245.1|  CASP-like protein                                     68.9    4e-10    
gb|EMR34515.1|  hypothetical protein MUQ_25091                        70.5    5e-10    
ref|WP_008730207.1|  epimerase                                        71.2    5e-10    
ref|WP_002701299.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  71.2    5e-10    
gb|AHF98602.1|  NADH dehydrogenase                                    71.2    5e-10    
ref|XP_002516873.1|  conserved hypothetical protein                   70.1    6e-10    
ref|WP_015173396.1|  NmrA family protein                              70.9    6e-10    
ref|WP_007142217.1|  NADH dehydrogenase                               71.2    7e-10    
ref|WP_010932675.1|  3-beta hydroxysteroid dehydrogenase              70.5    9e-10    
ref|XP_006855416.1|  hypothetical protein AMTR_s00057p00159510        69.3    9e-10    
ref|WP_037910857.1|  3-beta hydroxysteroid dehydrogenase              70.5    9e-10    
ref|WP_010482117.1|  3-beta hydroxysteroid dehydrogenase              70.5    1e-09    
ref|WP_039920025.1|  hypothetical protein                             68.9    1e-09    
ref|WP_025048678.1|  hypothetical protein                             70.1    1e-09    
ref|WP_035505173.1|  MULTISPECIES: hypothetical protein               70.1    1e-09    
gb|KDO75079.1|  hypothetical protein CISIN_1g040189mg                 67.8    1e-09    
dbj|BAK00793.1|  predicted protein                                    68.9    1e-09    
ref|WP_029314508.1|  hypothetical protein                             69.7    2e-09    
ref|WP_036918271.1|  NmrA family protein                              69.7    2e-09    
ref|XP_009630064.1|  PREDICTED: CASP-like protein 1E2 isoform X1      68.6    2e-09    
ref|WP_008384357.1|  nucleoside-diphosphate sugar epimerase           69.7    2e-09    
ref|WP_004242772.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  69.3    2e-09    
ref|XP_008652280.1|  PREDICTED: CASP-like protein 3                   68.6    2e-09    
gb|EPS66273.1|  hypothetical protein M569_08505                       68.2    2e-09    
gb|EEY35182.1|  hypothetical protein HMPREF0554_0337                  67.8    2e-09    
ref|WP_008525610.1|  NADH dehydrogenase                               69.3    2e-09    
ref|WP_005039273.1|  NAD-dependent epimerase/dehydratase              69.3    2e-09    
ref|WP_004251342.1|  hypothetical protein                             69.3    2e-09    
ref|WP_008080755.1|  epimerase                                        69.3    2e-09    
ref|WP_004247987.1|  hypothetical protein                             69.3    2e-09    
gb|KIN77019.1|  NmrA-like protein                                     69.7    2e-09    
ref|WP_036970602.1|  NmrA family protein                              68.9    3e-09    
ref|XP_007147871.1|  hypothetical protein PHAVU_006G161900g           69.3    3e-09    
ref|WP_024969730.1|  3-beta hydroxysteroid dehydrogenase              69.3    3e-09    
ref|XP_010036826.1|  PREDICTED: CASP-like protein 1E1                 67.8    3e-09    
ref|WP_036820243.1|  hypothetical protein                             68.6    4e-09    
gb|KDE57070.1|  NADH dehydrogenase                                    68.9    4e-09    
ref|WP_002779857.1|  putative enzyme                                  69.3    4e-09    
ref|WP_036474089.1|  NmrA family protein                              68.6    4e-09    
ref|WP_012474834.1|  3-beta hydroxysteroid dehydrogenase              68.6    4e-09    
ref|XP_008340843.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   67.4    4e-09    
ref|WP_015139067.1|  putative nucleoside-diphosphate sugar epimerase  68.2    5e-09    
ref|WP_012367883.1|  hypothetical protein                             68.2    5e-09    
ref|WP_021608072.1|  NAD dependent epimerase/dehydratase family p...  68.2    6e-09    
ref|XP_010036836.1|  PREDICTED: CASP-like protein 1E1                 67.0    6e-09    
ref|WP_011356826.1|  3-beta hydroxysteroid dehydrogenase              67.8    7e-09    
ref|XP_008438806.1|  PREDICTED: CASP-like protein 6                   66.2    8e-09    
ref|WP_011363026.1|  3-beta hydroxysteroid dehydrogenase              67.8    9e-09    
gb|KDP34883.1|  hypothetical protein JCGZ_09171                       66.2    9e-09    
gb|AHG04688.1|  NADH dehydrogenase                                    67.4    1e-08    
ref|WP_002762970.1|  3-beta hydroxysteroid dehydrogenase              67.8    1e-08    
ref|WP_022775382.1|  NAD dependent epimerase/dehydratase              67.4    1e-08    
emb|CDY22743.1|  BnaA08g05730D                                        66.2    1e-08    
ref|XP_006657652.1|  PREDICTED: CASP-like protein Os07g0442900-like   66.2    1e-08    
ref|WP_017631649.1|  epimerase                                        67.4    1e-08    
emb|CDX90578.1|  BnaA03g42030D                                        66.2    1e-08    
ref|WP_007657536.1|  NAD-dependent epimerase/dehydratase              67.0    1e-08    
ref|XP_009136705.1|  PREDICTED: CASP-like protein At4g15630           65.9    1e-08    
ref|XP_009107849.1|  PREDICTED: CASP-like protein At4g15630           65.9    1e-08    
ref|WP_010932170.1|  3-beta hydroxysteroid dehydrogenase              67.0    1e-08    
ref|WP_015228596.1|  nucleoside-diphosphate sugar epimerase           67.0    1e-08    
ref|WP_036976773.1|  NmrA family protein                              66.6    1e-08    
ref|WP_026516672.1|  NAD-dependent dehydratase                        66.6    1e-08    
ref|WP_010999429.1|  oxidoreductase                                   67.0    2e-08    
ref|WP_026522744.1|  NAD-dependent dehydratase                        66.6    2e-08    
ref|XP_008390727.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   65.5    2e-08    
ref|WP_013256640.1|  NmrA family protein                              66.6    2e-08    
ref|WP_015174180.1|  NmrA family protein                              66.6    2e-08    
ref|WP_017827471.1|  NmrA family protein                              66.6    2e-08    
ref|WP_036908042.1|  NmrA family protein                              66.6    2e-08    
ref|WP_008201587.1|  3-beta hydroxysteroid dehydrogenase              67.0    2e-08    
ref|XP_010666393.1|  PREDICTED: CASP-like protein 1E1                 65.5    2e-08    
ref|WP_014051426.1|  NADH dehydrogenase                               66.2    2e-08    
ref|WP_037028471.1|  NAD-dependent dehydratase                        66.2    2e-08    
ref|WP_016863089.1|  oxidoreductase                                   66.2    2e-08    
ref|WP_015111640.1|  NmrA family protein                              66.2    2e-08    
ref|WP_009411205.1|  NAD dependent epimerase/dehydratase family p...  66.2    2e-08    
ref|WP_009556131.1|  putative nucleoside-diphosphate sugar epimerase  66.6    2e-08    
emb|CDY09075.1|  BnaC08g10290D                                        64.7    3e-08    



>ref|XP_009596740.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009596741.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Nicotiana tomentosiformis]
Length=416

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/419 (80%), Positives = 376/419 (90%), Gaps = 4/419 (1%)
 Frame = +3

Query  153   MAAFAsssgltlqslqsqNFRRL-SSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERF  329
             M+AFA  SGLTLQS +  NFR+L SSHF+NH +QV+ VPYAI F S++   PF++N  + 
Sbjct  1     MSAFAPFSGLTLQSTKDHNFRQLLSSHFINH-VQVSTVPYAIPFLSVNV--PFRVNSRKL  57

Query  330   KPVSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERS  509
             KP++ SAA  +E+P +SFR KNP DIN+LVVGSTGYIG+FV  EL+ RGF+VIAIARE+S
Sbjct  58    KPITVSAASTIESPKISFRGKNPKDINVLVVGSTGYIGKFVVKELINRGFNVIAIAREKS  117

Query  510   GIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSW  689
             GI+G NSK+DTL+QL+GANVCFSDVT L SLEKSVE+LGVPIDVVVSCLASRNGGVKDSW
Sbjct  118   GIKGKNSKDDTLEQLNGANVCFSDVTNLESLEKSVENLGVPIDVVVSCLASRNGGVKDSW  177

Query  690   KIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTY  869
              IDYEATKNSLV G+KFGA+HFVLLSAICVQKPLLEFQRAKLKFE +LMKEAE D GFTY
Sbjct  178   LIDYEATKNSLVAGKKFGASHFVLLSAICVQKPLLEFQRAKLKFEAELMKEAEVDDGFTY  237

Query  870   SIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQ  1049
             SIVRPTAFFKSL GQVELVKDGKPYVMFGDGKLCACKPISE+DLASFI+DCVL EDKINQ
Sbjct  238   SIVRPTAFFKSLGGQVELVKDGKPYVMFGDGKLCACKPISEQDLASFIADCVLKEDKINQ  297

Query  1050  VLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAE  1229
             VLPIGGPGKALTPLEQ E+LFKL GKE KF+KVPI+IMDFAIG LD LVK+FPSLEDAAE
Sbjct  298   VLPIGGPGKALTPLEQAEILFKLVGKEPKFLKVPIEIMDFAIGLLDFLVKIFPSLEDAAE  357

Query  1230  FGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             FGKIGRYYAAESMLVWDPE GEY+A+ TPSYGKDTLE+FF++VL+EGMAGQELGEQ IF
Sbjct  358   FGKIGRYYAAESMLVWDPETGEYNADATPSYGKDTLEDFFQKVLKEGMAGQELGEQTIF  416



>ref|XP_010321210.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010321213.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010321216.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Solanum lycopersicum]
Length=420

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/402 (80%), Positives = 361/402 (90%), Gaps = 3/402 (1%)
 Frame = +3

Query  207   NFRRL-SSHFLNHHIQVNAVPYAITFPSIHFS-KPFKLNQERFKPVSCSAAPAVETPNVS  380
             NFR+L SSHF+NH +QV  VPYA  F S++ S +PF+++  + KP+  SAA  VETP +S
Sbjct  20    NFRQLFSSHFINH-VQVRTVPYATPFLSVNVSGRPFRVSSRKLKPIIASAASTVETPKIS  78

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FR KNP DIN+LVVGSTGYIG+FV  EL  RGF+VIA+ARE+SGI+G NSK+DTL+QL+G
Sbjct  79    FRGKNPKDINVLVVGSTGYIGKFVVKELTSRGFNVIAVAREKSGIKGKNSKDDTLEQLNG  138

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             ANVCFSDVT L +LEKSV+ LGV IDVVVSCLASRNGGVKDSW IDYEATKNSLV GRKF
Sbjct  139   ANVCFSDVTNLETLEKSVQGLGVSIDVVVSCLASRNGGVKDSWNIDYEATKNSLVAGRKF  198

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GA+HFVLLSAICVQKPLLEFQRAKLKFE +LMKEAE+D GFTYSIVRPTAFFKSL GQVE
Sbjct  199   GASHFVLLSAICVQKPLLEFQRAKLKFEAELMKEAEEDNGFTYSIVRPTAFFKSLGGQVE  258

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             LVKDGKPYVMFGDGKLCACKPISE+DLASF++DCVL EDKINQVLPIGGPGKALTPLEQG
Sbjct  259   LVKDGKPYVMFGDGKLCACKPISEQDLASFMADCVLKEDKINQVLPIGGPGKALTPLEQG  318

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLFKL GKE KF+KVPI+IMDFAIGFLD LVK+FPSLEDAAEFGKIGRYYAAESML+WD
Sbjct  319   EMLFKLVGKEPKFLKVPIEIMDFAIGFLDFLVKIFPSLEDAAEFGKIGRYYAAESMLIWD  378

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             P+ GEY+AE TPSYG DTLE+FF+RVL+EGMAGQELGEQ IF
Sbjct  379   PDTGEYNAEATPSYGNDTLEDFFQRVLKEGMAGQELGEQTIF  420



>ref|XP_006342779.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Solanum tuberosum]
Length=420

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/401 (80%), Positives = 358/401 (89%), Gaps = 3/401 (1%)
 Frame = +3

Query  210   FRRL-SSHFLNHHIQVNAVPYAITFPSIHFS-KPFKLNQERFKPVSCSAAPAVETPNVSF  383
             FR+L SSHF+NH +QV  VPYA  F S++ S +PF+++  + KP+  SAA  VET N+SF
Sbjct  21    FRQLFSSHFINH-VQVRTVPYATPFLSVNVSGRPFRVSSRKLKPIIASAASTVETSNISF  79

Query  384   RSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGA  563
             R KNP DIN+LVVGSTGYIG+FV  EL  RGF+ IA+ARE+SGI+G NSK+DTL+QL+GA
Sbjct  80    RGKNPKDINVLVVGSTGYIGKFVVKELTSRGFNAIAVAREKSGIKGKNSKDDTLEQLNGA  139

Query  564   NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFG  743
             NVCFSDVT L +LEKSV+ LGV IDVVVSCLASRNGGVKDSW IDYEATKNSLV GRKFG
Sbjct  140   NVCFSDVTNLETLEKSVQGLGVSIDVVVSCLASRNGGVKDSWNIDYEATKNSLVAGRKFG  199

Query  744   AAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVEL  923
             A+HFVLLSAICVQKPLLEFQRAKLKFE +LMKEAE+D GFTYSIVRPTAFFKSL GQVEL
Sbjct  200   ASHFVLLSAICVQKPLLEFQRAKLKFEAELMKEAEEDNGFTYSIVRPTAFFKSLGGQVEL  259

Query  924   VKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGE  1103
             VKDGKPYVMFGDGKLCACKPISE+DLASFI+DCVL EDKINQVLPIGGPGKALTPLEQGE
Sbjct  260   VKDGKPYVMFGDGKLCACKPISEQDLASFIADCVLKEDKINQVLPIGGPGKALTPLEQGE  319

Query  1104  MLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDP  1283
             MLFKL GKE KF+KVPI+IMDFAIGFLD LVK+FPSLEDAAEFGKIGRYYAAESML+WDP
Sbjct  320   MLFKLVGKEPKFLKVPIEIMDFAIGFLDFLVKIFPSLEDAAEFGKIGRYYAAESMLIWDP  379

Query  1284  EKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             E GEY+AE TPSYG DTLE+FF+RVL+EGM GQELGEQ IF
Sbjct  380   ETGEYNAEATPSYGNDTLEDFFQRVLKEGMTGQELGEQTIF  420



>ref|XP_009763391.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Nicotiana sylvestris]
Length=416

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/419 (79%), Positives = 373/419 (89%), Gaps = 4/419 (1%)
 Frame = +3

Query  153   MAAFAsssgltlqslqsqNFRRL-SSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERF  329
             M+AFA  S LTLQS +  NF++L SSHF+NH +QV+ VPYAI F S++   PF++N  + 
Sbjct  1     MSAFAPFSKLTLQSTKDHNFKQLLSSHFINH-VQVSTVPYAIPFLSVNV--PFRVNSRKL  57

Query  330   KPVSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERS  509
             KP++  AA  +E+P +SFR KNP DI +LVVGSTGYIG+FV  EL+ +GF+VIAIARE+S
Sbjct  58    KPITALAASTIESPKISFRGKNPKDIKVLVVGSTGYIGKFVVKELINKGFNVIAIAREKS  117

Query  510   GIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSW  689
             GI+G NSK+DTL+QL+GANVCFSDVT L SLEKSVE+LGVPIDVVVSCLASRNGGVKDSW
Sbjct  118   GIKGKNSKDDTLEQLNGANVCFSDVTNLESLEKSVENLGVPIDVVVSCLASRNGGVKDSW  177

Query  690   KIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTY  869
              IDYEATKNSLV G+KFGA+HFVLLSAICVQKPLLEFQRAKLKFE +LMKEAE D GFTY
Sbjct  178   LIDYEATKNSLVAGKKFGASHFVLLSAICVQKPLLEFQRAKLKFEAELMKEAEMDDGFTY  237

Query  870   SIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQ  1049
             SIVRPTAFFKSL GQVELVKDGKPYVMFGDGKLCACKPISE+DLASFI+DCVL EDKINQ
Sbjct  238   SIVRPTAFFKSLGGQVELVKDGKPYVMFGDGKLCACKPISEQDLASFIADCVLKEDKINQ  297

Query  1050  VLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAE  1229
             VLPIGGPGKALTPLEQ E+LFKL GKE KF++VPI+IMDFAIG LD LVK+FPSLEDAAE
Sbjct  298   VLPIGGPGKALTPLEQAEILFKLVGKEPKFLRVPIEIMDFAIGLLDFLVKIFPSLEDAAE  357

Query  1230  FGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             FGKIGRYYAAESMLVWDPE GEY+A+ TPSYGKDTLE+FF++VL+EGMAGQELGEQ IF
Sbjct  358   FGKIGRYYAAESMLVWDPETGEYNADATPSYGKDTLEDFFQKVLKEGMAGQELGEQTIF  416



>ref|XP_011090847.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Sesamum indicum]
Length=420

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/400 (79%), Positives = 356/400 (89%), Gaps = 0/400 (0%)
 Frame = +3

Query  207   NFRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFR  386
             +F+R  S+ L   +QV  VPYAI  PS++ SKP + ++ERFK V+ SA P VETP +SFR
Sbjct  21    SFKRHFSYHLISQVQVTTVPYAIPLPSVYLSKPKRFSKERFKLVTASATPTVETPKISFR  80

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
              KNP D+N+LVVGSTGYIG+FV  ELVKRGF+V AIARERSGIRG NSKE+TL+ LSGAN
Sbjct  81    GKNPKDVNVLVVGSTGYIGKFVVKELVKRGFNVTAIARERSGIRGKNSKEETLELLSGAN  140

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDVT L SLEKS+E+LG+ +DVVVSCLASR+GGVKDSW IDYEATKNSL+ GRKFGA
Sbjct  141   VCFSDVTNLESLEKSIENLGMSVDVVVSCLASRSGGVKDSWLIDYEATKNSLLAGRKFGA  200

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             AHFVLLSAICVQKPLLEFQRAKLKFE +L++EA+ DKGFTYSIVRPTAFFKSLAGQVELV
Sbjct  201   AHFVLLSAICVQKPLLEFQRAKLKFEAELIEEAKKDKGFTYSIVRPTAFFKSLAGQVELV  260

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE DLASFI+DCV S++ IN++LPIGGPG ALTPLEQGEM
Sbjct  261   KDGKPYVMFGDGKLCACKPISEPDLASFITDCVSSQELINKILPIGGPGDALTPLEQGEM  320

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+LAGKE KF+KVPIQIMDFAIG LD LVK+FPSLEDAAEFGKIGRYYAAESML+WDP+
Sbjct  321   LFRLAGKEPKFLKVPIQIMDFAIGVLDFLVKIFPSLEDAAEFGKIGRYYAAESMLIWDPK  380

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEYDAE TPSYG DTLEEFF+RVL EGM+GQELGEQ IF
Sbjct  381   TGEYDAEKTPSYGNDTLEEFFQRVLEEGMSGQELGEQTIF  420



>ref|XP_002276628.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Vitis vinifera]
Length=456

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/420 (77%), Positives = 363/420 (86%), Gaps = 3/420 (1%)
 Frame = +3

Query  150   KMAAFAsssgltlqslqsqNFRRLS-SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQER  326
             KM+ + SS+ LTL S ++++FR  S S F+N + QV   PYAIT   +  S+  K ++ER
Sbjct  39    KMSLYLSSNVLTLHSPKTRSFRNCSASQFINQN-QVTPAPYAITRLPLSLSQSPKFSRER  97

Query  327   FKPVSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARER  506
             F P++ S  P VE P+ SFR KN S+IN++VVGSTGYIG+FV  ELV RGF+VIAIARER
Sbjct  98    FLPITASITPTVEPPS-SFRGKNASEINVVVVGSTGYIGKFVVKELVSRGFNVIAIARER  156

Query  507   SGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDS  686
             SGIRG N KEDTL +L+GANV FSDVT L  LEKS+E+LG+PIDVVVSCLASR GGVKDS
Sbjct  157   SGIRGRNRKEDTLTELNGANVWFSDVTSLDVLEKSLENLGLPIDVVVSCLASRTGGVKDS  216

Query  687   WKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFT  866
             WKIDYEATKNSLV GRK GA+HFVLLSA+CVQKPLLEFQRAKLKFE +LMKEAE+D GFT
Sbjct  217   WKIDYEATKNSLVAGRKRGASHFVLLSAVCVQKPLLEFQRAKLKFEAELMKEAEEDDGFT  276

Query  867   YSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKIN  1046
             YSIVRPTAFFKSL GQVELVKDGKPYVMFGDGKLCACKPISE+DLASFI+DCVL +DKIN
Sbjct  277   YSIVRPTAFFKSLGGQVELVKDGKPYVMFGDGKLCACKPISEQDLASFIADCVLEKDKIN  336

Query  1047  QVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAA  1226
             QVLPIGGPGKALTPLEQGEMLF+LAG++  F+KVPI IMDFAIGFLD LVK+FPS+EDAA
Sbjct  337   QVLPIGGPGKALTPLEQGEMLFRLAGRKPNFLKVPIGIMDFAIGFLDFLVKIFPSMEDAA  396

Query  1227  EFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             EFGKIGRYYAAESMLV DPE GEY AE TPSYGKDTLEEFF+RVLREGMAGQELGEQ IF
Sbjct  397   EFGKIGRYYAAESMLVLDPETGEYSAEKTPSYGKDTLEEFFERVLREGMAGQELGEQTIF  456



>ref|XP_006489151.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Citrus sinensis]
Length=419

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/399 (78%), Positives = 347/399 (87%), Gaps = 5/399 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLN--QERFKPVSCSAAPAVETPNVSFRS  389
             RLSS F+N   QV + PY ++   ++ S+PFKL+   +RF P++  A+ AVE    SFR+
Sbjct  24    RLSSQFINQ-TQVKSAPYTLSDYHVNSSQPFKLSTSSKRFNPIT--ASTAVEATTSSFRN  80

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             KNP DINILVVGSTGYIG+FV  ELV RGF+VIAIARE+SGIRG N KE+TL QL GA+V
Sbjct  81    KNPKDINILVVGSTGYIGKFVVKELVSRGFNVIAIAREKSGIRGRNDKEETLNQLQGASV  140

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
             CFSDVT L SLEKS+E+LG  IDVVVSCLASR+GGVKDSWKIDYEA +NSLV GR  GA+
Sbjct  141   CFSDVTNLESLEKSLENLGTSIDVVVSCLASRSGGVKDSWKIDYEANRNSLVAGRNCGAS  200

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLLEFQRAKLKFE ++MK AE+D GFTYSIVRPTAFFKSL GQVELVK
Sbjct  201   HFVLLSAICVQKPLLEFQRAKLKFEAEMMKVAEEDSGFTYSIVRPTAFFKSLGGQVELVK  260

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
             +GKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQ+LPIGGPGKALTPLEQGE+L
Sbjct  261   EGKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQILPIGGPGKALTPLEQGEIL  320

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F+L GKE KF+KVPI IMDFAIG LD LVK+FPSLEDAAEFGKIGRYYAAESML+ DPE 
Sbjct  321   FRLLGKEPKFLKVPIGIMDFAIGVLDFLVKIFPSLEDAAEFGKIGRYYAAESMLILDPET  380

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GEY AE TPSYGKDTLEEFF+RVLREGMAGQELGEQ IF
Sbjct  381   GEYSAEKTPSYGKDTLEEFFERVLREGMAGQELGEQTIF  419



>ref|XP_007222603.1| hypothetical protein PRUPE_ppa006294mg [Prunus persica]
 gb|EMJ23802.1| hypothetical protein PRUPE_ppa006294mg [Prunus persica]
Length=419

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/398 (77%), Positives = 345/398 (87%), Gaps = 2/398 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFRSK  392
             R SS F N   +V++VPY     S++ S+ FK ++ER KP+S SA P  ET +  SFR K
Sbjct  23    RFSSQFTNQA-KVSSVPYGSPSSSLNLSEIFKFSKERTKPISASATPTAETASPPSFRGK  81

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             NP DINILVVG+TGYIG+FV  ELV R F+VIA+ARE+SGIRG  SK++TL QL GANVC
Sbjct  82    NPKDINILVVGATGYIGKFVVKELVNREFNVIAVAREKSGIRGKVSKDETLNQLKGANVC  141

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDVT L +LEKS+E+ GV IDVVVSCLASR+GGVKDSWKIDYEATKNSLV GR+ GA+H
Sbjct  142   FSDVTHLDTLEKSLENFGVSIDVVVSCLASRSGGVKDSWKIDYEATKNSLVAGRRRGASH  201

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             FVLLSAICVQKPLLEFQRAKLKFE +L++EAE+D GFTYSIVRPTAFFKSL GQVELVKD
Sbjct  202   FVLLSAICVQKPLLEFQRAKLKFESELIREAEEDNGFTYSIVRPTAFFKSLGGQVELVKD  261

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE DLASFISDC LSE+KINQVLPIGGPGKALTPLEQGE+LF
Sbjct  262   GKPYVMFGDGKLCACKPISEADLASFISDCALSENKINQVLPIGGPGKALTPLEQGELLF  321

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             +L G+E KF+KVPI+IMDFAIG LD LVK+FPS+ED AEFGKIGRYYAAESMLV DPE G
Sbjct  322   RLVGREPKFLKVPIEIMDFAIGVLDFLVKIFPSMEDTAEFGKIGRYYAAESMLVLDPETG  381

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             EY+AE TPSYGKDTLEEFF+ VLREGMAGQELGEQ IF
Sbjct  382   EYNAEKTPSYGKDTLEEFFETVLREGMAGQELGEQTIF  419



>ref|XP_006419664.1| hypothetical protein CICLE_v10005043mg [Citrus clementina]
 gb|ESR32904.1| hypothetical protein CICLE_v10005043mg [Citrus clementina]
Length=419

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/398 (78%), Positives = 347/398 (87%), Gaps = 5/398 (1%)
 Frame = +3

Query  219   LSSHFLNHHIQVNAVPYAITFPSIHFSKPFKL--NQERFKPVSCSAAPAVETPNVSFRSK  392
             LSS F+N   QV + PY ++   ++ S+PFKL  + +RF P++  A+ AVE    SFR+K
Sbjct  25    LSSQFINQ-TQVKSAPYTLSDYHVNSSQPFKLGTSSKRFNPIT--ASTAVEATTSSFRNK  81

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             NP DINILV+GSTGYIG+FV  ELV RGF+VIAIARE+SGIRG N KE+TL QL GA+VC
Sbjct  82    NPKDINILVLGSTGYIGKFVVKELVSRGFNVIAIAREKSGIRGRNDKEETLNQLQGASVC  141

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDVT L SLEKS+E+LG  IDVVVSCLASR+GGVKDSWKIDYEA++NSLV GR  GA+H
Sbjct  142   FSDVTNLESLEKSLENLGTSIDVVVSCLASRSGGVKDSWKIDYEASRNSLVAGRNCGASH  201

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             FVLLSAICVQKPLLEFQRAKLKFE ++MK AE+D GFTYSIVRPTAFFKSL GQVELVK+
Sbjct  202   FVLLSAICVQKPLLEFQRAKLKFEAEMMKVAEEDSGFTYSIVRPTAFFKSLGGQVELVKE  261

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQ+LPIGGPGKALTPLEQGE+LF
Sbjct  262   GKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQILPIGGPGKALTPLEQGEILF  321

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             +L GKE KF+KVPI IMDFAIG LD LVK+FPSLEDAAEFGKIGRYYAAESML+ DPE G
Sbjct  322   RLLGKEPKFLKVPIGIMDFAIGVLDFLVKIFPSLEDAAEFGKIGRYYAAESMLILDPETG  381

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             EY AE TPSYGKDTLEEFF+RVLREGMAGQELGEQ IF
Sbjct  382   EYSAEKTPSYGKDTLEEFFERVLREGMAGQELGEQTIF  419



>gb|KDP40021.1| hypothetical protein JCGZ_02019 [Jatropha curcas]
Length=418

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/397 (77%), Positives = 336/397 (85%), Gaps = 1/397 (0%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRSKN  395
             R S+ F++  IQV++   +++  +   S+PFK N+ R  P++ S+   VET   SFR KN
Sbjct  23    RFSTQFIDQ-IQVHSFSCSLSPSTPILSEPFKFNRHRLNPITASSTTTVETTQSSFRRKN  81

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P DINILV GSTGYIG+FV  ELV RGF+VIAIARERSGIRG NSKEDTL  L GANVCF
Sbjct  82    PKDINILVAGSTGYIGKFVVKELVNRGFNVIAIARERSGIRGKNSKEDTLNDLQGANVCF  141

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
             SDVT L  L+KS+  LGV IDVVVSCLASR+GG+KDSWKIDYEATKNSLV GR  GA HF
Sbjct  142   SDVTNLDILDKSLNDLGVSIDVVVSCLASRSGGIKDSWKIDYEATKNSLVAGRNNGANHF  201

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQKPLLEFQRAKLKFE DLMKEAE+D GF+YSIVRPTAFFKSL GQVELVKDG
Sbjct  202   VLLSAICVQKPLLEFQRAKLKFEADLMKEAEEDNGFSYSIVRPTAFFKSLGGQVELVKDG  261

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KPYVMFGDGKLCACKPISE DLASFI+DCVLSEDKIN+VLPIGGPGKALT LEQGEMLF+
Sbjct  262   KPYVMFGDGKLCACKPISESDLASFIADCVLSEDKINKVLPIGGPGKALTSLEQGEMLFR  321

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L GKE KF+KVPI IMDFAIG LD L  +FPS+EDAAEFGKIGRYYAAESMLV D E G+
Sbjct  322   LLGKEPKFLKVPIGIMDFAIGILDFLANIFPSMEDAAEFGKIGRYYAAESMLVLDSETGD  381

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             Y AE TPSYGKDTLEEFF+RVLR+GMAGQELGEQ IF
Sbjct  382   YSAEKTPSYGKDTLEEFFERVLRDGMAGQELGEQTIF  418



>ref|XP_010241367.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Nelumbo nucifera]
Length=420

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/396 (78%), Positives = 339/396 (86%), Gaps = 3/396 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPY--AITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRSKNP  398
             S   N  IQV+   Y  ++  P ++ S+P K  ++R   ++ S AP VET   SFR KNP
Sbjct  26    SQLPNSQIQVSFNSYNPSLLLP-LYVSEPTKFCRKRVCSITASTAPVVETAKSSFRDKNP  84

Query  399   SDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFS  578
              DIN+LVVGSTGYIG+FV  EL  RGF+VIAIARE+SGIRG NSKEDTL+QL GANVCFS
Sbjct  85    KDINVLVVGSTGYIGKFVVKELAHRGFNVIAIAREKSGIRGKNSKEDTLEQLKGANVCFS  144

Query  579   DVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFV  758
             DVT L SLE S+ES G  IDVVVSCLASR+GGVKDSWKIDYEATKNSLVVGR  GA+HFV
Sbjct  145   DVTHLGSLENSLESFGYSIDVVVSCLASRSGGVKDSWKIDYEATKNSLVVGRNHGASHFV  204

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LLSAICVQKPLLEFQRAKLKFE +L+KEAE+D GFTYSIVRPTAFFKSL GQVELVKDGK
Sbjct  205   LLSAICVQKPLLEFQRAKLKFEAELIKEAEEDAGFTYSIVRPTAFFKSLGGQVELVKDGK  264

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDGKLCACKPISE+DLASF++DCVL  DKINQ+LPIGGPGKALTPLEQGEMLF+L
Sbjct  265   PYVMFGDGKLCACKPISEQDLASFMADCVLGRDKINQILPIGGPGKALTPLEQGEMLFRL  324

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E KF+KVPIQIMD AIG LD LVK+FPS+EDAAE+GKIGRYYAAESMLV DPE GEY
Sbjct  325   VGREPKFLKVPIQIMDLAIGVLDFLVKIFPSMEDAAEYGKIGRYYAAESMLVLDPETGEY  384

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              AE TPSYGKDTLEEFFKR+LREGMAGQELGEQ IF
Sbjct  385   SAEETPSYGKDTLEEFFKRMLREGMAGQELGEQTIF  420



>emb|CDO98913.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/401 (79%), Positives = 344/401 (86%), Gaps = 5/401 (1%)
 Frame = +3

Query  207   NFRRL-SSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSF  383
             +FR L SS+F+N  IQV   PY+   PS+H S PFK  +ER   +S SA P VE    SF
Sbjct  19    SFRGLISSNFINR-IQVRPAPYS---PSLHLSGPFKFGKERCHLISASATPTVECSKTSF  74

Query  384   RSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGA  563
             RSKNP DI +LVVGSTGYIG FV  ELV+RGF+VIAIARERSGIRG N K+ T + L+GA
Sbjct  75    RSKNPEDITVLVVGSTGYIGNFVVKELVERGFNVIAIARERSGIRGRNDKDKTSEMLNGA  134

Query  564   NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFG  743
             NVCFSDVT+L  LEKS+    V +DVVVSCLASRNGGVKDSWKIDYEATKNSLV GRK G
Sbjct  135   NVCFSDVTQLDVLEKSLAERVVSVDVVVSCLASRNGGVKDSWKIDYEATKNSLVAGRKSG  194

Query  744   AAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVEL  923
             A+HFVLLSAICVQKPLLEFQRAKLKFE +LMKEAE D GFTYSIVRPTAFFKSL GQV+L
Sbjct  195   ASHFVLLSAICVQKPLLEFQRAKLKFEAELMKEAEQDAGFTYSIVRPTAFFKSLGGQVDL  254

Query  924   VKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGE  1103
             VKDGKPYVMFGDGKLCACKPISE DLASFI+DCVLSE+KINQVLPIGGPGKALTPLEQG+
Sbjct  255   VKDGKPYVMFGDGKLCACKPISEPDLASFIADCVLSENKINQVLPIGGPGKALTPLEQGQ  314

Query  1104  MLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDP  1283
             +LF+L GKE KF+KVPI+IMDFAIG LD LVK+FPSLEDAAEFGKIGRYYAAESMLVWDP
Sbjct  315   ILFRLLGKEPKFLKVPIEIMDFAIGVLDFLVKIFPSLEDAAEFGKIGRYYAAESMLVWDP  374

Query  1284  EKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             E GEY AE TPSYGKDTLEEFF +VLREGMAGQELGEQ IF
Sbjct  375   ETGEYSAEKTPSYGKDTLEEFFDKVLREGMAGQELGEQTIF  415



>ref|XP_011013337.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Populus euphratica]
Length=418

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/395 (77%), Positives = 338/395 (86%), Gaps = 3/395 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAI-TFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRSKNPS  401
             S F+N  IQVN+  +++ +FP ++ S PFK + +R  PV  S A + E    SFR+KNP 
Sbjct  26    SQFINQ-IQVNSFSHSLPSFP-LNSSLPFKFSVKRINPVRASTATSAEATQSSFRNKNPK  83

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             DINILV GSTGYIG+FV  ELV RGF+V+A+ARE+SGIRG NSKE+TL +L GANVCFSD
Sbjct  84    DINILVAGSTGYIGKFVVKELVNRGFNVVAVAREKSGIRGKNSKEETLNELQGANVCFSD  143

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             VTE+ +LEKS+   GV +DVVVSCLASR GGVKDSWKIDYEATKNSLV G+K GA HFVL
Sbjct  144   VTEVETLEKSLNDFGVSVDVVVSCLASRTGGVKDSWKIDYEATKNSLVAGKKLGAQHFVL  203

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQKPLLEFQRAKLKFE +LMKE E D GFTYSIVRPTAFFKSL GQVELVKDGKP
Sbjct  204   LSAICVQKPLLEFQRAKLKFEAELMKETEMDSGFTYSIVRPTAFFKSLGGQVELVKDGKP  263

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             YVMFGDG LCACKPISEEDLASFI+DCVL EDKINQ+LPIGGPGKALTPLEQGEMLF+L 
Sbjct  264   YVMFGDGNLCACKPISEEDLASFIADCVLGEDKINQILPIGGPGKALTPLEQGEMLFRLL  323

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
             GK+  F+KVPI IMDFAIG LD LVK+FPS+EDAAEFGKIGRYYAAESMLV DPE GEY 
Sbjct  324   GKKPNFLKVPIGIMDFAIGVLDFLVKIFPSMEDAAEFGKIGRYYAAESMLVLDPETGEYS  383

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             AE TPSYG+DTLEEFF++VLREGMAGQELGEQ IF
Sbjct  384   AERTPSYGEDTLEEFFEKVLREGMAGQELGEQAIF  418



>ref|XP_002311844.1| isoflavone reductase-related family protein [Populus trichocarpa]
 gb|EEE89211.1| isoflavone reductase-related family protein [Populus trichocarpa]
Length=418

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/395 (77%), Positives = 339/395 (86%), Gaps = 3/395 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAI-TFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRSKNPS  401
             S F+N  IQVN++ +++ +FP ++ S PFK + +R  P+  S A +VE    SFR+KNP 
Sbjct  26    SQFINQ-IQVNSLSHSLPSFP-LNSSLPFKFSVKRINPIRSSTATSVEATQSSFRNKNPK  83

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             DINILV GSTGYIG+FV  ELV RGF+VIA+ARE+SGIRG NS+E+TL QL GANVCFSD
Sbjct  84    DINILVAGSTGYIGKFVVKELVNRGFNVIAVAREKSGIRGKNSEEETLNQLQGANVCFSD  143

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             VT+L +LEKS+   GV +DVVVSCLASR GGVKDSWKIDYEATKNSLV G+K GA HFVL
Sbjct  144   VTKLETLEKSLNDFGVSVDVVVSCLASRTGGVKDSWKIDYEATKNSLVAGKKLGAKHFVL  203

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQKPLLEFQRAKLKFE +LM+E E D GFTYSIVRPTAFFKSL GQVELVKDGKP
Sbjct  204   LSAICVQKPLLEFQRAKLKFESELMRETEMDSGFTYSIVRPTAFFKSLGGQVELVKDGKP  263

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             YVMFGDG LCACKPISEEDLASFI+DCVL EDKINQ+LPIGGPGKALTPLEQGEMLF+L 
Sbjct  264   YVMFGDGNLCACKPISEEDLASFIADCVLGEDKINQILPIGGPGKALTPLEQGEMLFRLL  323

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
             GKE  F+KVPI IMDFAIG LD LVK+FPS+EDAAEFGKIGRYYAAESMLV DPE GEY 
Sbjct  324   GKEPNFLKVPIGIMDFAIGVLDFLVKIFPSMEDAAEFGKIGRYYAAESMLVLDPETGEYS  383

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             AE TPSYG+DTLE FF++VLREGMAGQELGEQ IF
Sbjct  384   AERTPSYGEDTLEVFFEKVLREGMAGQELGEQAIF  418



>ref|XP_010105025.1| hypothetical protein L484_008466 [Morus notabilis]
 gb|EXC03134.1| hypothetical protein L484_008466 [Morus notabilis]
Length=421

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/399 (77%), Positives = 346/399 (87%), Gaps = 3/399 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAA-PAVETPNVS-FRS  389
             R SS F+   IQV+++PYA     ++ S+ +K  +E+  P++ S+  P+VET   S FR+
Sbjct  24    RFSSQFIKK-IQVSSIPYAFPSSIVNSSELYKFGREKQNPITVSSTTPSVETAKTSSFRN  82

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             KNP ++NILVVGSTGYIG+FV  ELV RGF+VIAIARE+SGIRG  ++E+TL +L GANV
Sbjct  83    KNPKEVNILVVGSTGYIGKFVVNELVSRGFNVIAIAREKSGIRGKKNEEETLNELRGANV  142

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
             CFSDVT L +LEKSVESLGVPIDVVVSCLASR GGVKDSWKIDYEAT+NSLV G+KFGA+
Sbjct  143   CFSDVTNLETLEKSVESLGVPIDVVVSCLASRTGGVKDSWKIDYEATRNSLVAGKKFGAS  202

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLLEFQ AKLKFE +LMKEAE++ GF+YSIVRPTAFFKSL GQVELVK
Sbjct  203   HFVLLSAICVQKPLLEFQCAKLKFEAELMKEAEENGGFSYSIVRPTAFFKSLGGQVELVK  262

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
             DGKPYVMFGDGKLCACKPISE DLASFI+DCVL EDKIN+VLPIGGPGKALTPLEQGEML
Sbjct  263   DGKPYVMFGDGKLCACKPISEPDLASFIADCVLGEDKINKVLPIGGPGKALTPLEQGEML  322

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F+L GKE KF+KVPI IMDF IG LD LVK+FPS+EDAAEFGKIGRYYAAESMLV DPE 
Sbjct  323   FRLLGKEPKFLKVPIGIMDFGIGVLDFLVKIFPSMEDAAEFGKIGRYYAAESMLVLDPET  382

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GEY AE TPSYGKDTLEEFF+RVLREGMAGQELGEQ I 
Sbjct  383   GEYSAEKTPSYGKDTLEEFFERVLREGMAGQELGEQTIL  421



>ref|XP_007035487.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY06413.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=413

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/398 (78%), Positives = 341/398 (86%), Gaps = 8/398 (2%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETP-NVSFRSK  392
             R  S F+   IQV + P+  T PS    +PFK + ERF+ V   A   VET  + S+RSK
Sbjct  23    RFFSQFI-KQIQVKSAPF--TLPS----RPFKCSGERFELVRALATKPVETAVSASYRSK  75

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
              P  IN+LV+GSTGYIG+FV  ELV RGF+VIAIARERSGIRG NSKED+L  L GA+VC
Sbjct  76    IPKGINVLVMGSTGYIGKFVVKELVNRGFNVIAIARERSGIRGKNSKEDSLNDLQGASVC  135

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDVT L +LEKS+++LG PIDVVVSCLASR GGVKDSWKIDY+ATKNSLV G+KFGA+H
Sbjct  136   FSDVTNLDTLEKSLQNLGFPIDVVVSCLASRTGGVKDSWKIDYKATKNSLVAGKKFGASH  195

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             FVLLSAICVQKPLL+FQRAKLKFE +LMKEAE+D G T+SIVRPTAFFKSL GQVELVKD
Sbjct  196   FVLLSAICVQKPLLQFQRAKLKFEAELMKEAEEDGGVTFSIVRPTAFFKSLGGQVELVKD  255

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQVLPIGGPGKALTPLEQGE+LF
Sbjct  256   GKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQVLPIGGPGKALTPLEQGEILF  315

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             KL GKE KF+KVPI IMDFAIG LD LVK+FPS+EDAAEFGKIGRYYAAESMLV DPE G
Sbjct  316   KLLGKEPKFLKVPIGIMDFAIGILDFLVKIFPSMEDAAEFGKIGRYYAAESMLVLDPETG  375

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             EY AE TPSYGK+TLEEFF RVLREGMAGQELGEQ IF
Sbjct  376   EYSAEKTPSYGKETLEEFFARVLREGMAGQELGEQSIF  413



>gb|EYU43897.1| hypothetical protein MIMGU_mgv1a018558mg [Erythranthe guttata]
Length=416

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/400 (75%), Positives = 334/400 (84%), Gaps = 4/400 (1%)
 Frame = +3

Query  207   NFRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFR  386
             +F+ L +  L    QV   PYAI  PS+H  +P K   ++F   + SA     +    FR
Sbjct  21    SFKGLHASHLISQFQVTTAPYAIPLPSLHLHQPSKFRPKKFNLFTVSA----NSTKTHFR  76

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +KNP +IN+LVVGSTGYIG FV  ELV+RGF+V+AIARE+SG RG N K++TL  LSGA 
Sbjct  77    NKNPKEINVLVVGSTGYIGNFVVKELVRRGFNVVAIAREKSGTRGKNGKDETLSMLSGAK  136

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDVT L SLEKS+E+LG+ +DVVVSCLASRNGGVKDS  IDYEATKNSLV G+KFGA
Sbjct  137   VCFSDVTNLESLEKSIENLGISVDVVVSCLASRNGGVKDSRLIDYEATKNSLVAGKKFGA  196

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             AHFVLLSAICVQKPLLEFQRAKLKFE +L++E+E D+GFTYSIVRPTAFFKSLAGQVELV
Sbjct  197   AHFVLLSAICVQKPLLEFQRAKLKFESELIRESEKDEGFTYSIVRPTAFFKSLAGQVELV  256

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE DLASFI+DCVL ED +N+VLPIGGPG ALTPLEQGEM
Sbjct  257   KDGKPYVMFGDGKLCACKPISEPDLASFIADCVLGEDLVNRVLPIGGPGGALTPLEQGEM  316

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L GKE KFIKVPIQIMDFAIGFLD LV  FPSLED AEFGKIGRYYAAESML+ DPE
Sbjct  317   LFRLVGKEPKFIKVPIQIMDFAIGFLDFLVSAFPSLEDVAEFGKIGRYYAAESMLILDPE  376

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               EY+AE TPSYGKDTLE+FFKRVL EGMAGQELGEQ IF
Sbjct  377   TNEYNAEKTPSYGKDTLEDFFKRVLEEGMAGQELGEQTIF  416



>ref|XP_008223105.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Prunus mume]
Length=419

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/398 (77%), Positives = 343/398 (86%), Gaps = 2/398 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVS-FRSK  392
             R SS F N   +V++VPY      ++ S+ FK ++ER KP+S SA P   T +   FR K
Sbjct  23    RFSSQFTNQA-KVSSVPYGSPSSPLNLSEIFKFSKERTKPISASATPTAATASPPSFRGK  81

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             NP DINILVVG+TGYIG+FV  ELV R F+VIA++RE+SGIRG  SK++TL QL GANVC
Sbjct  82    NPKDINILVVGATGYIGKFVVKELVNREFNVIAVSREKSGIRGKVSKDETLNQLKGANVC  141

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDVT L +LEKS+E+LGV IDVVVSCLASR+GGVKDSWKIDYEATKNSLV GR+ GA+H
Sbjct  142   FSDVTHLDTLEKSLENLGVSIDVVVSCLASRSGGVKDSWKIDYEATKNSLVAGRRRGASH  201

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             FVLLSAICVQKPLLEFQRAKLKFE +L++ AE+D GFTYSIVRPTAFFKSL GQVELVKD
Sbjct  202   FVLLSAICVQKPLLEFQRAKLKFESELIRGAEEDNGFTYSIVRPTAFFKSLGGQVELVKD  261

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE DLASFISDCVLSE+KINQVLPIGGPGKALTPLEQGE+LF
Sbjct  262   GKPYVMFGDGKLCACKPISEADLASFISDCVLSENKINQVLPIGGPGKALTPLEQGELLF  321

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             +L G+E KF+KVPI+IMDFAIG LD LVK+FPS+ED AEFGKIGRYYAAESMLV DPE G
Sbjct  322   RLVGREPKFLKVPIEIMDFAIGVLDFLVKIFPSMEDTAEFGKIGRYYAAESMLVLDPETG  381

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             EY+AE TPSYGKDTLEEFF+ VLREGMAGQELGEQ IF
Sbjct  382   EYNAEKTPSYGKDTLEEFFETVLREGMAGQELGEQTIF  419



>ref|XP_008438802.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Cucumis melo]
Length=419

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/400 (75%), Positives = 338/400 (85%), Gaps = 1/400 (0%)
 Frame = +3

Query  207   NFRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFR  386
             N  RLSSHF+ + I V++  ++    S+  S+  K +++    +  S+AP VE+ N SFR
Sbjct  21    NSTRLSSHFV-YRIPVSSFSFSFQTSSLRLSQTPKFSRKGRNRIVVSSAPVVESTNSSFR  79

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +KNP D N+LVVGSTGYIG FV  ELV RGF+VIAIARE+SGIRG NSKE T  QL GAN
Sbjct  80    AKNPKDTNVLVVGSTGYIGNFVVKELVSRGFNVIAIAREKSGIRGRNSKERTSDQLKGAN  139

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDV+ L  LEKS+  L VPIDVVVSCLASR GG+KDSWKIDYEATKNSLV GR  GA
Sbjct  140   VCFSDVSHLDVLEKSLGDLDVPIDVVVSCLASRTGGIKDSWKIDYEATKNSLVAGRNRGA  199

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +LM+ A++D GFTYSIVRPTAFFKSL GQVELV
Sbjct  200   SHFVLLSAICVQKPLLEFQRAKLKFEAELMEAAKEDSGFTYSIVRPTAFFKSLGGQVELV  259

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQVLPIGGPGKALTPLEQGE+
Sbjct  260   KDGKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQVLPIGGPGKALTPLEQGEI  319

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L GKE  F+KVPI IMDFAIG LD LVK FP++EDAAE+GKIGRYYAAESML+ DPE
Sbjct  320   LFRLLGKEPNFLKVPIGIMDFAIGVLDFLVKFFPAMEDAAEYGKIGRYYAAESMLLLDPE  379

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEY A+ TPSYGKDTLE+FF+RVLREGMAGQELGEQ +F
Sbjct  380   TGEYSADKTPSYGKDTLEDFFERVLREGMAGQELGEQSVF  419



>ref|XP_004134186.1| PREDICTED: uncharacterized protein LOC101218189 [Cucumis sativus]
 sp|J9RYI6.1|DCVR_CUCSA RecName: Full=Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic; 
Flags: Precursor [Cucumis sativus]
 gb|AFR53113.1| divinyl reductase [Cucumis sativus]
 gb|KGN57068.1| hypothetical protein Csa_3G151460 [Cucumis sativus]
Length=419

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/400 (74%), Positives = 335/400 (84%), Gaps = 1/400 (0%)
 Frame = +3

Query  207   NFRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFR  386
             N  RLSS+F+ H I V++  ++    S+  S+  K +++R  P+  S+ P VE+   SFR
Sbjct  21    NSTRLSSNFV-HQIPVSSFSFSFQSSSLRLSQTPKFSRQRRNPIVVSSTPVVESTKSSFR  79

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +KNP D NILVVGSTGYIG FV  ELV RGF+VIAIARE+SGI+G NSKE    QL GAN
Sbjct  80    AKNPKDTNILVVGSTGYIGNFVVKELVSRGFNVIAIAREKSGIKGRNSKEQASDQLKGAN  139

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDV+ L  LEKS+  L VPIDVVVSCLASR GG+KDSWKIDYEATKNSLV GR  GA
Sbjct  140   VCFSDVSHLDVLEKSLGDLDVPIDVVVSCLASRTGGIKDSWKIDYEATKNSLVAGRNRGA  199

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +LM+ A++D GFTYSIVRPTAFFKSL GQVELV
Sbjct  200   SHFVLLSAICVQKPLLEFQRAKLKFEAELMEAAKEDSGFTYSIVRPTAFFKSLGGQVELV  259

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQVLPIGGPGKALTPLEQGE+
Sbjct  260   KDGKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQVLPIGGPGKALTPLEQGEI  319

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L GKE  F KVPI IMDFAIG LD LVK FP++EDAAE+GKIGRYYAAESML+ DPE
Sbjct  320   LFRLLGKEPNFFKVPIGIMDFAIGVLDFLVKFFPAMEDAAEYGKIGRYYAAESMLILDPE  379

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEY A+ TPSYGKDTLE+FF+RVL EGMAGQELGEQ +F
Sbjct  380   TGEYSADKTPSYGKDTLEDFFERVLSEGMAGQELGEQSVF  419



>ref|XP_009369106.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=421

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/398 (76%), Positives = 344/398 (86%), Gaps = 2/398 (1%)
 Frame = +3

Query  219   LSSHFLNHHIQVNAVPYAITFPS-IHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFRSK  392
             LSSHF N   +V++VP A +  S ++  +     ++R KP+S S+ P  E  N  SFR K
Sbjct  24    LSSHFPNQTCKVSSVPSAFSSSSPLNLHETLNFIKDRLKPISASSNPVAEITNPPSFRGK  83

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             NP DINILVVG+TGYIG+FV  ELV R F+VIAIARE+SGIRG  SK++TL++L GANVC
Sbjct  84    NPKDINILVVGATGYIGKFVVKELVSREFNVIAIAREKSGIRGKVSKDETLRELKGANVC  143

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDVT+L  LEK +E+LGV IDVVVSCLASR+GGVKDSWKIDYEATKNSLV GRK GA+H
Sbjct  144   FSDVTDLGVLEKCLENLGVSIDVVVSCLASRSGGVKDSWKIDYEATKNSLVAGRKRGASH  203

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             FVLLSAICVQKPLLEFQRAKLKFE +L++EAE+D GF+YSIVRPTAFFKSL GQVELVKD
Sbjct  204   FVLLSAICVQKPLLEFQRAKLKFESELIREAEEDNGFSYSIVRPTAFFKSLGGQVELVKD  263

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE DLASFI+DCVLSE+KINQVLPIGGPGKALTPLEQGE+LF
Sbjct  264   GKPYVMFGDGKLCACKPISEADLASFIADCVLSENKINQVLPIGGPGKALTPLEQGELLF  323

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             +L G+E KF+KVPI+IMDFAIG LD LVK+FPS+ED AEFGKIGRYYAAESMLV DPE G
Sbjct  324   RLVGREPKFLKVPIEIMDFAIGVLDFLVKIFPSMEDTAEFGKIGRYYAAESMLVLDPETG  383

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             EY+AE TPSYGKDTLEEFF+ VLREGMAGQELGEQ IF
Sbjct  384   EYNAEKTPSYGKDTLEEFFETVLREGMAGQELGEQTIF  421



>ref|XP_010524762.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Tarenaya hassleriana]
Length=416

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/389 (76%), Positives = 336/389 (86%), Gaps = 1/389 (0%)
 Frame = +3

Query  243   HIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSC-SAAPAVETPNVSFRSKNPSDINILV  419
             H +VN+ P+ +T P+  FS  F   +ERF+P+S   AA +    + SFR+KNP+DIN+LV
Sbjct  28    HFRVNSFPFTLTSPTHDFSGNFSFRRERFEPISALDAAISEAASSASFRNKNPNDINVLV  87

Query  420   VGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelss  599
             VGSTGYIGRFV  EL+KRGF+VIA+ARERSGIRG + K++TL QL GANVCFSDVT+L  
Sbjct  88    VGSTGYIGRFVVNELIKRGFNVIAVARERSGIRGRSDKQETLNQLQGANVCFSDVTQLDV  147

Query  600   leksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICV  779
             LEKSVE+LG PIDVVVSCLASR+GGVKDSWKIDYEATKNSLV G KFGA HFVLLSAICV
Sbjct  148   LEKSVENLGFPIDVVVSCLASRSGGVKDSWKIDYEATKNSLVGGMKFGARHFVLLSAICV  207

Query  780   QKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGD  959
             QKPLLEFQRAKLKFE +L   AE D  FTYSIVRPTAFFKSL GQV+LVKDGKPYVMFGD
Sbjct  208   QKPLLEFQRAKLKFESELTDLAEKDSSFTYSIVRPTAFFKSLGGQVDLVKDGKPYVMFGD  267

Query  960   GKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKF  1139
             GKLCACKPISE+DLASFI+DCVL EDK+N+VLPIGGPGKALTPLEQGE+LF+L GKE KF
Sbjct  268   GKLCACKPISEQDLASFIADCVLEEDKMNRVLPIGGPGKALTPLEQGEILFRLLGKEPKF  327

Query  1140  IKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPS  1319
             ++VPIQIMDFAIG LD + K+FP++EDAAEFGKIGRYYAAESML+ D E GEY  E TPS
Sbjct  328   LRVPIQIMDFAIGVLDFMAKIFPAMEDAAEFGKIGRYYAAESMLILDSETGEYSDEKTPS  387

Query  1320  YGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YGKDTLEEFF+RV+REGMAGQELGEQ IF
Sbjct  388   YGKDTLEEFFERVIREGMAGQELGEQTIF  416



>ref|XP_003546097.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Glycine max]
 gb|KHN33119.1| Protein TIC 62, chloroplastic [Glycine soja]
Length=412

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/369 (81%), Positives = 320/369 (87%), Gaps = 1/369 (0%)
 Frame = +3

Query  303   PFKLNQERFKP-VSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGF  479
             P K   ERFK   S +++P+VET   S+RSK+P D+N+LVVGSTGYIG+FV  ELVKRGF
Sbjct  44    PIKFTAERFKLFASLTSSPSVETSPSSYRSKSPKDVNVLVVGSTGYIGKFVVRELVKRGF  103

Query  480   SVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLA  659
             +V AIARERSGI+GS  K+ TL QL GANVCFSDVT L   E+S+  LG   DVVVSCLA
Sbjct  104   NVTAIARERSGIKGSVDKDQTLGQLRGANVCFSDVTNLDVFEESLNRLGKSFDVVVSCLA  163

Query  660   SRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMK  839
             SRNGGVKDSWKIDYEAT+NSLV GRK GA+HFVLLSAICVQKPLLEFQRAKLKFE +L+K
Sbjct  164   SRNGGVKDSWKIDYEATRNSLVAGRKRGASHFVLLSAICVQKPLLEFQRAKLKFEDELVK  223

Query  840   EAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISD  1019
              AE+D GFTYSIVRPTAFFKSL GQVELVKDGKPYVMFGDGKLCACKPISE DLASFI D
Sbjct  224   LAEEDGGFTYSIVRPTAFFKSLGGQVELVKDGKPYVMFGDGKLCACKPISESDLASFIVD  283

Query  1020  CVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVK  1199
             CVLSEDKINQVLPIGGPGKALTPLEQGEMLF+L GKE KF+KVPI IMDFAIG LD LVK
Sbjct  284   CVLSEDKINQVLPIGGPGKALTPLEQGEMLFRLLGKEPKFLKVPIGIMDFAIGVLDFLVK  343

Query  1200  VFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAG  1379
             VFPSLEDAAEFGKIGRYYAAESML+ DPE GEY AE TPSYG DTLEEFF RVLREGMAG
Sbjct  344   VFPSLEDAAEFGKIGRYYAAESMLLLDPETGEYSAEKTPSYGNDTLEEFFARVLREGMAG  403

Query  1380  QELGEQMIF  1406
             QELGEQ IF
Sbjct  404   QELGEQTIF  412



>ref|XP_003542917.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Glycine max]
 gb|KHN47294.1| Hypothetical protein glysoja_020162 [Glycine soja]
Length=412

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 319/369 (86%), Gaps = 1/369 (0%)
 Frame = +3

Query  303   PFKLNQERFKP-VSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGF  479
             P K   ERFK   S + +P VET   S+R K+P D+N+LVVGSTGYIG+FV  ELVKRGF
Sbjct  44    PIKFTAERFKLFASLTPSPPVETTPSSYRCKSPKDVNVLVVGSTGYIGKFVVRELVKRGF  103

Query  480   SVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLA  659
              V AIARERSGI+GS  K+ TL QL GANVCFSDVT L + E+S+ SLG   DVVVSCLA
Sbjct  104   DVTAIARERSGIKGSVDKDQTLNQLRGANVCFSDVTNLDAFEESLNSLGKSFDVVVSCLA  163

Query  660   SRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMK  839
             SRNGGVKDSWKIDYEAT+NSLV GRK GA+HFVLLSAICVQKPLLEFQRAKLKFE +LMK
Sbjct  164   SRNGGVKDSWKIDYEATRNSLVAGRKRGASHFVLLSAICVQKPLLEFQRAKLKFEAELMK  223

Query  840   EAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISD  1019
              AE+D GFTYSIVRPTAFFKSL GQVELVKDGKPYVMFGDGKLCACKP+SE DLASFI +
Sbjct  224   LAEEDDGFTYSIVRPTAFFKSLGGQVELVKDGKPYVMFGDGKLCACKPMSESDLASFIVN  283

Query  1020  CVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVK  1199
             CVLSEDKINQVLPIGGPGKALTPLEQGEMLF+L GKE KF+KVPI+IMDFAIG LD LVK
Sbjct  284   CVLSEDKINQVLPIGGPGKALTPLEQGEMLFRLLGKEPKFLKVPIEIMDFAIGVLDFLVK  343

Query  1200  VFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAG  1379
             VFPSLEDAAEFGKIGRYYAAESML+ DPE GEY AE TPSYG DTLEEFF RVLREGMAG
Sbjct  344   VFPSLEDAAEFGKIGRYYAAESMLLLDPETGEYSAEKTPSYGNDTLEEFFARVLREGMAG  403

Query  1380  QELGEQMIF  1406
             QELGEQ IF
Sbjct  404   QELGEQTIF  412



>ref|XP_004296795.1| PREDICTED: uncharacterized protein ycf39-like [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/400 (77%), Positives = 341/400 (85%), Gaps = 5/400 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHF--SKPFKLNQERFKPVSCSAAPAVETPNV-SFR  386
             R SS F N   +VN+  +   FPS  F  S+  K ++ER KP+S S  P  ET    SFR
Sbjct  23    RFSSQFTNP-TKVNSSLFT-GFPSSQFNLSEIVKFSKERLKPISASTTPTAETTVTPSFR  80

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +K+P DINILVVG+TGYIG+FV  ELV R F+VIAIARE+SGIRG  SK++TL QL GAN
Sbjct  81    NKSPKDINILVVGATGYIGKFVVKELVDREFNVIAIAREKSGIRGKFSKDETLNQLKGAN  140

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDVT L SLEKS+E +GVPIDVVVSCLASR+GGVKDSWKIDYEATKNSLV GR  GA
Sbjct  141   VCFSDVTNLDSLEKSIEDMGVPIDVVVSCLASRSGGVKDSWKIDYEATKNSLVAGRNRGA  200

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +L+KEAE D GF+Y+IVRPTAFFKSL GQVELV
Sbjct  201   SHFVLLSAICVQKPLLEFQRAKLKFEDELIKEAEKDSGFSYTIVRPTAFFKSLGGQVELV  260

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE DLASFI+DCVLSE+KINQ+LPIGGPGKALTP+EQGE+
Sbjct  261   KDGKPYVMFGDGKLCACKPISEADLASFIADCVLSENKINQILPIGGPGKALTPIEQGEL  320

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L G+E KF+KVPI+IMDFAIG LD LVK+FPSLED AEFGKIGRYYAAESMLV DPE
Sbjct  321   LFRLVGREPKFLKVPIEIMDFAIGVLDFLVKIFPSLEDTAEFGKIGRYYAAESMLVLDPE  380

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEY AE TPSYGKDTLE+FF+ VLREGMAGQELGEQ IF
Sbjct  381   TGEYSAEKTPSYGKDTLEDFFQTVLREGMAGQELGEQTIF  420



>ref|XP_010024569.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010024570.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010024571.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Eucalyptus grandis]
 gb|KCW61017.1| hypothetical protein EUGRSUZ_H03771 [Eucalyptus grandis]
Length=420

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/399 (77%), Positives = 343/399 (86%), Gaps = 3/399 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNV--SFRS  389
             R SS F++  IQV++  +A +   ++    FK ++ER  PV+ SAA A ET     SFR 
Sbjct  23    RFSSQFISS-IQVSSSTHARSVSRVNSPSFFKFSRERLDPVAASAASAAETATAPSSFRD  81

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             K P DIN+LVVGSTGYIG+FV  ELVKRGF+VIA+ARERSGIRG NSKE+TL +L GANV
Sbjct  82    KAPKDINVLVVGSTGYIGKFVVRELVKRGFNVIAVARERSGIRGRNSKEETLNELRGANV  141

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
             CFSDVT+L +LEKSVE LG  IDVVVSCLASRNGGVKDSWKIDYEAT+NSL+ GRKFGAA
Sbjct  142   CFSDVTDLETLEKSVEGLGCGIDVVVSCLASRNGGVKDSWKIDYEATRNSLLAGRKFGAA  201

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLLEFQRAKLKFE +LMK A +D  F+YSIVRPTAFFKSL GQVELVK
Sbjct  202   HFVLLSAICVQKPLLEFQRAKLKFEAELMKAAGEDSKFSYSIVRPTAFFKSLGGQVELVK  261

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
             DGKPYVMFGDGKLCACKP+SE DLASFI+DCVLSE+K NQVLPIGGPGKALTPLEQGE+L
Sbjct  262   DGKPYVMFGDGKLCACKPMSEPDLASFIADCVLSEEKANQVLPIGGPGKALTPLEQGEIL  321

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F+L GKE KF+KVPI+IMDFAIG LD LVK+FP LEDAAEFGKIGRYYAAESML+ DPE 
Sbjct  322   FRLLGKEPKFLKVPIEIMDFAIGVLDFLVKIFPGLEDAAEFGKIGRYYAAESMLILDPET  381

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GEY ++ TPSYGKDTLEEFF++VLREGMAGQELGEQ IF
Sbjct  382   GEYSSDKTPSYGKDTLEEFFEKVLREGMAGQELGEQTIF  420



>ref|XP_004159826.1| PREDICTED: uncharacterized LOC101218189 [Cucumis sativus]
Length=467

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/402 (74%), Positives = 336/402 (84%), Gaps = 1/402 (0%)
 Frame = +3

Query  207   NFRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFR  386
             N  RLSS+F+ H I V++  ++    S+  S+  K +++R  P+  S+ P VE+   SFR
Sbjct  21    NSTRLSSNFV-HQIPVSSFSFSFQSSSLRLSQTPKFSRQRRNPIVVSSTPVVESTKSSFR  79

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +KNP D NILVVGSTGYIG FV  ELV RGF+VIAIARE+SGI+G NSKE    QL GAN
Sbjct  80    AKNPKDTNILVVGSTGYIGNFVVKELVSRGFNVIAIAREKSGIKGRNSKEQASDQLKGAN  139

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDV+ L  LEKS+  L VPIDVVVSCLASR GG+KDSWKIDYEATKNSLV GR  GA
Sbjct  140   VCFSDVSHLDVLEKSLGDLDVPIDVVVSCLASRTGGIKDSWKIDYEATKNSLVAGRNRGA  199

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +LM+ A++D GFTYSIVRPTAFFKSL GQVELV
Sbjct  200   SHFVLLSAICVQKPLLEFQRAKLKFEAELMEAAKEDSGFTYSIVRPTAFFKSLGGQVELV  259

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQVLPIGGPGKALTPLEQGE+
Sbjct  260   KDGKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQVLPIGGPGKALTPLEQGEI  319

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L GKE  F KVPI IMDFAIG LD LVK FP++EDAAE+GKIGRYYAAESML+ DPE
Sbjct  320   LFRLLGKEPNFFKVPIGIMDFAIGVLDFLVKFFPAMEDAAEYGKIGRYYAAESMLILDPE  379

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF*I  1412
              GEY A+ TPSYGKDTLE+FF+RVL EGMAGQELGEQ +F I
Sbjct  380   TGEYSADKTPSYGKDTLEDFFERVLSEGMAGQELGEQSVFDI  421



>ref|XP_009352212.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=421

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/400 (74%), Positives = 336/400 (84%), Gaps = 4/400 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPS--IHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFR  386
             R SS F +   +V++V  A + PS  ++ S+      +  KP+S  + P  E  N  SFR
Sbjct  23    RFSSQFTHQTSKVSSVLSAFS-PSCPVNLSEVLNFRTDILKPISALSNPVAEITNPPSFR  81

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
              KNP DINILVVG+TGYIG+FV  ELV R F+VI IARE SGIRG  SK++TL++L GAN
Sbjct  82    RKNPKDINILVVGATGYIGKFVVKELVNREFNVIVIARENSGIRGKVSKDETLKELKGAN  141

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDVT+L   +K +E LGV IDVV+SCLASR+GGVKDSWKIDYEATKNSLV  RK GA
Sbjct  142   VCFSDVTDLGVFDKCLEDLGVSIDVVISCLASRSGGVKDSWKIDYEATKNSLVASRKRGA  201

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +L++EAE+D GF+YSIVRPTAFFKSL GQVELV
Sbjct  202   SHFVLLSAICVQKPLLEFQRAKLKFESELIREAEEDNGFSYSIVRPTAFFKSLGGQVELV  261

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE DLASFI+DCVLSE+KINQVLPIGGPGKALTPLEQGE+
Sbjct  262   KDGKPYVMFGDGKLCACKPISEADLASFIADCVLSENKINQVLPIGGPGKALTPLEQGEL  321

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L G+E KF+KVPI+IMDFAIG LD LV+VFPS+ED AEFGKIGRYYAAESMLV DPE
Sbjct  322   LFRLVGREPKFLKVPIEIMDFAIGVLDFLVRVFPSMEDTAEFGKIGRYYAAESMLVLDPE  381

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEY+AE TPSYGKDTLEEFF+ VLREGMAGQELGEQ IF
Sbjct  382   TGEYNAEKTPSYGKDTLEEFFETVLREGMAGQELGEQTIF  421



>ref|XP_007147868.1| hypothetical protein PHAVU_006G161600g [Phaseolus vulgaris]
 gb|ESW19862.1| hypothetical protein PHAVU_006G161600g [Phaseolus vulgaris]
Length=411

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/400 (76%), Positives = 329/400 (82%), Gaps = 9/400 (2%)
 Frame = +3

Query  234   LNHHIQVNAV-----PYAITFPSIHFSKP---FKLNQERFKPV-SCSAAPAVETPNVSFR  386
             LNH   ++       P  I   S+   KP    K   ERFK V S + AP +ET   S+R
Sbjct  12    LNHQKSLSLTFSSDSPRFINLFSVKHRKPHHPIKFTTERFKLVASLTPAPPIETAPSSYR  71

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             SK+P D+N+LVVGSTGYIG++V  ELVKRGF+V AIARERSGI+GS  K+ TL QL GAN
Sbjct  72    SKSPKDVNVLVVGSTGYIGKYVVRELVKRGFNVTAIARERSGIKGSVDKDQTLNQLRGAN  131

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDV  L +LE S+ SLG   DVVVSCLASRNGGVKDSWKIDYEAT+NSLV GRK GA
Sbjct  132   VCFSDVANLDALEGSLNSLGNSFDVVVSCLASRNGGVKDSWKIDYEATRNSLVAGRKRGA  191

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +LMK AE+D GF+YSIVRPTAFFKSL GQVELV
Sbjct  192   SHFVLLSAICVQKPLLEFQRAKLKFEDELMKLAEEDGGFSYSIVRPTAFFKSLGGQVELV  251

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE DLASFI DCVLSEDKIN+VLPIGGPGKALTPLEQGE+
Sbjct  252   KDGKPYVMFGDGKLCACKPISESDLASFIVDCVLSEDKINKVLPIGGPGKALTPLEQGEI  311

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L GKE KF+KVPI IMDFAIG LD LVKVFPSLEDAAEFGKIGRYYAAESML+ DPE
Sbjct  312   LFRLLGKEPKFLKVPIGIMDFAIGVLDFLVKVFPSLEDAAEFGKIGRYYAAESMLLLDPE  371

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEY AE TPSYG DTLEEFF  VLREGMAGQELGEQ IF
Sbjct  372   TGEYSAEKTPSYGNDTLEEFFATVLREGMAGQELGEQTIF  411



>ref|XP_009345803.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009345811.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=421

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/400 (74%), Positives = 333/400 (83%), Gaps = 4/400 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPS--IHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFR  386
             R SS   +   +V++V  A + PS  ++ S       +  KP+S  + P  E  N  SFR
Sbjct  23    RFSSQLTHQTSKVSSVLSAFS-PSCPVNLSGVLNFRTDILKPISALSNPVAEITNPPSFR  81

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
              KNP DINILVVG+TGYIG+FV  ELV R F+VI IARE SGIRG  SK++TL++L GAN
Sbjct  82    RKNPKDINILVVGATGYIGKFVVKELVNREFNVIVIARENSGIRGKVSKDETLKELKGAN  141

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             VCFSDVT+L   +K +E LGV IDVVVSCLASR+GGVKDSWKIDYEATKNSLV  RK GA
Sbjct  142   VCFSDVTDLGVFDKCLEDLGVSIDVVVSCLASRSGGVKDSWKIDYEATKNSLVASRKRGA  201

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             +HFVLLSAICVQKPLLEFQRAKLKFE +L++EAE+D GF+Y IVRPTAFFKSL GQVELV
Sbjct  202   SHFVLLSAICVQKPLLEFQRAKLKFESELIREAEEDIGFSYGIVRPTAFFKSLGGQVELV  261

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             KDGKPYVMFGDGKLCACKPISE DLASFI+DCVLSEDKINQVLPIGGPGKALTPLEQGE+
Sbjct  262   KDGKPYVMFGDGKLCACKPISEADLASFIADCVLSEDKINQVLPIGGPGKALTPLEQGEL  321

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L G+E KF+KVPI+IMDFAIG LD LV+VFPS+ED AEFGKIGRYYAAESMLV DPE
Sbjct  322   LFRLVGREPKFLKVPIEIMDFAIGVLDFLVRVFPSMEDTAEFGKIGRYYAAESMLVLDPE  381

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              GEY+AE TPSYGKDTLEEFF+ VLREGMAGQELGEQ IF
Sbjct  382   TGEYNAEKTPSYGKDTLEEFFETVLREGMAGQELGEQTIF  421



>gb|KDO75077.1| hypothetical protein CISIN_1g043385mg [Citrus sinensis]
Length=405

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/399 (75%), Positives = 332/399 (83%), Gaps = 19/399 (5%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLN--QERFKPVSCSAAPAVETPNVSFRS  389
             RLSS F+N   QV + PY ++   ++ S+PFKL+   +RF P++  A+ AVE    SFR+
Sbjct  24    RLSSQFINQ-TQVKSAPYTLSDYHVNSSQPFKLSTSSKRFNPIT--ASTAVEATTSSFRN  80

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             KNP DINILVVGSTGYIG+FV  ELV RGF+VIAIARE+SGIRG N KE+TL QL GA+V
Sbjct  81    KNPKDINILVVGSTGYIGKFVVEELVSRGFNVIAIAREKSGIRGRNDKEETLNQLQGASV  140

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
             CFSDVT L SLEKS+E+LG  IDVVVSCLASR+GGVKDSWKIDYEA +NSLV GR  GA+
Sbjct  141   CFSDVTNLESLEKSLENLGTSIDVVVSCLASRSGGVKDSWKIDYEANRNSLVAGRNCGAS  200

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLLEFQRAKLKFE ++MK AE+D GFTYSIVRPTAFFKSL GQVELVK
Sbjct  201   HFVLLSAICVQKPLLEFQRAKLKFEAEMMKVAEEDSGFTYSIVRPTAFFKSLGGQVELVK  260

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
             +GKPYVMFGDGKLCA               CVLSEDKINQ+LPIGGPGKALTPLEQGE+L
Sbjct  261   EGKPYVMFGDGKLCAY--------------CVLSEDKINQILPIGGPGKALTPLEQGEIL  306

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F+L GKE KF+KVPI IMDFAIG LD LVK+FPSLEDAAEFGKIGRYYAAESML+ DPE 
Sbjct  307   FRLLGKEPKFLKVPIGIMDFAIGVLDFLVKIFPSLEDAAEFGKIGRYYAAESMLILDPET  366

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GEY AE TPSYGKDTLEEFF+RVLREGMAGQELGEQ IF
Sbjct  367   GEYSAEKTPSYGKDTLEEFFERVLREGMAGQELGEQTIF  405



>ref|XP_008390783.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic, 
partial [Malus domestica]
Length=424

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/380 (77%), Positives = 327/380 (86%), Gaps = 5/380 (1%)
 Frame = +3

Query  282   PSIHFSKPFKLN----QERFKPVSCSAAPAVETPNV-SFRSKNPSDINILVVGSTGYIGR  446
             P +H    F ++    Q+  KP+S ++ P  E  N  SFR KNP DINILVVG+TGYIG+
Sbjct  45    PKLHIPFLFSVHPPNQQDILKPISATSNPVAEITNPPSFRGKNPKDINILVVGATGYIGK  104

Query  447   FVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslG  626
             FV  ELV R F+VIAIARE SGIRG  SK++TL++L GANVCFSDVT+L   EK +E LG
Sbjct  105   FVVKELVNREFNVIAIARENSGIRGKVSKDETLKELKGANVCFSDVTDLGVFEKCLEDLG  164

Query  627   VPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQR  806
             + IDVVVSCLASR+GGVKDSWKIDYEATKNSLV  RK GA+HFVLLSAICVQKPLLEFQR
Sbjct  165   ISIDVVVSCLASRSGGVKDSWKIDYEATKNSLVASRKRGASHFVLLSAICVQKPLLEFQR  224

Query  807   AKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPI  986
             AKLKFE +L+KEAE+D GF+YSIVRPTAFFKSL GQVELVKDGKPYVMFGDGKLCACKPI
Sbjct  225   AKLKFESELIKEAEEDNGFSYSIVRPTAFFKSLGGQVELVKDGKPYVMFGDGKLCACKPI  284

Query  987   SEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMD  1166
             SE DLASFI+DCVLSE+KINQ+LPIGGPGKALTPLEQGE+LF+L G++ KF+KVPI+IMD
Sbjct  285   SEADLASFIADCVLSENKINQILPIGGPGKALTPLEQGELLFRLVGRDPKFLKVPIEIMD  344

Query  1167  FAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEF  1346
             FAIG LD LVKVFPS+ED AEFGKIGRYYAAESMLV DPE GEY+AE TPSYGKDTLEEF
Sbjct  345   FAIGVLDFLVKVFPSMEDTAEFGKIGRYYAAESMLVLDPETGEYNAEKTPSYGKDTLEEF  404

Query  1347  FKRVLREGMAGQELGEQMIF  1406
             F+ VLREGMAGQELGEQ IF
Sbjct  405   FETVLREGMAGQELGEQTIF  424



>ref|XP_010675087.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=420

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/405 (73%), Positives = 329/405 (81%), Gaps = 8/405 (2%)
 Frame = +3

Query  207   NFRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERF-KPVSCSAAPAVETPN---  374
             NFR    +F     QVN  PYA+ F     SK  K ++     P++ +      T N   
Sbjct  19    NFRGKPENF--TQFQVNPFPYALPF-HFQLSKSQKYSKNNLLYPITAAINSTTTTENPKE  75

Query  375   VSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQL  554
              SFRSKNP DIN+L+ GSTGYIG+FV  ELVKRGF+VIA+ARE+SGI+G   K++TL QL
Sbjct  76    QSFRSKNPKDINVLITGSTGYIGKFVVNELVKRGFNVIAVAREKSGIKGKFGKDETLTQL  135

Query  555   SGANVCFSDVTelssleksveslGV-PIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
             +GANVCFSDVT    L +++E+ GV  IDVVVSCLASR+GGVKDSW IDYEATKNSL+ G
Sbjct  136   NGANVCFSDVTNFDDLARNLENFGVDSIDVVVSCLASRSGGVKDSWLIDYEATKNSLLAG  195

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             RKFGA HFVLLSAICVQKPLLEFQRAKLKFE +L++EAE D+GFTYSIVRPTAFFKSL G
Sbjct  196   RKFGAVHFVLLSAICVQKPLLEFQRAKLKFEAELIQEAEKDEGFTYSIVRPTAFFKSLGG  255

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             QVELVKDGKPYVMFGDGKLCACKPISE DLA FI D VL EDKINQ+LPIGGPGKALTPL
Sbjct  256   QVELVKDGKPYVMFGDGKLCACKPISEPDLARFIVDSVLDEDKINQILPIGGPGKALTPL  315

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESML  1271
             EQGEMLFKL GKE KFIKVPI+IMDFAIG LD L K+FPSLEDAAEFGKIGRYYAAESML
Sbjct  316   EQGEMLFKLVGKEPKFIKVPIEIMDFAIGVLDFLAKIFPSLEDAAEFGKIGRYYAAESML  375

Query  1272  VWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             V DPE G+Y AE TPSYG+DTL+EFF+RVL EGM GQELGEQ IF
Sbjct  376   VLDPETGDYSAEQTPSYGRDTLDEFFQRVLTEGMVGQELGEQTIF  420



>ref|XP_006400418.1| hypothetical protein EUTSA_v10013668mg [Eutrema salsugineum]
 gb|ESQ41871.1| hypothetical protein EUTSA_v10013668mg [Eutrema salsugineum]
Length=417

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/390 (75%), Positives = 328/390 (84%), Gaps = 2/390 (1%)
 Frame = +3

Query  234   LNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVE-TPNVSFRSKNPSDIN  410
             L   IQVN+     TF     S   +  + R KP+S   A   E   + SFR+KNPSDIN
Sbjct  26    LVSQIQVNSSALTSTFQIHESSTNLRFRRRRLKPISSLDAGISEIATSSSFRNKNPSDIN  85

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTe  590
             +LVVGSTGYIGRFV  EL+KRGF+VIA+ARE+SGIRG N K++TL QL GANVCFSDVT+
Sbjct  86    VLVVGSTGYIGRFVVKELIKRGFNVIAVAREKSGIRGKNDKQETLNQLQGANVCFSDVTQ  145

Query  591   lssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSA  770
             L +LEKSVE LG+ IDVVVSCLASRNGG+KDSWKIDYEATKNSL  G+KFGA HFVLLSA
Sbjct  146   LDALEKSVEDLGLGIDVVVSCLASRNGGIKDSWKIDYEATKNSLFAGKKFGAKHFVLLSA  205

Query  771   ICVQKPLLEFQRAKLKFEGDLMKEAE-DDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             ICVQKPLLEFQRAKLKFE +LM  AE  D  FTYSIVRPTAFFKSL GQVE+VKDGKPYV
Sbjct  206   ICVQKPLLEFQRAKLKFEAELMDLAESQDPSFTYSIVRPTAFFKSLGGQVEIVKDGKPYV  265

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MFGDGKLCACKPISE+DLA+FI+DCVL EDKINQVLPIGGPGKALTP+EQGE+LF++ G+
Sbjct  266   MFGDGKLCACKPISEQDLAAFIADCVLEEDKINQVLPIGGPGKALTPMEQGEILFRILGR  325

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E KF+KVPI+IMDFAIG LD L K+FPS+ +AAEFGKIGRYYAAESML+ DPE GEY  E
Sbjct  326   EPKFLKVPIEIMDFAIGVLDFLAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGEYSEE  385

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
              TPSYGKDTLE+FFK+V+REGMAGQELGEQ
Sbjct  386   KTPSYGKDTLEDFFKKVIREGMAGQELGEQ  415



>ref|XP_004486059.1| PREDICTED: protein TIC 62, chloroplastic-like [Cicer arietinum]
Length=420

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/394 (74%), Positives = 327/394 (83%), Gaps = 4/394 (1%)
 Frame = +3

Query  228   HFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKP-VSCSAAPAVETPNVSFRSKNPSD  404
             HF+N   QV++ P +      H  +P K   +R K   S S +  ++T   +FR+KNP D
Sbjct  30    HFINL-FQVSSTPLSSCSRKSH--EPIKFTTKRLKLYASLSPSQQIDTTPSTFRNKNPKD  86

Query  405   INILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDV  584
             +N+LVVGSTGYIG+FV  ELVKRGF+V AIARE+SGIRGS  KE TL QL GANVCFSDV
Sbjct  87    VNVLVVGSTGYIGKFVVKELVKRGFNVTAIAREKSGIRGSIDKETTLSQLRGANVCFSDV  146

Query  585   TelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLL  764
             T L + ++S+++LGV  DVVVSCLASRNGGVKDSW IDYEATKNSLV GRK GA+HFVLL
Sbjct  147   TNLDTFDESLKNLGVTFDVVVSCLASRNGGVKDSWLIDYEATKNSLVAGRKLGASHFVLL  206

Query  765   SAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPY  944
             SAICVQKPLLEFQRAKLK E +L+KEA+ D  F+YSIVRPTAFFKSL GQV+LVKDGKPY
Sbjct  207   SAICVQKPLLEFQRAKLKLEDELVKEAQKDDRFSYSIVRPTAFFKSLGGQVDLVKDGKPY  266

Query  945   VMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAG  1124
             VMFGDGKLCACKPISE+DLA FI DCV+S+DK+N++LPIGGPGKALTP+EQGEMLFKL G
Sbjct  267   VMFGDGKLCACKPISEQDLACFIVDCVMSDDKVNKILPIGGPGKALTPMEQGEMLFKLLG  326

Query  1125  KEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDA  1304
             KE KF KVPI IMDFAIG LD LVKVFPSLEDAAEFGKIGRYYAAESML+ DP+ GEY  
Sbjct  327   KEPKFFKVPIGIMDFAIGVLDFLVKVFPSLEDAAEFGKIGRYYAAESMLILDPDTGEYSD  386

Query  1305  ENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             E TPSYG DTLEEFF RVLREGMAGQELGEQ IF
Sbjct  387   EKTPSYGNDTLEEFFGRVLREGMAGQELGEQTIF  420



>ref|XP_010492887.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Camelina sativa]
Length=418

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/388 (74%), Positives = 329/388 (85%), Gaps = 3/388 (1%)
 Frame = +3

Query  243   HIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAV-ETP-NVSFRSKNPSDINIL  416
               QV + P A TF     S   K ++ R KP+S      V ETP + SFR+K+P D+N+L
Sbjct  29    QFQVKSSPLASTFQIHGSSTNLKFSRARLKPISSLVDSGVSETPTSSSFRNKSPKDVNVL  88

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             VVGSTGYIGRFV  EL+KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVCFSDVT+L 
Sbjct  89    VVGSTGYIGRFVVKELIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCFSDVTDLD  148

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
              LEK++E+LG  +DVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA HFVLLSAIC
Sbjct  149   VLEKTIENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAKHFVLLSAIC  208

Query  777   VQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMF  953
             VQKPLLEFQRAKLKFE +LM  AE  D  FTYSIVRPTAFFKSL GQVE+VKDGKPYVMF
Sbjct  209   VQKPLLEFQRAKLKFEAELMDLAESKDSSFTYSIVRPTAFFKSLGGQVEIVKDGKPYVMF  268

Query  954   GDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEA  1133
             GDGKLCACKPISE+DLASFISDCVL E+KINQVLPIGGPGKALTPLEQGE+LFK+ G+E 
Sbjct  269   GDGKLCACKPISEQDLASFISDCVLEENKINQVLPIGGPGKALTPLEQGEILFKILGREP  328

Query  1134  KFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENT  1313
             KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE GEY  E T
Sbjct  329   KFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGEYSEEKT  388

Query  1314  PSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             PSYGKDTLE+FF++V+REGMAGQELGEQ
Sbjct  389   PSYGKDTLEDFFEKVIREGMAGQELGEQ  416



>ref|XP_008353235.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Malus domestica]
Length=421

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/399 (74%), Positives = 339/399 (85%), Gaps = 2/399 (1%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPS-IHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFRS  389
             RLSSHF N   +V++VP   +  S ++  +     ++R K +S S+ P  E  N  SFR 
Sbjct  23    RLSSHFPNQTCKVSSVPSXFSSSSPLNLPETLNFIKDRLKXISASSNPVXEVTNPPSFRG  82

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             KN   INILVVG+TGYIG+FV  ELV R F+VIAIARE+SGIRG  SK++TL++L+GANV
Sbjct  83    KNXKXINILVVGATGYIGKFVVKELVSREFNVIAIAREKSGIRGKVSKDETLRELNGANV  142

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
             CFSDVT+L  LEK +E+LGV IDVVVSCLASR+GGVKDSWKIDYEATKNSLV GRK GA+
Sbjct  143   CFSDVTBLGVLEKCLENLGVSIDVVVSCLASRSGGVKDSWKIDYEATKNSLVAGRKRGAS  202

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLLEFQRAKLKFE +L++EAE+D GF+YSIV PTAFFKSL GQVELVK
Sbjct  203   HFVLLSAICVQKPLLEFQRAKLKFESELIREAEEDNGFSYSIVXPTAFFKSLGGQVELVK  262

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
             DGKPYVMFGDGKLCACKPISE DLASFI+DCVLSE+KINQVLPIGGPGKALTPLEQGE+L
Sbjct  263   DGKPYVMFGDGKLCACKPISEADLASFIADCVLSENKINQVLPIGGPGKALTPLEQGELL  322

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F+L G+E KF+KVPI+IMD AIG LD LVK+FPS+ED AEFGKIGRYYAAESMLV DPE 
Sbjct  323   FRLVGREPKFLKVPIEIMDCAIGXLDFLVKIFPSMEDTAEFGKIGRYYAAESMLVLDPET  382

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GEY+AE T SYGKDTLEEFF+ VLREG+AGQELGEQ IF
Sbjct  383   GEYNAEKTLSYGKDTLEEFFETVLREGIAGQELGEQTIF  421



>ref|XP_002873908.1| pale-green and chlorophyll B reduced 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50167.1| pale-green and chlorophyll B reduced 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/394 (73%), Positives = 333/394 (85%), Gaps = 5/394 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSC--SAAPAVETPNVSFRSKNP  398
             S F++   QV + P A TF +   S+  K  + R KP+S   S    + T + SFR+K+P
Sbjct  24    SKFISQ-FQVKSSPLASTFKTHESSETLKFKRARLKPISSLDSGISEIATSS-SFRNKSP  81

Query  399   SDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFS  578
              DIN+LVVGSTGYIGRFV  E++KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVCFS
Sbjct  82    KDINVLVVGSTGYIGRFVVKEMIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCFS  141

Query  579   DVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFV  758
             DVTEL  LEKS+E+LG  IDVVVSCLASRNGG+KDSWKIDYEATKNSLV G+KFGA HFV
Sbjct  142   DVTELDVLEKSIENLGFGIDVVVSCLASRNGGIKDSWKIDYEATKNSLVAGKKFGAKHFV  201

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             LLSAICVQKPLLEFQRAKLKFE +LM  AE+ D  FTYSIVRPTAFFKSL GQVE+VKDG
Sbjct  202   LLSAICVQKPLLEFQRAKLKFEAELMDLAEEQDSSFTYSIVRPTAFFKSLGGQVEIVKDG  261

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KPYVMFGDGKLCACKPISE+DLA+FI+DCVL E+KINQVLPIGGPGKALTPLEQGE+LF+
Sbjct  262   KPYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFR  321

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             + G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE GE
Sbjct  322   ILGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGE  381

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             Y  E TPSYGKDTLE+FF +V+REGMAGQELGEQ
Sbjct  382   YSEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQ  415



>ref|NP_197367.1| 3,8-divinyl protochlorophyllide [Arabidopsis thaliana]
 sp|Q1H537.1|DCVR_ARATH RecName: Full=Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic; 
AltName: Full=Protein PALE-GREEN AND CHLOROPHYLL 
B REDUCED 2; Flags: Precursor [Arabidopsis thaliana]
 gb|ABF59045.1| At5g18660 [Arabidopsis thaliana]
 gb|AED92595.1| 3,8-divinyl protochlorophyllide [Arabidopsis thaliana]
Length=417

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/393 (73%), Positives = 329/393 (84%), Gaps = 3/393 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFRSKNPS  401
             S F++   QV + P A TF +   S   K  + R KP+S   +   E     SFR+K+P 
Sbjct  24    SKFISQ-FQVKSSPLASTFHTNESSTSLKYKRARLKPISSLDSGISEIATSPSFRNKSPK  82

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             DIN+LVVGSTGYIGRFV  E++KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVCFSD
Sbjct  83    DINVLVVGSTGYIGRFVVKEMIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCFSD  142

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             VTEL  LEKS+E+LG  +DVVVSCLASRNGG+KDSWKIDYEATKNSLV G+KFGA HFVL
Sbjct  143   VTELDVLEKSIENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLVAGKKFGAKHFVL  202

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LSAICVQKPLLEFQRAKLKFE +LM  AE  D  FTYSIVRPTAFFKSL GQVE+VKDGK
Sbjct  203   LSAICVQKPLLEFQRAKLKFEAELMDLAEQQDSSFTYSIVRPTAFFKSLGGQVEIVKDGK  262

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDGKLCACKPISE+DLA+FI+DCVL E+KINQVLPIGGPGKALTPLEQGE+LFK+
Sbjct  263   PYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFKI  322

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE GEY
Sbjct  323   LGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGEY  382

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
               E TPSYGKDTLE+FF +V+REGMAGQELGEQ
Sbjct  383   SEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQ  415



>ref|XP_010420646.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Camelina sativa]
Length=419

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/396 (72%), Positives = 333/396 (84%), Gaps = 5/396 (1%)
 Frame = +3

Query  222   SSHFLNHHIQVNAVPYAITFPSIHFSKP-FKLNQERFKPVSCSAAPAVE--TPNVSFRSK  392
             +S+F++   QV + P   +   IH S    K ++ER KP+S      V     + SFR+K
Sbjct  23    NSNFVSQ-FQVKSAPLLASTFQIHGSPTNLKFSRERLKPISSLVDSGVSEIATSSSFRNK  81

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             +P D+N+LVVGSTGYIGRFV  EL+KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVC
Sbjct  82    SPKDVNVLVVGSTGYIGRFVVKELIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVC  141

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDV +L  LEKS+E+LG  +DVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA H
Sbjct  142   FSDVNDLDVLEKSIENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAKH  201

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVK  929
             FVLLSAICVQKPLLEFQRAKLKFE +LM  A++ D  FTYSIVRPTAFFKSL GQVE+VK
Sbjct  202   FVLLSAICVQKPLLEFQRAKLKFEAELMDLAQNKDSSFTYSIVRPTAFFKSLGGQVEIVK  261

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
             DGKPYVMFGDGKLCACKPISEEDLASFISDCVL E+KINQVLPIGGPGKALTPLEQGE+L
Sbjct  262   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLEENKINQVLPIGGPGKALTPLEQGEIL  321

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F++ G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE 
Sbjct  322   FRILGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLIIDPET  381

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             GEY  E TPSYGKDTLE+FFK+V+REGMAGQELGEQ
Sbjct  382   GEYSEEKTPSYGKDTLEDFFKKVIREGMAGQELGEQ  417



>ref|XP_003593996.1| hypothetical protein MTR_2g020160 [Medicago truncatula]
 gb|AES64247.1| 3,8-divinyl protochlorophyllide A 8-vinyl reductase [Medicago 
truncatula]
Length=412

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/406 (71%), Positives = 330/406 (81%), Gaps = 11/406 (3%)
 Frame = +3

Query  222   SSHFLNH-HIQVNAVPYAIT-FPSIHF--------SKPFKLNQERFKP-VSCSAAPAVET  368
             SS F+ H  ++   + +  +  P  HF        ++P K  +++ K   S S +  +ET
Sbjct  7     SSTFITHPSLKHQTLSFNFSSHPPSHFINLFKVKSNRPIKYTKQKLKLYASLSQSEQIET  66

Query  369   PNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ  548
                +FR KNP D+N+LVVGSTGYIG+FV  EL++RGF+V AIARE+SGI+GS  KE TL 
Sbjct  67    TPTTFRIKNPKDVNVLVVGSTGYIGKFVVKELIQRGFNVTAIAREKSGIKGSIDKETTLN  126

Query  549   QLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVV  728
             +L GANVCFSDVT L   ++ +++LGV  DVVVSCLASRNGGVKDSWKIDYEATKNSL+ 
Sbjct  127   ELRGANVCFSDVTNLDVFDEDLKNLGVGFDVVVSCLASRNGGVKDSWKIDYEATKNSLLA  186

Query  729   GRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLA  908
             GRK GA+HFVLLSAICVQKPLLEFQRAKLK E +L+KEAE D  F+YSIVRPTAFFKSL 
Sbjct  187   GRKLGASHFVLLSAICVQKPLLEFQRAKLKLEDELVKEAEKDDRFSYSIVRPTAFFKSLG  246

Query  909   GQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
             GQV+LVKDGKPYVMFGDGKLCACKPISE+DLASFI DCV+SEDKIN++LPIGGPGKALTP
Sbjct  247   GQVDLVKDGKPYVMFGDGKLCACKPISEQDLASFIVDCVMSEDKINKILPIGGPGKALTP  306

Query  1089  LEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESM  1268
             LEQGE+LFKL  KE KF+KVPI IMDFAIG LD LVKVFPSLEDAAEFGKIGRYYAAESM
Sbjct  307   LEQGEILFKLLRKEPKFLKVPIGIMDFAIGVLDNLVKVFPSLEDAAEFGKIGRYYAAESM  366

Query  1269  LVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             L+ DP+ GEY  E TPSYG DTLE+FF RVLREGMAGQELGEQ IF
Sbjct  367   LILDPDTGEYSDEKTPSYGNDTLEDFFARVLREGMAGQELGEQTIF  412



>ref|XP_010454119.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Camelina sativa]
Length=418

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/395 (72%), Positives = 330/395 (84%), Gaps = 4/395 (1%)
 Frame = +3

Query  222   SSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVE--TPNVSFRSKN  395
             +S+F++   QV + P A TF     S   K ++ R  P+S      +     + SFR+K 
Sbjct  23    NSNFVSQ-FQVKSSPLASTFQIHGSSTNLKFSRARLTPISSLVDSGISEIATSSSFRNKT  81

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P D+N+LVVGSTGYIGRFV  EL+ RGF+VIA+ARE+SGIRG N KE+TL+QL GANVCF
Sbjct  82    PKDVNVLVVGSTGYIGRFVVKELINRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCF  141

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
             SDVT+L  LEKSVE+LG  +DVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA HF
Sbjct  142   SDVTDLDVLEKSVENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAKHF  201

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKD  932
             VLLSAICVQKPLLEFQRAKLKFE +LM  AE+ D  FTYSIVRPTAFFKSL GQVE+VKD
Sbjct  202   VLLSAICVQKPLLEFQRAKLKFEAELMDLAENKDSSFTYSIVRPTAFFKSLGGQVEIVKD  261

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE+DLASFISDCVL E+KINQVLPIGGPGKALTPLEQGE+LF
Sbjct  262   GKPYVMFGDGKLCACKPISEQDLASFISDCVLEENKINQVLPIGGPGKALTPLEQGEILF  321

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             K+ G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE G
Sbjct  322   KILGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETG  381

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             EY  E TPSYGKDTLE+FF++V+REGMAGQELGEQ
Sbjct  382   EYSEEKTPSYGKDTLEDFFEKVIREGMAGQELGEQ  416



>gb|AAM62911.1| unknown [Arabidopsis thaliana]
Length=417

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/393 (73%), Positives = 328/393 (83%), Gaps = 3/393 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFRSKNPS  401
             S F++   QV + P A TF +   S   K  + R KP+S   +   E     SFR+K+P 
Sbjct  24    SKFISQ-FQVKSSPLASTFHTNESSTSLKYKRARLKPISSLDSGISEIATSPSFRNKSPK  82

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             DIN+LVVGSTGYIGRFV  E++KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVCFSD
Sbjct  83    DINVLVVGSTGYIGRFVVKEMIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCFSD  142

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             VTEL  LEKS+E+LG  +DVVVSCLASRNGG+KDSWKIDYEATKNSLV G+KFGA HFVL
Sbjct  143   VTELDVLEKSIENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLVAGKKFGAKHFVL  202

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LSAICVQKPLLEFQRAKLKFE +LM  AE  D  FTYSIVRPTAFFKSL GQVE+VKDGK
Sbjct  203   LSAICVQKPLLEFQRAKLKFEAELMDLAEQQDSSFTYSIVRPTAFFKSLGGQVEIVKDGK  262

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDGKLCACKPISE+DLA+FI+DCVL E+KINQVLPIGGPGKALTPLEQGE+LFK+
Sbjct  263   PYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFKI  322

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE  EY
Sbjct  323   LGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETEEY  382

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
               E TPSYGKDTLE+FF +V+REGMAGQELGEQ
Sbjct  383   SEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQ  415



>dbj|BAC41829.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/393 (73%), Positives = 328/393 (83%), Gaps = 3/393 (1%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNV-SFRSKNPS  401
             S F++   QV + P A TF +   S   K  + R KP+S   +   E     SFR+K+P 
Sbjct  24    SKFISQ-FQVKSSPLASTFHTNESSTSLKYKRARLKPISSLDSGISEIATSPSFRNKSPK  82

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             DIN+LVVGSTGYIGRFV  E++KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVCFSD
Sbjct  83    DINVLVVGSTGYIGRFVVKEMIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCFSD  142

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             VTEL  LEKS+E+LG  +DVVVSCLASRNGG+KDSWKIDYEATKNSLV G+KFGA HFVL
Sbjct  143   VTELDVLEKSIENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLVAGKKFGAKHFVL  202

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LSAICVQKPLLEFQRAKLKFE +LM  AE  D  FTYSIVRPTAFFKSL GQVE+VKDGK
Sbjct  203   LSAICVQKPLLEFQRAKLKFEAELMDLAEQQDSSFTYSIVRPTAFFKSLGGQVEIVKDGK  262

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDGKLCACKPISE+DLA+FI+DCVL E+KINQVLPIGGPGKALTPLEQGE+LFK+
Sbjct  263   PYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFKI  322

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE G Y
Sbjct  323   LGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGGY  382

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
               E TPSYGKDTLE+FF +V+REGMAGQELGEQ
Sbjct  383   SEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQ  415



>gb|ACJ85481.1| unknown [Medicago truncatula]
 gb|AFK42447.1| unknown [Medicago truncatula]
Length=412

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/406 (70%), Positives = 329/406 (81%), Gaps = 11/406 (3%)
 Frame = +3

Query  222   SSHFLNH-HIQVNAVPYAIT-FPSIHF--------SKPFKLNQERFKP-VSCSAAPAVET  368
             SS F+ H  ++   + +  +  P  HF        ++P K  +++ K   S S +  +ET
Sbjct  7     SSTFITHPSLKHQTLSFNFSSHPPSHFINLFKVKSNRPIKYTKQKLKLYASLSQSEQIET  66

Query  369   PNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ  548
                +FR KNP D+N+LVVGSTGYIG+FV  EL++RGF+V AIARE+SGI+GS  KE TL 
Sbjct  67    TPTTFRIKNPKDVNVLVVGSTGYIGKFVVKELIQRGFNVTAIAREKSGIKGSIDKETTLN  126

Query  549   QLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVV  728
             +L GANVCFSDVT L   ++ +++LGV  DVVVSCLASRNGGVKDSWKIDYEATKNSL+ 
Sbjct  127   ELRGANVCFSDVTNLDVFDEDLKNLGVGFDVVVSCLASRNGGVKDSWKIDYEATKNSLLA  186

Query  729   GRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLA  908
             GRK GA+HFVLLSAICVQKPLLEFQRAKLK E +L+KEAE D  F+YSIVRPT FFKSL 
Sbjct  187   GRKLGASHFVLLSAICVQKPLLEFQRAKLKLEDELVKEAEKDDRFSYSIVRPTTFFKSLG  246

Query  909   GQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
             GQV+LVKDGKPYVMFGDGKLCACKPISE+DLASFI DCV+SEDKIN++LPIGGPGKALTP
Sbjct  247   GQVDLVKDGKPYVMFGDGKLCACKPISEQDLASFIVDCVMSEDKINKILPIGGPGKALTP  306

Query  1089  LEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESM  1268
             LEQGE+LFKL  KE KF+KVP+ IMDFAIG LD LVKVFPSLEDAAEFGKIGRYYAAESM
Sbjct  307   LEQGEILFKLLRKEPKFLKVPMGIMDFAIGVLDNLVKVFPSLEDAAEFGKIGRYYAAESM  366

Query  1269  LVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             L+ DP+ GEY  E TPSYG DTLE+FF RVLREGMAGQELGEQ IF
Sbjct  367   LILDPDTGEYSDEKTPSYGNDTLEDFFARVLREGMAGQELGEQTIF  412



>ref|XP_006289483.1| hypothetical protein CARUB_v10003017mg [Capsella rubella]
 gb|EOA22381.1| hypothetical protein CARUB_v10003017mg [Capsella rubella]
Length=417

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/395 (73%), Positives = 334/395 (85%), Gaps = 5/395 (1%)
 Frame = +3

Query  222   SSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSC--SAAPAVETPNVSFRSKN  395
             +S+F++   QV + P A TF     S     ++ R KP+S   S    + T + SFR+K+
Sbjct  23    NSNFVSQ-FQVKSSPLASTFQFHGSSTSLMFSRARLKPISSLDSGISEIATSS-SFRNKS  80

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P D+N+LVVGSTGYIGRFV  EL+KRGF+VIA+ARE+SGIRG N KE+TL+QL GANVCF
Sbjct  81    PKDVNVLVVGSTGYIGRFVVKELIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCF  140

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
             SDVTEL  LEKSVE+LG  IDVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA HF
Sbjct  141   SDVTELDVLEKSVENLGFGIDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAKHF  200

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAED-DKGFTYSIVRPTAFFKSLAGQVELVKD  932
             VLLSAICVQKPLLEFQRAKLKFE +LM  AE+ D  F+YSIVRPTAFFKSL GQV++VKD
Sbjct  201   VLLSAICVQKPLLEFQRAKLKFEAELMDLAENKDPSFSYSIVRPTAFFKSLGGQVDIVKD  260

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE+DLA+FI+DCVL E+KINQVLPIGGPGKALTPLEQGE+LF
Sbjct  261   GKPYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILF  320

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             ++ G+E KF+KVPI+IMDF IG LD + K+FPS+ +AAEFGKIGRYYAAESML+ DPE G
Sbjct  321   RILGREPKFLKVPIEIMDFVIGVLDFIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETG  380

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             EY  E TPSYGKDTLE+FFK+V+REGMAGQELGEQ
Sbjct  381   EYSEEKTPSYGKDTLEDFFKKVIREGMAGQELGEQ  415



>emb|CDY13910.1| BnaC09g39160D [Brassica napus]
Length=418

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/394 (72%), Positives = 332/394 (84%), Gaps = 6/394 (2%)
 Frame = +3

Query  228   HFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNV----SFRSKN  395
               ++   Q+N+ P A TF +   S   +L + R KPVS      ++T +     +FR+K 
Sbjct  25    KLVSRSQQLNSFPLASTFQTNEPSSNLRLTRSRLKPVSSLGTSEIDTSSSSSSSTFRNKI  84

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P ++NILVVGSTGYIGRFV  ELVKRGF+VIA+ARE+SG+RG N KE TL+QL GANVCF
Sbjct  85    PREVNILVVGSTGYIGRFVVQELVKRGFNVIAVAREKSGVRGKNDKEATLKQLQGANVCF  144

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
             SDVT+L+SLE+SVE+LG+ IDVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA HF
Sbjct  145   SDVTDLASLERSVEALGLGIDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAKHF  204

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQKPLLEFQRAKLKFE +LM+    D  FTYSIVRPTAFFKSL GQV++VKDG
Sbjct  205   VLLSAICVQKPLLEFQRAKLKFEAELMELP--DSTFTYSIVRPTAFFKSLGGQVDIVKDG  262

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KPYVMFGDGKLCACKPISEEDLASFI+DCVL EDKIN+VLPIGGPGKALTPLEQGE+LF+
Sbjct  263   KPYVMFGDGKLCACKPISEEDLASFIADCVLEEDKINKVLPIGGPGKALTPLEQGEILFR  322

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             + G+E KF++VPI+IMDF IG LD + KVFPS+ +AAEFGKIGRYYAAESML+ DPE GE
Sbjct  323   ILGREPKFLRVPIEIMDFVIGVLDGVAKVFPSVAEAAEFGKIGRYYAAESMLILDPETGE  382

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             Y  E TPSYGKDTLE+FF++V+REGMAGQELGEQ
Sbjct  383   YSEEKTPSYGKDTLEDFFEKVVREGMAGQELGEQ  416



>ref|XP_009120951.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Brassica rapa]
Length=410

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/391 (74%), Positives = 331/391 (85%), Gaps = 8/391 (2%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRSKNPSD  404
             S  L+   Q+N+ P A TF +   SK       R KPVS S   A  + + +FR+K+PS+
Sbjct  26    SKLLSRPQQLNSFPLASTFQTNEPSKNL-----RLKPVS-SLETAPTSSSSTFRNKSPSE  79

Query  405   INILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDV  584
             INILVVGSTGYIGRFV  ELVKRGF+VIA+ARE+SG+RG N KE TL+QL GANVCFSDV
Sbjct  80    INILVVGSTGYIGRFVVQELVKRGFNVIAVAREKSGVRGKNDKEATLKQLQGANVCFSDV  139

Query  585   TelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLL  764
             T+L+SLE+SVESL + IDVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA HFVLL
Sbjct  140   TDLASLEQSVESLNLGIDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAKHFVLL  199

Query  765   SAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPY  944
             SAICVQKPLLEFQRAKLKFE +LM+    D  FTYSIVRPTAFFKSL GQV++VKDGKPY
Sbjct  200   SAICVQKPLLEFQRAKLKFEAELMEV--QDSTFTYSIVRPTAFFKSLGGQVDIVKDGKPY  257

Query  945   VMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAG  1124
             VMFGDGKLCACKPISEEDLASFI+DCVL E KIN+VLPIGGPGKALTPLEQGE+LF++ G
Sbjct  258   VMFGDGKLCACKPISEEDLASFIADCVLEESKINKVLPIGGPGKALTPLEQGEILFRILG  317

Query  1125  KEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDA  1304
             +E KF+KVPI+IMDF IG LD + KVFPS+ +AAEFGKIGRYYAAESML+ DPE GEY  
Sbjct  318   REPKFLKVPIEIMDFVIGVLDGIAKVFPSVAEAAEFGKIGRYYAAESMLILDPETGEYSE  377

Query  1305  ENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             E TPSYGKDTLE+FF++V+REGMAGQELGEQ
Sbjct  378   EKTPSYGKDTLEDFFEKVVREGMAGQELGEQ  408



>ref|XP_010921737.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Elaeis guineensis]
Length=413

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/406 (68%), Positives = 323/406 (80%), Gaps = 18/406 (4%)
 Frame = +3

Query  231   FLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAA--------------PAVET  368
              L+ H  ++++P+   FPS     P  +N  + KP +   +                  T
Sbjct  12    LLHSHPHLSSLPH---FPSSLLISPL-INPSKPKPSTIKLSIDASSSPIPPSPVLKPTTT  67

Query  369   PNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ  548
             P+ SFR+K P DINILV GSTGYIG+FV  EL +RGF+VIA+ARERSGIRG N K+ TLQ
Sbjct  68    PSPSFRTKPPKDINILVTGSTGYIGKFVVRELCRRGFNVIAVARERSGIRGRNDKDQTLQ  127

Query  549   QLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVV  728
             QL+G+ VCFSDVT+L +L +S++SLG+PID VV CLASR GG+KDSWKIDY AT+NSLV 
Sbjct  128   QLAGSTVCFSDVTDLDALHRSLDSLGLPIDAVVCCLASRTGGIKDSWKIDYSATRNSLVA  187

Query  729   GRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLA  908
             GR+ GA+H VLLSAICVQKPLLEFQRAKLKFE  L KEA D  GFTYSIVRPTAFFKSL 
Sbjct  188   GRRLGASHLVLLSAICVQKPLLEFQRAKLKFEAKLEKEAADGTGFTYSIVRPTAFFKSLG  247

Query  909   GQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
             GQVE VK GKPYVMFGDG+LCACKPISEEDLASFI+DCV+ EDK  ++LPIGGPGKALTP
Sbjct  248   GQVETVKGGKPYVMFGDGRLCACKPISEEDLASFIADCVMDEDKTCKILPIGGPGKALTP  307

Query  1089  LEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESM  1268
             LEQGEMLF+L G+E KF+KVPI +MDFAIG LD L K+FPSLEDAAEFG+IGRYYAAESM
Sbjct  308   LEQGEMLFRLLGQEPKFLKVPIGVMDFAIGVLDFLSKIFPSLEDAAEFGRIGRYYAAESM  367

Query  1269  LVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             LV DPE GEY A+ TPSYG+DTLE+FF +V+REGMAGQELGEQ IF
Sbjct  368   LVLDPETGEYSADKTPSYGEDTLEDFFAKVIREGMAGQELGEQTIF  413



>gb|EPS66272.1| hypothetical protein M569_08504, partial [Genlisea aurea]
Length=363

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/365 (74%), Positives = 313/365 (86%), Gaps = 3/365 (1%)
 Frame = +3

Query  315   NQERFKPVSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAI  494
              +ERF     S++P  ET   SFR+K P +IN+LVVGSTGYIG+FV  EL++RGF+VIA+
Sbjct  1     RRERFNFSVSSSSP--ETAKPSFRAKRPQEINVLVVGSTGYIGKFVVKELIRRGFNVIAV  58

Query  495   ARERSGIRGSNSKEDTLQQLSGANVCFSDVTel-ssleksveslGVPIDVVVSCLASRNG  671
             ARERSGI G N    T + LSGANVCFSDVTEL S      +++G  +DVVVSCLASRNG
Sbjct  59    ARERSGIGGRNGGSQTAELLSGANVCFSDVTELDSLEGSVRKAVGSGLDVVVSCLASRNG  118

Query  672   GVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAED  851
             GVKDSW IDYEAT+NSL+VG+KFGA+HFVLLSAICVQKPLLEFQRAKLKFE +L++E+ +
Sbjct  119   GVKDSWLIDYEATRNSLIVGKKFGASHFVLLSAICVQKPLLEFQRAKLKFEAELIQESTN  178

Query  852   DKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLS  1031
                 TYSIVRPTAFFKSLAGQVELV+DGKPYVMFGDG+LCACKPISE DLASF++DCV  
Sbjct  179   GTRMTYSIVRPTAFFKSLAGQVELVRDGKPYVMFGDGRLCACKPISERDLASFVADCVTG  238

Query  1032  EDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPS  1211
             E+ IN+VLP+GGPG+A+TPLEQGE+LF+LAGKEAKF++VPI IMDF IG L+ L  +FPS
Sbjct  239   EESINRVLPVGGPGEAVTPLEQGELLFRLAGKEAKFVRVPIGIMDFVIGVLEFLAGIFPS  298

Query  1212  LEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELG  1391
             LEDAAEFG+IGRYYAAESMLVWDPE GEYDA+ TPSYGKDTLEEFFKRVL EG+AGQELG
Sbjct  299   LEDAAEFGRIGRYYAAESMLVWDPETGEYDADKTPSYGKDTLEEFFKRVLEEGIAGQELG  358

Query  1392  EQMIF  1406
             EQMIF
Sbjct  359   EQMIF  363



>ref|XP_007035488.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY06414.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=386

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 316/371 (85%), Gaps = 8/371 (2%)
 Frame = +3

Query  216   RLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETP-NVSFRSK  392
             R  S F+   IQV + P+  T PS    +PFK + ERF+ V   A   VET  + S+RSK
Sbjct  23    RFFSQFI-KQIQVKSAPF--TLPS----RPFKCSGERFELVRALATKPVETAVSASYRSK  75

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
              P  IN+LV+GSTGYIG+FV  ELV RGF+VIAIARERSGIRG NSKED+L  L GA+VC
Sbjct  76    IPKGINVLVMGSTGYIGKFVVKELVNRGFNVIAIARERSGIRGKNSKEDSLNDLQGASVC  135

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             FSDVT L +LEKS+++LG PIDVVVSCLASR GGVKDSWKIDY+ATKNSLV G+KFGA+H
Sbjct  136   FSDVTNLDTLEKSLQNLGFPIDVVVSCLASRTGGVKDSWKIDYKATKNSLVAGKKFGASH  195

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             FVLLSAICVQKPLL+FQRAKLKFE +LMKEAE+D G T+SIVRPTAFFKSL GQVELVKD
Sbjct  196   FVLLSAICVQKPLLQFQRAKLKFEAELMKEAEEDGGVTFSIVRPTAFFKSLGGQVELVKD  255

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKPYVMFGDGKLCACKPISE+DLASFI+DCVLSEDKINQVLPIGGPGKALTPLEQGE+LF
Sbjct  256   GKPYVMFGDGKLCACKPISEQDLASFIADCVLSEDKINQVLPIGGPGKALTPLEQGEILF  315

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             KL GKE KF+KVPI IMDFAIG LD LVK+FPS+EDAAEFGKIGRYYAAESMLV DPE G
Sbjct  316   KLLGKEPKFLKVPIGIMDFAIGILDFLVKIFPSMEDAAEFGKIGRYYAAESMLVLDPETG  375

Query  1293  EYDAENTPSYG  1325
             EY AE TPSYG
Sbjct  376   EYSAEKTPSYG  386



>emb|CDX92592.1| BnaA10g16310D [Brassica napus]
Length=412

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/392 (73%), Positives = 329/392 (84%), Gaps = 8/392 (2%)
 Frame = +3

Query  225   SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVS-FRSKNPS  401
             S  L+   Q+N+ P A TF +   SK       R KPVS        + + S FR+K+PS
Sbjct  26    SKLLSRSQQLNSFPLASTFQTNEPSKNL-----RLKPVSSLETATSSSSSSSTFRNKSPS  80

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             +INILVVGSTGYIGRFV  ELVKRGF+VIA+ARE+SG+RG N KE TL+QL GANVCFSD
Sbjct  81    EINILVVGSTGYIGRFVVKELVKRGFNVIAVAREKSGVRGKNDKEATLKQLQGANVCFSD  140

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             VT+L+SLE+SVESL + IDVVVSCLASRNGG+KDSWKIDYEATKNSL+ G+KFGA HFVL
Sbjct  141   VTDLASLERSVESLNLGIDVVVSCLASRNGGIKDSWKIDYEATKNSLLAGKKFGAEHFVL  200

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQKPLLEFQRAKLKFE +LM+    D  FTYSIVRPTAFFKSL GQV++VKDGKP
Sbjct  201   LSAICVQKPLLEFQRAKLKFEAELMEV--QDSTFTYSIVRPTAFFKSLGGQVDIVKDGKP  258

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             YVMFGDGKLCACKPISEEDLASFI+DCVL E KIN+VLPIGGPGKALTPLEQGE+LF++ 
Sbjct  259   YVMFGDGKLCACKPISEEDLASFIADCVLEESKINKVLPIGGPGKALTPLEQGEILFRIL  318

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
             G+E KF+KVPI+IMDF IG LD + KVFPS+ +AAEFGKIGRYYAAESML+ DPE GEY 
Sbjct  319   GREPKFLKVPIEIMDFVIGVLDGIAKVFPSVAEAAEFGKIGRYYAAESMLILDPETGEYS  378

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
              E TPSYGKDTLE+FF++V+REGMAGQELGEQ
Sbjct  379   EEKTPSYGKDTLEDFFEKVVREGMAGQELGEQ  410



>ref|XP_008812306.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008812307.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Phoenix dactylifera]
Length=415

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/408 (67%), Positives = 323/408 (79%), Gaps = 20/408 (5%)
 Frame = +3

Query  231   FLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKP------VSCSAAPAVETPNVS----  380
              L+ H  ++++P    FPS     P  +   + KP      +  S +P   +P +     
Sbjct  12    LLHSHPHLSSLP---NFPSSLLVSPL-ITHSKLKPRTVKLSIDASNSPNPPSPVLEPTTT  67

Query  381   ------FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDT  542
                   FR+K   DINILV GSTGYIG+FV  EL +RGF+VIA+ARERSGIRG + K+ T
Sbjct  68    PSPSPSFRTKPHKDINILVTGSTGYIGKFVVRELCRRGFNVIAVARERSGIRGRSDKDQT  127

Query  543   LQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSL  722
             LQQL+G+ VCFSDVT+L +L++S++SLG+PID VV CLASR GG+KDSWKIDY AT+NSL
Sbjct  128   LQQLAGSTVCFSDVTDLDTLDRSLDSLGLPIDAVVCCLASRTGGIKDSWKIDYGATRNSL  187

Query  723   VVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKS  902
             V GR+ GA+HFVLLSAICVQKPLLEFQRAKLKFE +L KEA D  GFTYSIVRPTAFFKS
Sbjct  188   VAGRRRGASHFVLLSAICVQKPLLEFQRAKLKFEDELEKEAADGTGFTYSIVRPTAFFKS  247

Query  903   LAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKAL  1082
             L GQVE VK GKPYVMFGDG+LCACKPISEEDLASFI+DCV+ EDK  ++LPIGGPGKAL
Sbjct  248   LGGQVETVKGGKPYVMFGDGRLCACKPISEEDLASFIADCVMDEDKACKILPIGGPGKAL  307

Query  1083  TPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAE  1262
             TPL+QGEMLF+L G+E KF+KVPI +MDF+IG LD L K+FPSLEDAAEFG+IGRYYAAE
Sbjct  308   TPLDQGEMLFRLLGQEPKFLKVPIGVMDFSIGVLDFLSKIFPSLEDAAEFGRIGRYYAAE  367

Query  1263  SMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             SMLV DPE G+Y AE TPSYGKDTL++FF RV REGMAGQELGEQ IF
Sbjct  368   SMLVLDPETGQYSAEKTPSYGKDTLDDFFARVTREGMAGQELGEQTIF  415



>ref|XP_006855435.1| hypothetical protein AMTR_s00057p00165960 [Amborella trichopoda]
 gb|ERN16902.1| hypothetical protein AMTR_s00057p00165960 [Amborella trichopoda]
Length=487

 Score =   533 bits (1373),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 264/342 (77%), Positives = 299/342 (87%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             F +K P  IN+LVVGSTGYIG+FV   LV+RG++VIAIARE SGIRG  SKE TL++L G
Sbjct  147   FINKEPKYINVLVVGSTGYIGKFVVRALVQRGYNVIAIARENSGIRGKTSKEKTLEELKG  206

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A VCFSDVT L  LEKS+E+LG+ ID  VSCLASRNGGVKDSWKIDYEATKNSL+  ++F
Sbjct  207   AKVCFSDVTNLPELEKSIENLGISIDAAVSCLASRNGGVKDSWKIDYEATKNSLLASKRF  266

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GA+HFVLLSAICVQKP LEFQRAKLKFE  L KEAE   G TYSIVRPTAFFKSL GQVE
Sbjct  267   GASHFVLLSAICVQKPFLEFQRAKLKFEAKLQKEAEGG-GLTYSIVRPTAFFKSLGGQVE  325

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +VKDGKPYVMFGDGKLCACKPISEEDLASFI DC+ S+DKIN+VLPIGGPGKALTPLEQG
Sbjct  326   IVKDGKPYVMFGDGKLCACKPISEEDLASFIVDCISSKDKINKVLPIGGPGKALTPLEQG  385

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF++ G+E KF+KVPI +MDF I  L+ LV++FPSLEDAAEFG+IGRYYAAESMLVWD
Sbjct  386   EMLFRILGQEPKFLKVPIGLMDFVISVLEFLVRIFPSLEDAAEFGRIGRYYAAESMLVWD  445

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             P+ G+YD ++TPSYGKDTLEEFF++V+REGM GQELGEQ IF
Sbjct  446   PKTGKYDEDSTPSYGKDTLEEFFEKVIREGMVGQELGEQTIF  487



>gb|ABR17729.1| unknown [Picea sitchensis]
Length=454

 Score =   529 bits (1363),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 258/343 (75%), Positives = 299/343 (87%), Gaps = 1/343 (0%)
 Frame = +3

Query  378   SFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLS  557
             SFR K+  DIN+LVVGSTGYIG+FV  ELVKRG++VIA+ARERSGI G   K +T++ L 
Sbjct  113   SFRKKSIQDINVLVVGSTGYIGKFVVKELVKRGYNVIAVARERSGIDGRYGKNETIEDLK  172

Query  558   GANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRK  737
             GA VCF+DVT++SSL+ ++  +GV IDV++SCLASRNGGVKDSW+IDYEATKNSLV G+ 
Sbjct  173   GAQVCFADVTDISSLKTAIHDVGVAIDVIISCLASRNGGVKDSWRIDYEATKNSLVAGKA  232

Query  738   FGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQV  917
              GA+HFVLLSAICVQKPLLEFQRAKLKFE +L +EA+  +  TYSIVRPTAFFKSL GQV
Sbjct  233   AGASHFVLLSAICVQKPLLEFQRAKLKFEAELQREAKIGE-LTYSIVRPTAFFKSLGGQV  291

Query  918   ELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQ  1097
             EL K GKPYVMFGDG LCACKPISE DLASF+ DC+L EDKIN++LPIGGPGKALTPLEQ
Sbjct  292   ELAKSGKPYVMFGDGTLCACKPISERDLASFMVDCILEEDKINKILPIGGPGKALTPLEQ  351

Query  1098  GEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVW  1277
             GEM+F+L GKE KF+KVP+ IMDFAIG L+ LVK+FPSLEDAAEFGKIGRYYAAESML+ 
Sbjct  352   GEMIFRLMGKEPKFLKVPLGIMDFAIGVLEFLVKIFPSLEDAAEFGKIGRYYAAESMLLL  411

Query  1278  DPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             DP+ GEYDA  TPSYG+DTLEEFF+R LREGMAGQELG+Q +F
Sbjct  412   DPKTGEYDANATPSYGRDTLEEFFERGLREGMAGQELGDQAVF  454



>emb|CAN63393.1| hypothetical protein VITISV_001886 [Vitis vinifera]
Length=398

 Score =   522 bits (1345),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 314/403 (78%), Gaps = 26/403 (6%)
 Frame = +3

Query  207   NFRRLS-SHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSF  383
             +FR  S S F+N + QV   PYAIT   +  S+  K ++ERF P++ S  P VE    SF
Sbjct  19    SFRNCSASQFINQN-QVTPAPYAITRLPLSLSQSPKFSRERFLPITASITPTVEPTPSSF  77

Query  384   RSKNPSDINILVVGSTGYIGRFVATE--LVKRGFSVIAIARERSGIRGSNSKEDTLQQLS  557
             R K     N    G   ++ R +  E  L+++G  +                     +L+
Sbjct  78    RGKI-RKRNQCGGGGFNWVHRKICGERQLLEKGVGL---------------------ELN  115

Query  558   GANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRK  737
             GANV FSDVT L  LEKS+E+LG+PIDVVVSCLASR GGVKDSWKIDYEATKNSLV GRK
Sbjct  116   GANVWFSDVTSLDVLEKSLENLGLPIDVVVSCLASRTGGVKDSWKIDYEATKNSLVAGRK  175

Query  738   FGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQV  917
              GA+HFVLLSA+CVQKPLLEFQRAKLKFE +LMKEAE+D GFTYSIVRPTAFFKSL GQV
Sbjct  176   RGASHFVLLSAVCVQKPLLEFQRAKLKFEAELMKEAEEDDGFTYSIVRPTAFFKSLGGQV  235

Query  918   ELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQ  1097
             ELVKDGKPYVMFGDGKLCACKPISE+DLASFI+DCVL +DKINQVLPIGGPGKALTPLEQ
Sbjct  236   ELVKDGKPYVMFGDGKLCACKPISEQDLASFIADCVLEKDKINQVLPIGGPGKALTPLEQ  295

Query  1098  GEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVW  1277
             GEMLF+LAG+   F+KVPI IMDFAIGFLD LVK+FPS+EDAAEFGKIGRYYAAESMLV 
Sbjct  296   GEMLFRLAGRXPNFLKVPIGIMDFAIGFLDFLVKIFPSMEDAAEFGKIGRYYAAESMLVL  355

Query  1278  DPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             DPE GEY AE TPSYGKDTLEEFF+RVLREGMAGQELGEQ IF
Sbjct  356   DPETGEYSAEKTPSYGKDTLEEFFERVLREGMAGQELGEQTIF  398



>ref|XP_009414186.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Musa acuminata subsp. malaccensis]
 ref|XP_009414187.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   518 bits (1333),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 250/349 (72%), Positives = 297/349 (85%), Gaps = 0/349 (0%)
 Frame = +3

Query  357   AVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKE  536
             +  +P  SFR ++P D+N+LV GSTGYIG+FV  EL +RGF+V+A+ARERSGIRG + K 
Sbjct  72    STASPTQSFRKRSPKDVNVLVTGSTGYIGKFVVRELCRRGFNVVAVARERSGIRGRDDKA  131

Query  537   DTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKN  716
                 QL+GA VCF+DVT+  +L +++++LG P+D VV CLASR GG+ DSWK+DY A++N
Sbjct  132   RAAGQLAGATVCFADVTDPDALGRALDALGRPVDAVVCCLASRGGGISDSWKVDYGASRN  191

Query  717   SLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFF  896
             SL+ GR+ GA+HFVLLSAICVQKPLLEFQRAKLKFE +L++EA  D GFTYS+VRPTAFF
Sbjct  192   SLLAGRRLGASHFVLLSAICVQKPLLEFQRAKLKFEAELVEEAAADPGFTYSVVRPTAFF  251

Query  897   KSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGK  1076
             KSL GQVE VKDGKPYVMFGDG+LCACKPISE DLA+FI+DCV+ EDK  ++LPIGGPGK
Sbjct  252   KSLGGQVETVKDGKPYVMFGDGRLCACKPISEADLAAFIADCVMDEDKACKILPIGGPGK  311

Query  1077  ALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYA  1256
             ALTPLEQG++LFKL G+E KF KVPI++MDF IG LD L K+FPSLEDAAEFGKIGRYYA
Sbjct  312   ALTPLEQGQLLFKLLGREPKFFKVPIEVMDFVIGVLDFLAKLFPSLEDAAEFGKIGRYYA  371

Query  1257  AESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMI  1403
             AESMLV DPE GEY AE TPSYGKDTLEEFF +V+REGMAGQELGEQ I
Sbjct  372   AESMLVLDPETGEYSAEKTPSYGKDTLEEFFAKVIREGMAGQELGEQTI  420



>dbj|BAJ85154.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88102.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   491 bits (1263),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/343 (71%), Positives = 270/343 (79%), Gaps = 1/343 (0%)
 Frame = +3

Query  378   SFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLS  557
             SFRS  PSD  +LV GSTGYIGRFV  EL+ RG  VIA+AR RSGI G NS E+ +  L+
Sbjct  57    SFRSLPPSDTTVLVTGSTGYIGRFVVRELLYRGHRVIAVARPRSGIHGKNSPEEVVSDLA  116

Query  558   GANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRK  737
              A V FSDVT+  +L   +   G P+   V CLASR GGV+DSW++DY AT ++L   R 
Sbjct  117   PARVVFSDVTDPGALLAGLSEYG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQAARS  175

Query  738   FGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQV  917
              GAAHFVLLSA+CVQKPLLEFQRAKLKFE +L  EA  D  FTYSIVRPTAFFKSL GQV
Sbjct  176   LGAAHFVLLSAVCVQKPLLEFQRAKLKFEDELAAEAARDPAFTYSIVRPTAFFKSLGGQV  235

Query  918   ELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQ  1097
             E VK G PYVMFGDGKLCACKPISEEDLASFI+DC+  E+K N+VLPIGGPGKALTPLEQ
Sbjct  236   ETVKKGNPYVMFGDGKLCACKPISEEDLASFIADCIFDEEKANKVLPIGGPGKALTPLEQ  295

Query  1098  GEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVW  1277
             GEMLF+L G+E KFIKVPIQIMD  I  LD L KVFP LEDAAEFGKIGRYYA+ESMLV 
Sbjct  296   GEMLFRLLGREPKFIKVPIQIMDGVIWVLDGLAKVFPGLEDAAEFGKIGRYYASESMLVL  355

Query  1278  DPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             DPE GEY  + TPSYG DTLE FF +V+REGMAGQELGEQ IF
Sbjct  356   DPETGEYSDDKTPSYGTDTLEHFFDKVIREGMAGQELGEQTIF  398



>ref|XP_003557853.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   488 bits (1255),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 238/342 (70%), Positives = 274/342 (80%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FRS  PS+  +LV G+TGYIGRFV  EL++RG  V+A+AR RSG+RG NS E+ +  L+ 
Sbjct  63    FRSLLPSETTVLVTGATGYIGRFVVRELLRRGHRVLAVARPRSGLRGRNSPEEVVADLAP  122

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+ ++L   +   G P+   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  123   ARVVFSDVTDPAALLADLSEYG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQASRSL  181

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSA+CVQKPLLEFQRAKLKFE +L  EA  D  FTYSIVRPTAFFKSL GQVE
Sbjct  182   GAAHFVLLSAVCVQKPLLEFQRAKLKFEDELAAEAARDPAFTYSIVRPTAFFKSLGGQVE  241

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
              VK G+PYVMFGDGKLCACKPISEEDLA+FI++C+  EDK N+VLPIGGPGKALTP+EQG
Sbjct  242   TVKKGQPYVMFGDGKLCACKPISEEDLAAFIANCIFDEDKANKVLPIGGPGKALTPMEQG  301

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E KFIKVPIQIMD  I  LD L KVFP LEDAAEFGKIGRYYA+ESMLV D
Sbjct  302   EMLFRLLGREPKFIKVPIQIMDGVIWVLDGLAKVFPGLEDAAEFGKIGRYYASESMLVLD  361

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE GEY  E TPSYG DTLE+FF +V+REGMAGQELGEQ IF
Sbjct  362   PETGEYSDEKTPSYGTDTLEQFFDKVIREGMAGQELGEQTIF  403



>ref|NP_001050115.1| Os03g0351200 [Oryza sativa Japonica Group]
 sp|Q10LH0.1|DCVR_ORYSJ RecName: Full=Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|D5L1S4.1|DCVR_ORYSI RecName: Full=Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|ABF95932.1| isoflavone reductase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12029.1| Os03g0351200 [Oryza sativa Japonica Group]
 gb|EAZ26913.1| hypothetical protein OsJ_10840 [Oryza sativa Japonica Group]
 gb|ADE43128.1| divinyl reductase [Oryza sativa Indica Group]
Length=405

 Score =   487 bits (1254),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 234/342 (68%), Positives = 275/342 (80%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FRS  PS+  +LV G+TGYIGR+V  EL++RG  V+A+AR RSG+RG N  ++ +  L+ 
Sbjct  65    FRSLAPSETTVLVTGATGYIGRYVVRELLRRGHPVVAVARPRSGLRGRNGPDEVVADLAP  124

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+  +L   +   G PI   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  125   ARVVFSDVTDAGALRADLSPHG-PIHAAVCCLASRGGGVRDSWRVDYRATLHTLQAARGL  183

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSA+CVQKPLLEFQRAKL+FEG+L  EA  D  FTYSIVRPTAFFKSL GQVE
Sbjct  184   GAAHFVLLSAVCVQKPLLEFQRAKLRFEGELAAEASRDPSFTYSIVRPTAFFKSLGGQVE  243

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
              VK+G+PYVMFGDGKLCACKPISEEDLA+FI+DC+  E K N++LPIGGPGKALTPLEQG
Sbjct  244   TVKNGQPYVMFGDGKLCACKPISEEDLAAFIADCISDEGKANKILPIGGPGKALTPLEQG  303

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E +FIKVPIQ+MD AI  LD L KVFP +EDAAEFGKIGRYYA+ESMLV D
Sbjct  304   EMLFRLLGREPRFIKVPIQVMDAAIWVLDALAKVFPGVEDAAEFGKIGRYYASESMLVLD  363

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             P+ GEY  E TPSYG DTLE+FF+RV+REGMAGQELGEQ IF
Sbjct  364   PDTGEYSDEMTPSYGSDTLEQFFERVIREGMAGQELGEQTIF  405



>ref|XP_004984383.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Setaria italica]
Length=446

 Score =   483 bits (1243),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 240/342 (70%), Positives = 276/342 (81%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FR+   S+  +LV G+TGYIGR+V  EL++RG  V+A+AR RSGIRG NS ED +  L+ 
Sbjct  106   FRALPASETTVLVTGATGYIGRYVVRELLRRGHRVLAVARARSGIRGRNSPEDVVADLAP  165

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+   L   + + G P+   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  166   AQVVFSDVTDPDVLLADLSAHG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQAARGL  224

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQRAKLKFE +L  EA  D  FTYSIVRPTAFFKSL GQV+
Sbjct  225   GAAHFVLLSAICVQKPLLEFQRAKLKFEEELAAEAARDPSFTYSIVRPTAFFKSLGGQVD  284

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +VK+G+PYVMFGDGKLCACKPISEEDLA+FI+DC+  ED IN+VLPIGGPGKALTPLEQG
Sbjct  285   IVKNGQPYVMFGDGKLCACKPISEEDLAAFIADCIYDEDNINKVLPIGGPGKALTPLEQG  344

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E KFIKVPIQIMD  I  LD L K+FP LEDAAEFGKIGRYYA+ESML+ D
Sbjct  345   EMLFRLVGREPKFIKVPIQIMDAVIWVLDGLAKLFPGLEDAAEFGKIGRYYASESMLLLD  404

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE GEY  E TPSYGKDTLE+FF+RVLREGMAGQELGEQ IF
Sbjct  405   PETGEYSDEKTPSYGKDTLEQFFERVLREGMAGQELGEQTIF  446



>ref|XP_002465274.1| hypothetical protein SORBIDRAFT_01g035390 [Sorghum bicolor]
 gb|EER92272.1| hypothetical protein SORBIDRAFT_01g035390 [Sorghum bicolor]
Length=397

 Score =   480 bits (1236),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/342 (69%), Positives = 277/342 (81%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FR+   S+  +LV G+TGYIGR+V  EL++RG  V+A+AR RSGIRG NS ED +  L+ 
Sbjct  57    FRALPASETTVLVTGATGYIGRYVVRELLRRGHRVLAVARPRSGIRGRNSPEDVVADLAP  116

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+ ++L   +   G P+   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  117   AQVVFSDVTDPAALLADLAPHG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQAARGL  175

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQRAKLKFE +L  EA  D  FTYS+VRPTAFFKSL GQV+
Sbjct  176   GAAHFVLLSAICVQKPLLEFQRAKLKFEEELAAEAARDPAFTYSVVRPTAFFKSLGGQVD  235

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +VK+G+PYVMFGDGKLCACKPISEEDLA+FI+DC+  +DK N+VLPIGGPGKALTPLEQG
Sbjct  236   IVKNGQPYVMFGDGKLCACKPISEEDLAAFIADCIYDQDKANKVLPIGGPGKALTPLEQG  295

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E KFIKVPIQIMD  I  LD L K+FP LEDAAEFGKIGRYYA+ESML+ D
Sbjct  296   EMLFRLLGREPKFIKVPIQIMDAVIWVLDGLAKLFPGLEDAAEFGKIGRYYASESMLLLD  355

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE GEY  E TPSYGKDTLE+FF+RV+REGMAGQELGEQ IF
Sbjct  356   PETGEYSDEKTPSYGKDTLEQFFQRVIREGMAGQELGEQTIF  397



>gb|AFR53112.1| divinyl reductase [Zea mays]
Length=401

 Score =   477 bits (1228),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 235/342 (69%), Positives = 277/342 (81%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +R+   S+  +LV G+TGYIGR+V  EL++RG  V+A+AR RSGIRG NS +D +  L+ 
Sbjct  61    YRALPASETTVLVTGATGYIGRYVVRELLRRGHRVLAVARSRSGIRGRNSPDDVVADLAP  120

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+ ++L   +   G P+   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  121   AQVVFSDVTDPAALLADLAPHG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQAARGL  179

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQRAKLKFE +L  EA  D  FTYS+VRPTAFFKSL GQV+
Sbjct  180   GAAHFVLLSAICVQKPLLEFQRAKLKFEEELAAEAARDPSFTYSVVRPTAFFKSLGGQVD  239

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +VK+G+PYVMFGDGKLCACKPISEEDLA+FI+DC+  +DK N+VLPIGGPGKALTPLEQG
Sbjct  240   IVKNGQPYVMFGDGKLCACKPISEEDLAAFIADCIYDQDKANKVLPIGGPGKALTPLEQG  299

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E KFIKVPIQIMD  I  LD L K+FP LEDAAEFGKIGRYYA+ESML+ D
Sbjct  300   EMLFRLLGREPKFIKVPIQIMDAVIWVLDGLAKLFPGLEDAAEFGKIGRYYASESMLLLD  359

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE GEY  E TPSYGKDTLE+FF+RV+REGMAGQELGEQ IF
Sbjct  360   PETGEYSDEKTPSYGKDTLEQFFQRVIREGMAGQELGEQTIF  401



>ref|XP_001771287.1| predicted protein [Physcomitrella patens]
 gb|EDQ63847.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   478 bits (1231),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/378 (64%), Positives = 289/378 (76%), Gaps = 6/378 (2%)
 Frame = +3

Query  279   FPSIHFSKPFKLNQERFKPVSCSAAPAVETP--NVSFRSKNPSDINILVVGSTGYIGRFV  452
              PS+  S+  +    R +    + AP VE      S+RSK P D  +++VG+TGYIG+FV
Sbjct  57    LPSLKISRELETPLVR-QICRAALAPEVEAAVSKQSWRSKEPKDTTVMIVGATGYIGKFV  115

Query  453   ATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVP  632
               E+V RG++VIA+ARE+SGI G    E T++   G+ V F+DV++  S+  +++S  + 
Sbjct  116   VREMVNRGYNVIAVAREKSGIGGKVDAEQTIRDFPGSTVVFADVSDTDSITSALQSPNIN  175

Query  633   IDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAK  812
             +DVV+SCLASR GG KDSWKIDY+AT+NSL  G   GA+HFVLLSAICVQKPLLEFQ+AK
Sbjct  176   VDVVISCLASRTGGKKDSWKIDYQATRNSLDAGVARGASHFVLLSAICVQKPLLEFQKAK  235

Query  813   LKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISE  992
             LKFE +L+       G TYSIVRPTAFFKSL GQV+ V+ G PYVMFGDGKLCACKPISE
Sbjct  236   LKFEDELVNYG---NGLTYSIVRPTAFFKSLGGQVQSVQGGGPYVMFGDGKLCACKPISE  292

Query  993   EDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFA  1172
              DLASFISDCV   +K+NQ+LPIGGPGKALTPLEQGEMLFK+ GKE KFIKVPI IMDF 
Sbjct  293   ADLASFISDCVSDVEKVNQMLPIGGPGKALTPLEQGEMLFKIVGKEPKFIKVPIGIMDFV  352

Query  1173  IGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFK  1352
             IG LD L KVFP+LEDAAEFGKIGRYYAAESMLV DP   +YDA+ TP YG DTLE FF 
Sbjct  353   IGVLDNLSKVFPNLEDAAEFGKIGRYYAAESMLVLDPVTQKYDADATPGYGSDTLEAFFD  412

Query  1353  RVLREGMAGQELGEQMIF  1406
             R +REGMAGQELG+Q +F
Sbjct  413   RCVREGMAGQELGDQAVF  430



>ref|NP_001148282.1| divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Zea 
mays]
 sp|B6SZW0.1|DCVR_MAIZE RecName: Full=Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic; 
Flags: Precursor [Zea mays]
 gb|ACG30393.1| PCB2 [Zea mays]
Length=401

 Score =   476 bits (1226),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 235/342 (69%), Positives = 277/342 (81%), Gaps = 1/342 (0%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +R+   S+  +LV G+TGYIGR+V  EL++RG  V+A+AR RSGIRG NS +D +  L+ 
Sbjct  61    YRALPASETTVLVTGATGYIGRYVVWELLRRGHRVLAVARSRSGIRGRNSPDDVVADLAP  120

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+ ++L   +   G P+   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  121   AQVVFSDVTDPAALLADLAPHG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQAARGL  179

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQRAKLKFE +L  EA  D  FTYS+VRPTAFFKSL GQV+
Sbjct  180   GAAHFVLLSAICVQKPLLEFQRAKLKFEEELAAEAARDPSFTYSVVRPTAFFKSLGGQVD  239

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +VK+G+PYVMFGDGKLCACKPISEEDLA+FI+DC+  +DK N+VLPIGGPGKALTPLEQG
Sbjct  240   IVKNGQPYVMFGDGKLCACKPISEEDLAAFIADCIYDQDKANKVLPIGGPGKALTPLEQG  299

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E KFIKVPIQIMD  I  LD L K+FP LEDAAEFGKIGRYYA+ESML+ D
Sbjct  300   EMLFRLLGREPKFIKVPIQIMDAVIWVLDGLAKLFPGLEDAAEFGKIGRYYASESMLLLD  359

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE GEY  E TPSYGKDTLE+FF+RV+REGMAGQELGEQ IF
Sbjct  360   PETGEYSDEKTPSYGKDTLEQFFQRVIREGMAGQELGEQTIF  401



>ref|XP_005649981.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25437.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=345

 Score =   459 bits (1181),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 232/356 (65%), Positives = 277/356 (78%), Gaps = 13/356 (4%)
 Frame = +3

Query  342   CSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRG  521
             C+AA A       +RSK+  DI +LVVGSTGYIG+FV  ELVKRG+ V+A ARE+SG+ G
Sbjct  2     CAAATA------DYRSKDNKDIRVLVVGSTGYIGKFVVKELVKRGYDVVAFAREKSGVGG  55

Query  522   SNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDY  701
               S EDT+++  GA+V F DV  + SL     +   P+DVVVSCLASR GG KDSW IDY
Sbjct  56    KASMEDTVKEFEGADVKFGDVQNVESLSTVGFAQ--PVDVVVSCLASRTGGKKDSWDIDY  113

Query  702   EATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVR  881
             +AT N L   R+ GAAHFVLLSAICVQKPLLEFQ AKLKFE +L    +     TYSIVR
Sbjct  114   QATMNVLEAARQKGAAHFVLLSAICVQKPLLEFQHAKLKFEAELQAAGD----ITYSIVR  169

Query  882   PTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPI  1061
             PTAFFKS+AGQV+LVK+GKPYVMFGDG+L ACKPISE DL +F++DCV  + K NQVLPI
Sbjct  170   PTAFFKSVAGQVKLVKEGKPYVMFGDGRLAACKPISEADLGAFMADCVKDQSKANQVLPI  229

Query  1062  GGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKI  1241
             GGPGKA T LEQGE LF+LA ++  FIKVP+ +MD  IGFLDLL KVFP LED+AEFG+I
Sbjct  230   GGPGKAWTALEQGEYLFELAERKPNFIKVPVALMDGIIGFLDLLAKVFPGLEDSAEFGRI  289

Query  1242  GRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLRE-GMAGQELGEQMIF  1406
             G+YYA ESMLV+DPE+ EYDA+ TPSYGKDTLEEFF+R ++E GMAGQ+LG+  +F
Sbjct  290   GKYYATESMLVYDPERQEYDADATPSYGKDTLEEFFRRAVKEDGMAGQDLGDAAVF  345



>ref|XP_002516871.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45485.1| conserved hypothetical protein [Ricinus communis]
Length=343

 Score =   459 bits (1180),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 220/253 (87%), Positives = 234/253 (92%), Gaps = 0/253 (0%)
 Frame = +3

Query  648   SCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEG  827
             S  +SR GGVKDSWKIDYEATKNSL+ GRKFGA HFVLLSAICVQKPLLEFQRAKLKFE 
Sbjct  91    SIKSSRTGGVKDSWKIDYEATKNSLIAGRKFGAQHFVLLSAICVQKPLLEFQRAKLKFEA  150

Query  828   DLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLAS  1007
             +LMKE+E+D GFTYSIVRPTAFFKSL GQ+ELVKDGKPYVMFGDGKLCACKPISE DLAS
Sbjct  151   ELMKESENDNGFTYSIVRPTAFFKSLGGQIELVKDGKPYVMFGDGKLCACKPISEPDLAS  210

Query  1008  FISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLD  1187
             FI+DCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL GKE KF+KVPI IMDFAIG LD
Sbjct  211   FIADCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLLGKEPKFLKVPIGIMDFAIGILD  270

Query  1188  LLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLRE  1367
              LV++FPS+EDAAEFGKIGRYYAAESML+ DPE G+Y AE TPSYGKDTLEEFF+RVLRE
Sbjct  271   FLVQIFPSMEDAAEFGKIGRYYAAESMLILDPETGDYSAEKTPSYGKDTLEEFFERVLRE  330

Query  1368  GMAGQELGEQMIF  1406
             GMAGQELGEQ IF
Sbjct  331   GMAGQELGEQTIF  343



>ref|XP_005850169.1| hypothetical protein CHLNCDRAFT_56043 [Chlorella variabilis]
 gb|EFN58067.1| hypothetical protein CHLNCDRAFT_56043 [Chlorella variabilis]
Length=347

 Score =   432 bits (1112),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/342 (63%), Positives = 261/342 (76%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +R +  S++ +LVVG+TGYIG++V  ELV+RG+ V+A ARERSGI G  + ED  ++L G
Sbjct  7     YRQRPTSEVRVLVVGATGYIGKYVVRELVRRGYQVVAFARERSGIGGKKTAEDVRRELEG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DV  + SL +      V  DVVVSCLASR GG++DSW +DY+A+ N+L  GR  
Sbjct  67    AEVRFGDVMSVDSLLREGCKEHV--DVVVSCLASRTGGIQDSWDVDYQASLNALEAGRAQ  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GA+HFVLLSAICVQKPLLEFQRAKL FE  L +EA D    TYSIVRPTAFFKSLAGQV+
Sbjct  125   GASHFVLLSAICVQKPLLEFQRAKLAFEAKL-QEAGD---ITYSIVRPTAFFKSLAGQVD  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             LVKDGKPYVMFGDG L ACKPISE+DLASFI+DCV  EDKINQVLPIGGPG+ALT  +Q 
Sbjct  181   LVKDGKPYVMFGDGTLAACKPISEQDLASFIADCVSQEDKINQVLPIGGPGRALTAKDQA  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             E+LF + G + K+  VP+ +MD  I  LD L + FP L+D AEFGKIGRYYA ESML+WD
Sbjct  241   ELLFGILGTQPKYFPVPVALMDGIIALLDFLARFFPGLKDGAEFGKIGRYYAVESMLLWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             P    Y A+ TPSYG DTLE+FF++ + EG+ GQELG+Q +F
Sbjct  301   PVAERYVADQTPSYGTDTLEDFFRKAVTEGLKGQELGDQAVF  342



>ref|XP_002953959.1| hypothetical protein VOLCADRAFT_76013 [Volvox carteri f. nagariensis]
 gb|EFJ44988.1| hypothetical protein VOLCADRAFT_76013 [Volvox carteri f. nagariensis]
Length=415

 Score =   434 bits (1116),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 214/357 (60%), Positives = 264/357 (74%), Gaps = 7/357 (2%)
 Frame = +3

Query  336   VSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGI  515
             V C  A A   P   FR ++P D+ +LVVG TGYIG+FV  ELVKRG++V+A ARE++GI
Sbjct  63    VPCRVA-ASTAPAEDFRKRDPKDVRVLVVGPTGYIGKFVVKELVKRGYNVVAFAREQAGI  121

Query  516   RGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKI  695
             +G  +KEDT+++  GA V F  V +  SL K       P+DVVVSCLASR GG KDSW I
Sbjct  122   KGKMNKEDTMKEFPGAEVRFGSVLDHDSLRKVAFRE--PVDVVVSCLASRTGGKKDSWLI  179

Query  696   DYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSI  875
             DY ATKN+L V R+ G+ HFVLLSAICVQ+PLLEFQRAKLKFE DL    +     TYSI
Sbjct  180   DYTATKNTLDVARESGSKHFVLLSAICVQRPLLEFQRAKLKFEADLQAAGD----ITYSI  235

Query  876   VRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVL  1055
             VRPTAFFKS+AGQ+++VK G PYVMFGDG L ACKPISE DLASFI+DCV  EDK+N+VL
Sbjct  236   VRPTAFFKSIAGQIDIVKKGNPYVMFGDGNLAACKPISEADLASFIADCVTEEDKVNKVL  295

Query  1056  PIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFG  1235
             PIGGP +A T  +Q ++LF++ G   K+  VP+ +MD  I   D L ++FPSLED AEF 
Sbjct  296   PIGGPSRAYTAKQQADLLFQITGLPPKYFPVPVALMDGMISIFDALARLFPSLEDTAEFA  355

Query  1236  KIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             +IG+YYA ESMLVWD ++G Y  E TP YGK+TLEEFF R ++EG+ GQELG+Q +F
Sbjct  356   RIGKYYATESMLVWDEQRGVYLEEATPGYGKETLEEFFSRAVKEGLKGQELGDQAVF  412



>ref|WP_012474793.1| oxidoreductase [Chlorobium phaeobacteroides]
 ref|YP_001959789.1| NmrA family protein [Chlorobium phaeobacteroides BS1]
 gb|ACE04308.1| NmrA family protein [Chlorobium phaeobacteroides BS1]
Length=357

 Score =   421 bits (1083),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 211/340 (62%), Positives = 259/340 (76%), Gaps = 6/340 (2%)
 Frame = +3

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             + N     I VVG+TGYIG++V  ELV RG  V++ ARERSG+  S S E+T +QL G+ 
Sbjct  24    ASNHQSKRIFVVGATGYIGKYVVRELVLRGHEVVSFARERSGVGASASAEETRKQLKGSE  83

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             V F DV+ + SL ++    G   DVV SCL SR+GGVKDSW IDY+AT+N+L  G+  GA
Sbjct  84    VRFGDVSSMDSLLENGIK-GERFDVVYSCLTSRSGGVKDSWNIDYQATRNALDAGKSAGA  142

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
              HFVLLSAICVQKPLLEFQRAKLKFE +L+     + G TYSIVRPTAFFKS+AGQVE V
Sbjct  143   RHFVLLSAICVQKPLLEFQRAKLKFEKELI-----ESGLTYSIVRPTAFFKSIAGQVESV  197

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             K GKPYVMFG+G+L ACKPISE DLA F++DC+   DK N++LP+GGPGKA++  EQGEM
Sbjct  198   KKGKPYVMFGNGELTACKPISEADLARFMADCLEDPDKQNKILPVGGPGKAISAREQGEM  257

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L G+E KF  +PI++ D  I  L +L KVFP LED AEF +IG+YY +ESMLV +PE
Sbjct  258   LFELLGREPKFKNMPIRMFDVIIPVLSMLAKVFPRLEDKAEFARIGKYYCSESMLVLNPE  317

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              G+YDA+ TPSYG DTL +F+KRVL+EGMAGQELGE  IF
Sbjct  318   TGKYDADLTPSYGSDTLRDFYKRVLKEGMAGQELGEHAIF  357



>ref|WP_028951847.1| oxidoreductase [Synechococcus sp. CC9616]
Length=342

 Score =   420 bits (1079),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 204/342 (60%), Positives = 264/342 (77%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FRS+ P  + ++V G+TGYIGRFV  EL++RG+ V+A +R+RSGI G N ++  +   +G
Sbjct  7     FRSRPPEQVRVVVFGATGYIGRFVTRELIQRGYQVVAFSRDRSGIGGRNRRKQVVADFAG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A+V F DVT+ +S+ ++      P DVVVSCLASR+GG KDSW ID++AT N+   GR+ 
Sbjct  67    ADVRFGDVTDAASIAENAFDQ--PADVVVSCLASRSGGRKDSWAIDHDATLNTYREGRRA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQ+AKL FE  L +++E     T+SIVRPTAFFKSLAGQVE
Sbjct  125   GAAHFVLLSAICVQKPLLEFQKAKLAFESVLQQDSE----MTHSIVRPTAFFKSLAGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G+L +CKPISE DLASF++DC+  EDKIN+VLPIGGPG A++  EQG
Sbjct  181   SCRKGGPYVMFGGGRLASCKPISEADLASFMADCLRDEDKINRVLPIGGPGPAMSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             E+LF+   ++ + + VPI +MD  I  L+ L ++FP L+D AEFGKIGRYYA+ESMLVWD
Sbjct  241   ELLFRALNRKPRMLSVPIALMDGPIALLEGLSQLFPGLQDTAEFGKIGRYYASESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              E+G YDAE TPS G DTLE+FF+RV+R+G+AGQELG+  +F
Sbjct  301   SEQGCYDAEATPSTGNDTLEQFFERVVRDGLAGQELGDAALF  342



>ref|WP_038544377.1| oxidoreductase [Synechococcus sp. KORDI-100]
 gb|AII43232.1| oxidoreductase [Synechococcus sp. KORDI-100]
Length=342

 Score =   419 bits (1078),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 262/342 (77%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FRS+ P  + ++V G+TGYIGRFV  EL++RG+ V+A +R+RSG+ G N +E  +  L+G
Sbjct  7     FRSRPPEQVRVVVFGATGYIGRFVTRELIQRGYQVVAFSRDRSGVGGRNRREQVVADLAG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A+V F DVT+ +S+  +      P DVVVSCLASR+GG +DSW ID++AT N+   GR+ 
Sbjct  67    ADVRFGDVTDAASIADNAFDQ--PADVVVSCLASRSGGRRDSWAIDHDATLNTYREGRRA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQ+AKL FE  L +    D   T+SIVRPTAFFKSLAGQVE
Sbjct  125   GAAHFVLLSAICVQKPLLEFQKAKLAFESVLQQ----DSDMTHSIVRPTAFFKSLAGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G+L +CKPISE DLA F++DC+  EDKIN+VLPIGGPG A++  EQG
Sbjct  181   SCRKGGPYVMFGGGRLASCKPISEADLARFMADCLTDEDKINRVLPIGGPGPAMSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             E+LF+   ++ + + VPI +MD  I  L+ L ++FP+L+D AEFGKIGRYYA+ESMLVWD
Sbjct  241   ELLFRALKRKPRLLSVPIALMDGPIALLEGLSQLFPTLQDTAEFGKIGRYYASESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              E G YDA+ TPS G+DTLE+FF+RV+REG+AGQELG+  +F
Sbjct  301   SEHGCYDADATPSTGEDTLEQFFERVVREGLAGQELGDAALF  342



>ref|WP_011127828.1| oxidoreductase [Synechococcus sp. WH 8102]
 ref|NP_897056.1| hypothetical protein SYNW0963 [Synechococcus sp. WH 8102]
 emb|CAE07478.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=342

 Score =   417 bits (1071),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 255/342 (75%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FRS+ P  + ++V G+TGYIGRFV  ELV+RG+ V+A ARERSGI G  S+E  +    G
Sbjct  7     FRSRPPEQVRVVVFGATGYIGRFVVQELVERGYQVVAFARERSGIGGRQSQEQVIIDHKG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DVT+ +S+     +   P DVVVSCLASR GG  DSW ID++AT N+   GR+ 
Sbjct  67    AEVRFGDVTDPASIAAEAFNQ--PTDVVVSCLASRTGGRNDSWAIDHQATLNTYREGRRA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G AH+VLLSAICVQKPLLEFQ+AKL FE +L  + E     T+SIVRPTAFFKSL GQVE
Sbjct  125   GVAHYVLLSAICVQKPLLEFQKAKLAFEAELQADGE----MTHSIVRPTAFFKSLGGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G+L +CKPISE DLA F++DC+  EDK NQVLPIGGPG AL+  +QG
Sbjct  181   SCRKGGPYVMFGGGELASCKPISEADLARFMADCLRDEDKRNQVLPIGGPGPALSAKQQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+  G+  + + VPI +MD  I  L+ L ++FP L+D AEFG+IGRYYAAESMLVWD
Sbjct  241   EMLFRALGRPPRMLSVPIALMDGPIALLEGLSRLFPGLQDTAEFGRIGRYYAAESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE+  YDA+ TPSYG+DTLE FF+RV+R+GMAGQ+LG+  +F
Sbjct  301   PERQCYDADATPSYGEDTLERFFERVVRDGMAGQDLGDAALF  342



>ref|XP_001690168.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Chlamydomonas 
reinhardtii]
 gb|EDP09906.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Chlamydomonas 
reinhardtii]
Length=415

 Score =   417 bits (1073),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 252/342 (74%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +R + P D+ +LVVG TGYIG+FV  ELV RG++V+A ARE +GI+G   +ED +++  G
Sbjct  77    YRKREPKDVRVLVVGPTGYIGKFVVKELVSRGYNVVAFARENAGIKGKMGREDIVKEFPG  136

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F  V + +SL         P+DVVVSCLASR GG KDSW IDY ATKNSL V R  
Sbjct  137   AEVRFGSVLDPASLRDVAFKD--PVDVVVSCLASRTGGKKDSWLIDYTATKNSLDVARAS  194

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GA HFVLLSAICVQKPLLEFQ+AKL+FE DL    +     TYSIVRPTAFFKS+AGQ++
Sbjct  195   GAKHFVLLSAICVQKPLLEFQKAKLQFESDLQAAGD----ITYSIVRPTAFFKSIAGQID  250

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +VK G PYVMFGDG L ACKPISE DLASFI+DCV  ++K+N+VLPIGGP KA T  +Q 
Sbjct  251   IVKKGNPYVMFGDGNLAACKPISEADLASFIADCVTEQNKVNKVLPIGGPSKAFTAKQQA  310

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             ++LF + G   K+  VP+ +MD  IG  D L K+FP LED+AEF +IG+YYA ESMLV+D
Sbjct  311   DLLFNITGLPPKYFPVPVALMDGMIGLFDSLAKLFPQLEDSAEFARIGKYYATESMLVYD  370

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               +G Y  + TP YGKDTLE+FF R ++EG+ GQELG+Q +F
Sbjct  371   EARGVYLEDETPGYGKDTLEDFFSRAVKEGLQGQELGDQAVF  412



>gb|AHF63388.1| hypothetical protein Syncc8109_1014 [Synechococcus sp. WH 8109]
Length=342

 Score =   412 bits (1058),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 204/342 (60%), Positives = 249/342 (73%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +RS+ P  + ++V G+TGYIGRFV  ELV+RG+ VIA ARERSGI G  S+++ +    G
Sbjct  7     YRSRPPEQVRVVVFGATGYIGRFVVKELVERGYQVIAFARERSGIGGCQSRDEVIADFPG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DVT+ +S+         P DVVVSCLASR GG KDSW IDY AT N+   GR  
Sbjct  67    AEVRFGDVTDPASIAAEAFDQ--PTDVVVSCLASRTGGRKDSWAIDYAATLNTYEQGRAA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G AH+VLLSAICVQKPLLEFQ+AKL FE  L    + D+  ++SIVRPTAFFKSL GQVE
Sbjct  125   GVAHYVLLSAICVQKPLLEFQKAKLAFEAVL----QADEAMSHSIVRPTAFFKSLGGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G L +CKPISE+DLA F++DC+  E K NQVLPIGGPG AL+  EQG
Sbjct  181   SCRKGGPYVMFGGGTLASCKPISEDDLARFMADCIHDESKRNQVLPIGGPGPALSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+   K  + + VPI +MD  I  LD L ++FP + D AEFG+IGRYYA+ESMLVWD
Sbjct  241   EMLFRALNKPERMLSVPIALMDAPIALLDALAQLFPGINDTAEFGRIGRYYASESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +K  YDA+ TPSYG DTLE+FF+RV REGMAGQ+LG+  +F
Sbjct  301   EQKECYDADATPSYGTDTLEQFFERVAREGMAGQDLGDAALF  342



>gb|AII45521.1| oxidoreductase [Synechococcus sp. KORDI-49]
Length=342

 Score =   411 bits (1057),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 254/342 (74%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FR++ P  + ++V G+TGYIGRFV  ELV+RG+ V+A ARERSGI G  +++  +    G
Sbjct  7     FRNRPPEQVRVVVFGATGYIGRFVVRELVRRGYDVVAFARERSGIGGRQTRDQVIADCPG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DV + +SL+        P DVVVSCLASR+GG +DSW ID++AT N+   GR+ 
Sbjct  67    AEVRFGDVLDPASLKTQAFDQ--PADVVVSCLASRSGGRQDSWAIDHQATLNTYREGRRA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G AH+VLLSAICVQKPLLEFQ+AKL FE  L  + E     T+SIVRPTAFFKSL GQVE
Sbjct  125   GVAHYVLLSAICVQKPLLEFQKAKLAFEAVLRADEE----MTHSIVRPTAFFKSLGGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G+L +CKPISE DLA F++DCV  +D+INQVLPIGGPG AL+  EQG
Sbjct  181   SCRRGGPYVMFGGGELASCKPISEADLARFMADCVHDQDRINQVLPIGGPGPALSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+  G+  + + +PI +MD  I  L  L ++ PSL+D AEFG+IGRYYA+ESMLVWD
Sbjct  241   EMLFRALGRTPRMLSLPIALMDAPIAVLQGLARLVPSLQDTAEFGRIGRYYASESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              E   YDAE TPSYG+DTLE+FF+RV+REGMAGQ+LG+  +F
Sbjct  301   EETQRYDAEATPSYGEDTLEQFFERVVREGMAGQDLGDAALF  342



>gb|KFM25948.1| Uncharacterized protein ycf39 [Auxenochlorella protothecoides]
Length=377

 Score =   412 bits (1060),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 254/348 (73%), Gaps = 6/348 (2%)
 Frame = +3

Query  372   NVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQ  551
              +S+   +P+++ + V+G+TGYIGRFV  ELVKRGF V+A+ R  SGI       D  + 
Sbjct  33    KLSYADLSPAEVRVAVLGATGYIGRFVVLELVKRGFQVLAVTRPSSGIGSKQKVSDVEKA  92

Query  552   LSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
             L GA V  +DVT+ + LE+       P   VVSCLASR GG+ DSW +D++A  N+L   
Sbjct  93    LEGATVAVADVTDPADLERCFSEHPAP-HAVVSCLASRTGGIADSWAVDHDANVNALRAA  151

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             R  GAAHFVLLSAICVQ+P LEFQRAKL FE  L      + G ++SIVRPTAFFKSLAG
Sbjct  152   RAVGAAHFVLLSAICVQRPSLEFQRAKLAFEAKLR-----EGGTSWSIVRPTAFFKSLAG  206

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             QVELV  GKPYV FGDG+L ACKPISE DLAS+I+DCV  E ++N+VLPIGGPG+ALTP 
Sbjct  207   QVELVATGKPYVWFGDGRLAACKPISEADLASYIADCVTDEARVNRVLPIGGPGRALTPR  266

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESML  1271
             +Q ++LFK  GK+   + +P+ IMD  IG LDLL K FP L++AAEFG+IGRYYA ESML
Sbjct  267   DQAQLLFKAFGKKEWTLGLPVGIMDGVIGILDLLAKPFPGLKEAAEFGRIGRYYATESML  326

Query  1272  VWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF*IS  1415
             VWD ++G YDA+ TP YG DTLE FF RV REG+AGQELG+Q +F I+
Sbjct  327   VWDEKEGRYDADATPEYGSDTLEAFFNRVAREGLAGQELGDQAVFNIN  374



>ref|WP_011360161.1| oxidoreductase [Synechococcus sp. CC9902]
 ref|YP_377382.1| hypothetical protein Syncc9902_1374 [Synechococcus sp. CC9902]
 gb|ABB26338.1| conserved hypothetical protein [Synechococcus sp. CC9902]
Length=346

 Score =   411 bits (1056),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 256/342 (75%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FR +  +DI ++V G+TGYIGRFV  ELVKRG+ V+A  RERSG+ G  S++  +    G
Sbjct  11    FRERPAADIRVVVFGATGYIGRFVVKELVKRGYQVVAFCRERSGVGGRQSQDQAVADFPG  70

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DVT++ SL ++      P+DVVVSCLASR GG +DSW ID++A+ N+   G K 
Sbjct  71    AEVRFGDVTDVDSLNQNAFQQ--PVDVVVSCLASRTGGGQDSWAIDHQASLNTYTEGLKA  128

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G AH+VLLSAICVQKPLLEFQ+AKL FE  L  + E     +YSIVRPTAFFKSL GQVE
Sbjct  129   GVAHYVLLSAICVQKPLLEFQKAKLAFETALQADTE----MSYSIVRPTAFFKSLGGQVE  184

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G L +CKPISE DLA+F++DC+   +K NQVLPIGGPG A++ LEQG
Sbjct  185   SCRKGGPYVMFGGGTLASCKPISESDLAAFMADCITDPEKRNQVLPIGGPGPAMSALEQG  244

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+  G++ + + VPI +MD  I  L+ L K+FP L+D AEFG+IGRYYA+ESMLVWD
Sbjct  245   EMLFRALGRQQRMLSVPIALMDGPIALLEGLSKLFPGLQDTAEFGRIGRYYASESMLVWD  304

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              ++  YDA+ TPSYG+DTLE+FF+RV+R+GMAGQ+LG+  +F
Sbjct  305   AQEQRYDADATPSYGEDTLEQFFERVVRDGMAGQDLGDASVF  346



>ref|WP_009789553.1| oxidoreductase [Synechococcus sp. BL107]
 gb|EAU70762.1| hypothetical protein BL107_11856 [Synechococcus sp. BL107]
Length=342

 Score =   410 bits (1054),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 256/342 (75%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             FR + P+D+ ++V G+TGYIGRFV  ELVKRG+ V+A  RERSGI G  +++  +    G
Sbjct  7     FRERPPADVRVVVFGATGYIGRFVVKELVKRGYQVVAFCRERSGIGGRQNQDQVVADFPG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DV +++SL ++      P+DVVVSCLASR GG +DSW ID++AT N+   GRK 
Sbjct  67    AEVRFGDVKDVNSLSRNAFPQ--PVDVVVSCLASRTGGRQDSWAIDHQATLNTYTEGRKA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G AH+VLLSAICVQKPLLEFQ+AKL FE  L  + E     +YSIVRPTAFFKSL GQVE
Sbjct  125   GVAHYVLLSAICVQKPLLEFQKAKLAFEKALQADGE----MSYSIVRPTAFFKSLGGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G L +CKPISE DLA FI+DC+   +K NQVLPIGGPG+A++  EQG
Sbjct  181   SCRKGGPYVMFGGGTLASCKPISESDLARFIADCISDPEKRNQVLPIGGPGQAMSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+  G++ + + VPI +MD  I  L+ L K+FP L+D AEFG+IGRYYA+ESMLVW+
Sbjct  241   EMLFRALGRQQRMLSVPIALMDGPIALLEGLSKLFPGLQDTAEFGRIGRYYASESMLVWN  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +   YDA+ TPSYG+DTLE+FF+RV+R+GMAGQ+LG+  +F
Sbjct  301   AQDQRYDADATPSYGEDTLEQFFERVVRDGMAGQDLGDASVF  342



>ref|WP_012502262.1| oxidoreductase [Chlorobaculum parvum]
 ref|YP_001998629.1| NmrA family protein [Chlorobaculum parvum NCIB 8327]
 gb|ACF11429.1| NmrA family protein [Chlorobaculum parvum NCIB 8327]
Length=343

 Score =   410 bits (1053),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 251/333 (75%), Gaps = 6/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + VVG+TGYIG+FV  ELV RG+ V++ AR+RSG+  S + E T Q+L G+ V F DV+
Sbjct  17    RVFVVGATGYIGKFVVRELVTRGYEVVSFARQRSGVNASTTAEQTRQELKGSEVRFGDVS  76

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             ++ SL +     G   D VVSCL SRNGG+KDSW IDY+AT+N+L  G   G + FVLLS
Sbjct  77    DMDSLMRDGVR-GEHFDAVVSCLTSRNGGIKDSWNIDYQATRNALDAGMSAGISQFVLLS  135

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP+LEFQRAKLKFE +L      + G TYSIVRPTAFFKS+AGQ+E VK+GKPYV
Sbjct  136   AICVQKPMLEFQRAKLKFEKELR-----ESGVTYSIVRPTAFFKSIAGQIEKVKNGKPYV  190

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MFGDGKL ACKPISE DLA FI+DC+   +K N+++PIGGPG+A+T L+Q  MLF+L G+
Sbjct  191   MFGDGKLTACKPISEADLARFIADCLEDPEKQNKIMPIGGPGEAVTNLDQALMLFELLGR  250

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E K  KVPIQ+ D  I  L LL KVFPS  + AEF +IG+YY +ESMLVWDP K +YDA+
Sbjct  251   EPKLKKVPIQMFDVIIPVLTLLSKVFPSFAEKAEFARIGKYYCSESMLVWDPVKQQYDAD  310

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPSYG DTL +F+KR L+EG+AGQELG   +F
Sbjct  311   ATPSYGTDTLRDFYKRALKEGLAGQELGAHSMF  343



>tpg|DAA45366.1| TPA: hypothetical protein ZEAMMB73_163548 [Zea mays]
Length=376

 Score =   411 bits (1056),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 211/342 (62%), Positives = 251/342 (73%), Gaps = 26/342 (8%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +R+   S+  +LV G+TGYIGR+V  EL++RG  V+A+AR RSGIRG NS +D +  L+ 
Sbjct  61    YRALPASETTVLVTGATGYIGRYVVRELLRRGHRVLAVARSRSGIRGRNSPDDVVADLAP  120

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V FSDVT+ ++L   +   G P+   V CLASR GGV+DSW++DY AT ++L   R  
Sbjct  121   AQVVFSDVTDPAALLADLAPHG-PVHAAVCCLASRGGGVQDSWRVDYRATLHTLQAARGL  179

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQRAKLKFE +L  EA  D  FTYS+VRPTAFF++ A    
Sbjct  180   GAAHFVLLSAICVQKPLLEFQRAKLKFEEELAAEAARDPSFTYSVVRPTAFFRASAA---  236

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
                                   SEEDLA+FI+DC+  +DK N+VLPIGGPGKALTPLEQG
Sbjct  237   ----------------------SEEDLAAFIADCIYDQDKANKVLPIGGPGKALTPLEQG  274

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+L G+E KFIKVPIQIMD  I  LD L K+FP LEDAAEFGKIGRYYA+ESML+ D
Sbjct  275   EMLFRLLGREPKFIKVPIQIMDAVIWVLDGLAKLFPGLEDAAEFGKIGRYYASESMLLLD  334

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE GEY  E TPSYGKDTLE+FF+RV+REGMAGQELGEQ IF
Sbjct  335   PETGEYSDEKTPSYGKDTLEQFFQRVIREGMAGQELGEQTIF  376



>ref|WP_011364574.1| oxidoreductase [Synechococcus sp. CC9605]
 ref|YP_381917.1| hypothetical protein Syncc9605_1613 [Synechococcus sp. CC9605]
 gb|ABB35362.1| conserved hypothetical protein [Synechococcus sp. CC9605]
Length=342

 Score =   409 bits (1051),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 249/342 (73%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +RS+ P  + ++V G+TGYIGRFV  ELV+RG+ VIA ARERSG+ G  S+++ +  L G
Sbjct  7     YRSRPPEQVRVVVFGATGYIGRFVVKELVERGYQVIAFARERSGVGGRQSRDEVIADLPG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A + F DVT+ +S+         P DVVVSCLASR GG KDSW ID+ AT N+   GR  
Sbjct  67    AELRFGDVTDPASIAAEAFDQ--PTDVVVSCLASRTGGRKDSWAIDHAATLNTYEQGRAA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAAHFVLLSAICVQKPLLEFQ+AKL FE  L  + E     T+SIVRPTAFFKSL GQVE
Sbjct  125   GAAHFVLLSAICVQKPLLEFQKAKLAFEAVLQADEE----VTHSIVRPTAFFKSLGGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G L +CKPISE DLA F++DC+  E K NQVLPIGGPG AL+  EQG
Sbjct  181   SCRKGGPYVMFGGGTLASCKPISEADLARFMADCIHDESKRNQVLPIGGPGPALSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+   K  + + VPI +MD  I  L+ L ++FP + D AEFG+IGRYYA+ESMLVWD
Sbjct  241   EMLFRALNKPERMLSVPIALMDGPIALLNALSRLFPGINDTAEFGRIGRYYASESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              ++  YDA+ TPSYG DTLE+FF+RV REGMAGQ+LG+  +F
Sbjct  301   EQRQCYDADATPSYGTDTLEQFFERVAREGMAGQDLGDAALF  342



>ref|WP_012507930.1| oxidoreductase [Pelodictyon phaeoclathratiforme]
 ref|YP_002018055.1| NmrA family protein [Pelodictyon phaeoclathratiforme BU-1]
 gb|ACF43438.1| NmrA family protein [Pelodictyon phaeoclathratiforme BU-1]
Length=340

 Score =   408 bits (1049),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 256/345 (74%), Gaps = 6/345 (2%)
 Frame = +3

Query  372   NVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQ  551
             N S  S       + VVG+TGYIG+FV  ELV RG+ V++ ARERSG+      ++T  Q
Sbjct  2     NTSLHSPPRRHERVFVVGATGYIGKFVVRELVARGYDVVSFARERSGVGSMTRADETRAQ  61

Query  552   LSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
             L G+ V F DV+ + SL K+    G   DVVVSCL SRNGGVKDSW IDY+AT+N+L  G
Sbjct  62    LQGSEVRFGDVSNMESLMKNGIC-GEHFDVVVSCLTSRNGGVKDSWNIDYQATRNALDAG  120

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             +  GA HFVLLSAICVQKPLLEFQRAKLKFE +L      + G T+SIVRPTAFFKS+AG
Sbjct  121   KAAGATHFVLLSAICVQKPLLEFQRAKLKFEQEL-----KESGLTWSIVRPTAFFKSIAG  175

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             QVE VK GKP+V FG+G+L +CKPISE DLA FI+DC+   +K N++LPIGGPG+A++  
Sbjct  176   QVESVKKGKPFVTFGNGELTSCKPISESDLARFIADCLEDSEKQNKILPIGGPGRAISHK  235

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESML  1271
             EQGEMLF+L G+  KF  +PIQ+ D  I  + LL K+FP L+D AEF +IG+YY +ESML
Sbjct  236   EQGEMLFELLGRTPKFKYMPIQMFDVIIPLMSLLAKIFPKLQDKAEFARIGKYYCSESML  295

Query  1272  VWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             V +P+ G+YDA+ TPSYG DTL +F+KRVL+EG+AGQELGE  +F
Sbjct  296   VLNPQTGKYDADMTPSYGSDTLRDFYKRVLKEGIAGQELGEHSMF  340



>ref|WP_010932741.1| oxidoreductase [Chlorobaculum tepidum]
 ref|NP_661954.1| hypothetical protein CT1063 [Chlorobium tepidum TLS]
 gb|AAM72296.1| conserved hypothetical protein [Chlorobium tepidum TLS]
Length=344

 Score =   406 bits (1044),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 250/333 (75%), Gaps = 6/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + VVG+TGYIG+FV  ELV RG+ VI+ AR RSG+  S ++++T +QL G+ V F DV+
Sbjct  18    RVFVVGATGYIGKFVVRELVSRGYEVISFARPRSGVNASTTEDETRRQLQGSEVRFGDVS  77

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
              L SL +     G   D VVSCLASRNGG+KDSW IDY+AT+NSL  G K G  HFVLLS
Sbjct  78    NLESLLRDGIR-GEHFDAVVSCLASRNGGIKDSWDIDYQATRNSLDAGMKAGINHFVLLS  136

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP+LEFQRAKLKFE +L      + G TYSIVRPTAFFKS+AGQ+E VK+GKPYV
Sbjct  137   AICVQKPMLEFQRAKLKFEKELR-----ESGVTYSIVRPTAFFKSIAGQIEKVKNGKPYV  191

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MFGDGKL ACKPISE DLA FI+DC+   +K N++LPIGGPG+ +T L+Q  MLF+L G+
Sbjct  192   MFGDGKLTACKPISEGDLARFITDCLEDPEKQNKILPIGGPGEPVTNLDQALMLFELLGR  251

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             + K  KVPIQI D  I  L L+ K  PS  + AEF +IG+YY +ESMLVWDP K  YDA+
Sbjct  252   KPKLKKVPIQIFDVIIPLLTLISKFLPSFAEKAEFARIGKYYCSESMLVWDPVKKRYDAD  311

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPSYG +TL +F+KRVL+EG+AGQELG   +F
Sbjct  312   ATPSYGTETLRDFYKRVLKEGLAGQELGAHAMF  344



>ref|XP_002976331.1| hypothetical protein SELMODRAFT_55147, partial [Selaginella moellendorffii]
 gb|EFJ22591.1| hypothetical protein SELMODRAFT_55147, partial [Selaginella moellendorffii]
Length=338

 Score =   405 bits (1040),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 211/344 (61%), Positives = 261/344 (76%), Gaps = 11/344 (3%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +  K   +++++V GSTGYIGRFV  EL+ RG+ V+A+AR+ S    S  +E   +  SG
Sbjct  1     YGGKPAEEVSVMVTGSTGYIGRFVVKELLNRGYKVVAVARQGSNANPSVEEE---KSASG  57

Query  561   ANVCFS-DVTelssleksveslGV-PIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGR  734
             +  C + DVT   SLEKS+ S G+  IDVVV CLASR+GGV DSW IDY+A++NS  VG 
Sbjct  58    SLECVTGDVTNKESLEKSLISQGIGKIDVVVCCLASRSGGVADSWNIDYQASRNSFDVGL  117

Query  735   KFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQ  914
             + GA+H VLLSAICVQKPLL FQRAKLK E ++     +    T+SIVRPTAFFKSLAGQ
Sbjct  118   ELGASHLVLLSAICVQKPLLHFQRAKLKLEAEIQGLPSNP---TWSIVRPTAFFKSLAGQ  174

Query  915   VELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLE  1094
             V++VK G P+V+FGDG+LC+CKPISE DLASFI DC+  E K  ++LPIGGPG+A TPLE
Sbjct  175   VDIVKAGGPFVVFGDGRLCSCKPISESDLASFICDCISDESKHQKLLPIGGPGRAYTPLE  234

Query  1095  QGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFP---SLEDAAEFGKIGRYYAAES  1265
             QG++LF++ GK  +F+KVPIQIMDFAIG LD +   FP    L+DAAE+ KIGRYYAAES
Sbjct  235   QGDLLFEITGKSRRFVKVPIQIMDFAIGLLDSIAGFFPDNAGLQDAAEYAKIGRYYAAES  294

Query  1266  MLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             MLV DP+ G YDA+ TPSYG DTLE FF+RV+ EGMAGQELGEQ
Sbjct  295   MLVLDPDTGCYDADATPSYGSDTLEAFFQRVVMEGMAGQELGEQ  338



>ref|XP_002987313.1| hypothetical protein SELMODRAFT_45092, partial [Selaginella moellendorffii]
 gb|EFJ11628.1| hypothetical protein SELMODRAFT_45092, partial [Selaginella moellendorffii]
Length=338

 Score =   404 bits (1037),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 261/344 (76%), Gaps = 11/344 (3%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +  K   +++++V GSTGYIGRFV  EL+ RG+ V+A+AR+ S    S  +E   +  SG
Sbjct  1     YGGKPAEEVSVMVTGSTGYIGRFVVKELLNRGYKVVAVARQGSNANPSVEEE---KSSSG  57

Query  561   ANVCFS-DVTelssleksveslGV-PIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGR  734
             +  C + DVT   SLEKS+ S G+  IDVVV CLASR+GGV DSW IDY+A++NS  VG 
Sbjct  58    SLECVTGDVTNKESLEKSLTSQGIGKIDVVVCCLASRSGGVADSWNIDYQASRNSFDVGL  117

Query  735   KFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQ  914
             + GA+H VLLSAICVQKPLL FQRAKLK E ++     +    T+SIVRPTAFFKSLAGQ
Sbjct  118   ELGASHLVLLSAICVQKPLLHFQRAKLKLEAEIQGLPSNP---TWSIVRPTAFFKSLAGQ  174

Query  915   VELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLE  1094
             V++VK G P+V+FGDG+LC+CKPISE DLASFI DC+  E K  ++LPIGGPG+A TPLE
Sbjct  175   VDIVKAGGPFVVFGDGRLCSCKPISESDLASFICDCISDESKHQKLLPIGGPGRAYTPLE  234

Query  1095  QGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFP---SLEDAAEFGKIGRYYAAES  1265
             QG++LF++ GK  +F+KVPIQIMDFAIG LD +   FP    ++DAAE+ KIGRYYAAES
Sbjct  235   QGDLLFEITGKSRRFVKVPIQIMDFAIGLLDSVAGFFPDNAGIQDAAEYAKIGRYYAAES  294

Query  1266  MLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQ  1397
             MLV DP+ G YDA+ TPSYG DTLE FF+RV+ EGMAGQELGEQ
Sbjct  295   MLVLDPDTGCYDADATPSYGTDTLEAFFQRVVMEGMAGQELGEQ  338



>ref|XP_006651376.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like, 
partial [Oryza brachyantha]
Length=247

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/247 (77%), Positives = 212/247 (86%), Gaps = 0/247 (0%)
 Frame = +3

Query  666   NGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEA  845
              GGV+DSW++DY AT ++L   R  GAAHFVLLSA+CVQKPLLEFQRAKL+FE +L  EA
Sbjct  1     GGGVQDSWRVDYRATLHTLQAARGLGAAHFVLLSAVCVQKPLLEFQRAKLRFEDELAAEA  60

Query  846   EDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCV  1025
               D  FTYSIVRPTAFFKSL GQV+ VK+G+PYVMFGDGKLCACKPISEEDLA++I+DC+
Sbjct  61    SRDPSFTYSIVRPTAFFKSLGGQVDTVKNGQPYVMFGDGKLCACKPISEEDLAAYIADCI  120

Query  1026  LSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVF  1205
               EDK N++LPIGGPGKALTPLEQGEMLF+L G+E KFIKVPIQIMD AI  LD L KVF
Sbjct  121   FDEDKANKILPIGGPGKALTPLEQGEMLFRLLGREPKFIKVPIQIMDAAIWVLDGLAKVF  180

Query  1206  PSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQE  1385
             P LEDAAEFGKIGRYYA+ESMLV DPE GEY  E TPSYG DTLE+FF+RV+REGMAGQE
Sbjct  181   PGLEDAAEFGKIGRYYASESMLVLDPETGEYSDEKTPSYGNDTLEQFFERVIREGMAGQE  240

Query  1386  LGEQMIF  1406
             LGEQ IF
Sbjct  241   LGEQTIF  247



>ref|WP_038554329.1| oxidoreductase [Synechococcus sp. KORDI-52]
 gb|AII49114.1| oxidoreductase [Synechococcus sp. KORDI-52]
Length=342

 Score =   399 bits (1024),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 243/342 (71%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             +R++    + ++V G+TGYIGRFV  ELV+RG+ V+A ARERSGI G  S+++ +    G
Sbjct  7     YRNRPAEKVRVVVFGATGYIGRFVVKELVERGYQVVAFARERSGIGGRQSRDEVIADFPG  66

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DVT  +S+         P DVVVSCLASR GG +DSW ID+ AT N+   G+  
Sbjct  67    AEVRFGDVTNPASIAAEAFDQ--PTDVVVSCLASRTGGRRDSWAIDHAATLNTYQQGKAA  124

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G AH+VLLSAICVQKPLLEFQ+AKL FE  L  + E     T+SIVRPTAFFKSL GQVE
Sbjct  125   GVAHYVLLSAICVQKPLLEFQKAKLAFEAVLQADEE----MTHSIVRPTAFFKSLGGQVE  180

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
               + G PYVMFG G L +CKPISE DLA F++DC+  E K NQVLPIGGPG AL+  EQG
Sbjct  181   SCRKGGPYVMFGGGTLASCKPISEADLARFMADCIHDESKRNQVLPIGGPGPALSAREQG  240

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             EMLF+   K  + + VP+ +MD  I  LD L ++FP + D AEFG+IGRYYA+ESMLVWD
Sbjct  241   EMLFRALNKPQRMLSVPLALMDAPIAVLDGLARLFPGINDTAEFGRIGRYYASESMLVWD  300

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              E   YDA+ TPSYG DTLE+FF+RV  EGMAGQ+LG+  +F
Sbjct  301   EENQRYDADATPSYGTDTLEQFFERVALEGMAGQDLGDAALF  342



>ref|WP_011889777.1| oxidoreductase [Chlorobium phaeovibrioides]
 ref|YP_001130051.1| NmrA family protein [Chlorobium phaeovibrioides DSM 265]
 gb|ABP36549.1| NmrA family protein [Chlorobium phaeovibrioides DSM 265]
Length=361

 Score =   397 bits (1020),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 200/356 (56%), Positives = 247/356 (69%), Gaps = 17/356 (5%)
 Frame = +3

Query  339   SCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIR  518
             S  +AP  ETP             I VVG+TGYIG+FV  EL  RG  V++ AR RSG+ 
Sbjct  23    SRHSAPGTETPK-----------RIFVVGATGYIGKFVTRELAARGHKVVSFARPRSGVN  71

Query  519   GSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKID  698
              + ++E+T +QL G+ V F DV             G   D VVSCL SR GGV+DSW ID
Sbjct  72    ATATEEETRRQLDGSEVRFGDV-GNPESIVRDGICGERFDAVVSCLTSRTGGVEDSWAID  130

Query  699   YEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIV  878
             Y+AT+N+L  G   G + F+LLSAICVQKP+LEFQRAKL+FE +L+       G TYSIV
Sbjct  131   YQATRNALDAGLGAGISQFILLSAICVQKPMLEFQRAKLQFERELIA-----SGVTYSIV  185

Query  879   RPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLP  1058
             RPTAFFKS+AGQVE VK+G PY+MFGDG L ACKPISE DLA F++DC+   DK N++LP
Sbjct  186   RPTAFFKSIAGQVEKVKNGSPYLMFGDGTLTACKPISEADLARFMADCLEDADKKNRILP  245

Query  1059  IGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGK  1238
             IGGPG+A+T  EQGEMLF+L G+E KF + PIQ+ D  I  L  L K+FP+L+D AEF +
Sbjct  246   IGGPGRAITAKEQGEMLFELLGREPKFRRAPIQMFDIIIPILATLSKLFPNLKDKAEFAR  305

Query  1239  IGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             IG+YY +ESMLV +PE G YD E TPSYG DTL  F+ RVL+EG+AGQELG   +F
Sbjct  306   IGKYYCSESMLVLNPETGRYDEEMTPSYGTDTLRNFYARVLKEGLAGQELGAHAVF  361



>ref|WP_006852306.1| oxidoreductase [Synechococcus sp. WH 8016]
 gb|EHA63126.1| hypothetical protein Syn8016DRAFT_0167 [Synechococcus sp. WH 
8016]
Length=346

 Score =   393 bits (1010),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 249/348 (72%), Gaps = 6/348 (2%)
 Frame = +3

Query  363   ETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDT  542
             + P   FR ++P  + + V G+TGYIGRFV  ELVKRG+ V+A AR+ SGI G   + + 
Sbjct  5     QLPRHDFRERSPDQVRVAVFGATGYIGRFVVKELVKRGYQVMAFARDSSGIGGRQGQAEV  64

Query  543   LQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSL  722
             +    GA V F DVT  +SL     +   P DVV+SCLASR GG KDSW IDY+A  N+ 
Sbjct  65    VADFPGAEVRFGDVTNPASLATHAFNE--PTDVVISCLASRTGGKKDSWAIDYQANLNTY  122

Query  723   VVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKS  902
               GRK G AHFV+LSAICVQKP+LEFQ+AKL FE    ++ ++DK  T++IVRPTAFFKS
Sbjct  123   SEGRKAGVAHFVMLSAICVQKPILEFQKAKLAFE----RQLQEDKEITHTIVRPTAFFKS  178

Query  903   LAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKAL  1082
             +AGQ E  K G PYVMFG+G+L +CKPISE+DLA F+++CV   DK+NQVLPIGGPG AL
Sbjct  179   IAGQFESCKKGAPYVMFGNGELTSCKPISEQDLACFLANCVHETDKVNQVLPIGGPGPAL  238

Query  1083  TPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAE  1262
             +   QGEMLFK  G+  + + +P+ +M+     L+ + ++ P++ED AEF +IG YYA+E
Sbjct  239   SARTQGEMLFKTLGRSPRMLSLPMAVMNAPTALLEKVAELIPAVEDTAEFARIGCYYASE  298

Query  1263  SMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             SMLVWD ++  YD + TPS+G DTLE+FF RV +EGMAGQELG+  +F
Sbjct  299   SMLVWDEKRACYDPDATPSFGDDTLEQFFARVHKEGMAGQELGDAALF  346



>ref|WP_012505780.1| oxidoreductase [Prosthecochloris aestuarii]
 ref|YP_002015892.1| NmrA family protein [Prosthecochloris aestuarii DSM 271]
 gb|ACF46245.1| NmrA family protein [Prosthecochloris aestuarii DSM 271]
Length=343

 Score =   392 bits (1007),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 246/333 (74%), Gaps = 6/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + VVG+TGYIG+FV  ELV RG+ V++ +RERSG+  S + ++T ++L G+ V F DV+
Sbjct  17    RVFVVGATGYIGKFVVRELVARGYDVVSFSRERSGVGASTTADETRRELKGSEVRFGDVS  76

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                SL K     G   DVVVSCL SR GGVKD+W IDY+AT+N L      GA+ FVLLS
Sbjct  77    NPDSLVKQGIC-GEHFDVVVSCLTSRTGGVKDAWNIDYQATRNVLDAALLAGASQFVLLS  135

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLLEFQRAKLKFE +L +      G  YSIVRPTAFFKS+AGQVE V+ GKPYV
Sbjct  136   AICVQKPLLEFQRAKLKFEEELQRS-----GLIYSIVRPTAFFKSIAGQVEAVRKGKPYV  190

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MFG+G+L ACKPISE DLA F++DC+    K N++LPIGGPGKA++  EQGEMLF+L G+
Sbjct  191   MFGNGELTACKPISEADLARFMADCLEDASKQNRILPIGGPGKAISAREQGEMLFELLGR  250

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E KF  +PI++ D  I  L  L K+FP LED AEF +IG+YY +ESMLV +P  G+YDA+
Sbjct  251   EPKFKNMPIRMFDVIIPVLSFLSKIFPKLEDKAEFARIGKYYCSESMLVLNPHTGKYDAD  310

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPSYG DTL +F+ R L+EG++GQELG+  +F
Sbjct  311   MTPSYGSDTLRDFYTRALKEGLSGQELGDHAMF  343



>ref|XP_001421306.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99599.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=381

 Score =   392 bits (1007),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 245/335 (73%), Gaps = 6/335 (2%)
 Frame = +3

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             D+ +LVVG+TGYIG++V  EL  RG+ V A  RE+SGI G  +  D       A V F D
Sbjct  52    DVKVLVVGATGYIGKYVTRELCARGYDVTAFTREKSGIGGKTNATDAKALFPDAKVKFGD  111

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             V    S+E      G   DVVVSCLASR GGVKDSW IDY ATKN L V R+ G+ HFVL
Sbjct  112   VGSKESIETKAFDEGA-YDVVVSCLASRTGGVKDSWDIDYRATKNVLDVARERGSKHFVL  170

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQKP L FQ+AKLKFE +L    +     +Y+IVRPTAFFKSLAGQVE+V+ G P
Sbjct  171   LSAICVQKPTLTFQKAKLKFEAELQAAGD----ISYTIVRPTAFFKSLAGQVEVVQKGGP  226

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             YVMFGDG+L +CKPISE DLA F++D +   + +N+VLPIGGPG+A++ L+QG MLF+L 
Sbjct  227   YVMFGDGQLASCKPISESDLAKFMADSIREPEMLNKVLPIGGPGEAMSALQQGTMLFELL  286

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
               E KFIKVPI++MD AI  LD+    F +++DAAEFGKIGRYYAAESMLV + + G+YD
Sbjct  287   EMEPKFIKVPIEVMDVAIKVLDVFAGFFSNMKDAAEFGKIGRYYAAESMLVMN-DDGKYD  345

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             A  TPSYG DTL+EFF +V +EG+AGQELG+Q +F
Sbjct  346   AAATPSYGSDTLKEFFDKVSKEGLAGQELGDQAVF  380



>ref|XP_007515010.1| NmrA family protein [Bathycoccus prasinos]
 emb|CCO15250.1| NmrA family protein [Bathycoccus prasinos]
Length=397

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 243/336 (72%), Gaps = 5/336 (1%)
 Frame = +3

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSD  581
             D+ +LVVG+TGYIG+FV  EL  +G+ V A  R RSGI G N++ D  +  + A V F  
Sbjct  65    DVKVLVVGATGYIGKFVTNELCSQGYDVTAYVRPRSGIGGKNTEADAKKLFTNAKVEFGT  124

Query  582   V-TelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFV  758
               +     + + +  G   DVVVSCLASR GGVKDSW +DY+ATKN L V RK G   FV
Sbjct  125   CGSMEDVEKNAFKDGGEKYDVVVSCLASRTGGVKDSWDVDYQATKNVLDVARKNGTKKFV  184

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LLSAICVQKPLL FQ+AKLKFE +L K  ED    +YSIVRPTAFFKSLAGQVE V+ G 
Sbjct  185   LLSAICVQKPLLTFQKAKLKFEEELEK-CED---ISYSIVRPTAFFKSLAGQVESVQKGG  240

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDG+L +CKPISE DLA ++++C+      N+VLPIGGPGKAL+ LEQG MLF+L
Sbjct  241   PYVMFGDGQLASCKPISERDLAKYMAECIRDASLENKVLPIGGPGKALSALEQGTMLFEL  300

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
                E KF+KVPI+IMD  I  LD     F ++ DAAEFGKIGRYYAAESMLV D + GEY
Sbjct  301   LEMEPKFVKVPIEIMDTVIKVLDFFAGFFGNMTDAAEFGKIGRYYAAESMLVMDEKTGEY  360

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              A+ TPSYG DTL +FFK+V  EG+AGQELG+Q +F
Sbjct  361   KADETPSYGTDTLRDFFKKVSVEGLAGQELGDQAVF  396



>ref|WP_011357234.1| oxidoreductase [Pelodictyon luteolum]
 ref|YP_374402.1| hypothetical protein Plut_0471 [Chlorobium luteolum DSM 273]
 gb|ABB23359.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
Length=341

 Score =   387 bits (994),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 235/333 (71%), Gaps = 6/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              I VVG+TGYIG+FV  ELV RG  V++ AR RSG+  + + E+T +QL+G+ V F DV 
Sbjct  15    RIFVVGATGYIGKFVTRELVARGHEVVSFARPRSGVDAATTAEETRRQLAGSEVRFGDV-  73

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                         G   D V SCL SR GG++D+W IDY ATKN+L  G K G  HFVLLS
Sbjct  74    GDLQSILREGIRGEHFDAVYSCLTSRTGGIEDAWNIDYRATKNALEAGIKAGITHFVLLS  133

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP+LEFQ AKLKFE +LM       G +YSIVRPTAFFKS+AGQVE VK+GKPYV
Sbjct  134   AICVQKPMLEFQHAKLKFEAELMAS-----GVSYSIVRPTAFFKSIAGQVESVKNGKPYV  188

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MF DG+L  CKPISE DLA F++DC+ +    N++LPIGGPGKA++  EQG MLF+L GK
Sbjct  189   MFADGELTRCKPISEADLARFMADCIENPSLQNRILPIGGPGKAISAREQGAMLFELLGK  248

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E KF KVPIQI D  I  L +L K  P L D AEF +IG+YY +ESML+++ E G YD E
Sbjct  249   EPKFKKVPIQIFDVIIPVLTMLSKFIPKLRDKAEFARIGKYYCSESMLLFNHETGRYDEE  308

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPSYG DTL +F+ RVL+EG+ GQELG   +F
Sbjct  309   ATPSYGTDTLRDFYARVLKEGLKGQELGAHSMF  341



>ref|XP_002505345.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Micromonas 
sp. RCC299]
 gb|ACO66603.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Micromonas 
sp. RCC299]
Length=379

 Score =   387 bits (993),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/339 (58%), Positives = 235/339 (69%), Gaps = 6/339 (2%)
 Frame = +3

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             K   D  +LVVG TGYIG+FV  EL  +G+ V A  RE+SGI G             A+V
Sbjct  46    KENKDTKVLVVGGTGYIGKFVVRELCAQGYDVTAFVREKSGIGGKTDASGAKSMFPDASV  105

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
              F  V  + S+           DVVVSCLASR GG+KDSW +DY+ATKN L V R+ GA 
Sbjct  106   KFGSVGSVDSIRSGAFDS--DYDVVVSCLASRTGGIKDSWDVDYQATKNVLDVAREKGAK  163

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLL FQ AKLKFE +L    +     ++SIVRPTAFFKSLAGQVE V+
Sbjct  164   HFVLLSAICVQKPLLTFQAAKLKFEEELQSATD----ISHSIVRPTAFFKSLAGQVESVQ  219

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
              G PYVMFGDG+L +CKPISE DLA ++++C+      N+VLPIGGPGKA++ LEQG ML
Sbjct  220   KGGPYVMFGDGQLASCKPISERDLAKYMAECIRDASLENKVLPIGGPGKAMSALEQGTML  279

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F + G E KF+KVPI++MD  I  LD     F ++ DAAEFGKIGRYYAAESMLV D   
Sbjct  280   FDILGMEPKFVKVPIEVMDGVIKILDTFAGFFANMRDAAEFGKIGRYYAAESMLVLDSTT  339

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GEYDA  TPSYG DTLE FFK+V  EG+AGQELG+Q +F
Sbjct  340   GEYDASKTPSYGTDTLEAFFKKVSVEGLAGQELGDQAVF  378



>emb|CEG01792.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=379

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 251/342 (73%), Gaps = 6/342 (2%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
                +   ++ +LVVG+TGYIG+FV  EL  RG+ V A  RE+SGI G    ++       
Sbjct  43    LEGRENGEVKVLVVGATGYIGKFVTRELCARGYDVTAFTREKSGIGGKTGADEARALFPN  102

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V F DV++  S+E+         DVVVSCLASR GGVKDSW IDY+ATKN L   R  
Sbjct  103   ATVKFGDVSDALSVERDAFGE-EKYDVVVSCLASRTGGVKDSWDIDYQATKNVLDAARAN  161

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             G+ HFVLLSAICVQKPLL FQ+AKLKFE +L +EA D    +YSIVRPTAFFKSLAGQVE
Sbjct  162   GSKHFVLLSAICVQKPLLTFQKAKLKFEQEL-QEAGD---ISYSIVRPTAFFKSLAGQVE  217

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
             +V+ G PYVMFGDG+L +CKPISE DLA F++D +     +N+VLPIGGPG+A++ L+QG
Sbjct  218   VVQKGGPYVMFGDGQLASCKPISESDLAKFMADSIREPSMMNKVLPIGGPGEAMSALQQG  277

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
              MLF++  KE KF+KVPI+IMD  I  LD+    F +++DAAEFGKIGRYYAAESMLV +
Sbjct  278   TMLFEILDKEPKFVKVPIEIMDVVIKVLDVFAGFFSNMKDAAEFGKIGRYYAAESMLVMN  337

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +K +YDA+ TPSYG DTL++FF +V +EG+AGQELG+Q +F
Sbjct  338   -DKEQYDADATPSYGTDTLKDFFVKVSKEGLAGQELGDQAVF  378



>ref|XP_003083332.1| Predicted dehydrogenase (ISS) [Ostreococcus tauri]
Length=383

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/339 (59%), Positives = 251/339 (74%), Gaps = 6/339 (2%)
 Frame = +3

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             +   ++ +LVVG+TGYIG+FV  EL  RG+ V A  RE+SGI G    ++       A V
Sbjct  50    RENGEVKVLVVGATGYIGKFVTRELCARGYDVTAFTREKSGIGGKTGADEARALFPNATV  109

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
              F DV++  S+E+         DVVVSCLASR GGVKDSW IDY+ATKN L   R  G+ 
Sbjct  110   KFGDVSDALSVERDAFGE-EKYDVVVSCLASRTGGVKDSWDIDYQATKNVLDAARANGSK  168

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLL FQ+AKLKFE +L +EA D    +YSIVRPTAFFKSLAGQVE+V+
Sbjct  169   HFVLLSAICVQKPLLTFQKAKLKFEQEL-QEAGD---ISYSIVRPTAFFKSLAGQVEVVQ  224

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
              G PYVMFGDG+L +CKPISE DLA F++D +     +N+VLPIGGPG+A++ L+QG ML
Sbjct  225   KGGPYVMFGDGQLASCKPISESDLAKFMADSIREPSMMNKVLPIGGPGEAMSALQQGTML  284

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F++  KE KF+KVPI+IMD  I  LD+    F +++DAAEFGKIGRYYAAESMLV + +K
Sbjct  285   FEILDKEPKFVKVPIEIMDVVIKVLDVFAGFFSNMKDAAEFGKIGRYYAAESMLVMN-DK  343

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +YDA+ TPSYG DTL++FF +V +EG+AGQELG+Q +F
Sbjct  344   EQYDADATPSYGTDTLKDFFVKVSKEGLAGQELGDQAVF  382



>ref|WP_011618948.1| oxidoreductase [Synechococcus sp. CC9311]
 ref|YP_730226.1| hypothetical protein sync_1014 [Synechococcus sp. CC9311]
 gb|ABI46988.1| conserved hypothetical protein [Synechococcus sp. CC9311]
Length=403

 Score =   385 bits (990),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  369   PNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ  548
             P   FR ++P  + + V G+TGYIGRFV  ELV+RG+ V+A ARE SGI G  S+ D + 
Sbjct  64    PRHDFRERSPDQVRVAVFGATGYIGRFVVKELVRRGYQVMAFARESSGIGGRKSEADVVA  123

Query  549   QLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVV  728
                 A V F DVT  +SL     S   P DVV+SCLASR GG KDSW IDY+A  N+   
Sbjct  124   DFPDAEVRFGDVTNPTSLATHAFSE--PTDVVISCLASRTGGKKDSWAIDYQANLNTYNE  181

Query  729   GRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLA  908
             GRK G AHFV+LSAICVQKP+LEFQ+AKL FE  L++E   D   T++IVRPTAFFKS+A
Sbjct  182   GRKAGVAHFVMLSAICVQKPILEFQKAKLAFE-TLLRE---DTEITHTIVRPTAFFKSIA  237

Query  909   GQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
             GQ E  K G PYVMFG+G+L +CKPISE+DLA F+++CV   DK+NQVLPIGGPG AL+ 
Sbjct  238   GQFESCKKGAPYVMFGNGELTSCKPISEKDLACFLANCVNEADKVNQVLPIGGPGPALSA  297

Query  1089  LEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESM  1268
               QGE+LFK  G+  + + +PI +M+     L+ +  + P++ED AEF +IG YYA+ESM
Sbjct  298   RTQGEILFKTLGRSPRMLSLPIAVMNAPTAILEKVAVLVPAVEDTAEFARIGCYYASESM  357

Query  1269  LVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             LVWD  +  YD + TPS+G DTLE+FF RV +EGMAGQELG+  +F
Sbjct  358   LVWDETRDCYDPDATPSFGDDTLEQFFARVNKEGMAGQELGDAALF  403



>ref|WP_011362086.1| oxidoreductase [Chlorobium chlorochromatii]
 ref|YP_379364.1| hypothetical protein Cag_1059 [Chlorobium chlorochromatii CaD3]
 gb|ABB28321.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
Length=332

 Score =   382 bits (982),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 243/332 (73%), Gaps = 6/332 (2%)
 Frame = +3

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTe  590
             + VVGSTGYIG+FV  ELV RG+ V++ ARERSG+  + + E   Q L G+ V F DV  
Sbjct  7     VFVVGSTGYIGKFVVRELVARGYHVVSFARERSGVGAATTAEQLRQDLKGSEVRFGDV-G  65

Query  591   lssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSA  770
                  ++    G   DVVVSCL SRNGG++DSW IDY+AT+N+L   +  GA  FVLLSA
Sbjct  66    NMQSLRANGIRGEHFDVVVSCLTSRNGGIQDSWNIDYQATRNALDAAKAAGATQFVLLSA  125

Query  771   ICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVM  950
             ICVQKP+LEFQRAKLKFE +L      + G T+SIVRPTAFFKS+AGQVE VK+GKP+VM
Sbjct  126   ICVQKPMLEFQRAKLKFEREL-----QESGLTWSIVRPTAFFKSIAGQVEAVKNGKPFVM  180

Query  951   FGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKE  1130
             FG+G+L ACKPISE DLA +I +C+      N++LPIGGPG A+TPL+QG MLF+L G+E
Sbjct  181   FGNGRLTACKPISEADLARYIVNCIDDSSMQNRILPIGGPGPAITPLDQGMMLFELLGRE  240

Query  1131  AKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAEN  1310
              KF K+PIQ+ D  I  L LL K+FP  ++ AEF +IG+YY +ESMLV DP+ G Y+A  
Sbjct  241   PKFKKMPIQMFDVIIPVLALLGKIFPQFKEKAEFARIGKYYCSESMLVLDPKTGNYNAAI  300

Query  1311  TPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             TPS+G DTL EF+ RVL++G+ GQELGE  +F
Sbjct  301   TPSFGSDTLREFYGRVLKDGLKGQELGEHAMF  332



>ref|WP_006366632.1| oxidoreductase [Chlorobium ferrooxidans]
 gb|EAT58680.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid dehydrogenase/isomerase:NmrA-like 
[Chlorobium ferrooxidans DSM 
13031]
Length=340

 Score =   381 bits (979),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 210/346 (61%), Positives = 259/346 (75%), Gaps = 8/346 (2%)
 Frame = +3

Query  372   NVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ-  548
             N S  S+  +   + VVG+TGYIG+FV  ELV RG+ V++ ARERSG+ G+ +K D L+ 
Sbjct  2     NSSSHSQAVTPKRVFVVGATGYIGKFVVRELVSRGYEVVSFARERSGV-GAMTKADELRV  60

Query  549   QLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVV  728
             QL G+ V F DV+ L SL +S    G   DVVVSCL SRNGGVKDSW IDY+AT+N+L  
Sbjct  61    QLKGSEVRFGDVSSLDSLMQSGIR-GEHFDVVVSCLTSRNGGVKDSWNIDYQATRNALDA  119

Query  729   GRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLA  908
              +  GA HFVLLSAICVQKPLLEFQRAKLKFE +L      + G T+SIVRPTAFFKS+A
Sbjct  120   AKAAGAGHFVLLSAICVQKPLLEFQRAKLKFEKEL-----QESGLTWSIVRPTAFFKSIA  174

Query  909   GQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
             GQVE VK GKPYV+FG+G+L ACKPISE DLA FI+DC+    K N++LPIGGPG+A+T 
Sbjct  175   GQVEAVKKGKPYVVFGNGELTACKPISERDLARFIADCLDDPSKQNRILPIGGPGRAITA  234

Query  1089  LEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESM  1268
              EQGE+LF+L G   KF  +PIQ+ D  I  + LL ++FP LED AEF +IG+YY +ESM
Sbjct  235   REQGELLFELLGLVPKFKNMPIQMFDVIIPVMTLLARIFPKLEDKAEFARIGKYYCSESM  294

Query  1269  LVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             LV +P  G+YDAE TPSYG DTL +F+KRVL+EG+AGQELGE  +F
Sbjct  295   LVLNPVTGKYDAEITPSYGSDTLRDFYKRVLQEGLAGQELGEHSMF  340



>ref|XP_005823840.1| 8-vinyl reductase [Guillardia theta CCMP2712]
 gb|EKX36860.1| 8-vinyl reductase [Guillardia theta CCMP2712]
Length=398

 Score =   375 bits (962),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/400 (51%), Positives = 264/400 (66%), Gaps = 26/400 (7%)
 Frame = +3

Query  234   LNHHIQVNA-VPYAITFPSIH--FSKPFK----LNQERFKPVSCSAAPAVETPNVSFRSK  392
             L H  Q+++ +  + T PS+   FS+ F+        R   V  S +    +  V   + 
Sbjct  15    LVHGFQLSSPLLRSPTSPSVSKSFSRSFQPAYSARSPRTSAVRFSQSSRDLSMKVDLSTA  74

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
              P D+ +LV G TGYIGR+V  EL+ RG+ V+A +RE+SG+ G  S +D ++   GA+V 
Sbjct  75    KPEDVRVLVAGCTGYIGRYVTKELISRGYKVVAFSREKSGVGGKKSMDDVVKDFKGADVR  134

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             F DVT+L SL        V  DVVVSCLASR GG++DSW IDY+A+KN L V R+ G +H
Sbjct  135   FGDVTDLESLRSVAFKDKV--DVVVSCLASRTGGLQDSWDIDYQASKNCLDVLREQGGSH  192

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             +VLLSAICVQKPLLEFQRAKLK EGD+M++ +     +YSIVRPTAFFKSLAGQV LVK+
Sbjct  193   YVLLSAICVQKPLLEFQRAKLKLEGDIMEQQD----VSYSIVRPTAFFKSLAGQVNLVKN  248

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             G PYVMFGDG++C    ISE DLA  ++DC+  + + N+VLP+GGPGK LTPLEQ ++LF
Sbjct  249   GSPYVMFGDGEVCKANAISEPDLAIVMADCITDKSRWNKVLPVGGPGKPLTPLEQSKILF  308

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             +L G E K+I+VP+ + D  IG LD +  +FPS +D AEF +IGRYYA E M+       
Sbjct  309   ELFGLEPKYIRVPVAVFDAIIGLLDGIAFLFPSFKDKAEFARIGRYYATEDMV-------  361

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF*I  1412
                    PSYG  TL EFFK V   G+ GQELG+Q +F I
Sbjct  362   ------GPSYGTTTLREFFKDVAENGLQGQELGDQAVFNI  395



>ref|XP_003060270.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Micromonas 
pusilla CCMP1545]
 gb|EEH55039.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Micromonas 
pusilla CCMP1545]
Length=414

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 207/399 (52%), Positives = 260/399 (65%), Gaps = 38/399 (10%)
 Frame = +3

Query  312   LNQERFKPVSCSAAPAVE------TPNVSFRS--KNPSDINILVVGSTGYIGRFVATELV  467
             LN  R +  + S APA        TP  S     K+ + + +LVVG TGYIG+FV  EL 
Sbjct  19    LNAAR-RGRASSTAPARRARRVSTTPRASIADLPKDNASVKVLVVGGTGYIGKFVVRELC  77

Query  468   KRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksv-eslGVPIDVV  644
              +G+ V A  RE+SGI G + KED  +    A V F  V++++S+            DVV
Sbjct  78    AQGYDVTAFVREKSGIGGKSGKEDARRTFPDATVKFGSVSDVASIRGDAFGDADGAFDVV  137

Query  645   VSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRA-----  809
             VSCLASR GG+KDSW +DY+ATKN L V R+ GA HFVLLSAICVQKPLL FQ+A     
Sbjct  138   VSCLASRTGGIKDSWDVDYQATKNVLDVAREKGAKHFVLLSAICVQKPLLTFQKARSYSH  197

Query  810   -------------KLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVM  950
                          KLKFE +L   + +    ++SIVRPTAFFKSLAGQVE V+ G PYVM
Sbjct  198   RSPYDRVGVVNAAKLKFEEELAAASSE---ISHSIVRPTAFFKSLAGQVESVQKGGPYVM  254

Query  951   FGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKE  1130
             FGDG+L +CKPISE DLA ++++C+      N++LPIGGPG+A++ L+QG MLF++ G E
Sbjct  255   FGDGQLASCKPISERDLAKYMAECIRDPKLENKILPIGGPGEAMSALQQGTMLFEILGME  314

Query  1131  AKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE-----  1295
              KFIKVPI++MD  I  LD     F ++ DAAEFGKIGRYYAAESMLV D EK +     
Sbjct  315   PKFIKVPIEVMDGVIKVLDTFAGFFSNMRDAAEFGKIGRYYAAESMLVLDDEKSDAEKDE  374

Query  1296  --YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               YDA  TPSYG DTL +FFK+V  EG+AGQELG+Q +F
Sbjct  375   WVYDASKTPSYGTDTLGDFFKKVSVEGLAGQELGDQAVF  413



>emb|CCC15097.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Lepidodinium 
chlorophorum]
Length=444

 Score =   363 bits (933),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 232/342 (68%), Gaps = 9/342 (3%)
 Frame = +3

Query  384   RSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGA  563
             RS +     ++V G+TGYIGRFV  E + RG+  +A ARERSG+ G NSK D  +   GA
Sbjct  104   RSVSTPGKRVVVFGATGYIGRFVVAESISRGYDTVAFARERSGVGGKNSKNDVEKDFDGA  163

Query  564   NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFG  743
              V F  +T+ S         G  +D VV CLASR GG +DS+ IDY ATK  L   RK G
Sbjct  164   -VVFGSITDDSVQRAFD---GKAVDTVVVCLASRTGGKQDSYDIDYGATKRVLDTARKNG  219

Query  744   AAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVEL  923
               HFVLLSAICVQKP L FQ AKLK E +L    +     TYSIVRPTA+FKSLAGQ+E 
Sbjct  220   VRHFVLLSAICVQKPTLAFQDAKLKLEAELQAAGD----ITYSIVRPTAYFKSLAGQIEK  275

Query  924   VKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGE  1103
             VK G  YVMFGDG L +CKPISE DLA+++ +CV  +   N++LPIGGPGKA+TP EQGE
Sbjct  276   VKGGGSYVMFGDGALTSCKPISERDLAAYMINCVEDKSLENKILPIGGPGKAITPKEQGE  335

Query  1104  MLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDP  1283
             +LFK  GKE K   VP+ + D   G L  L  +FPSL D AEF +IG+YYA ESMLV+DP
Sbjct  336   LLFKALGKEPKMSSVPVALFDVITGVLGFLASIFPSLADKAEFARIGKYYAVESMLVYDP  395

Query  1284  EKGEY-DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              KG Y   ++TPSYGKDTLE+F+   +++G+ GQELG+Q +F
Sbjct  396   VKGVYLPGDSTPSYGKDTLEQFYVDAVQKGLKGQELGDQAVF  437



>ref|WP_034416297.1| oxidoreductase, partial [Candidatus Synechococcus spongiarum]
Length=322

 Score =   347 bits (890),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 223/328 (68%), Gaps = 6/328 (2%)
 Frame = +3

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTe  590
             +LVVGSTGYIG+ V   L+ RG  V+A AR RSG+ G   +E T + L+GA+V F   T 
Sbjct  1     MLVVGSTGYIGKVVVRALLNRGHGVVAFARPRSGVGGIEDEEATRRSLAGADVRFGQATR  60

Query  591   lssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSA  770
             L SL       G     VV CLASR GGV DSW+ID++AT N++   R+ GA  FVLLSA
Sbjct  61    LDSLVMDGGR-GESFHAVVCCLASRTGGVADSWRIDHQATANAIEAARRLGARQFVLLSA  119

Query  771   ICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVM  950
             ICVQKPLL FQ+AK K E +L        G T+SIVRPTAFFKSLA QVE V+ G PYV+
Sbjct  120   ICVQKPLLAFQKAKCKVEEELKA-----SGLTWSIVRPTAFFKSLAAQVEPVRRGFPYVV  174

Query  951   FGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKE  1130
              GDG+  AC PISEEDLA +++ C+   D+ N+VLPIGGPG ALT  +QGE+LF L  + 
Sbjct  175   VGDGRQAACTPISEEDLAEYMAGCLERPDRQNRVLPIGGPGPALTARQQGELLFSLLQRP  234

Query  1131  AKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAEN  1310
              +F+ VP+ + D  IG    L ++ P LED  E+ +IGRYYA ESML WDP+   Y A+ 
Sbjct  235   PRFLSVPVALFDGIIGAFTALNRLIPGLEDTVEYARIGRYYATESMLAWDPQTNAYCADA  294

Query  1311  TPSYGKDTLEEFFKRVLREGMAGQELGE  1394
             TPS G DTLE+F+KR+L EG+ GQ+LG+
Sbjct  295   TPSTGTDTLEDFYKRILNEGLHGQDLGD  322



>gb|EMS52423.1| hypothetical protein TRIUR3_02709 [Triticum urartu]
Length=218

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = +3

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             +LS    + PL +FQRAK +FEG+   EA  D  FTYS+VRPTAFFKSL GQVE VK G 
Sbjct  3     ILSQRDHRTPLSDFQRAKPRFEGERAAEAARDPAFTYSVVRPTAFFKSLGGQVEAVKKGN  62

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDGKLCACKPISEEDLASFI+DC+  ++K N+VLPIGGPGKALTPLEQGEMLF+L
Sbjct  63    PYVMFGDGKLCACKPISEEDLASFIADCIFDQEKANKVLPIGGPGKALTPLEQGEMLFRL  122

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E +FIKVPIQ+MD  I  LD L KVFP LEDAAEFGKIGRYYA+ESMLV DPE GEY
Sbjct  123   LGREPRFIKVPIQVMDGVIWVLDGLAKVFPGLEDAAEFGKIGRYYASESMLVLDPETGEY  182

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               E TPSYGKDTLE FF++V+REGMAGQELGEQ IF
Sbjct  183   SDEKTPSYGKDTLEHFFEKVIREGMAGQELGEQTIF  218



>ref|WP_035526307.1| epimerase [Hoeflea sp. BAL378]
 gb|KGF69338.1| epimerase [Hoeflea sp. BAL378]
Length=340

 Score =   323 bits (827),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 226/339 (67%), Gaps = 7/339 (2%)
 Frame = +3

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             K+P    +LV+G+TG IGR     LV RG  V+   R  +G    ++ ++T + L GA +
Sbjct  9     KSPRPRRVLVLGATGTIGRATVKALVDRGHEVVCFLRTNAGFGVDHAPDETSRLLHGAAL  68

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
              F DVT+ +S++      G   DV+VSCLASR G  KD+W IDY A  ++L   +  G  
Sbjct  69    RFGDVTDPASVDADGFH-GEKFDVLVSCLASRTGTPKDAWAIDYRAHCHALKAAKADGVE  127

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             H VLLSAICVQKPLLEFQ+AKL FE +L+       G TYSIVRPTAFFKSL+GQVE VK
Sbjct  128   HMVLLSAICVQKPLLEFQKAKLAFEAELIAS-----GMTYSIVRPTAFFKSLSGQVERVK  182

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
              GKP+++FGDG+L ACKPIS+ DL  FI+ C+      N++LPIGGPG+A+TP +QGE L
Sbjct  183   RGKPFLVFGDGELTACKPISDRDLGEFIARCLDDPACRNRILPIGGPGEAITPRQQGEEL  242

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F+L G+E +F  VP+ ++D  I  LD L  V   L+D AE  +IGRYYA +SMLV DP  
Sbjct  243   FRLLGREPRFRHVPVALLDAVILALDTLGIVSQRLKDKAELARIGRYYATQSMLVLDPGT  302

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             G YDA  TPS+G DTL +++++++R G A  E G+  +F
Sbjct  303   GRYDAAATPSFGSDTLFDYYRQLIR-GTARAERGDHAVF  340



>ref|WP_035516132.1| hypothetical protein [Pseudohaliea rubra]
 gb|KGE02878.1| Divinyl protochlorophyllide a 8-vinyl-reductase [Haliea rubra 
DSM 19751]
Length=335

 Score =   320 bits (819),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 217/332 (65%), Gaps = 6/332 (2%)
 Frame = +3

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTe  590
             + V G++GY GR +  EL  RG  V+ + R RSG+ G +S ED  + L  A     DV++
Sbjct  10    VFVAGASGYSGRALVRELCARGHRVVCLVRPRSGVGGRDSPEDLARALPDAEFRVGDVSD  69

Query  591   lssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSA  770
               SL +   + G   D V SCLA+R GGV+D+W +++EA +  L      G  HFVLLSA
Sbjct  70    PHSLREDGFA-GESFDAVFSCLATRGGGVRDAWTVEFEANRVLLDAALTAGVPHFVLLSA  128

Query  771   ICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVM  950
             ICVQ+P L FQRAKL FE  L        G  YSIVRPTAFFKSLAGQ+  V  GKPY++
Sbjct  129   ICVQRPKLAFQRAKLTFEALLAA-----SGLRYSIVRPTAFFKSLAGQLPRVLAGKPYLL  183

Query  951   FGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKE  1130
             FG+G+L ACKPISE DLA ++ DC+    + + +LP+GGPG ALTP   GE+LF+L+G+ 
Sbjct  184   FGNGELTACKPISERDLACYLVDCLDDPMRHDAILPVGGPGPALTPRAMGELLFRLSGRP  243

Query  1131  AKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAEN  1310
              ++  VP  +     G L  L +V PSL D AEF +IG YYA ESML+WD  +G YDA  
Sbjct  244   PRYRSVPPGLFTAVGGVLGALGRVVPSLVDKAEFARIGHYYATESMLLWDETRGAYDAAA  303

Query  1311  TPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             TPS+G+DTLE F+++ L +G+AGQELG+  +F
Sbjct  304   TPSFGEDTLEAFYEQALAKGLAGQELGDHALF  335



>ref|WP_034492161.1| epimerase [Afifella pfennigii]
Length=316

 Score =   318 bits (814),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 222/323 (69%), Gaps = 7/323 (2%)
 Frame = +3

Query  438   IGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksve  617
             +GR     LV+RG  V+   R R+G  GS S E + + L GA + F +VT+ +SL +   
Sbjct  1     MGRAAVRALVERGHEVVCFLRPRAGAGGSLSPEASARLLPGATLRFGEVTDPASLVRDGI  60

Query  618   slGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLE  797
             + G   DV++SCLASR G  KD+W IDY+A  ++L   R+ G    VLLSAICVQKPLL 
Sbjct  61    A-GERFDVLLSCLASRTGAPKDAWAIDYQAHVDALAAARQAGVCQMVLLSAICVQKPLLA  119

Query  798   FQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCAC  977
             FQ+AKL FE  LM     + G TYSIVRPTAFFKSL+GQ++ ++ GKPY++FGDG+L AC
Sbjct  120   FQKAKLAFEKALM-----ESGLTYSIVRPTAFFKSLSGQIDRIRAGKPYLLFGDGRLTAC  174

Query  978   KPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQ  1157
             KPIS+ DL  ++++C+  E + N++LPIGGPG+A+TPLEQGE LF L G++ +F +VP+ 
Sbjct  175   KPISDADLGRYLAECLDDESRHNRILPIGGPGRAVTPLEQGEHLFALLGRKPRFRRVPVA  234

Query  1158  IMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTL  1337
             ++D  +  L  L ++ P L + AE  +IGRYYA ESMLV +PE G YDAE TPSYG ++L
Sbjct  235   LLDAIVFTLGALGRLAPPLREKAELARIGRYYATESMLVLNPETGRYDAEATPSYGSESL  294

Query  1338  EEFFKRVLREGMAGQELGEQMIF  1406
              +F+ R++  G A  E G+  +F
Sbjct  295   FDFYARLV-AGEAAVERGDHAVF  316



>ref|WP_029059232.1| epimerase [Stappia stellulata]
Length=323

 Score =   316 bits (809),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 217/330 (66%), Gaps = 7/330 (2%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR  A  LV+ G  V+   R R       +  D    L GA V F+ VT+ +
Sbjct  1     MLGATGTIGRATARALVEAGAEVVCPVRPRPDRETVAAAVDHEGALGGAKVRFASVTDRN  60

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             SL +     G   D VVSCLASR+G  KD+W +D+ A  N+L   R+ GA  FVLLSAIC
Sbjct  61    SLVRDGLC-GERFDAVVSCLASRSGAPKDAWAVDHRANLNALEAAREAGAGTFVLLSAIC  119

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQ+PLL FQ+AK  FE +LM       G  YSIVRPTAFFKSL+GQ+E V+ GKP+++FG
Sbjct  120   VQRPLLAFQQAKRTFEAELMA-----SGLAYSIVRPTAFFKSLSGQIERVRQGKPFLVFG  174

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+EDL  +I+ CV  E + NQVLPIGGPG A+TP +QGE LF+L G+  +
Sbjct  175   DGELTACKPISDEDLGRYIAACVFDESRHNQVLPIGGPGPAITPKDQGEALFRLLGRSPR  234

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
             F  VP+ ++D  +G L LL ++ P L + AE  +IGRYYA +SML+ DP  G+YDAE TP
Sbjct  235   FKHVPVALLDAIVGGLALLGRISPRLAEKAELARIGRYYATQSMLLLDPATGKYDAEATP  294

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G DTL  +++RVL  G A  E G   +F
Sbjct  295   STGSDTLFAYYERVL-NGEATVERGAHSVF  323



>ref|WP_023411876.1| hypothetical protein [uncultured Thiohalocapsa sp. PB-PSB1]
 gb|ESQ14934.1| hypothetical protein N838_10230 [uncultured Thiohalocapsa sp. 
PB-PSB1]
Length=361

 Score =   313 bits (801),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 217/350 (62%), Gaps = 15/350 (4%)
 Frame = +3

Query  381   FRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQ---  551
              ++ +P    IL+ G TG IGR V   LV RG  VI + R  +G R  ++++  L     
Sbjct  19    MQTASPRPRRILMAGGTGTIGRAVVAALVARGHEVICVVRPHTGKRAKSARKHDLPPAQA  78

Query  552   -----LSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKN  716
                  L GA V F +VT+ +SL +         D +VSCLASR G  +D+W ID++A  N
Sbjct  79    RGIDFLEGAEVRFCEVTDPASLSEQGLRNEA-FDALVSCLASRTGEPRDAWAIDHQANLN  137

Query  717   SLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFF  896
              L  GR  GA   VLLSAICVQ+P L FQ+AKL FE  L      D G TYSIVR TAFF
Sbjct  138   LLYQGRAAGATQMVLLSAICVQRPRLAFQQAKLAFEAALA-----DSGLTYSIVRATAFF  192

Query  897   KSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGK  1076
             KSLAGQ+E V+ GKPY++FGDG+L ACKPIS+ DLA+++ DC+    + N++LPIGGPG 
Sbjct  193   KSLAGQIERVRQGKPYLLFGDGRLTACKPISDRDLAAYLVDCLDDASRHNRILPIGGPGP  252

Query  1077  ALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYA  1256
             A+TPLEQGE LF L G+EA F +VP+ ++      L    K  P L   AE  +IG YYA
Sbjct  253   AITPLEQGERLFDLLGREACFKQVPVALLQNIAATLGFAGKFVPPLAAKAELARIGHYYA  312

Query  1257  AESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +SMLV DP  G YDA+ TP  G+DTL ++++ VL +G    E GE  IF
Sbjct  313   TQSMLVLDPATGRYDADATPETGQDTLFDYYRHVL-DGTETVERGEHAIF  361



>ref|WP_007197007.1| epimerase [Hoeflea phototrophica]
 gb|EDQ34001.1| putative nucleoside-diphosphate-sugar epimerase [Hoeflea phototrophica 
DFL-43]
Length=338

 Score =   311 bits (796),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/337 (49%), Positives = 213/337 (63%), Gaps = 7/337 (2%)
 Frame = +3

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P    +LV+G TG IGR     LV +G  V+   R + G   + ++        G +V  
Sbjct  9     PRGHRVLVLGGTGTIGRATVRALVDQGHEVVCFVRGKPGGEPAPAQSARGDWPVGVSVRH  68

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
              D+T+  S  +     G   D +VSCLASR G  KD+W ID +A   +L V  + G    
Sbjct  69    GDITDPLSFARDGIC-GETFDALVSCLASRTGAPKDAWAIDCQAHSKALKVATEAGIGQM  127

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQKPLLEFQ+AKL FE +LM       G TYSIVRPTAFFKSL+GQ+E V+ G
Sbjct  128   VLLSAICVQKPLLEFQKAKLAFEAELMAS-----GLTYSIVRPTAFFKSLSGQIERVRKG  182

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KP+++FGDG+L ACKPIS+ DL  FI+ C+  E + N++LP+GGPG A+TP EQG+ LF 
Sbjct  183   KPFLLFGDGELTACKPISDRDLGQFIATCLKDESRWNRILPVGGPGPAITPREQGDKLFA  242

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L GKE KF  VP+ +MD  I  L +   V P L D AE  +IGRYYA ESMLV DP    
Sbjct  243   LLGKEPKFKHVPVAMMDVIIKLLSVAGHVSPRLADKAELARIGRYYATESMLVLDPATNR  302

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDA+ TPS+G DTL ++++++LR G A  E G+  +F
Sbjct  303   YDADATPSFGSDTLFDYYEQMLRGG-ASVERGDHAVF  338



>ref|WP_010467713.1| epimerase [Acaryochloris sp. CCMEE 5410]
Length=336

 Score =   308 bits (790),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 213/333 (64%), Gaps = 7/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              ILV+G TG IGR     LVKRG+ V+ IAR ++G+ G  ++E T Q L G  VCF DV 
Sbjct  11    RILVLGGTGTIGRATVAALVKRGYEVVCIARPKAGVGGQLTQEKTAQLLQGTEVCFGDVK  70

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +   L + V     P   VVSCLASR G   D+W IDY+A  + L + ++ G    VLLS
Sbjct  71    DPKFLAEQVFQDQ-PFYGVVSCLASRTGEPDDTWAIDYQAHMDVLSLAKESGVKQMVLLS  129

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ AKL FE     +A  + G  YSIVRPTA+FKSLAGQV  +++GKP+ 
Sbjct  130   AICVQKPRLAFQHAKLAFE-----KALRESGLIYSIVRPTAYFKSLAGQVAKIQNGKPFY  184

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDGKL ACKPIS+ DLA++I DC+      N++LPIGGPG ALTPLEQGE LFKL   
Sbjct  185   LFGDGKLTACKPISDPDLAAYIVDCLEDASLQNKILPIGGPGPALTPLEQGEYLFKLLDC  244

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP   +      L  + K+ PSL   AE  +IG YYA ESMLV+D E G YDA+
Sbjct  245   PPRFKSVPPGFLSAIATLLGGIAKIVPSLAAKAELARIGHYYATESMLVFDAETGRYDAD  304

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP  GKDTL E+++R++ +G    E G+  +F
Sbjct  305   ATPETGKDTLFEYYQRLV-DGSEEAERGDFAVF  336



>ref|WP_009030287.1| epimerase [Bradyrhizobium sp. ORS 375]
 emb|CCD95371.1| conserved hypothetical protein [Bradyrhizobium sp. ORS 375]
Length=313

 Score =   306 bits (784),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 211/330 (64%), Gaps = 17/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     L+ RG  V+   R R          +    + GA V   DVT+ +
Sbjct  1     MLGATGTIGRATVHALLARGHEVVCFVRPR----------NDAMTIPGATVRTGDVTDPA  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             SL +     G P D VVSC+ASR G  +D+  IDY+A  N L   R+ G   FVLLSAIC
Sbjct  51    SLARDGFR-GEPFDAVVSCMASRTGAPRDAQAIDYQAHVNVLEAARQAGVGQFVLLSAIC  109

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE  LM       G TYSIVRPTAFFKSL+GQV  V+ G+PY++FG
Sbjct  110   VQKPLLAFQQAKLTFEARLMG-----AGLTYSIVRPTAFFKSLSGQVARVQQGRPYLVFG  164

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DL  +++ C+  E + N+VLPIGGPG A+TPL+Q E LF L G++  
Sbjct  165   DGRLTACKPISDADLGDYLAGCLDDESRWNKVLPIGGPGPAITPLDQAEHLFALLGRKPT  224

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
               +VP+ ++D  IG LD+  ++ PSL D AE  +IGRYYA ESMLV DP  G YDA+ TP
Sbjct  225   IRRVPVALLDVIIGGLDVARRIVPSLADKAELARIGRYYATESMLVLDPATGRYDADATP  284

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G +TL +++  ++R G A  E G+  +F
Sbjct  285   STGNETLFDYYAELIR-GEAAAERGDHAVF  313



>ref|WP_012162873.1| epimerase [Acaryochloris marina]
 ref|YP_001516718.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Acaryochloris 
marina MBIC11017]
 gb|ABW27404.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase, putative 
[Acaryochloris marina MBIC11017]
Length=336

 Score =   306 bits (783),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/333 (50%), Positives = 210/333 (63%), Gaps = 7/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              ILV+G TG IGR    ELVKRG+ V+ IAR ++G+ G  ++E T Q L G  VCF DV 
Sbjct  11    RILVLGGTGTIGRATVAELVKRGYEVVCIARPQAGVGGQLTQEKTAQLLQGTEVCFGDV-  69

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +                 VVSCLASR G   D+W IDY+A  + L + ++ G    VLLS
Sbjct  70    KDPKFLAEQVFKNRQFYGVVSCLASRTGEPDDTWAIDYQAHMDVLSLAKESGVKQIVLLS  129

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ AKL FE     +A  + G  YSIVRPTA+FKSLAGQV  +++GKP+ 
Sbjct  130   AICVQKPRLAFQHAKLAFE-----KALRESGLIYSIVRPTAYFKSLAGQVAKIQNGKPFY  184

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS+ DLA++I DC+      N++LPIGGPG ALTPLEQGE LFKL   
Sbjct  185   LFGDGTLTACKPISDPDLAAYIVDCLEDASLQNKILPIGGPGPALTPLEQGEYLFKLLDC  244

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP   ++     L  + K+ PSL   AE  +IG YYA ESMLV+D E G YDA+
Sbjct  245   PPRFKSVPPGFLNAIATVLGGIAKIVPSLAAKAELARIGHYYATESMLVYDAETGRYDAD  304

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP  GKDTL E+++R++ +G    E G+  +F
Sbjct  305   ATPETGKDTLFEYYQRLV-DGSEEAERGDFAVF  336



>ref|WP_006517457.1| putative nucleoside-diphosphate sugar epimerase [Leptolyngbya 
sp. PCC 7375]
 gb|EKV03087.1| putative nucleoside-diphosphate sugar epimerase [Leptolyngbya 
sp. PCC 7375]
Length=336

 Score =   305 bits (782),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 208/318 (65%), Gaps = 6/318 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              ILV+G TG IGR     LVKRG  V+ IAR ++G  G  +KE T + L GA+V F DVT
Sbjct  11    RILVLGGTGSIGRAAVAALVKRGHEVVCIARSKAGSGGQLTKEKTARLLQGADVLFGDVT  70

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
               + L + V   G   D V+SCLASR G  KD+W IDY+A  + L + ++ G    +LLS
Sbjct  71    NTTFLAEHVFR-GQQFDAVLSCLASRTGEPKDAWAIDYQAHADVLSLAKESGVTQMILLS  129

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ AKLKFE +L+     + G TYSIVRPTA+FKSL GQV+ VK GK ++
Sbjct  130   AICVQKPRLVFQHAKLKFEQELI-----ESGLTYSIVRPTAYFKSLVGQVDRVKKGKSFL  184

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDGKL ACKPIS+ DLA +++DC+      N+VLPIGGPG A+T L+QGE LFK+  +
Sbjct  185   LFGDGKLTACKPISDADLAEYMADCLEDVSLQNKVLPIGGPGPAITLLDQGEYLFKILDR  244

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             +  F  VP  ++      LD L KV P L   AE  +IG YYA ESMLV + E G YDA+
Sbjct  245   KPSFRSVPASLLSGVAAVLDGLGKVVPPLAAKAELARIGHYYATESMLVLNSETGLYDAD  304

Query  1308  NTPSYGKDTLEEFFKRVL  1361
              TP  G DTL E+ +R++
Sbjct  305   ATPETGSDTLFEYLQRLI  322



>ref|WP_026849060.1| epimerase [Gemmatimonas sp. AP64]
Length=325

 Score =   304 bits (778),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 210/333 (63%), Gaps = 16/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + +VG+TG IGR     LV+ G  V+   R R+G             + GA V   +V+
Sbjct  9     RVFMVGATGTIGRATVQALVQHGHEVVCFVRARNG---------QAPAIPGATVRTGNVS  59

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +  S+ +     G   D VVSC+ASR GG KD+W ID++A ++ L   +  G + FVLLS
Sbjct  60    DAKSVVRDGFC-GESFDAVVSCMASRTGGSKDAWAIDHDAQRHVLDAAKAAGVSQFVLLS  118

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLL FQ AKL FE  LM     + G T+SIVRPTAFFKS++GQV+ V+ GKP++
Sbjct  119   AICVQKPLLAFQHAKLAFEQALM-----NSGLTWSIVRPTAFFKSISGQVKRVQQGKPFL  173

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FG+G L ACKPIS+ DLA F++ C+ +    N++LPIGGPG A+T  +QGE+LF LAGK
Sbjct  174   LFGNGALTACKPISDGDLAHFLAGCLHNPSWTNRILPIGGPGDAMTLRQQGELLFSLAGK  233

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP+ + D  +G    L  + P L D AEF +IGRYYA ESML+WDP    YDA 
Sbjct  234   PPQFKSVPVALFDVIVGVFSTLGAIIPPLRDKAEFARIGRYYATESMLLWDPVAQRYDAV  293

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPS+G DTL + + R+LR G    + GE  +F
Sbjct  294   ATPSFGSDTLADHYARLLR-GEVADDRGEHAVF  325



>ref|WP_029140308.1| epimerase [Citromicrobium bathyomarinum]
Length=331

 Score =   303 bits (775),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 213/333 (64%), Gaps = 14/333 (4%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              ILV+G TG IGR     LV RG  V+ +AR         S+      LSGA +   DVT
Sbjct  13    RILVLGGTGTIGRATVHALVARGHEVVCLARR-------TSERSAPPHLSGAQLRACDVT  65

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             + +SL +     G   D V+SCLASR G   D+W+ID++A  ++L   +  G  H +LLS
Sbjct  66    DPASLARDGIR-GERFDAVLSCLASRTGAPDDAWRIDHDAHLDALRQAQAAGIPHMILLS  124

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ+AKL FE  L+       G  YSIVRPTAFFKSL+GQVE V+ GKP+V
Sbjct  125   AICVQKPQLAFQKAKLAFEHSLIAS-----GIDYSIVRPTAFFKSLSGQVERVRQGKPFV  179

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MFGDG L ACKPIS+ DLA++++DC+ + ++ N++LPIGGPG A+TP  QGE LF + G+
Sbjct  180   MFGDGTLTACKPISDGDLAAYLADCIDNPERRNRILPIGGPGPAITPRMQGEALFAMLGQ  239

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP+ ++D  +  L  + +V PSL   AE  +IGRYYA ESMLV +PE G YDAE
Sbjct  240   PPRFKHVPVALLDAIVLMLGTMGRVVPSLRAKAELARIGRYYATESMLVLNPETGLYDAE  299

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPS G + L +++ ++L  G A  E GE  +F
Sbjct  300   ATPSTGSEKLFDYYAQLL-SGEAQAERGEHAVF  331



>gb|EIZ82844.1| NAD-dependent epimerase/dehydratase [Methylobacterium sp. GXF4]
Length=326

 Score =   301 bits (772),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 211/341 (62%), Gaps = 19/341 (6%)
 Frame = +3

Query  384   RSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGA  563
             R  +P+   +LV+GSTG IGR     L  RG +V+ + R  +               +G 
Sbjct  5     RPHDPAPRRVLVLGSTGTIGRATVRALAARGHAVVCLVRRPAPFP------------AGV  52

Query  564   NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFG  743
                 +DVT+ ++L +     G P DV+VSCLASR G   D+W IDY A  N+L      G
Sbjct  53    TARVADVTDPAALARDGIR-GEPFDVLVSCLASRTGLPDDAWAIDYRAQVNALEAAEAAG  111

Query  744   AAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVEL  923
                 +LLSAICVQKP+L FQ AKL FE  LM     + G  Y+IVRPTAFFKSL+GQ++ 
Sbjct  112   VTQVILLSAICVQKPVLAFQHAKLAFERVLM-----ESGLAYTIVRPTAFFKSLSGQIDR  166

Query  924   VKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGE  1103
             V+ GKP+++FGDG L ACKPIS++DL  +++DC+ + D+ N+VLPIGGPG+A+TP  QGE
Sbjct  167   VRRGKPFLVFGDGMLTACKPISDDDLGRYLADCIDAGDRRNRVLPIGGPGEAITPRAQGE  226

Query  1104  MLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDP  1283
              LF L G+  +F  VP+ ++D  I  L  L +  P+L   AE  +IGRYYA ESMLV DP
Sbjct  227   HLFALLGRAPRFQHVPVALLDAIIAVLGTLGRWVPALAAKAELARIGRYYATESMLVLDP  286

Query  1284  EKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               G YDA  TPS G DTL  ++ RV+R G A  E G+  +F
Sbjct  287   ATGRYDAHATPSTGSDTLFAYYARVVR-GEAVAERGDHAVF  326



>ref|WP_023075391.1| epimerase [Leptolyngbya sp. Heron Island J]
 gb|ESA33764.1| epimerase [Leptolyngbya sp. Heron Island J]
Length=336

 Score =   301 bits (772),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 209/318 (66%), Gaps = 6/318 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              ILV+G TG IGR V   LVKRG  V+ IAR ++G  G  ++E   + L+GA V F DVT
Sbjct  11    RILVLGGTGTIGRAVVATLVKRGHEVVCIARPKAGSGGKLTQEKIARLLAGAKVLFGDVT  70

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
               + L + V       D VVSCLASR G  KD+W IDY+A  + L + ++ G    VLLS
Sbjct  71    NTTFLTEQVFCEQ-QFDAVVSCLASRTGEPKDAWAIDYQAHADVLSLAKESGVTQVVLLS  129

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ AKLKFE +L+     + G TYSIVRPTA+FKSL GQV+ VK G+P++
Sbjct  130   AICVQKPRLVFQHAKLKFEKELV-----ESGLTYSIVRPTAYFKSLVGQVDRVKKGQPFL  184

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDGKL ACKPIS+ DLA +++DC+      N++LPIGGPG A+T L+QGE LFK+  +
Sbjct  185   LFGDGKLTACKPISDADLAEYMADCLEDVSLQNKILPIGGPGPAITLLDQGEYLFKILDR  244

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             +  F  VP  ++ +    LD L K+ P L   AE  +IG YYA ESMLV + E G YDA+
Sbjct  245   KPCFKSVPASLLSWVASILDGLGKIVPPLAAKAELARIGHYYATESMLVLNSETGLYDAD  304

Query  1308  NTPSYGKDTLEEFFKRVL  1361
              TP  G DTL E+ +R++
Sbjct  305   ATPETGSDTLFEYLQRLV  322



>ref|WP_019905757.1| epimerase [Methylobacterium sp. 77]
Length=323

 Score =   301 bits (771),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 212/330 (64%), Gaps = 7/330 (2%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G TG IGR     LV RG  V+ + R  +  R  +   D  +  SGA   FSDVT+ S
Sbjct  1     MLGGTGTIGRATVRALVSRGHEVVCLVRRSAESRDPSGPADRGRLPSGATARFSDVTDPS  60

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             SL +     G P DV+VSCLASR G   D+W ID++A  N+L   +  G  H + LSAIC
Sbjct  61    SLARDGFR-GEPFDVLVSCLASRTGLPADAWAIDHQAHVNALHASKAAGVTHVIHLSAIC  119

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKP+L FQ AKL +E     E     G  Y+IVRPTAFFKSL+GQ++ VK GKP+++FG
Sbjct  120   VQKPILAFQHAKLAYE-----EVLTTSGLDYTIVRPTAFFKSLSGQIDRVKRGKPFLVFG  174

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             +G L ACKPI ++DL +++++C+ + D+ N+VLPIGGPG+A+TP  QGE LF L G+E +
Sbjct  175   NGMLTACKPIGDDDLGTYLAECIDNADRRNRVLPIGGPGEAVTPKAQGERLFALLGREPR  234

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
             F  VP+ ++D  I  L  L ++ P+L   AE  +IGRYYA ESMLV DP  G YDA  TP
Sbjct  235   FTHVPVLMLDVIIAVLATLGRLVPALAAKAELARIGRYYATESMLVLDPATGRYDASATP  294

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G +TL +++ R++R G    E G+  +F
Sbjct  295   STGSETLFDYYARLVR-GETVAERGDHAVF  323



>ref|WP_009550096.1| epimerase [Burkholderiales bacterium JOSHI_001]
 gb|EHR70960.1| putative nucleoside-diphosphate sugar epimerase [Burkholderiales 
bacterium JOSHI_001]
Length=329

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 212/333 (64%), Gaps = 7/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + VVG++G IGR     L+++G  V+ + R RSG+ G+   +D  + L GA V   +VT
Sbjct  4     RVFVVGASGSIGRATVQALLRQGNEVVCLVRPRSGVGGAMGPDDWSRLLPGATVRVGEVT  63

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             + +SL +     G   D +VSCLASR G   D+W ID+ A   +L    + G  H VLLS
Sbjct  64    DAASLARDGFR-GERFDALVSCLASRTGAPADAWAIDHRANLQALHAALQAGVTHEVLLS  122

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLL FQ+AKL FE +LM       G  +SIVRPTAFFKSL+GQVE V+ GKP++
Sbjct  123   AICVQKPLLAFQQAKLAFEKELMAS-----GLAWSIVRPTAFFKSLSGQVERVRRGKPFL  177

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKP+S+ DL  +++ C+    +  +VLPIGGPG A+TP +QGEMLF L G+
Sbjct  178   VFGDGTLTACKPLSDRDLGEYLAGCLDDPGRQQRVLPIGGPGDAITPRQQGEMLFALLGQ  237

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP+ ++D  +G L    ++ P+L   AE  +IGRYYA ESMLV DP  G YDA 
Sbjct  238   PPRFKPVPVALLDAIVGVLGTAGRLLPALAAKAELARIGRYYATESMLVLDPATGRYDAA  297

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPS G DTL +F++ ++  G    E G+  +F
Sbjct  298   ATPSTGSDTLMDFYRNLI-SGAVKLERGDHAVF  329



>ref|WP_040844167.1| epimerase [Thiorhodococcus drewsii]
Length=331

 Score =   301 bits (770),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 214/342 (63%), Gaps = 16/342 (5%)
 Frame = +3

Query  393   NPSDIN----ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             N SD      +L+VG TG IGR   + LV RG  V+ I R R+     + +E  +  L G
Sbjct  2     NASDTRRPRRVLMVGGTGTIGRATVSALVARGHEVVCIVRPRA-----SKQERPMDFLQG  56

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V  +DVT+  SL +     G   D VVSCLASR G  +D+W ID+ A    L   +  
Sbjct  57    AEVRLADVTDPDSLAEHGFC-GERFDAVVSCLASRTGEPRDAWAIDHGAHMVLLEQAKAA  115

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GA   VLLSAICVQ+P L FQ+AKL FE  LM       G TYSIVRPTAFFKSLAGQV 
Sbjct  116   GATQMVLLSAICVQRPRLAFQQAKLAFEQALMA-----SGLTYSIVRPTAFFKSLAGQVA  170

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
              V+ GKPY++FGDG+L ACKPIS+ DLA++++DC+      N+VLPIGGPG A+TP+EQG
Sbjct  171   RVQQGKPYLLFGDGRLTACKPISDADLAAYLADCLEDPSLQNRVLPIGGPGPAITPIEQG  230

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             + LF L G+E +F +VP+  +      L  L KV P L   AE  +IG YYA ESMLV D
Sbjct  231   QFLFDLLGREPRFKQVPVGFISGIAAVLGALGKVVPPLAVKAELARIGHYYATESMLVLD  290

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE   YDA+ TP  G+DTL +++++++ EG    E GE  +F
Sbjct  291   PETDRYDADATPETGRDTLFDYYRQLV-EGTETAERGEHAVF  331



>gb|EXJ16439.1| Divinyl protochlorophyllide a 8-vinyl-reductase [Thiorhodococcus 
sp. AK35]
Length=331

 Score =   300 bits (769),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 214/342 (63%), Gaps = 16/342 (5%)
 Frame = +3

Query  393   NPSDIN----ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG  560
             N SD      IL+VG TG IGR     LV RG  V+ I R R+     + +E  L  L G
Sbjct  2     NASDTQRTRRILMVGGTGTIGRATVAALVARGHEVVCIVRPRA-----SKQERPLDFLQG  56

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V  +DV++ +SL +         D VVSCLASR G  +D+W ID+      L   +  
Sbjct  57    AEVRLADVSDPASLAEHGFRHER-FDAVVSCLASRTGEPRDAWAIDHGVHMVLLEQAKAA  115

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GA   VLLSAICVQ+P L FQ+AKL FE  LM     + G TYSIVRPTAFFKSLAGQV 
Sbjct  116   GATQMVLLSAICVQRPRLAFQQAKLAFEKALM-----ESGLTYSIVRPTAFFKSLAGQVA  170

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
              V+ GKPY++FGDG L ACKPIS+ DLA++++DC+      N++LPIGGPG A+TPLEQG
Sbjct  171   RVQQGKPYLLFGDGTLTACKPISDADLAAYLADCLEDPSLQNRILPIGGPGPAITPLEQG  230

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             + LF+L G+E KF +VP+  +      L  L K+ P L   AE  +IG YYA ESMLV D
Sbjct  231   QFLFELLGREPKFKQVPVGFISGIATVLGALGKIVPPLAAKAELARIGHYYATESMLVLD  290

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PE G YDA+ TP  G+DTL +++++++ EG    E GE  +F
Sbjct  291   PETGRYDADATPETGRDTLFDYYRQLV-EGSETAERGEHAVF  331



>ref|WP_011925529.1| epimerase [Bradyrhizobium sp. ORS 278]
 ref|YP_001204555.1| hypothetical protein BRADO2496 [Bradyrhizobium sp. ORS 278]
 emb|CAL76318.1| conserved hypothetical protein [Bradyrhizobium sp. ORS 278]
Length=313

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 210/330 (64%), Gaps = 17/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     LV RG  V+   R RS              + GA V   DVT+ +
Sbjct  1     MLGATGTIGRATVRALVARGHEVVCFVRPRS----------EAITIPGATVRTGDVTDPA  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             SL +     G   D VVSC+ASR G  +D+  IDY+A  N L   R  G   FVLLSAIC
Sbjct  51    SLVRDGFR-GERFDAVVSCMASRTGVPRDAQAIDYQAHVNVLEAARAAGVTQFVLLSAIC  109

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE  L+       G TYSIVRPTAFFKSL+GQV  V+ G+PY++FG
Sbjct  110   VQKPLLAFQQAKLAFEAQLVA-----AGLTYSIVRPTAFFKSLSGQVARVQQGRPYLVFG  164

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DL ++++ C+  E   N+VLPIGGPG A+TPL+Q E LF L G++  
Sbjct  165   DGRLTACKPISDADLGAYLAGCLDDEALWNRVLPIGGPGPAITPLDQAEHLFALLGRKPN  224

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
               +VP+ ++D  IG LD+  ++ PSL D AE  +IGRYYA ESMLV +P  G YDA+ TP
Sbjct  225   IRRVPVGLLDAIIGGLDVARRIVPSLADKAELARIGRYYATESMLVMNPATGRYDADATP  284

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G DTL +++ R++R G A  E G+  +F
Sbjct  285   STGSDTLFDYYARLIR-GEAEAERGDHAVF  313



>ref|WP_006613377.1| epimerase [Bradyrhizobium sp. ORS 285]
 emb|CCD88036.1| conserved hypothetical protein [Bradyrhizobium sp. ORS 285]
Length=313

 Score =   299 bits (766),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 210/330 (64%), Gaps = 17/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     LV RG  V+   R RS         D +  + GA V   DVT+  
Sbjct  1     MLGATGTIGRATVRALVARGHEVVCFVRSRS---------DAVT-IPGATVRTGDVTDPV  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             SL +     G   D +VSC+ASR G  +D+  IDY+A  N L   R  G   FVLLSAIC
Sbjct  51    SLARDGFR-GEHFDAIVSCMASRTGVPRDAQAIDYQAHVNVLNAVRDAGVTQFVLLSAIC  109

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE  LM       G TYSIVRPTAFFKSL+GQV  V+ G+PY++FG
Sbjct  110   VQKPLLAFQKAKLAFEAQLMT-----AGLTYSIVRPTAFFKSLSGQVARVRQGRPYLVFG  164

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DL  +++ C+  E + N+VLPIGGPG A+ P+EQ E LF L G++  
Sbjct  165   DGRLTACKPISDADLGDYLAGCLDDESRWNRVLPIGGPGPAIAPIEQAEHLFALLGRKPT  224

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
               +VP+ ++D  IG LD+  ++ PSL D AE  +IGRYYA ESMLV +P  G YDA+ TP
Sbjct  225   IRRVPVALLDVIIGGLDIAKRLVPSLADKAELARIGRYYATESMLVLNPSTGGYDADATP  284

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G +TL +++ R++R G A  E G+  +F
Sbjct  285   STGSETLFDYYARLIR-GEAEAERGDHAVF  313



>ref|WP_039332943.1| epimerase [Novosphingobium subterraneum]
 gb|KHS48258.1| NmrA-like family protein [Novosphingobium subterraneum]
Length=315

 Score =   298 bits (762),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/335 (49%), Positives = 209/335 (62%), Gaps = 21/335 (6%)
 Frame = +3

Query  405   INILVVGSTGYIGRFVATELVKRGFSVIAIARE-RSGIRGSNSKEDTLQQLSGANVCFSD  581
             + + V G TG IGR V   L KRG  V  + R    G+  +   E  L  LS  NV +  
Sbjct  1     MRVCVAGGTGTIGRAVVRNLAKRGHVVSCLTRRPDDGL--AAIAEVILADLSYTNVLWRT  58

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
               E               D V+SC+ASR G   D+W +D+ A  N L   ++ G  HFVL
Sbjct  59    FGEGR------------FDAVISCIASRTGVPGDAWAVDHRANLNLLDAAKEAGIGHFVL  106

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQKPLL FQ AKL FE  L+       G  YSIVRPTAFFKSL+GQ+E VK GKP
Sbjct  107   LSAICVQKPLLAFQHAKLAFEAALVAS-----GIRYSIVRPTAFFKSLSGQIERVKAGKP  161

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             +++FG+G+L ACKPIS+ DLA++I++C+  E++ N+VLPIGGPG ALTP +QGE LF + 
Sbjct  162   FLVFGNGELTACKPISDGDLAAYIAECLEHEERWNRVLPIGGPGPALTPRQQGEALFAML  221

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
             GKE +F  VP+ ++D   G L L  KV PSL   AE  +IGRYYA+ESMLV DP  G YD
Sbjct  222   GKEPRFRSVPLGLLDTIAGILGLAGKVIPSLATKAELARIGRYYASESMLVLDPATGRYD  281

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             A+ TPS G DTL + ++ VL +G A  + G+  +F
Sbjct  282   ADATPSTGSDTLFDHYRAVL-DGRASVDRGDHAVF  315



>ref|WP_011910783.1| epimerase [Rhodobacter sphaeroides]
 ref|YP_001170066.1| glucose/sorbosone dehydrogenase-like protein [Rhodobacter sphaeroides 
ATCC 17025]
 gb|ABP72761.1| Glucose/sorbosone dehydrogenase-like protein [Rhodobacter sphaeroides 
ATCC 17025]
Length=330

 Score =   298 bits (763),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 218/340 (64%), Gaps = 14/340 (4%)
 Frame = +3

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +  P    IL++G+TG IGR     L+ RG  V+   R RS   G     D      GA 
Sbjct  5     AARPEPRRILMLGATGTIGRATVRALLARGHEVVCFLRPRSP-GGRTHLPD------GAI  57

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             + + DVT+  SL +         D +VSCLASR G  +D+W ID++A  ++L   R  G 
Sbjct  58    LRYGDVTDPVSLARDGFR-NEQFDALVSCLASRTGVPRDAWAIDHKAHSDALAAARAAGV  116

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
                VLLSAICVQ+PLL FQ+AKL FE +LM+      G  +SIVRPTAFFKSL+GQV+ V
Sbjct  117   TQVVLLSAICVQRPLLAFQQAKLAFEDELMR-----SGLDWSIVRPTAFFKSLSGQVKRV  171

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             ++G+P+++FG+G+L ACKPIS++DL  +++ C+      N++LPIGGPG ALTP  Q EM
Sbjct  172   QEGRPFLVFGNGELTACKPISDDDLGRYMALCLEDPALRNRILPIGGPGPALTPRAQAEM  231

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPE  1286
             LF+L G+E K   VP+ ++D  I  L  L +V P L D AE  +IGRYYA ESMLV DP 
Sbjct  232   LFRLTGREPKVRHVPVALLDTIIAVLSTLGRVVPKLRDKAELARIGRYYATESMLVLDPA  291

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              G YDA+ TPS+G++TLEEF+ R+LR G A  +LGE  +F
Sbjct  292   TGRYDADATPSFGQETLEEFYTRLLR-GEATVDLGEHAVF  330



>ref|WP_031447776.1| epimerase [Caulobacteraceae bacterium PMMR1]
Length=339

 Score =   298 bits (762),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 210/337 (62%), Gaps = 11/337 (3%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAI--ARERSGIRGSNSKEDTLQQLSG--ANVCF  575
              +LV+G+TG +GR     L +RG  ++ +   R R+G        +  +   G  A + +
Sbjct  3     KVLVLGATGSLGRATTQALRRRGHELVCVLRPRHRNGADSGWPAANLARPPGGERAELRY  62

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
             +DVT+  SL +     G   D VVSCLASR G   D+W ID+ A  N+L   +  G  HF
Sbjct  63    ADVTDPVSLAEEGFR-GERFDAVVSCLASRTGAPDDAWAIDHRAHLNALEAAQAVGVGHF  121

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQKPLL FQRAKL FE  L+       G  YSIVRPTAFFKSL+GQ+E V+ G
Sbjct  122   VLLSAICVQKPLLAFQRAKLAFEAALIAS-----GLRYSIVRPTAFFKSLSGQIERVRRG  176

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KP++MFGDG L ACKPIS++DLA +I+ C+      N+VLPIGGPG A+TP EQGE LF 
Sbjct  177   KPFLMFGDGALTACKPISDDDLADYIARCLDDGACWNRVLPIGGPGPAITPREQGERLFA  236

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+ A+   VP+ ++D  +G L +L +V P+L   AE  KIGRYYA ESMLV D   G 
Sbjct  237   LLGRPARLQSVPVALLDGIVGGLSILGRVSPALARKAELAKIGRYYATESMLVLDAATGR  296

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDA  TPS G  TL +F+  V+  G    ELG+  +F
Sbjct  297   YDAAATPSTGTRTLFDFYADVI-AGAPAPELGDHAVF  332



>ref|WP_008964061.1| epimerase [Bradyrhizobium sp. STM 3809]
 emb|CCE01500.1| conserved hypothetical protein [Bradyrhizobium sp. STM 3809]
Length=313

 Score =   296 bits (759),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 209/330 (63%), Gaps = 17/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     L+ RG  V+   R RS         D +  + GA V   DV++  
Sbjct  1     MLGATGTIGRATVRALLARGHEVVCFVRPRS---------DAIT-IPGATVRTGDVSDPV  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             S+ +     G   D VVSC+ASR G  +D+  ID++A  N L   R  G   FVLLSAIC
Sbjct  51    SVARDGFR-GEHFDAVVSCMASRTGVPRDAQAIDHQAHVNVLEAARSAGVTQFVLLSAIC  109

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE  L        G TYS+VRPTAFFKSL+GQV  V+ G+PY++FG
Sbjct  110   VQKPLLAFQQAKLAFEAQLTAS-----GLTYSVVRPTAFFKSLSGQVARVQQGRPYLVFG  164

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DL +++  C+  E + N+VLPIGGPG A+TPL+Q E LF L G++  
Sbjct  165   DGRLTACKPISDADLGAYLGGCLDDEARWNRVLPIGGPGPAITPLDQAEHLFALLGRKPN  224

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
               +VP+ ++D  IG LD+  ++ P L D AE  +IGRYYA ESMLV DP  G YDA+ TP
Sbjct  225   IRRVPVGLLDAIIGGLDVAKRIVPRLADKAELARIGRYYATESMLVLDPATGRYDADATP  284

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G DTL +++ R++R G A  E G+  +F
Sbjct  285   STGSDTLFDYYARLVR-GEAMAERGDHAVF  313



>ref|WP_015133448.1| NAD-dependent epimerase/dehydratase [Leptolyngbya sp. PCC 7376]
 ref|YP_007070510.1| NAD-dependent epimerase/dehydratase [Leptolyngbya sp. PCC 7376]
 gb|AFY37676.1| NAD-dependent epimerase/dehydratase [Leptolyngbya sp. PCC 7376]
Length=351

 Score =   296 bits (758),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 211/331 (64%), Gaps = 10/331 (3%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
             +IL++G TG IGR     L+ RG  V  IAR +SGI    +K+ T + L G  V F DV 
Sbjct  24    SILMLGGTGTIGRATVAALLSRGHKVTCIARPKSGIGRKFTKDKTQELLQGTEVIFGDVK  83

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                 L K V       DV+ SC+ASR G  KD+W +DY+A  + L + ++ G    VLLS
Sbjct  84    NRDFLAKDVFGD-RSFDVIYSCMASRTGEPKDAWAVDYQAHADVLALAKESGVTQMVLLS  142

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ AKLKFE +L      + G TYSIVRPTA+FKSLAGQVE VK GKP++
Sbjct  143   AICVQKPKLVFQHAKLKFEQELA-----ESGLTYSIVRPTAYFKSLAGQVERVKKGKPFL  197

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS+ DL ++++DC+      N++LPIGGPG A+T   QGE LFKL  +
Sbjct  198   LFGDGTLAACKPISDPDLGAYLADCLDDVSLQNKILPIGGPGPAITLKNQGEYLFKLLDR  257

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E KF  VP  ++      +D++ KV P + + AE  +IG YYA ESMLVWD E  EYDA+
Sbjct  258   EPKFKSVPADLLMNISKVMDVIGKVIPPVAEKAELARIGHYYATESMLVWDAEAEEYDAD  317

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQM  1400
              TP  G +TL +++KR++     G+E  E++
Sbjct  318   ATPETGSETLFDYYKRLVE----GKEKAERV  344



>ref|WP_008028070.1| epimerase [Rhodobacter sp. SW2]
 gb|EEW26409.1| NAD-dependent epimerase/dehydratase [Rhodobacter sp. SW2]
Length=331

 Score =   295 bits (754),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 216/349 (62%), Gaps = 18/349 (5%)
 Frame = +3

Query  360   VETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKED  539
             + T   +  +  P    + ++G+TG IGR     L++RG  V+   R      G+    D
Sbjct  1     MHTSETAPDAPAPQPRRVFLLGATGTIGRATLAALLERGHQVVCFVRP-----GAKGLPD  55

Query  540   TLQQLSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNS  719
                    A + F DVT+  +L +     G   D +VSCLASR G  +D+W ID++A  ++
Sbjct  56    A------ALLRFGDVTDPGALARDGFR-GERFDALVSCLASRTGVPRDAWAIDHQAHVDA  108

Query  720   LVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFK  899
             L   +  G    VLLSAICVQKPLL FQ+AKL FE  L+       G TYSIVRPTAFFK
Sbjct  109   LAAAQAAGVTQVVLLSAICVQKPLLAFQQAKLAFETALIAS-----GLTYSIVRPTAFFK  163

Query  900   SLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKA  1079
             SL+GQV  V+ GKP+++FG+G L ACKPIS+ DL  +I+DC+    + N++LPIGGPG A
Sbjct  164   SLSGQVARVQQGKPFLLFGNGALTACKPISDADLGGYIADCLHDPSRHNRILPIGGPGPA  223

Query  1080  LTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAA  1259
             +TP +QGE LF+L G+  KF +VP+ +MD AI  L  L ++ P L D AE  +IGRYYA 
Sbjct  224   ITPRQQGEELFRLLGRAPKFKQVPVALMDAAIAVLSTLGQLSPKLRDKAELARIGRYYAT  283

Query  1260  ESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             ESMLV +P  G YDAE TPS G DTL +F+ R+L  G A  +LG+  +F
Sbjct  284   ESMLVLNPASGRYDAEATPSTGSDTLFDFYARLL-GGTATVDLGDHAVF  331



>ref|WP_026190588.1| epimerase [Methylobacterium sp. WSM2598]
Length=337

 Score =   295 bits (754),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 213/333 (64%), Gaps = 7/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + +VG+TG IGR  A  L  RG  V+   R R G    +     L   +GA V F +VT
Sbjct  12    RVFLVGATGTIGRATARALAARGHDVVCFVRPRPGRSPGSDAAVRLGLPAGAAVRFGNVT  71

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             + +SL       G P D +VSCLASR G  +D+W ID++A    L   R  G  H VLLS
Sbjct  72    DPASLAHDGLR-GEPFDTLVSCLASRTGRPRDAWAIDHDAHLALLAAARTSGIGHMVLLS  130

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLL FQ+AKL FE  L+    D     Y+IVRPTAFFKSL+GQVE V+ G+P++
Sbjct  131   AICVQKPLLAFQQAKLAFERALIASGTD-----YTIVRPTAFFKSLSGQVERVRRGRPWL  185

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS++DLA ++++CV   ++ N+VLPIGGPG+A+TP +QGE LF L G 
Sbjct  186   LFGDGALTACKPISDDDLARYLAECVEERERRNRVLPIGGPGEAITPRQQGEALFALLGH  245

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP+ ++D  +G L    +V PSL D AE  +IGRYYA ESMLV DP  G YDA 
Sbjct  246   SPRFRHVPVVLLDAVVGGLSACGRVIPSLADKAELARIGRYYATESMLVLDPASGRYDAA  305

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPS G +TL +++ R+LR G A  E G+  +F
Sbjct  306   ATPSTGSETLFDYYARLLR-GEAEAERGDHAVF  337



>ref|WP_019428305.1| hypothetical protein [Limnohabitans sp. Rim28]
Length=314

 Score =   294 bits (752),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 206/319 (65%), Gaps = 7/319 (2%)
 Frame = +3

Query  450   VATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGV  629
              A  L+K G  V+ + R R G R + +     ++LSGA + +    +     +   +   
Sbjct  3     TARALLKNGHEVVCLVRPRQGGRPTPADMALPERLSGATLLWGSADDERVWLQPGLAQ-T  61

Query  630   PIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRA  809
             P D VVSC+ASR G  +D+WK+D++A   +L   +  G  HFV LSAICVQKPLL FQ A
Sbjct  62    PFDAVVSCMASRMGSPQDAWKVDHQAHLWALKAAQTAGVKHFVQLSAICVQKPLLAFQHA  121

Query  810   KLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPIS  989
             KL FE  L+     + G TYSIVRPTAFFKSL+GQ+E VK GKP+++FGDG+L ACKPIS
Sbjct  122   KLAFEKALI-----ESGITYSIVRPTAFFKSLSGQLERVKKGKPFLIFGDGQLTACKPIS  176

Query  990   EEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDF  1169
             ++DLA+F++ C+ +  + NQ+LPIGGPG A+TPL QGE LF L G   +F +VP+ ++D 
Sbjct  177   DDDLANFLAGCLDNASRHNQILPIGGPGPAITPLAQGEHLFALLGMPPRFKRVPVGLLDL  236

Query  1170  AIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFF  1349
              +G L +L K+ P+  + AE  +IGRYYA ESMLVWD +   YD + TPS+G  TL + +
Sbjct  237   IVGVLRVLGKLIPAAANKAELARIGRYYATESMLVWDAQAQRYDEQATPSHGSQTLFDAY  296

Query  1350  KRVLREGMAGQELGEQMIF  1406
              R ++ G    + GE  +F
Sbjct  297   ARWVK-GEGAPDRGEHAVF  314



>ref|WP_028641859.1| epimerase [Novosphingobium acidiphilum]
Length=310

 Score =   293 bits (750),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 206/331 (62%), Gaps = 22/331 (7%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKE-DTLQQLSGANVCFSDVTel  593
             ++G+TG IGR  A  LV+RG  V+ + R  + I G + ++ D   + S A   F+     
Sbjct  1     MLGATGTIGRATAAALVQRGHDVVCLVRAPADIPGVSIRQVDFADRASVARNGFA-----  55

Query  594   ssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAI  773
                       G  +D VVSC+ASR G   D+W ID+ A  + L   +  G A FVL+SAI
Sbjct  56    ----------GERVDAVVSCMASRTGTPDDAWAIDHRAHCHVLDAAQAAGVAQFVLVSAI  105

Query  774   CVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMF  953
             CVQKP L FQ AKL FE  L+       G  YSIVRPTAFFKSL+GQ+E V+ GKP+++F
Sbjct  106   CVQKPRLAFQHAKLAFEAALIAS-----GLRYSIVRPTAFFKSLSGQIERVRRGKPFLVF  160

Query  954   GDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEA  1133
             GDG L ACKPIS+ DLA +I+DC+    + N++LPIGGPG A+TP +QGE LF + G+  
Sbjct  161   GDGTLTACKPISDHDLAEYIADCLTDGSRWNRILPIGGPGPAITPRQQGEALFAMLGRAP  220

Query  1134  KFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENT  1313
             +F +VP+ ++D     L L+ ++ PSL   AE  +IGRYYA ESMLV DP  G YDAE T
Sbjct  221   RFSRVPVALLDTIAAALGLVGRIVPSLAVKAELARIGRYYATESMLVRDPATGRYDAEAT  280

Query  1314  PSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PS G  TL E+++ V+ +G    E G+  +F
Sbjct  281   PSAGTQTLFEYYRAVI-DGAQPVERGDHAVF  310



>ref|WP_040706521.1| epimerase [Oceanibaculum indicum]
Length=323

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 215/330 (65%), Gaps = 7/330 (2%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     LV RG  V+   R R+G  G    ++    L GA++ + DVT+ S
Sbjct  1     MLGATGTIGRATVRALVDRGHEVVCFIRPRAGSGGVPGADEIAGILPGASLRYGDVTDAS  60

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             S+ +     G   D +VSCLASR G  +D+WKID++A  ++L   ++ G AH VLLSAIC
Sbjct  61    SIARDGFR-GEAFDALVSCLASRTGRARDAWKIDHQAHADALAAAKQAGVAHMVLLSAIC  119

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ AKL FE +L+       G TYSIVRPTAFFKSL+GQV  VK GKP+++FG
Sbjct  120   VQKPLLAFQHAKLAFEHELIHS-----GLTYSIVRPTAFFKSLSGQVGRVKRGKPFLIFG  174

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG L ACKPIS+ DL  +++ C+  E++ N++LPIGGPG A+TP +QGEMLF   G+E +
Sbjct  175   DGTLTACKPISDGDLGRYLAGCLDDEERWNRILPIGGPGDAITPRQQGEMLFAQLGREPR  234

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
             F +VP+ ++      L  L +V P + D AE   IG YYA ESMLV +PE G YDA+ TP
Sbjct  235   FRQVPLALLWGIRWILAALGRVSPKMADKAELASIGLYYARESMLVLNPETGMYDADATP  294

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G +TL   + R++R G A  + G+  +F
Sbjct  295   STGTETLAGHYARLIR-GEARDDRGDHAVF  323



>gb|EMS40737.1| hypothetical protein MmSR116_4255 [Methylobacterium mesophilicum 
SR1.6/6]
Length=328

 Score =   293 bits (750),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 213/333 (64%), Gaps = 17/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +LV+G+TG IGR     LV RG +V+ + R         S +  L   +GA     D+T
Sbjct  13    RVLVLGATGTIGRATVRALVSRGHAVVCLVR--------RSADTALP--AGATERIVDLT  62

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +  SL +     G   DV+VSCLASR G   D+W IDY A  ++L   R  G  H VLLS
Sbjct  63    DPLSLARDGVR-GEAFDVLVSCLASRTGLPDDAWAIDYAAQVSALHACRAAGVTHVVLLS  121

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP+L FQRAKL FE  L      + G  Y+IVRPTAFFKSL+GQ+E +K GKP++
Sbjct  122   AICVQKPILAFQRAKLAFETVLT-----ESGLDYTIVRPTAFFKSLSGQIERLKRGKPFL  176

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS++DL  +++ C+  E++ N+VLPIGGPG+A+TP  QGE LF L G+
Sbjct  177   VFGDGTLTACKPISDDDLGRYLAACLDDEERRNRVLPIGGPGEAITPKAQGERLFALLGR  236

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E +F  VP++++D  +  L  + +  P+L   AE  +IGRYYA ESMLV +P  G+YDA 
Sbjct  237   EPRFTHVPVRLLDVIVIVLAAIGRWVPALAAKAELARIGRYYATESMLVLNPATGQYDAH  296

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP+ G +TL +++ RV+R G A  E G+  +F
Sbjct  297   ATPATGSETLFDYYARVIR-GEAVAERGDHAVF  328



>ref|WP_039903678.1| epimerase [Methylobacterium sp. GXF4]
Length=310

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 204/329 (62%), Gaps = 19/329 (6%)
 Frame = +3

Query  420   VGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelss  599
             +GSTG IGR     L  RG +V+ + R  +               +G     +DVT+ ++
Sbjct  1     MGSTGTIGRATVRALAARGHAVVCLVRRPAPFP------------AGVTARVADVTDPAA  48

Query  600   leksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICV  779
             L +     G P DV+VSCLASR G   D+W IDY A  N+L      G    +LLSAICV
Sbjct  49    LARDGIR-GEPFDVLVSCLASRTGLPDDAWAIDYRAQVNALEAAEAAGVTQVILLSAICV  107

Query  780   QKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGD  959
             QKP+L FQ AKL FE  LM     + G  Y+IVRPTAFFKSL+GQ++ V+ GKP+++FGD
Sbjct  108   QKPVLAFQHAKLAFERVLM-----ESGLAYTIVRPTAFFKSLSGQIDRVRRGKPFLVFGD  162

Query  960   GKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKF  1139
             G L ACKPIS++DL  +++DC+ + D+ N+VLPIGGPG+A+TP  QGE LF L G+  +F
Sbjct  163   GMLTACKPISDDDLGRYLADCIDAGDRRNRVLPIGGPGEAITPRAQGEHLFALLGRAPRF  222

Query  1140  IKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPS  1319
               VP+ ++D  I  L  L +  P+L   AE  +IGRYYA ESMLV DP  G YDA  TPS
Sbjct  223   QHVPVALLDAIIAVLGTLGRWVPALAAKAELARIGRYYATESMLVLDPATGRYDAHATPS  282

Query  1320  YGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              G DTL  ++ RV+R G A  E G+  +F
Sbjct  283   TGSDTLFAYYARVVR-GEAVAERGDHAVF  310



>ref|WP_026605224.1| epimerase [Methylobacterium sp. 285MFTsu5.1]
Length=328

 Score =   292 bits (747),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 206/333 (62%), Gaps = 17/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +L +G+TG IGR     LV RG  V+ + R           E  +   SGA     D+T
Sbjct  13    RVLFLGATGTIGRATVRALVSRGHEVVCLVR--------RPAETAIP--SGATARIVDLT  62

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +  SL +     G   D +VSCLASR G   D+W IDY A   +L  G   G  H VLLS
Sbjct  63    DTVSLARDGVR-GERFDALVSCLASRTGLPDDAWAIDYGAQVEALHAGLTAGVTHVVLLS  121

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP+L FQ AK  FE +L+       G  Y+IVRPTAFFKSL+GQ+E VK GKP++
Sbjct  122   AICVQKPILAFQHAKRAFEAELIAS-----GLDYTIVRPTAFFKSLSGQIERVKRGKPFL  176

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS++DL  +++DC+   D+ N+VLPIGGPG+A+TP  QGE LF L G+
Sbjct  177   VFGDGTLTACKPISDDDLGRYLADCLDDGDRRNRVLPIGGPGEAITPRAQGERLFALLGR  236

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E +F  +P+ ++D  +  L  + +  P+L   AE  +IGRYYA ESMLV DP  G YDA+
Sbjct  237   EPRFTHIPVVLLDAIVAVLTTMGRWVPALAAKAELARIGRYYATESMLVLDPATGRYDAQ  296

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPS G +TL +++ RV+R G A  E G+  +F
Sbjct  297   ATPSTGSETLFDYYARVVR-GEAVAERGDHAVF  328



>ref|WP_012332942.1| epimerase [Methylobacterium sp. 4-46]
 ref|YP_001769976.1| NmrA family protein [Methylobacterium sp. 4-46]
 gb|ACA17542.1| NmrA family protein [Methylobacterium sp. 4-46]
Length=337

 Score =   291 bits (746),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 7/333 (2%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              + +VG+TG IGR  A  L  RG  V+   R R G    +     L   +GA V F +VT
Sbjct  12    RVFLVGATGTIGRATARALAARGHDVVCFVRPRPGRSPGSDAAVRLGLPAGAAVRFGNVT  71

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             + +SL       G P D +VSCLASR G  +D+W ID++A    L      G  H VLLS
Sbjct  72    DPASLAHDGLR-GEPFDTLVSCLASRTGRPRDAWAIDHDAHLALLAAAGASGIGHMVLLS  130

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLL FQ+AKL FE  L+    D     Y+IVRPTAFFKSL+GQVE V+ G+P++
Sbjct  131   AICVQKPLLAFQQAKLAFERALIASGTD-----YTIVRPTAFFKSLSGQVERVRRGRPWL  185

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS++DLA ++++CV   ++ N+VLPIGGPG+A+TP +QGE LF L G+
Sbjct  186   LFGDGALTACKPISDDDLARYLAECVEERERRNRVLPIGGPGEAITPRQQGEALFALLGQ  245

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               +F  VP+ ++D  +G L    +V PSL D AE  +IGRYYA ESMLV DP  G YDA 
Sbjct  246   SPRFRHVPVVLLDAVVGGLSACGRVIPSLADKAELARIGRYYATESMLVLDPASGRYDAA  305

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPS G +TL +++ R+LR G A  E G+  +F
Sbjct  306   ATPSTGSETLFDYYARLLR-GEAEAERGDHAVF  337



>ref|WP_015668184.1| hypothetical protein [Bradyrhizobium oligotrophicum]
 ref|YP_007514682.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
 dbj|BAM91095.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
Length=275

 Score =   288 bits (738),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 185/257 (72%), Gaps = 6/257 (2%)
 Frame = +3

Query  636   DVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKL  815
             D V+SC+ASR G  +D+  IDY+A  N L   R  G +HFVLLSAICVQKPLL FQ+AKL
Sbjct  25    DAVMSCMASRTGVPRDAQAIDYQAHVNVLEAARNAGVSHFVLLSAICVQKPLLAFQQAKL  84

Query  816   KFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEE  995
              FE  L+       G TYSI+RPTAFFKSL+GQVE V+ G+P+++FG+G+L ACKPIS++
Sbjct  85    AFEAQLIA-----AGLTYSIIRPTAFFKSLSGQVERVRQGRPFLVFGNGRLTACKPISDD  139

Query  996   DLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAI  1175
             DL  +++ C+  E + N+VLPIGGPG A+TP+EQGE LF L G++ +F  VP+ ++D  I
Sbjct  140   DLGGYLAGCLDDESRWNKVLPIGGPGPAITPIEQGEHLFALLGRKPQFRHVPVALLDAII  199

Query  1176  GFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKR  1355
             G LDL  ++ PSL D AE  +IGRYYA ESMLV +P  G YDA+ TPS G +TL +++ +
Sbjct  200   GGLDLARRIVPSLADKAELARIGRYYAIESMLVLNPATGRYDADATPSTGSETLFDYYAK  259

Query  1356  VLREGMAGQELGEQMIF  1406
             ++R G A  E G+  +F
Sbjct  260   LIR-GEAEAERGDHAVF  275



>ref|WP_033921385.1| epimerase [Sphingomonas sp. 37zxx]
Length=348

 Score =   291 bits (744),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 205/345 (59%), Gaps = 18/345 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIR-GSNSKEDTLQQLSGA-------  563
              ILV+GSTG IGR     LV RG+  I   R R+     +N   DT ++ +G+       
Sbjct  10    RILVLGSTGTIGRATVRALVARGYETICFVRPRATPDVDANFPPDTTKEKNGSSTSAVRT  69

Query  564   ----NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
                 N              S        D ++SCLASR G   D+W ID+ A  ++L   
Sbjct  70    GGGQNPILRHGNITDPDALSAAIANESFDAIISCLASRTGAPADAWAIDHAAHIHALAAA  129

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             +  G  HF+ LSAICVQKPLL FQ AKL FE +L+       G  YSIVRPTAFFKSL+G
Sbjct  130   KAAGIPHFIQLSAICVQKPLLAFQHAKLAFEAELIAS-----GVRYSIVRPTAFFKSLSG  184

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             QVE V+ GKPY++FGDG L ACKPIS++DLA+++ DC+    + N++LPIGGPG A TP 
Sbjct  185   QVERVRSGKPYLLFGDGSLTACKPISDDDLAAYLVDCLDDPSRWNRILPIGGPGPAQTPR  244

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESML  1271
             +QGE LF L G+  +F +VP++++D  I  L  L ++ P+L   AE  +IGRYYA ESML
Sbjct  245   QQGEALFALLGRPPRFRQVPVKLLDTIIAVLSALGRIAPTLAAKAELARIGRYYATESML  304

Query  1272  VWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             V DP  G YDA+ TPS G  TL  +  ++L  G A  E G+  +F
Sbjct  305   VLDPHTGRYDADATPSTGTQTLSGYHAQLL-AGQASAERGDHAVF  348



>gb|EMS66826.1| hypothetical protein TRIUR3_34906 [Triticum urartu]
Length=211

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = +3

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             +L+ +    PLLEFQRAKLKFE  L  +A  D  FTYS+VRPTAFFKS  GQVE VK G 
Sbjct  14    VLADLRTTNPLLEFQRAKLKFEDKLAAKAARDPAFTYSVVRPTAFFKSQGGQVETVKKGN  73

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             PYVMFGDGK CACKPI EEDLASFI+DC+  ++K N+VLPIGG GKALTPL+QGEMLF+L
Sbjct  74    PYVMFGDGKFCACKPICEEDLASFIADCIFDQEKANKVLPIGGTGKALTPLDQGEMLFRL  133

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E +FIKVPI+IMD  I  +D L KVFP LEDAAEFGKIGRYYA+ES LV DPE GEY
Sbjct  134   PGREPRFIKVPIRIMDGVIWVIDGLAKVFPGLEDAAEFGKIGRYYASESTLVLDPETGEY  193

Query  1299  DAENTPSYGKDTLEEFF  1349
               E TPSYG DTLE+FF
Sbjct  194   SDEKTPSYGTDTLEQFF  210



>ref|WP_012042991.1| epimerase [Bradyrhizobium sp. BTAi1]
 ref|YP_001238876.1| hypothetical protein BBta_2842 [Bradyrhizobium sp. BTAi1]
 gb|ABQ34970.1| hypothetical protein BBta_2842 [Bradyrhizobium sp. BTAi1]
Length=315

 Score =   289 bits (739),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 208/330 (63%), Gaps = 15/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     LV RG  V+   R    +           ++ GA +   DVT+  
Sbjct  1     MLGATGTIGRATVRALVARGHEVVCFIRPHRDV----------VEVPGAALRIGDVTDPV  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             SL +     G P D VVSC+ASR G   D+  ID +A  N L    + G  HFVLLSAIC
Sbjct  51    SLARDGFR-GEPFDAVVSCMASRTGVPGDAQAIDDQAHVNVLDAACRAGITHFVLLSAIC  109

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE  L+ + E     TYSIVRPTAFFKSL+GQV  VK G+PY++FG
Sbjct  110   VQKPLLAFQQAKLAFEARLIGQGER---LTYSIVRPTAFFKSLSGQVARVKQGRPYLVFG  166

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DL  +++ C+  E + N+VLPIGGPG A+TP+EQ E LF L G++  
Sbjct  167   DGRLTACKPISDADLGDYLAGCLDDERRWNKVLPIGGPGPAITPIEQAEHLFALLGRKPN  226

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
               +VP+ ++D  I  L +  ++ PSL D AE  +IGRYYA ESMLV DP  G YDA+ TP
Sbjct  227   IRRVPVALLDVIIAGLGIAGRIAPSLADKAELARIGRYYATESMLVLDPVTGRYDADATP  286

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G +TL +++ +++R G A  E G+  +F
Sbjct  287   STGSETLFDYYTQLIR-GEAMAERGDHAVF  315



>ref|WP_039894310.1| epimerase [Methylobacterium mesophilicum]
Length=312

 Score =   288 bits (738),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 210/329 (64%), Gaps = 17/329 (5%)
 Frame = +3

Query  420   VGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelss  599
             +G+TG IGR     LV RG +V+ + R         S +  L   +GA     D+T+  S
Sbjct  1     MGATGTIGRATVRALVSRGHAVVCLVR--------RSADTALP--AGATERIVDLTDPLS  50

Query  600   leksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICV  779
             L +     G   DV+VSCLASR G   D+W IDY A  ++L   R  G  H VLLSAICV
Sbjct  51    LARDGVR-GEAFDVLVSCLASRTGLPDDAWAIDYAAQVSALHACRAAGVTHVVLLSAICV  109

Query  780   QKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGD  959
             QKP+L FQRAKL FE  L      + G  Y+IVRPTAFFKSL+GQ+E +K GKP+++FGD
Sbjct  110   QKPILAFQRAKLAFETVLT-----ESGLDYTIVRPTAFFKSLSGQIERLKRGKPFLVFGD  164

Query  960   GKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKF  1139
             G L ACKPIS++DL  +++ C+  E++ N+VLPIGGPG+A+TP  QGE LF L G+E +F
Sbjct  165   GTLTACKPISDDDLGRYLAACLDDEERRNRVLPIGGPGEAITPKAQGERLFALLGREPRF  224

Query  1140  IKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPS  1319
               VP++++D  +  L  + +  P+L   AE  +IGRYYA ESMLV +P  G+YDA  TP+
Sbjct  225   THVPVRLLDVIVIVLAAIGRWVPALAAKAELARIGRYYATESMLVLNPATGQYDAHATPA  284

Query  1320  YGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              G +TL +++ RV+R G A  E G+  +F
Sbjct  285   TGSETLFDYYARVIR-GEAVAERGDHAVF  312



>ref|WP_009827978.1| epimerase [Rhodobacteraceae bacterium HTCC2083]
 gb|EDZ41106.1| NmrA-like family [Rhodobacteraceae bacterium HTCC2083]
Length=322

 Score =   288 bits (738),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 212/336 (63%), Gaps = 18/336 (5%)
 Frame = +3

Query  402   DINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQL-SGANVCFS  578
             D  +LV G++G  G      L+++G+ V  + R           E ++  L +G  V + 
Sbjct  4     DKRVLVFGASGTAGSGAVRALLRQGYGVTCVLRS----------ERSVSALPAGVEVVYG  53

Query  579   DVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFV  758
             DVT          S     DVVVSCLASR+GG KD+W ID++A    L + ++ GA HF+
Sbjct  54    DVTAPEMGLAGALS-AEKFDVVVSCLASRSGGAKDAWAIDHDAQVTVLDLTKQIGATHFI  112

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LLSAICVQKP L FQ AKL FE  L+       G TYSIVRPTAFFKSL+GQ+E ++ GK
Sbjct  113   LLSAICVQKPTLPFQHAKLAFEAKLIAS-----GLTYSIVRPTAFFKSLSGQIERLRRGK  167

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             P+++FGDG L ACKPIS++DL  +++ C+  + + N++LPIGGPG A+TP EQGE+LF+L
Sbjct  168   PFLVFGDGTLTACKPISDDDLGDYVAGCIEDDTRQNRILPIGGPGDAITPKEQGEVLFRL  227

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEY  1298
              G+E  F  VPI +M      L     V  +  + A   +IG+YYA+ESMLVW+ E+G+Y
Sbjct  228   LGREPNFKHVPIAMMGVIHNVLRCAGLVSVNAAEKAGLAQIGQYYASESMLVWNAEQGKY  287

Query  1299  DAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             DA+ TPS G +TL E++ +V+  G+A  E G+  +F
Sbjct  288   DADKTPSTGTETLFEYYAKVIESGVA-IERGDHSVF  322



>ref|WP_008191018.1| epimerase [Labrenzia alexandrii]
 gb|EEE44150.1| NmrA-like family [Labrenzia alexandrii DFL-11]
Length=322

 Score =   287 bits (734),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 206/330 (62%), Gaps = 14/330 (4%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             + G+TG IGR    EL+++G  V+   R ++  +        +Q+ +   V  +      
Sbjct  1     MFGATGTIGRATLNELLRQGHYVVCFVRPQAAAK--------IQRFAPETVVRTGYVTNP  52

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
                +     G   D V+SCL+SR G   D+WKID++A  + L + ++ G  HF+LLSAIC
Sbjct  53    QSIRQDAFRGDEFDAVISCLSSRTGIPDDAWKIDHQANSDILKIAKETGKPHFILLSAIC  112

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQ+P L FQ AKL FE +L        G  YSI+RPTAFFKSL+GQVE VK GKP+++FG
Sbjct  113   VQRPRLAFQHAKLAFEAELQAS-----GLPYSIIRPTAFFKSLSGQVERVKAGKPFLIFG  167

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG L +CKPIS+ D+ASFI++C  +    N+VLP+GGPG+A+TP  QG  LF+  G E +
Sbjct  168   DGTLTSCKPISDHDVASFIAECFENPAMKNKVLPVGGPGEAITPRAQGTYLFQSLGLEPR  227

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
             F KVP+ +MD+ I  L+   +  P   D AE  +IGRYYA ESMLV +P+ G YDA+ TP
Sbjct  228   FRKVPVALMDWIIRALEFAGRFGPKYRDKAELARIGRYYATESMLVLNPKTGLYDADATP  287

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S+GK+TL EF+K+ L  G     LG+  +F
Sbjct  288   SFGKETLFEFYKK-LANGDETPSLGDHAVF  316



>ref|WP_011339018.1| epimerase [Rhodobacter sphaeroides]
 ref|YP_354588.1| nucleoside-diphosphate-sugar epimerase [Rhodobacter sphaeroides 
2.4.1]
 gb|ABA80687.1| nucleoside-diphosphate-sugar epimerase [Rhodobacter sphaeroides 
2.4.1]
Length=344

 Score =   287 bits (735),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 216/337 (64%), Gaps = 14/337 (4%)
 Frame = +3

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P+   IL++G+TG IG+  A  L+ RG  V+   R   G R      D      GA + +
Sbjct  8     PAPRRILMLGATGTIGQATARALLARGHEVVCFLRP-CGTRRQARLPD------GAVLRY  60

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
              DVT+  SL +     G   D +VSCLASR G  +D+W ID+ A  ++L   R  G    
Sbjct  61    GDVTDPQSLTRDGFC-GERFDALVSCLASRTGVPRDAWAIDHAAHSHALAAARAAGVTQV  119

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQ+PLL FQ+AKL  E +LM+      G  +SIVRPTAFFKSL+GQV+ V++G
Sbjct  120   VLLSAICVQRPLLAFQQAKLASEEELMR-----SGLAWSIVRPTAFFKSLSGQVKRVQEG  174

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             +P+++FGDG L ACKPIS++DL  +++ C+      N++LPIGGPG ALTP  Q EMLF+
Sbjct  175   RPFLVFGDGTLTACKPISDDDLGRYMALCLEDPALRNRILPIGGPGPALTPRAQAEMLFR  234

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+  K  +VP+ ++D  I  L L  ++ PSL D AE  +IGRYYA ESMLV DP  G 
Sbjct  235   LMGRPPKIRQVPVALLDAIIAVLSLGGRLLPSLRDKAELARIGRYYATESMLVLDPATGR  294

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDAE TPS+G +TLE+F++++L  G A  +LGE  +F
Sbjct  295   YDAEATPSFGTETLEDFYRQLL-AGEATVDLGEHAVF  330



>ref|WP_007812089.1| epimerase [Roseobacter sp. AzwK-3b]
 gb|EDM73300.1| hypothetical protein RAZWK3B_03730 [Roseobacter sp. AzwK-3b]
Length=332

 Score =   286 bits (733),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 212/338 (63%), Gaps = 13/338 (4%)
 Frame = +3

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             +P    + V+G TG IG+     L+ +G  V    R R+      S +  +     A++ 
Sbjct  8     SPDPKRVFVLGGTGTIGQATVAALLAQGHHVTCFLRPRA------SDDMRVPLPDAASLR  61

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             F DVT+ +SL +     G   D +VSC+ASR+G  +D+W ID++A   +L   R  G AH
Sbjct  62    FGDVTDPASLIRDGFR-GDRFDALVSCMASRSGTPRDAWAIDHKAHVAALGPARDAGIAH  120

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
              VLLSAICVQKP L FQ+AKL  E  L+       G TYSIVRPTAFFKSL+GQV  ++ 
Sbjct  121   VVLLSAICVQKPRLAFQQAKLAAEQALIAS-----GLTYSIVRPTAFFKSLSGQVARLRA  175

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKP+++FGDG L ACKPIS+ DL  +I+ C+   D+ N++LPIGGPG A+TP +QGE+LF
Sbjct  176   GKPFLLFGDGALTACKPISDADLGRYIATCLDDPDRQNRILPIGGPGPAITPRQQGELLF  235

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             +L G++ +F  VP+ +MD  I  L  L ++ P   D AE  +IGRYYA ESML+ DP  G
Sbjct  236   RLLGQDPRFRHVPVGMMDAIIAGLGALGRLSPKWRDKAELARIGRYYATESMLLLDPVTG  295

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              YDA+ T  +G DTLE F+ R++R G    +LG+  +F
Sbjct  296   RYDADATLEFGTDTLEAFYTRLIR-GEVSVDLGDHAVF  332



>emb|CBJ30364.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase, putative 
chloroplast precursor [Ectocarpus siliculosus]
Length=346

 Score =   287 bits (734),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/329 (47%), Positives = 211/329 (64%), Gaps = 25/329 (8%)
 Frame = +3

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGAN  566
             +K   D+ + V GSTGYIG+FVA E V+RG+  IA+ R    +            + GA 
Sbjct  4     TKAAKDMTVAVAGSTGYIGKFVALECVRRGYKTIALTRNPDAV------------VEGAE  51

Query  567   VCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGA  746
             +  +DVT+ +S++ ++   G  ID +VSCLASR+G   DS+ IDY+AT N L   +K GA
Sbjct  52    MVVADVTDPASVDAALA--GRKIDGLVSCLASRSGTKSDSFAIDYQATLNCLETAKKEGA  109

Query  747   AHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELV  926
             AHFV+LSA CV+ P+L+FQ+AKLKFE  L+ EA +     YSIVRPTAFFKS++GQ+E+V
Sbjct  110   AHFVMLSAFCVKNPILQFQKAKLKFEEKLV-EAGNAGEIGYSIVRPTAFFKSVSGQLEVV  168

Query  927   KDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEM  1106
             + G P+V+FGDG +C C PI+E DLA+++ DC+  + + N++L IGGP   LT   QG++
Sbjct  169   QGGAPFVVFGDGTMCKCNPIAEADLATYLVDCITEKSRSNKILNIGGPDAGLTMTAQGKL  228

Query  1107  LFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFP-SLEDAAEFGKIGRYYAAESMLVWDP  1283
             LF+  GKE K +KVP+ + D  IG LD L  + P   ED AE  KIG+YYA E ML  DP
Sbjct  229   LFEAVGKEPKILKVPVLLFDVIIGALDFLAAILPKQFEDPAELAKIGKYYAVEDMLTVDP  288

Query  1284  EKGEYDAENTPSYGKDTLEEFFKRVLREG  1370
              +          +G  TL E +KR+  EG
Sbjct  289   SE---------KFGTVTLGEHYKRIAVEG  308



>gb|AIQ92467.1| Glucose/sorbosone dehydrogenase-like protein [Methylobacterium 
oryzae CBMB20]
Length=271

 Score =   284 bits (726),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 182/261 (70%), Gaps = 6/261 (2%)
 Frame = +3

Query  624   GVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQ  803
             G P DV+VSCLASR G   D+W IDY A  ++L  G+  G  H +LLSAICVQKP+L FQ
Sbjct  17    GEPFDVLVSCLASRTGLPDDAWAIDYRAHVSALHAGKAAGVTHVILLSAICVQKPVLAFQ  76

Query  804   RAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKP  983
              AK  FEG L        G  Y+IVRPTAFFKSL+GQ++ +K GK +++FGDG L ACKP
Sbjct  77    HAKRAFEGVLAAS-----GLDYTIVRPTAFFKSLSGQIDRLKRGKSFLIFGDGTLTACKP  131

Query  984   ISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIM  1163
             IS++DL ++I++C+   D+ N+VLPIGGPG+A+TP  QGE LF L G+EA+F  VP+ ++
Sbjct  132   ISDDDLGTYIAECLDDPDRRNRVLPIGGPGEAVTPKAQGEQLFALLGREARFTHVPVALL  191

Query  1164  DFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEE  1343
             D  I  L +L ++ P+L   AE  +IGRYYA ESMLV DP  G+YDA  TPS G +TL +
Sbjct  192   DVIIVTLAMLGRLVPTLAAKAELARIGRYYATESMLVLDPVTGQYDARATPSTGSETLFD  251

Query  1344  FFKRVLREGMAGQELGEQMIF  1406
             ++ RV+R G A  E G+  +F
Sbjct  252   YYARVIR-GEAVAERGDHAVF  271



>ref|WP_009561256.1| Divinyl protochlorophyllide a 8-vinyl-reductase [Rhodobacter 
sp. AKP1]
 gb|EKX59709.1| Divinyl protochlorophyllide a 8-vinyl-reductase [Rhodobacter 
sp. AKP1]
Length=344

 Score =   285 bits (730),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 218/337 (65%), Gaps = 14/337 (4%)
 Frame = +3

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P+   IL++G+TG IG+  A  L+ RG  V+   R   G R      D      GA + +
Sbjct  8     PAPRRILMLGATGTIGQATARALLARGHEVVCFLRP-CGTRRQARLPD------GAVLRY  60

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
              DVT+  SL +     G   D +VSCLASR G  +D+W ID+ A  ++L   R  GA   
Sbjct  61    GDVTDPQSLARDGFC-GERFDALVSCLASRTGVPRDAWAIDHAAHSHALAAARAAGATQV  119

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQ+PLL FQ+AKL FE +LM+      G  +SIVRPTAFFKSL+GQV+ V++G
Sbjct  120   VLLSAICVQRPLLAFQQAKLAFEEELMR-----SGLAWSIVRPTAFFKSLSGQVKRVQEG  174

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             +P+++FGDG L ACKPIS++DL  +++ C+      N++LPIGGPG ALTP  Q EMLF+
Sbjct  175   RPFLVFGDGTLTACKPISDDDLGRYMALCLEDPALRNRILPIGGPGPALTPRAQAEMLFR  234

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+  K  +VP+ ++D  I  L L  ++ P+L D AE  +IGRYYA ESMLV DP  G 
Sbjct  235   LMGRPPKIRQVPVALLDAIIAGLSLGGRIIPALRDKAELARIGRYYATESMLVLDPATGR  294

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDAE TPS+G +TLE+F++++L  G A  +LGE  +F
Sbjct  295   YDAEATPSFGTETLEDFYRQLL-AGEATVDLGEHAVF  330



>ref|WP_011842660.1| epimerase [Rhodobacter sphaeroides]
 ref|YP_001045650.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides 
ATCC 17029]
 gb|ABN78878.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides 
ATCC 17029]
Length=344

 Score =   282 bits (722),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 218/337 (65%), Gaps = 14/337 (4%)
 Frame = +3

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P+   IL++G+TG IG+  A  L+ RG  V+ + R R G R      D      GA + +
Sbjct  8     PAPRRILMLGATGTIGQATAKALLARGHEVVCLLRPR-GTRRQARLPD------GAVLRY  60

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
              DVT+  SL +     G   D +VSCLASR G  +D+W ID+ A  ++L   R  G    
Sbjct  61    GDVTDPQSLTRDGFC-GERFDALVSCLASRTGAPRDAWAIDHAAHSHALAAARAAGVTQV  119

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQ+PLL FQ+AKL FE +LM+      G  +SIVRPTAFFKSL+GQV+ V++G
Sbjct  120   VLLSAICVQRPLLAFQQAKLAFEEELMR-----SGLNWSIVRPTAFFKSLSGQVKRVQEG  174

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             +P+++FGDG L ACKPIS++DL  +++ C+      N++LPIGGPG ALTP  Q EMLF+
Sbjct  175   RPFLVFGDGTLTACKPISDDDLGRYMALCLEDPALRNRILPIGGPGPALTPRAQAEMLFR  234

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+  K  +VP+ ++D  I  L L   + PSL D AE  +IGRYYA ESMLV DP  G 
Sbjct  235   LMGRPPKIRQVPVALLDAIIAVLSLGGLLLPSLRDKAELARIGRYYATESMLVLDPATGR  294

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDAE TPS+G +TLE+F++++L  G A  +LGE  +F
Sbjct  295   YDAEATPSFGTETLEDFYRQLL-AGEATVDLGEHAVF  330



>ref|WP_029940970.1| epimerase [Sphingomonas astaxanthinifaciens]
Length=331

 Score =   282 bits (721),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 207/339 (61%), Gaps = 14/339 (4%)
 Frame = +3

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             + P    IL+VG+TG IGR     LV RG  V+ + R        ++       L+GA V
Sbjct  6     RPPVPRRILLVGATGTIGRATVRALVARGHEVVCLVRR-------STAAAVQAGLAGAEV  58

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
                DVT+  S+ +     G   D VVSCLASR G  +D+W ID++A    L   +  G  
Sbjct  59    RVGDVTDPGSVARDGFR-GERFDTVVSCLASRTGAPRDAWAIDHDAHLVLLEAAKAAGVM  117

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
             HFVLLSAICVQKPLL FQ AKL FE  L+       G  YSIVRPTA+FKSL+GQV  V+
Sbjct  118   HFVLLSAICVQKPLLAFQHAKLAFEQALI-----GSGMAYSIVRPTAYFKSLSGQVARVQ  172

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
              GKP+++FGDG+L ACKPIS+ DLA++++ CV  E    ++LPIGGPG A+TP EQGE L
Sbjct  173   RGKPFLLFGDGRLTACKPISDADLAAYLAACVDDEALRGRILPIGGPGPAITPREQGEAL  232

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
             F L  +  +F  VP+ ++D  I  L  L +  P L D AE  +IGRYYA +SMLV DP  
Sbjct  233   FALLRQPPRFRSVPVGLLDAVIAVLGGLGRFSPRLADKAELARIGRYYATQSMLVLDPAT  292

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             G YDAE TPS G DTL + + +++R G A  +LG   I 
Sbjct  293   GRYDAEATPSSGSDTLVDHYAKLVR-GEATADLGAHAIL  330



>ref|WP_002723534.1| epimerase [Rhodobacter sphaeroides]
 gb|EGJ19796.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides 
WS8N]
Length=344

 Score =   282 bits (721),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 218/337 (65%), Gaps = 14/337 (4%)
 Frame = +3

Query  396   PSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCF  575
             P+   IL++G+TG IG+  A  L+ RG  V+ + R R G R      D      GA + +
Sbjct  8     PAPRRILMLGATGTIGQATARALLARGHEVVCLLRPR-GTRRQARLPD------GAVLRY  60

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
              DVT+  SL +     G   D +VSCLASR G  +D+W ID+ A  ++L   R  G    
Sbjct  61    GDVTDPQSLARDGFC-GERFDALVSCLASRTGAPRDAWAIDHAAHSHALAAARAAGVTQV  119

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQ+PLL FQ+AKL FE +LM+      G  +SIVRPTAFFKSL+GQV+ V++G
Sbjct  120   VLLSAICVQRPLLAFQQAKLAFEEELMR-----SGLDWSIVRPTAFFKSLSGQVKRVQEG  174

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             +P+++FGDG L ACKPIS++DL  +++ C+      N++LPIGGPG ALTP  Q EMLF+
Sbjct  175   RPFLVFGDGTLTACKPISDDDLGRYMALCLEDPALRNRILPIGGPGPALTPRAQAEMLFR  234

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+  K  +VP+ ++D  I  L L   + PSL D AE  +IGRYYA ESMLV DP  G 
Sbjct  235   LMGRPPKIRQVPVALLDAIIAVLSLGGLLLPSLRDKAELARIGRYYATESMLVLDPATGR  294

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDAE TPS+G +TLE+F++++L  G A  +LGE  +F
Sbjct  295   YDAEATPSFGTETLEDFYRQLL-AGEATVDLGEHAVF  330



>ref|WP_039683909.1| epimerase [Tateyamaria sp. ANG-S1]
 gb|KIC51441.1| epimerase [Tateyamaria sp. ANG-S1]
Length=315

 Score =   278 bits (711),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 201/331 (61%), Gaps = 16/331 (5%)
 Frame = +3

Query  414   LVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTel  593
             +V G+TG IGR     LV +G+ V    R+ +         +T   LSGA + + DVT+ 
Sbjct  1     MVFGATGTIGRATTAALVAQGYEVTCFLRKPA---------ETPASLSGALLRYGDVTDK  51

Query  594   ssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAI  773
             +S+  +      P D V+SCLASR G   D+W ID+ AT N +      G     LLSAI
Sbjct  52    ASIRDNAFGD-APFDAVISCLASRTGAPADAWAIDHRATVNIIEAAHASGTPQMALLSAI  110

Query  774   CVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMF  953
             CVQKP L FQ AKLK E     EA    G TYSIVRPTA+FKSLAGQ+  V+ GKPY++F
Sbjct  111   CVQKPRLAFQHAKLKAE-----EALIASGLTYSIVRPTAYFKSLAGQIARVQQGKPYLLF  165

Query  954   GDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEA  1133
             GDG+L AC PIS+ DL +++++C+ ++++ NQ+LPIGGPG  LTP   G+ LF L G+  
Sbjct  166   GDGELTACTPISDRDLGTYMAECLTAKERWNQILPIGGPGPELTPKAMGQHLFDLLGQTP  225

Query  1134  KFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENT  1313
             KF  VP+ +M    G L     + P L   AEF +IG YYA ESML  + + GEYD + T
Sbjct  226   KFKHVPVGMMRAIAGGLGAASHIVPPLAAKAEFARIGLYYATESMLAINQDTGEYDRDAT  285

Query  1314  PSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             PS G+DTL +++  VLR G A  E G+  +F
Sbjct  286   PSTGRDTLFDYYAAVLR-GDATVERGDHSVF  315



>gb|EMT13025.1| hypothetical protein F775_24683 [Aegilops tauschii]
Length=234

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  900   SLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKA  1079
             SL GQVE VK G PYVMFGDGKLCACKPISEEDLASFI+DC+  + K N+VLPIGGPGKA
Sbjct  66    SLGGQVEAVKKGNPYVMFGDGKLCACKPISEEDLASFIADCISDQQKANKVLPIGGPGKA  125

Query  1080  LTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAA  1259
             LTPLEQGEMLF+L G+E +F++VPIQIMD  I  LD L KVFP LEDAAEFGKIGRYYA+
Sbjct  126   LTPLEQGEMLFRLLGREPRFLRVPIQIMDGVIWVLDGLAKVFPGLEDAAEFGKIGRYYAS  185

Query  1260  ESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             ESMLV DPE GEY  + TPSYGKDTLE+FF++V+REGMAGQELGEQ IF
Sbjct  186   ESMLVLDPETGEYSDDKTPSYGKDTLEQFFEKVIREGMAGQELGEQTIF  234



>ref|WP_028794171.1| epimerase [Thalassobaculum salexigens]
Length=317

 Score =   278 bits (710),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 211/330 (64%), Gaps = 13/330 (4%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G TG IGR   + ++ RG  VI        +R ++     LQ    A++   ++T+ +
Sbjct  1     MLGGTGTIGRATVSAILARGHRVIC------PVRPASLDTARLQLPPDADIRPCEITDPA  54

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             +L +     G   D +VSCLASR+G  +D+W IDY A   +L V R  G +H VLLSAIC
Sbjct  55    ALARDGFR-GETFDALVSCLASRSGAPRDAWAIDYTAHSQALGVARSSGISHMVLLSAIC  113

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQ+P L FQ+AKL FE +L+       G T+SIVRPTA+FKSL+GQV+ V+ GKPY++FG
Sbjct  114   VQRPRLAFQKAKLAFEEELIG-----SGLTFSIVRPTAYFKSLSGQVDRVRRGKPYLVFG  168

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             +G+L ACKPIS+ DL ++++DC+      N+VLPIGGPG A+TPL Q E LF+L  +  +
Sbjct  169   NGELTACKPISDRDLGNYLADCLDDASLWNRVLPIGGPGPAITPLAQAERLFELLNEAPR  228

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
               +VP+ ++D  I  L +L  V   L D AE  +IGRYYA ESMLV DP  G YDA+ TP
Sbjct  229   VRRVPVGLLDAIIVGLSVLGTVSRRLRDKAELARIGRYYATESMLVLDPATGRYDADATP  288

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G DTL +F+ +++ +  +  +LGE  +F
Sbjct  289   STGADTLFDFYAKIVAQEES-VDLGEHAVF  317



>gb|EAU39711.1| hypothetical protein FP2506_13289 [Fulvimarina pelagi HTCC2506]
Length=323

 Score =   276 bits (707),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 207/331 (63%), Gaps = 8/331 (2%)
 Frame = +3

Query  414   LVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTel  593
             +++G+TG IGR     L+  G+ V+   R ++G+ G     DTL+ L GA + F DVT+ 
Sbjct  1     MLLGATGTIGRATVRALINEGYEVVCFVRSQTGL-GKPQIMDTLRCLEGAELRFGDVTDP  59

Query  594   ssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAI  773
             +S EK+    G   D +V+CLASR G  +D+W IDY A  ++L      G    VLLSAI
Sbjct  60    TSFEKNGLQ-GEAFDALVTCLASRTGAPEDAWAIDYRANSSALKAALAAGIEQVVLLSAI  118

Query  774   CVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMF  953
             CVQKPLL FQ+AKL FE +L+       G TYSIVRPTAFFKSL+GQV+ V+ GKPY++F
Sbjct  119   CVQKPLLAFQKAKLAFEAELIA-----SGLTYSIVRPTAFFKSLSGQVDRVRQGKPYIIF  173

Query  954   GDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEA  1133
              DG+L ACKPIS+ DLA +I  C+  E   N+VLPIGGPG A+ P EQGE L ++ G+  
Sbjct  174   DDGRLTACKPISDGDLARYIVRCLYDETLWNRVLPIGGPGPAINPREQGEALCRMLGRRP  233

Query  1134  KFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENT  1313
              F +VP   +      L  L  V P L   AE  +IG YYA +SMLV DP    Y AE T
Sbjct  234   VFRQVPTWFLSSIASGLRPLSVVSPRLAVKAELARIGYYYATQSMLVLDPVSRTYAAELT  293

Query  1314  PSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             P  G +TL EF+++++ EG++  E G+  +F
Sbjct  294   PETGTETLFEFYRQLV-EGISTVERGDHAVF  323



>ref|WP_040489836.1| epimerase [Fulvimarina pelagi]
Length=322

 Score =   276 bits (705),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 206/330 (62%), Gaps = 8/330 (2%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     L+  G+ V+   R ++G+ G     DTL+ L GA + F DVT+ +
Sbjct  1     MLGATGTIGRATVRALINEGYEVVCFVRSQTGL-GKPQIMDTLRCLEGAELRFGDVTDPT  59

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             S EK+    G   D +V+CLASR G  +D+W IDY A  ++L      G    VLLSAIC
Sbjct  60    SFEKNGLQ-GEAFDALVTCLASRTGAPEDAWAIDYRANSSALKAALAAGIEQVVLLSAIC  118

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE +L+       G TYSIVRPTAFFKSL+GQV+ V+ GKPY++F 
Sbjct  119   VQKPLLAFQKAKLAFEAELIA-----SGLTYSIVRPTAFFKSLSGQVDRVRQGKPYIIFD  173

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DLA +I  C+  E   N+VLPIGGPG A+ P EQGE L ++ G+   
Sbjct  174   DGRLTACKPISDGDLARYIVRCLYDETLWNRVLPIGGPGPAINPREQGEALCRMLGRRPV  233

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
             F +VP   +      L  L  V P L   AE  +IG YYA +SMLV DP    Y AE TP
Sbjct  234   FRQVPTWFLSSIASGLRPLSVVSPRLAVKAELARIGYYYATQSMLVLDPVSRTYAAELTP  293

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               G +TL EF+++++ EG++  E G+  +F
Sbjct  294   ETGTETLFEFYRQLV-EGISTVERGDHAVF  322



>sp|A2PZE5.2|CSPL1_IPONI RecName: Full=CASP-like protein IN26; AltName: Full=CASP-like 
protein 1D1; Short=InCASPL1D1, partial [Ipomoea nil]
Length=195

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -3

Query  2414  VAPTGSVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETELISVKLDPF  2235
             VAPTGSVETEKAGPSYKPKEYYKVTEAILRLLLLASLVVAVVVMVTSKETELISVKLDPF
Sbjct  1     VAPTGSVETEKAGPSYKPKEYYKVTEAILRLLLLASLVVAVVVMVTSKETELISVKLDPF  60

Query  2234  PPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILD  2055
             PPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILD
Sbjct  61    PPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILD  120

Query  2054  VVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIV  1884
             VVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIV
Sbjct  121   VVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIV  177



>ref|WP_026352699.1| epimerase [Loktanella vestfoldensis]
Length=318

 Score =   274 bits (701),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 195/344 (57%), Gaps = 33/344 (10%)
 Frame = +3

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRG------SNSKEDTLQQL  554
              PS   +L++G+TG IGR  A  L+  G  +IA  R  S   G      S   + +L  L
Sbjct  2     RPSPKTVLLLGATGTIGRATAKALLADGHKIIAPVRPGSDSNGLEVLVSSALTQASLSAL  61

Query  555   SGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGR  734
                + C                     D V+SC+ASR+G   D+W ID +  +  L    
Sbjct  62    MTDHAC---------------------DAVISCVASRSGAPADAWAIDRDLNRALLRAAT  100

Query  735   KFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQ  914
               G   FVLLSAICVQKP L FQ AKL FE +L          T+SIV PTA+FKSL+GQ
Sbjct  101   GAGVKQFVLLSAICVQKPKLAFQHAKLAFEAELQAAP-----ITWSIVHPTAYFKSLSGQ  155

Query  915   VELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLE  1094
             +  ++ GKP+++FGDG+L ACKPIS +DLA ++  C+   D  N++LPIGGPG A+TP  
Sbjct  156   LNRLRAGKPFLLFGDGELTACKPISNDDLARYLVLCLSDPDLQNRILPIGGPGPAITPRA  215

Query  1095  QGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLV  1274
             QGEMLF   G   +F  VP+ +M   +G L    KV P L D AE  +IGRYYA ESMLV
Sbjct  216   QGEMLFHALGLTPRFKHVPVAMMSAIVGGLSFFGKVSPRLRDKAELARIGRYYATESMLV  275

Query  1275  WDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             WD   G YDA+ TP +G +TL + +KR+  E +A  + GE  +F
Sbjct  276   WDDAHGRYDADATPEFGTETLADHYKRLATEDIA-DDRGEHAVF  318



>gb|EGV32173.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase, putative 
[Thiorhodococcus drewsii AZ1]
Length=281

 Score =   273 bits (697),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 186/285 (65%), Gaps = 7/285 (2%)
 Frame = +3

Query  552   LSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
             L GA V  +DVT+  SL +     G   D VVSCLASR G  +D+W ID+ A    L   
Sbjct  4     LQGAEVRLADVTDPDSLAEHGFC-GERFDAVVSCLASRTGEPRDAWAIDHGAHMVLLEQA  62

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             +  GA   VLLSAICVQ+P L FQ+AKL FE  LM       G TYSIVRPTAFFKSLAG
Sbjct  63    KAAGATQMVLLSAICVQRPRLAFQQAKLAFEQALMA-----SGLTYSIVRPTAFFKSLAG  117

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             QV  V+ GKPY++FGDG+L ACKPIS+ DLA++++DC+      N+VLPIGGPG A+TP+
Sbjct  118   QVARVQQGKPYLLFGDGRLTACKPISDADLAAYLADCLEDPSLQNRVLPIGGPGPAITPI  177

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESML  1271
             EQG+ LF L G+E +F +VP+  +      L  L KV P L   AE  +IG YYA ESML
Sbjct  178   EQGQFLFDLLGREPRFKQVPVGFISGIAAVLGALGKVVPPLAVKAELARIGHYYATESML  237

Query  1272  VWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             V DPE   YDA+ TP  G+DTL +++++++ EG    E GE  +F
Sbjct  238   VLDPETDRYDADATPETGRDTLFDYYRQLV-EGTETAERGEHAVF  281



>gb|AHM03217.1| Divinyl protochlorophyllide a 8-vinyl-reductase [Roseibacterium 
elongatum DSM 19469]
Length=324

 Score =   273 bits (699),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 201/333 (60%), Gaps = 19/333 (6%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +L+VG TG IGR  A+ L+  G  V A+ R  +   G          L    V    VT
Sbjct  11    RVLLVGGTGTIGRATASALMAAGHDVTALVRPGADATG----------LPACTVVEGAVT  60

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +     +++       D VVSCLASR G  KD+W IDY+A  + L   +  G   FVLLS
Sbjct  61    DSDDRRRTLARG---FDAVVSCLASRTGAPKDAWAIDYKAHSDLLADAQVAGIGQFVLLS  117

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLL FQ+AKL FE +L        G T+SIVRPTAFFKSL+GQ++ +K GKP++
Sbjct  118   AICVQKPLLAFQQAKLAFEEELRAS-----GLTWSIVRPTAFFKSLSGQIDRLKAGKPFL  172

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FG+G+L ACKPIS+ DL  +++ C+   D  N++LPIGGPG ALTPL+Q +MLF L G+
Sbjct  173   VFGNGELTACKPISDADLGRYVARCLSDPDLQNRILPIGGPGPALTPLDQAQMLFDLMGQ  232

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             +     V  +++D  I  L L  +V     + AE  +IGRYYA ESMLV DP  G YDA+
Sbjct  233   KPSVRHVSPRVLDGIIAVLGLAGRVSGKAAEKAELARIGRYYATESMLVLDPATGRYDAD  292

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP +G+DTL   ++++LR G    + G   +F
Sbjct  293   ATPEFGEDTLYAHYQKLLR-GEVADDRGAHAVF  324



>ref|XP_010027034.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic-like 
[Eucalyptus grandis]
Length=235

 Score =   268 bits (686),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 158/238 (66%), Gaps = 62/238 (26%)
 Frame = +3

Query  693   IDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYS  872
             ++YEAT+NSL+ GRKFGAAHFVLLSAICVQK LLE Q                       
Sbjct  60    VNYEATRNSLLAGRKFGAAHFVLLSAICVQKHLLEVQ-----------------------  96

Query  873   IVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQV  1052
                           VELVKDGKPYVMFGDGK                            V
Sbjct  97    --------------VELVKDGKPYVMFGDGKFAL-------------------------V  117

Query  1053  LPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEF  1232
              PIGGPGKA+TPLEQGE+LF+L GKE KF++VPI+IMDFAIG LD LVK+FP LEDAAEF
Sbjct  118   SPIGGPGKAVTPLEQGEILFRLLGKEPKFLEVPIEIMDFAIGILDFLVKIFPGLEDAAEF  177

Query  1233  GKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             GKIGRYYAAESML+ DPE GEY ++ TPSYGKDTLEEFF+ VLREGMAGQELGEQ IF
Sbjct  178   GKIGRYYAAESMLILDPETGEYSSDKTPSYGKDTLEEFFEEVLREGMAGQELGEQTIF  235



>ref|WP_038650876.1| epimerase [Roseibacterium elongatum]
Length=311

 Score =   270 bits (691),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 199/330 (60%), Gaps = 19/330 (6%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             +VG TG IGR  A+ L+  G  V A+ R  +   G          L    V    VT+  
Sbjct  1     MVGGTGTIGRATASALMAAGHDVTALVRPGADATG----------LPACTVVEGAVTDSD  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
                +++       D VVSCLASR G  KD+W IDY+A  + L   +  G   FVLLSAIC
Sbjct  51    DRRRTLARG---FDAVVSCLASRTGAPKDAWAIDYKAHSDLLADAQVAGIGQFVLLSAIC  107

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ+AKL FE +L        G T+SIVRPTAFFKSL+GQ++ +K GKP+++FG
Sbjct  108   VQKPLLAFQQAKLAFEEELRAS-----GLTWSIVRPTAFFKSLSGQIDRLKAGKPFLVFG  162

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             +G+L ACKPIS+ DL  +++ C+   D  N++LPIGGPG ALTPL+Q +MLF L G++  
Sbjct  163   NGELTACKPISDADLGRYVARCLSDPDLQNRILPIGGPGPALTPLDQAQMLFDLMGQKPS  222

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
                V  +++D  I  L L  +V     + AE  +IGRYYA ESMLV DP  G YDA+ TP
Sbjct  223   VRHVSPRVLDGIIAVLGLAGRVSGKAAEKAELARIGRYYATESMLVLDPATGRYDADATP  282

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +G+DTL   ++++LR G    + G   +F
Sbjct  283   EFGEDTLYAHYQKLLR-GEVADDRGAHAVF  311



>gb|EKE78069.1| hypothetical protein P24_03550 [Oceanibaculum indicum P24]
Length=288

 Score =   269 bits (688),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/285 (51%), Positives = 193/285 (68%), Gaps = 7/285 (2%)
 Frame = +3

Query  552   LSGANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
             L GA++ + DVT+ SS+ +     G   D +VSCLASR G  +D+WKID++A  ++L   
Sbjct  11    LPGASLRYGDVTDASSIARDGFR-GEAFDALVSCLASRTGRARDAWKIDHQAHADALAAA  69

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             ++ G AH VLLSAICVQKPLL FQ AKL FE +L+       G TYSIVRPTAFFKSL+G
Sbjct  70    KQAGVAHMVLLSAICVQKPLLAFQHAKLAFEHELIHS-----GLTYSIVRPTAFFKSLSG  124

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             QV  VK GKP+++FGDG L ACKPIS+ DL  +++ C+  E++ N++LPIGGPG A+TP 
Sbjct  125   QVGRVKRGKPFLIFGDGTLTACKPISDGDLGRYLAGCLDDEERWNRILPIGGPGDAITPR  184

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESML  1271
             +QGEMLF   G+E +F +VP+ ++      L  L +V P + D AE   IG YYA ESML
Sbjct  185   QQGEMLFAQLGREPRFRQVPLALLWGIRWILAALGRVSPKMADKAELASIGLYYARESML  244

Query  1272  VWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             V +PE G YDA+ TPS G +TL   + R++R G A  + G+  +F
Sbjct  245   VLNPETGMYDADATPSTGTETLAGHYARLIR-GEARDDRGDHAVF  288



>ref|WP_009817942.1| epimerase [Roseovarius sp. 217]
 gb|EAQ23971.1| hypothetical protein ROS217_15590 [Roseovarius sp. 217]
Length=325

 Score =   270 bits (691),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 201/337 (60%), Gaps = 27/337 (8%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIAR---ERSGI-RGSNSKEDTLQQLSGANVCF  575
              +LV+G+TG IGR     L+ RG +V+   R   E +G+  G   +   + +L    V  
Sbjct  12    RVLVLGATGTIGRATVAALLARGHAVVCFLRPGAEAAGLPEGVTLRRGAITELGREGV--  69

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
                             G   D +VSC+ASR+G   D+W +D++A   +L   +  G  H 
Sbjct  70    ---------------RGERFDALVSCMASRSGLPGDAWAVDHDAHILALEAAQAAGVGHM  114

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
             VLLSAICVQKP+L FQ AKL FE  L+       G  YSIVRPTA+FKSL+GQ+  ++ G
Sbjct  115   VLLSAICVQKPMLAFQAAKLAFEARLIA-----SGMRYSIVRPTAYFKSLSGQIARIQAG  169

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             +P+++FGDG+L ACKPIS+ DL  +++ C+    + N+VLPIGGPG A+TP +Q   LF+
Sbjct  170   RPFLVFGDGRLTACKPISDRDLGDYLAGCLEEPRRWNKVLPIGGPGPAITPRDQAAWLFE  229

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
               G+ AK  +VP+ +MD  I  L L  ++ P L   AE  +IGRYYA ESMLVW+P    
Sbjct  230   RLGRPAKVRQVPVGMMDAIIAGLSLAGRIAPRLRAKAELARIGRYYATESMLVWNPATEV  289

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDAE TP  G+D L ++++ V+  G A  +LGE  +F
Sbjct  290   YDAEATPETGRDRLFDYYEEVI-SGRARVDLGEHAVF  325



>ref|WP_023920211.1| epimerase [Rhodobacter capsulatus]
 gb|ETD87109.1| epimerase [Rhodobacter capsulatus YW2]
Length=321

 Score =   269 bits (687),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/333 (44%), Positives = 201/333 (60%), Gaps = 18/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +L++G TG IGR  A  L+  G  V A+ R      G++       +L G  +   DV+
Sbjct  7     RVLLLGGTGTIGRATAAALLAEGHGVWALVRP-----GTDP-----AKLPGCTLIEGDVS  56

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                ++ + ++    P   +VSCLASR G   D+W ID  A  ++L    +     FVLLS
Sbjct  57    HPDTVARVLKDH--PCAAIVSCLASRTGLPADAWAIDDRAHAHALEAAMEARVRKFVLLS  114

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP LEFQ+AKL FE  L           +SIVRPTAFFKSL+GQ+  V+ GKP++
Sbjct  115   AICVQKPYLEFQKAKLAFEAQLRGSP-----LEWSIVRPTAFFKSLSGQIPRVQKGKPFL  169

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG++ ACKPIS+ DL  F++ C+   DK+ +VLPIGGPG A+TPL+Q  ML +L G+
Sbjct  170   VFGDGRITACKPISDADLGRFLTSCLSDPDKVRKVLPIGGPGPAITPLDQAAMLERLTGQ  229

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               K   V  ++MD  +G L +L K  P L   AE  +IGRYYA+ESML+W+P KG YDA+
Sbjct  230   PVKIRHVTPKLMDAIVGVLSVLGKFSPKLAGKAELARIGRYYASESMLLWNPAKGCYDAD  289

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP +G D  E++   +LR G    + G+  IF
Sbjct  290   ATPEFGADRFEDYVAAMLR-GEIADDRGDHAIF  321



>ref|WP_029310694.1| epimerase [Acidiphilium angustum]
Length=313

 Score =   266 bits (681),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 201/330 (61%), Gaps = 17/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G+TG IGR     LV RG  V+   R  + +            L  A +   DV++ S
Sbjct  1     MLGATGTIGRATLRALVSRGDEVVCFVRAGADV----------TPLHSATIRTVDVSDAS  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             +L +     G   D V+SC+ASR G  +D+W ID+ A    L   +  G   FVLLSAIC
Sbjct  51    ALARGGFC-GERFDAVISCMASRTGAPRDAWAIDHRAHLAVLAAAKAAGVGQFVLLSAIC  109

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKPLL FQ AKL FE  L+     + G TYSIVRPTAFFKSL+GQ+  V+ GK +++FG
Sbjct  110   VQKPLLAFQHAKLAFEQALV-----ESGLTYSIVRPTAFFKSLSGQIARVRRGKAFLLFG  164

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG+L ACKPIS+ DLA+++ DC+  E + N+VLPIGGPG A+TP EQGE LF    +  +
Sbjct  165   DGRLTACKPISDGDLATYLVDCLYDEARWNRVLPIGGPGAAITPREQGEFLFARLRQAPR  224

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
             F +VP+ ++D  IG L     V P+L   AE  +IGRYYA ESMLV DP  G YDA+ TP
Sbjct  225   FRQVPVGLLDGIIGVLGTAGLVVPALAAKAELARIGRYYATESMLVLDPATGRYDAQATP  284

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             S G + L +++ +VL  G     LG+  +F
Sbjct  285   STGSERLFDYYDQVL-GGAPVAALGDHAVF  313



>gb|ETD80575.1| epimerase [Rhodobacter capsulatus B6]
Length=321

 Score =   266 bits (681),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 203/333 (61%), Gaps = 18/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +L++G TG IGR  A  L+  G  V A+ R      G++       +L G  +  +DV+
Sbjct  7     RVLLLGGTGTIGRATAAALLAAGHGVWALVRP-----GTDP-----AKLPGCTLIEADVS  56

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                ++ + ++    P   +VSCLASR G   D+W ID  A  ++L    +     FVLLS
Sbjct  57    HPDTVARVLKDH--PCAAIVSCLASRTGLPADAWAIDDRAHAHALEAAMEARVRKFVLLS  114

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP LEFQ+AKL FE  L           +SIVRPTAFFKSL+GQ+  V+ GKP++
Sbjct  115   AICVQKPYLEFQKAKLAFEAQLRGSP-----LEWSIVRPTAFFKSLSGQIPRVQKGKPFL  169

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG++ ACKPIS+ DL  F++ C+   +K+ ++LPIGGPG A+TPL+Q  ML +L GK
Sbjct  170   VFGDGRITACKPISDADLGRFLTSCLNDPEKVRKLLPIGGPGPAITPLDQAAMLERLTGK  229

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               K   V  ++MD  +G L LL KV P L   AE  +IGRYYA+ESML+W+P KG YDA+
Sbjct  230   PVKIKHVTPKLMDVIVGVLSLLGKVSPKLAGKAELARIGRYYASESMLLWNPAKGGYDAD  289

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP +G D  E++   +LR G    + G+  IF
Sbjct  290   ATPEFGTDRFEDYVAAMLR-GEIADDRGDHAIF  321



>ref|WP_023915621.1| epimerase [Rhodobacter capsulatus]
 gb|ETD80859.1| epimerase [Rhodobacter capsulatus YW1]
Length=321

 Score =   266 bits (680),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 145/333 (44%), Positives = 201/333 (60%), Gaps = 18/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +L++G TG IGR  A  L+  G  V A+ R      G++       +L G  +   DV+
Sbjct  7     RVLLLGGTGTIGRATAAALLAEGHGVWALVRP-----GTDP-----AKLPGCTLIEGDVS  56

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                ++ + ++    P   +VSCLASR G   D+W ID  A  ++L    +     FVLLS
Sbjct  57    HPDTVARVLKDH--PCAAIVSCLASRTGLPADAWAIDDRAHAHALEAAMEARVRKFVLLS  114

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP LEFQ+AKL FE  L           +SIVRPTAFFKSL+GQ+  V+ GKP++
Sbjct  115   AICVQKPYLEFQKAKLAFEAQLRGSP-----LEWSIVRPTAFFKSLSGQIPRVQKGKPFL  169

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG++ ACKPIS+ DL  F++ C+   +K+ +VLPIGGPG A+TPL+Q  ML +L G+
Sbjct  170   VFGDGRITACKPISDADLGRFLTSCLSDPEKVRKVLPIGGPGPAITPLDQAAMLERLTGQ  229

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               K   V  ++MD  +G L +L K  P L   AE  +IGRYYA+ESML+W+P KG YDA+
Sbjct  230   PVKIRHVTPKLMDAIVGVLSVLGKFSPKLAGKAELARIGRYYASESMLLWNPVKGCYDAD  289

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP +G D  E++   +LR G    + G+  IF
Sbjct  290   ATPEFGTDRFEDYVAAMLR-GEIADDRGDHAIF  321



>ref|WP_013068957.1| epimerase [Rhodobacter capsulatus]
 ref|YP_003579391.1| NAD-dependent epimerase/dehydratase [Rhodobacter capsulatus SB 
1003]
 gb|ADE86984.1| NAD-dependent epimerase/dehydratase family protein [Rhodobacter 
capsulatus SB 1003]
 gb|ETD00513.1| epimerase [Rhodobacter capsulatus DE442]
 gb|ETD74853.1| epimerase [Rhodobacter capsulatus R121]
 gb|ETE52419.1| epimerase [Rhodobacter capsulatus Y262]
Length=321

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 196/333 (59%), Gaps = 18/333 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +L++G TG IGR  A  L+  G  V A+ R      G++  +     L   +V + D  
Sbjct  7     RVLLLGGTGTIGRATAAALLAEGHGVWALVRP-----GTDPAKLPGCTLIEGDVSYPDTV  61

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                  +        P   +VSCLASR G   D+W ID  A  ++L    +     FVLLS
Sbjct  62    ARVLKDH-------PCAAIVSCLASRTGLPADAWAIDDRAHAHALEAAMEARVRKFVLLS  114

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP LEFQ+AKL FE  L           +SIVRPTAFFKSL+GQ+  V+ GKP++
Sbjct  115   AICVQKPYLEFQKAKLAFEAQLRGSP-----LEWSIVRPTAFFKSLSGQIPRVQKGKPFL  169

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG++ ACKPIS+ DL  F++ C+   +K+ +VLPIGGPG A+TPL+Q  ML +L G+
Sbjct  170   VFGDGRITACKPISDADLGRFLTSCLSDPEKVRKVLPIGGPGPAITPLDQAAMLERLTGQ  229

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               K   V  ++MD  +G L +L K  P L   AE  +IGRYYA+ESML+W+P KG YDA+
Sbjct  230   PVKIRHVTPKLMDAIVGVLSVLGKFSPKLAGKAELARIGRYYASESMLLWNPVKGCYDAD  289

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP +G D  E++   +LR G    + G+  IF
Sbjct  290   ATPEFGTDRFEDYVAAMLR-GEIADDRGDHAIF  321



>ref|WP_037118243.1| epimerase [Rhodobacter capsulatus]
Length=312

 Score =   264 bits (674),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 201/330 (61%), Gaps = 18/330 (5%)
 Frame = +3

Query  417   VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTels  596
             ++G TG IGR  A  L+  G  V A+ R      G++       +L G  +  +DV+   
Sbjct  1     MLGGTGTIGRATAAALLAAGHGVWALVRP-----GTDP-----AKLPGCTLIEADVSHPD  50

Query  597   sleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAIC  776
             ++ + ++    P   +VSCLASR G   D+W ID  A  ++L    +     FVLLSAIC
Sbjct  51    TVARVLKDH--PCAAIVSCLASRTGLPADAWAIDDRAHAHALEAAMEARVRKFVLLSAIC  108

Query  777   VQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFG  956
             VQKP LEFQ+AKL FE  L           +SIVRPTAFFKSL+GQ+  V+ GKP+++FG
Sbjct  109   VQKPYLEFQKAKLAFEAQLRGSP-----LEWSIVRPTAFFKSLSGQIPRVQKGKPFLVFG  163

Query  957   DGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAK  1136
             DG++ ACKPIS+ DL  F++ C+   +K+ ++LPIGGPG A+TPL+Q  ML +L GK  K
Sbjct  164   DGRITACKPISDADLGRFLTSCLNDPEKVRKLLPIGGPGPAITPLDQAAMLERLTGKPVK  223

Query  1137  FIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTP  1316
                V  ++MD  +G L LL KV P L   AE  +IGRYYA+ESML+W+P KG YDA+ TP
Sbjct  224   IKHVTPKLMDVIVGVLSLLGKVSPKLAGKAELARIGRYYASESMLLWNPAKGGYDADATP  283

Query  1317  SYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              +G D  E++   +LR G    + G+  IF
Sbjct  284   EFGTDRFEDYVAAMLR-GEIADDRGDHAIF  312



>ref|WP_036801180.1| epimerase [Porphyrobacter sp. HL-46]
Length=315

 Score =   263 bits (671),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/321 (46%), Positives = 198/321 (62%), Gaps = 14/321 (4%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              I+V G+TG IGR V   LV  G +V A+ R  SG  G++     + +L+GA +    V 
Sbjct  9     RIVVAGATGTIGRAVVRRLVADGHAVTALLRSGSG--GAD-----MTELAGAQIV--RVA  59

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                S   +        DVV+SC+ASR+G  +D+  ID+ A    L   +  GA  F+LLS
Sbjct  60    LSDSAGLARMMADASPDVVISCIASRSGAPRDAEAIDFAANAALLDAAQGAGARQFILLS  119

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKPLL FQ AKLKFE  L        G  Y+IVRPTAFFKSL+GQV  VK GKP++
Sbjct  120   AICVQKPLLAFQHAKLKFEARLAA-----SGIEYAIVRPTAFFKSLSGQVRRVKAGKPFL  174

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG+L  CKPIS++DLA FI  C+ + +   ++LP+GGPG A++  EQG ++F+LAG+
Sbjct  175   IFGDGELTRCKPISDDDLARFIVGCIDNPETSGRILPVGGPGPAISLREQGNLIFELAGR  234

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E +F  V  ++  +A   L L   V     + AE+ +I RYYA ESMLV DPE GEY A+
Sbjct  235   EPRFKSVSPKVFTYAERVLALGAGVSGWFAEKAEYARIARYYATESMLVLDPETGEYSAD  294

Query  1308  NTPSYGKDTLEEFFKRVLREG  1370
              TP YG +TL + +  +L EG
Sbjct  295   LTPEYGSETLRDHYASLLAEG  315



>ref|WP_034952092.1| epimerase [Erythrobacter sp. JL475]
 gb|KEO87947.1| epimerase [Erythrobacter sp. JL475]
Length=322

 Score =   262 bits (669),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 197/315 (63%), Gaps = 16/315 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              +LV G++G IGR V   LV++G +  A+ R         S  D   +L+ A +   D+ 
Sbjct  12    RVLVAGASGTIGRAVVKALVEQGHAAFALLR---------SGADQPAELAEATILHDDLR  62

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             + S L +S+      ID VVSC+ASRNG  KD+  +D+ A  N L    + GA HF+LLS
Sbjct  63    DPSGLGRSLAEH--RIDAVVSCIASRNGAPKDAEAVDFRANLNLLNAAEQSGADHFILLS  120

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQ+PLL FQ AK+ FE  L     D     ++IVRPTAFFKSL+GQ++ V  GKP++
Sbjct  121   AICVQRPLLAFQHAKIAFERALKASRID-----HTIVRPTAFFKSLSGQIDRVLAGKPFL  175

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FG+G+L  CKPIS+ DLA +I DC+   ++    LPIGGPG A+T  +QGE+LF+ AG+
Sbjct  176   IFGNGELTRCKPISDADLARYIVDCLHLPERRGATLPIGGPGPAITLKQQGELLFEAAGR  235

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E +F  VP+ + D A G L L  +      + AE+ +I RYYA +SMLV DP  GEY AE
Sbjct  236   EPRFRTVPVGLFDAAAGVLSLGERYSDWFAEKAEYARIARYYATQSMLVLDPVSGEYSAE  295

Query  1308  NTPSYGKDTLEEFFK  1352
              TP +G+DTL E ++
Sbjct  296   ATPEFGQDTLIEHYR  310



>ref|XP_002288833.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94269.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=472

 Score =   265 bits (676),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 206/335 (61%), Gaps = 21/335 (6%)
 Frame = +3

Query  387   SKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGA-  563
             S N  D   ++ G+TGYIG+    E V++G+  +A+ R++  +     K    Q   GA 
Sbjct  127   SGNKGDKVAVIAGATGYIGKSTVRESVRQGYKTVALVRDKKKVESDEGKMLYGQFFEGAE  186

Query  564   ----NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVG  731
                 +VC ++    +  + S +  G  ID VVSCLASR+G  KD++ IDY+AT N L  G
Sbjct  187   LVECDVCDAEKLTEALKDISDQYNG-KIDAVVSCLASRSGIKKDAYAIDYQATLNCLESG  245

Query  732   RKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAG  911
             R  GA HFVLLSA CV+ P L+FQ+AKLKFE  L  +++     +YSIVRPTAFFKS++G
Sbjct  246   RAVGARHFVLLSAFCVKNPWLQFQQAKLKFESALTAQSD----MSYSIVRPTAFFKSVSG  301

Query  912   QVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPL  1091
             Q+E+++ G P+VMFGDG++  C PISE DLA+++ DC+  + ++N+++ +GGP + LT  
Sbjct  302   QLEVIQSGAPFVMFGDGEVTRCNPISEADLATYLIDCIADKSRLNKIINLGGPDEPLTMK  361

Query  1092  EQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPS--LEDAAEFGKIGRYYAAES  1265
             +QGEML+   GKE  F   P+ + D  I  L  +   F S   E+AAE G+IG+YYA E 
Sbjct  362   KQGEMLYASIGKEPNFFYAPLWLFDVIIDSLQWVADTFNSEKFENAAELGRIGKYYAVED  421

Query  1266  MLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREG  1370
             ML  DPE+          +G  TL+E + ++  EG
Sbjct  422   MLTTDPEE---------KFGTMTLQEHYDKIAVEG  447



>gb|EWM24553.1| NAD(P)-binding domain protein [Nannochloropsis gaditana]
Length=390

 Score =   261 bits (666),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 201/329 (61%), Gaps = 21/329 (6%)
 Frame = +3

Query  390   KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANV  569
             K PS + + V G+TGYIG+ V  E V+RG+   A  RE S  R       +L  L GA V
Sbjct  65    KPPSQLTVAVAGATGYIGKAVVRECVRRGYKTKAYVREESIERAK-----SLDYLKGAEV  119

Query  570   CFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSL--VVGRKFG  743
                 + + + +E  +     P+DVV+SC+ASR+G   D+WK+D++A  + L   +     
Sbjct  120   IGGSLDDSAEVEAKLFQE--PVDVVISCIASRSGAPADAWKVDHQANVHLLDASLHAPTP  177

Query  744   AAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVEL  923
             A HFV+LSA CV+KP L FQ AKLKFE  L  + ++    T +I+RPTAFFKS++GQ+E+
Sbjct  178   AQHFVMLSAFCVRKPELVFQHAKLKFENYLRGKQDE---ITSTIIRPTAFFKSVSGQLEI  234

Query  924   VKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGE  1103
             V+ G PYVMFGDG++C C PISE DLA +I   +  +   +QVL +GGP + LTP  Q E
Sbjct  235   VQKGYPYVMFGDGEICKCNPISEADLAEYIVKSIDDQSMHHQVLDVGGPDEGLTPKRQAE  294

Query  1104  MLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDP  1283
             +LF++ GKE +FI VPI + D  IG +D   + F   +DAAE  +IG+YYA E ML    
Sbjct  295   ILFEVVGKEPRFIAVPIGLFDAIIGTIDFFAQFFDGAKDAAELARIGKYYAVEDMLATG-  353

Query  1284  EKGEYDAENTPSYGKDTLEEFFKRVLREG  1370
              +GE        YG+ TL E F R+ +EG
Sbjct  354   -RGE-------QYGQITLREHFARIAKEG  374



>gb|EJK64133.1| hypothetical protein THAOC_15156, partial [Thalassiosira oceanica]
Length=472

 Score =   263 bits (672),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 210/340 (62%), Gaps = 21/340 (6%)
 Frame = +3

Query  372   NVSFRSKNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQ  551
             N +  S+N SD   +V G+TGYIG+    E V++G+  IA+ R+R  +     K      
Sbjct  83    NGASESQN-SDKIAVVAGATGYIGKSTVRESVRQGYKTIALVRDRKKVESEEGKMLYGTF  141

Query  552   LSGA-----NVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKN  716
               GA     +VC +D    +  E S +S    ID V+SCLASR+G  KD++ IDY+AT N
Sbjct  142   FEGAEIFECDVCDADKLTEAFREISSKSSSGKIDAVISCLASRSGIKKDAYAIDYQATLN  201

Query  717   SLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFF  896
              L  GR   A HFVLLSA CV+ P L+FQ+AKLKFE  L  EA++D   T+SIVRPTAFF
Sbjct  202   CLESGRAVDARHFVLLSAFCVKNPWLQFQQAKLKFEAAL--EAQND--MTWSIVRPTAFF  257

Query  897   KSLAGQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGK  1076
             KS++GQ+E+++ G P+VMFGDG++  C PISE DLA+++ DC+  + + N+++ +GGP +
Sbjct  258   KSVSGQLEVIQQGAPFVMFGDGEVTRCNPISEADLATYLIDCIADKSRSNKIINLGGPDE  317

Query  1077  ALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPS--LEDAAEFGKIGRY  1250
              LT  +QGEML+K  GKE  F   P+ + D  I  L  +   F S   E+AAE G+IG+Y
Sbjct  318   PLTMKKQGEMLYKAVGKEPNFFYAPLWLFDTIIDSLQWVSDTFNSEKFENAAELGRIGKY  377

Query  1251  YAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREG  1370
             YA E ML  DP++          +G  TL+E + ++  EG
Sbjct  378   YAVEDMLTTDPDE---------KFGTMTLQEHYDKIAVEG  408



>ref|WP_037272836.1| epimerase [Roseovarius mucosus]
 gb|KGM88325.1| divinylchlorophyllide 8-vinylreductase [Roseovarius mucosus DSM 
17069]
Length=325

 Score =   258 bits (658),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/338 (43%), Positives = 200/338 (59%), Gaps = 27/338 (8%)
 Frame = +3

Query  405   INILVVGSTGYIGRFVATELVKRGFSVIAIAR---ERSGI-RGSNSKEDTLQQLSGANVC  572
             + +LV+G+TG IGR     L  RG  V+   R   E +G+  G   +   + Q +     
Sbjct  11    VRVLVLGATGTIGRATVAALCARGHEVVCYLRPEAEAAGLPEGVTLRRGEMAQFA-----  65

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
                              G   D ++SC+ASR+G   D+W +D++A   +L   +  G  H
Sbjct  66    ------------PEALRGERFDALLSCMASRSGLPADAWAVDHDAHLLALEAAQAAGVGH  113

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
              VLLSAICVQKP+L FQ AKL FE  L+       G  YSIVRPTA+FKSL+GQ+  V+ 
Sbjct  114   MVLLSAICVQKPMLAFQAAKLAFEARLIAS-----GLRYSIVRPTAYFKSLSGQIARVQA  168

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GKP+++FGDG+L ACKPIS+ DL ++++ C+ + D+ N VLPIGGPG A+TP +Q E LF
Sbjct  169   GKPFLVFGDGRLTACKPISDRDLGAYLAGCLEAPDRWNWVLPIGGPGPAITPRDQAEWLF  228

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             K  GK     +VP+ +MD  IG L L  ++ P L   AE  +IGRYYA ESMLVWD   G
Sbjct  229   KRLGKPVSLRQVPVGMMDAIIGGLSLGGRILPGLRAKAELARIGRYYATESMLVWDAAAG  288

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              YDAE TP  G+D L ++++ V+  G A  +LG   +F
Sbjct  289   AYDAEATPETGQDRLFDYYEEVI-TGKARVDLGAHAVF  325



>ref|WP_037969244.1| hypothetical protein [Sulfitobacter sp. NB-77]
Length=304

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 189/328 (58%), Gaps = 26/328 (8%)
 Frame = +3

Query  423   GSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssl  602
             G+TG  G      L   G++V A+ R    I G             A++   D++     
Sbjct  3     GATGTAGHATTLTLRDAGYNVTALGRTDPKIDGV--------AFQAADIHAPDLS-----  49

Query  603   eksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQ  782
                     +  DVV+SCLASR G   D+W++D++A    L   +  G  HFVLLSAICVQ
Sbjct  50    -------ALKSDVVISCLASRTGAPADAWQVDHDANLRVLEAAKSAGTGHFVLLSAICVQ  102

Query  783   KPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDG  962
             KP L FQ AKL FE  L +      G TYSIVRPTA+FKSL+GQ++ ++  KPY+MFG G
Sbjct  103   KPRLAFQYAKLAFEDTLKRS-----GLTYSIVRPTAYFKSLSGQLDRLRAAKPYLMFGGG  157

Query  963   KLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFI  1142
              L ACKPIS+ DL SFI+  +    + N VLPIGGPG ALTPL+ G  LF++   E K+ 
Sbjct  158   TLTACKPISDGDLGSFITSTLTDTKRQNAVLPIGGPGPALTPLDMGAALFEVLQIEPKYR  217

Query  1143  KVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSY  1322
              V   I+      L L  KV P+L+  A+  +IG YYA ESML+WD +  +YDA+ TP +
Sbjct  218   SVSPHIIAGIAQGLSLAGKVIPTLQAKADLARIGHYYATESMLLWDEKAQQYDADATPEF  277

Query  1323  GKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             G +TL +F+++ L  G A  E G+  +F
Sbjct  278   GSETLFDFYRK-LASGEAHIERGDHAVF  304



>gb|EEC75257.1| hypothetical protein OsI_11570 [Oryza sativa Indica Group]
Length=153

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             MFGDGKLCACKPISEEDLA+FI+DC+  E K N++LPIGGPGKALTPLEQGEMLF+L G+
Sbjct  1     MFGDGKLCACKPISEEDLAAFIADCISDEGKANKILPIGGPGKALTPLEQGEMLFRLLGR  60

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E +FIKVPIQ+MD AI  LD L KVFP +EDAAEFGKIGRYYA+ESMLV DP+ GEY  E
Sbjct  61    EPRFIKVPIQVMDAAIWVLDALAKVFPGVEDAAEFGKIGRYYASESMLVLDPDTGEYSDE  120

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TPSYG DTLE+FF+RV+REGMAGQELGEQ IF
Sbjct  121   MTPSYGSDTLEQFFERVIREGMAGQELGEQTIF  153



>ref|WP_007165227.1| epimerase [Erythrobacter sp. NAP1]
 gb|EAQ28021.1| hypothetical protein NAP1_10518 [Erythrobacter sp. NAP1]
Length=308

 Score =   254 bits (649),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 197/322 (61%), Gaps = 15/322 (5%)
 Frame = +3

Query  405   INILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDV  584
             + + V G++G IG  V  E + RG++V A+ R  +         + L +L GA     D+
Sbjct  1     MRVAVAGASGTIGLAVVRECMARGYAVTALVRTEAA--------EKLPELEGAETRVVDL  52

Query  585   TelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLL  764
             ++ +++  ++     P  V+ SC+ASR+G  KD+  +D +A  N L       A HF+LL
Sbjct  53    SDPAAVVLALGEAK-PASVI-SCIASRSGSPKDAKAVDLDANLNLLAAAGACDAEHFILL  110

Query  765   SAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPY  944
             SAICVQ+P L FQRAKL FE  L K         ++I+RPTAFFKSL+GQV  V+DGKP+
Sbjct  111   SAICVQRPRLAFQRAKLAFEAALAK-----ADIAHTIIRPTAFFKSLSGQVARVRDGKPF  165

Query  945   VMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAG  1124
             ++FGDGKL  CKPIS+ DLA FI D V + ++  +VLPIGGPG A++  EQGEMLF+LAG
Sbjct  166   LLFGDGKLTRCKPISDADLARFIVDSVGNAERYGKVLPIGGPGPAISLREQGEMLFELAG  225

Query  1125  KEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDA  1304
             K  +F  +  ++   A   L L         + AE+ +I  YYA +SMLV D E GEYDA
Sbjct  226   KPPRFRSISPRLFMAASRVLSLGAPFSKWFAEKAEYARIAHYYATQSMLVLDEETGEYDA  285

Query  1305  ENTPSYGKDTLEEFFKRVLREG  1370
             + TP YG+DTL + ++ +L  G
Sbjct  286   DATPEYGEDTLRDHYRAMLATG  307



>gb|KIN64281.1| 3,8-divinyl protochlorophyllide a 8-vinyl reductase [Sulfitobacter 
sp. NB-77]
Length=269

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 167/257 (65%), Gaps = 6/257 (2%)
 Frame = +3

Query  636   DVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKL  815
             DVV+SCLASR G   D+W++D++A    L   +  G  HFVLLSAICVQKP L FQ AKL
Sbjct  19    DVVISCLASRTGAPADAWQVDHDANLRVLEAAKSAGTGHFVLLSAICVQKPRLAFQYAKL  78

Query  816   KFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEE  995
              FE  L +      G TYSIVRPTA+FKSL+GQ++ ++  KPY+MFG G L ACKPIS+ 
Sbjct  79    AFEDTLKRS-----GLTYSIVRPTAYFKSLSGQLDRLRAAKPYLMFGGGTLTACKPISDG  133

Query  996   DLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAI  1175
             DL SFI+  +    + N VLPIGGPG ALTPL+ G  LF++   E K+  V   I+    
Sbjct  134   DLGSFITSTLTDTKRQNAVLPIGGPGPALTPLDMGAALFEVLQIEPKYRSVSPHIIAGIA  193

Query  1176  GFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKR  1355
               L L  KV P+L+  A+  +IG YYA ESML+WD +  +YDA+ TP +G +TL +F+++
Sbjct  194   QGLSLAGKVIPTLQAKADLARIGHYYATESMLLWDEKAQQYDADATPEFGSETLFDFYRK  253

Query  1356  VLREGMAGQELGEQMIF  1406
              L  G A  E G+  +F
Sbjct  254   -LASGEAHIERGDHAVF  269



>ref|WP_017666291.1| hypothetical protein [Porphyrobacter sp. AAP82]
Length=298

 Score =   252 bits (644),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 164/245 (67%), Gaps = 5/245 (2%)
 Frame = +3

Query  633   IDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAK  812
             IDVV+SC+ASR+G   D+  +DY A    L   R+ G A F+LLSAICVQKPLL FQ AK
Sbjct  58    IDVVISCIASRSGAPGDALAVDYGANATLLAAAREAGVAQFILLSAICVQKPLLAFQHAK  117

Query  813   LKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISE  992
             L+FE +L        G  Y+I+RPTAFFKSL+GQV+ VK GKP+++FGDG L  CKPIS+
Sbjct  118   LRFEAELQA-----SGIGYTIIRPTAFFKSLSGQVKRVKAGKPFLIFGDGNLTRCKPISD  172

Query  993   EDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFA  1172
             +DLA FI+ C+ +   + +V PIGGPG AL+  + GE+LF  AG+E +F  V   +  +A
Sbjct  173   DDLACFIASCIGNPGALGKVFPIGGPGPALSLRDAGELLFAAAGREPRFRSVSPAMFTWA  232

Query  1173  IGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFK  1352
                L L     P   + AE+ +I RYYA ESMLV DP  GEY A+ TP YG++TL + ++
Sbjct  233   EKVLALGAPFSPWFAEKAEYARIARYYATESMLVLDPASGEYSADLTPEYGRETLADHYR  292

Query  1353  RVLRE  1367
             R+L E
Sbjct  293   RLLAE  297



>gb|KEO90062.1| epimerase [Erythrobacter longus]
Length=318

 Score =   249 bits (637),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 193/318 (61%), Gaps = 15/318 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
             +I V G++G IGR V  E V RG+ V A+ R  +  +        L +L GA V   DV+
Sbjct  12    SIAVAGASGTIGRAVVRECVSRGYDVTALVRSEAAAQ--------LPELEGAQVTTVDVS  63

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +  +L +  +   VP D V+SC+ASR+G  KD+  ID +A  N L+  +     HF+LLS
Sbjct  64    DPDALARVFKE-AVP-DTVISCIASRSGSPKDAKAIDLDANLNLLLGAQAARTQHFILLS  121

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQ+P L FQRAKL FE  L      D    ++IVRPTAFFKSL+GQVE V++GKP+ 
Sbjct  122   AICVQRPRLAFQRAKLAFEAALT-----DAPIEHTIVRPTAFFKSLSGQVERVREGKPFF  176

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG+L ACKPIS+ DLA FI             LPIGGPG A+T   QGE+LF+ AG+
Sbjct  177   LFGDGELTACKPISDADLARFIVAQADDPKAYGATLPIGGPGPAITLKRQGEILFEAAGR  236

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
             E +F +VP+ +     G   L       L + AE+ +I  YYA +SMLVWD E+  YDA+
Sbjct  237   EPRFRRVPVGLFSLFGGVFSLGAWASDWLAEKAEYARIAEYYATQSMLVWDDERRAYDAD  296

Query  1308  NTPSYGKDTLEEFFKRVL  1361
              TP +G DTL + + R+L
Sbjct  297   ATPEFGSDTLADHYARLL  314



>ref|XP_002184654.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43713.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=391

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 198/326 (61%), Gaps = 24/326 (7%)
 Frame = +3

Query  414   LVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTel  593
             ++ G+TGYIG+    E +++G+   A+ R+ + I      E     + GA++   DV + 
Sbjct  47    IIAGATGYIGKSTVRESLRQGYDTFALVRDATKIDAKTKAE----YMDGAHIIECDVCDE  102

Query  594   ssleksveslG--VP---IDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFV  758
             + L+     +    P   +  VVSCLASR+G  KD+++IDY+AT N L  GR  GA HFV
Sbjct  103   AQLQTVFREIADRTPDRKVQAVVSCLASRSGVKKDAYRIDYQATLNCLNAGRAVGARHFV  162

Query  759   LLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGK  938
             LLSA CV+ P L+FQ+AKLKFE  L ++++     T++IVRPTAFFKS++GQ+E+V+ G 
Sbjct  163   LLSAFCVKNPWLQFQQAKLKFEAALQEQSD----MTWTIVRPTAFFKSVSGQLEVVQGGA  218

Query  939   PYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             P+VMFGDG++  C PI+E +LA ++ D V    + N V  +GGP + LT  +QGEM+F+ 
Sbjct  219   PFVMFGDGQVTRCNPIAEAELAQYLMDSVTDPTRRNLVRNLGGPDEPLTMRKQGEMMFRA  278

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPS--LEDAAEFGKIGRYYAAESMLVWDPEKG  1292
               KE  +   P+ I D  I  L  L  V  S  LEDAAE G+IG+YYA E ML  DPE+ 
Sbjct  279   VDKEPNYFYAPLWIFDVIINGLQFLADVTRSEQLEDAAETGRIGKYYAVEDMLTTDPEE-  337

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREG  1370
                      YG  TL+E + R+  EG
Sbjct  338   --------KYGTVTLQEHYNRIAVEG  355



>gb|AII88479.1| hypothetical protein, NmrA-like protein [Planktomarina temperata 
RCA23]
Length=319

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/328 (41%), Positives = 193/328 (59%), Gaps = 24/328 (7%)
 Frame = +3

Query  393   NPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVC  572
             NP+  ++L+ G+TG  G+ V   L + G+ V  +      +R   +     Q L      
Sbjct  7     NPTA-SVLLFGATGTAGQGVCRALHRAGYVVTCV------LRAGQTPPQPAQPL------  53

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             ++D+T+               D V+SC+ASRNGG +D+W ID+ A  N L V ++     
Sbjct  54    YADITQPMPHILGQ------FDAVISCVASRNGGREDAWAIDHAAQMNILDVAQRLAVPQ  107

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             F+LLSAICVQKP L FQ AKL FE  L+       G TYSIVRPTAFFKSL+GQ+  ++ 
Sbjct  108   FILLSAICVQKPKLPFQFAKLAFEKALIAS-----GLTYSIVRPTAFFKSLSGQIPRLRA  162

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             GK +++FG+G+L ACKPIS++DL +F+ DC+ +  K N++LPIGGPG A+TP +Q + LF
Sbjct  163   GKAFLVFGNGELTACKPISDDDLGNFMVDCIANPTKHNKILPIGGPGPAITPRDQAQALF  222

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
              L G+  K  +VP+ ++    G L L   + P+    A+  +IG YYA ESML+W   + 
Sbjct  223   GLLGRPVKLRRVPVALLRIICGGLRLAGALIPAARRKADLAEIGLYYATESMLIWQGAQR  282

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREGMA  1376
              Y AE T S G + L + +  ++R G A
Sbjct  283   GYSAELTSSTGTEHLFDHYAEIMRSGAA  310



>ref|WP_040811554.1| epimerase [marine gamma proteobacterium HTCC2080]
Length=323

 Score =   249 bits (635),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 195/334 (58%), Gaps = 21/334 (6%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSK-EDTLQQLSGANVCFSDV  584
              +LV G++GYIGR V   L+ R + V+A  R  +    ++ K E    +L+ +     D+
Sbjct  10    RVLVAGASGYIGRHVVEALLHRNYRVVAQLRAGAQWSLTHPKLECVYGELTESEQFLLDI  69

Query  585   TelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLL  764
                            P   V+SCLASR+GGV+D+  ++Y+A    L V  ++G   F+LL
Sbjct  70    E--------------PCHFVISCLASRSGGVRDARLVEYDANSRLLAVALQWGVQRFLLL  115

Query  765   SAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPY  944
             SAICVQKP L FQ+ KL+FE  L      +    ++I+RPTAFFKSL+GQ+  ++ GKP+
Sbjct  116   SAICVQKPRLVFQKEKLRFEAKL-----RESNLPWTIIRPTAFFKSLSGQIMRLQQGKPF  170

Query  945   VMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAG  1124
              +FG G L ACKPI+EEDLA+FI++ + S   I+ +LPIGGPG A+TPL Q ++L ++  
Sbjct  171   FVFGSGTLTACKPIAEEDLATFIAEQLTSSSAIDAILPIGGPGPAITPLGQAQLLSQVLQ  230

Query  1125  KEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDA  1304
             +  K   +P ++   A   L L   +F    D AEF +I  +YA ESMLVW  E G Y  
Sbjct  231   QPVKTRSLPPRLFLIAAAVLSLFGLLFSRARDQAEFLRIAHFYATESMLVWSDEAGAYSE  290

Query  1305  ENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               TP  G  TL E ++ +++ G+   ELGE  +F
Sbjct  291   ALTPESGSKTLSECYQEIIKGGVVS-ELGEHKLF  323



>gb|EAW41560.1| hypothetical protein MGP2080_02665 [marine gamma proteobacterium 
HTCC2080]
Length=317

 Score =   248 bits (634),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 195/334 (58%), Gaps = 21/334 (6%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSK-EDTLQQLSGANVCFSDV  584
              +LV G++GYIGR V   L+ R + V+A  R  +    ++ K E    +L+ +     D+
Sbjct  4     RVLVAGASGYIGRHVVEALLHRNYRVVAQLRAGAQWSLTHPKLECVYGELTESEQFLLDI  63

Query  585   TelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLL  764
                            P   V+SCLASR+GGV+D+  ++Y+A    L V  ++G   F+LL
Sbjct  64    E--------------PCHFVISCLASRSGGVRDARLVEYDANSRLLAVALQWGVQRFLLL  109

Query  765   SAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPY  944
             SAICVQKP L FQ+ KL+FE  L      +    ++I+RPTAFFKSL+GQ+  ++ GKP+
Sbjct  110   SAICVQKPRLVFQKEKLRFEAKL-----RESNLPWTIIRPTAFFKSLSGQIMRLQQGKPF  164

Query  945   VMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAG  1124
              +FG G L ACKPI+EEDLA+FI++ + S   I+ +LPIGGPG A+TPL Q ++L ++  
Sbjct  165   FVFGSGTLTACKPIAEEDLATFIAEQLTSSSAIDAILPIGGPGPAITPLGQAQLLSQVLQ  224

Query  1125  KEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDA  1304
             +  K   +P ++   A   L L   +F    D AEF +I  +YA ESMLVW  E G Y  
Sbjct  225   QPVKTRSLPPRLFLIAAAVLSLFGLLFSRARDQAEFLRIAHFYATESMLVWSDEAGAYSE  284

Query  1305  ENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
               TP  G  TL E ++ +++ G+   ELGE  +F
Sbjct  285   ALTPESGSKTLSECYQEIIKGGVVS-ELGEHKLF  317



>ref|WP_025064323.1| epimerase [Sulfitobacter guttiformis]
Length=309

 Score =   248 bits (632),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 165/257 (64%), Gaps = 6/257 (2%)
 Frame = +3

Query  636   DVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKL  815
             D VVSC+ASR+G   D+  +DY+A    L   +  G   F+LLSAICVQKP LEFQ AKL
Sbjct  59    DAVVSCIASRSGTRNDAQAVDYDANIALLRAAQTAGVPQFILLSAICVQKPRLEFQHAKL  118

Query  816   KFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEE  995
              FE  L        G  YSIVRPTAFFKSL+GQ++ V+ GK +++FGDG L ACKPIS+ 
Sbjct  119   AFEAKLRAS-----GMIYSIVRPTAFFKSLSGQLDRVRAGKAFLVFGDGLLTACKPISDR  173

Query  996   DLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAI  1175
             DL  FI+ C+    + N++LPIGGPG A+TP++Q E LF L  +  K  +VP+ +M    
Sbjct  174   DLGVFIAGCLDDPARENRILPIGGPGPAITPMDQAEALFALLDRPLKVTRVPVALMTGVR  233

Query  1176  GFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKR  1355
               L L   V P++ D AE   IGRYYA ESMLVWD ++G YDA+ TP  G DTL +F+  
Sbjct  234   SLLRLAGVVSPAMADKAELAGIGRYYATESMLVWDAKRGIYDADATPETGTDTLFDFYAT  293

Query  1356  VLREGMAGQELGEQMIF  1406
             ++ +  +   LG+  +F
Sbjct  294   LIAQDRS-VALGDHSVF  309



>gb|AAM48668.1| conserved hypothetical protein [uncultured marine proteobacterium]
Length=319

 Score =   248 bits (633),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/323 (41%), Positives = 190/323 (59%), Gaps = 23/323 (7%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
             ++L+ G+TG  G+ V   L + G+ V  +      +R   +     Q L      ++D+T
Sbjct  11    SVLLFGATGTAGQGVCRALHRAGYVVTCV------LRAGQTPPQPAQPL------YADIT  58

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
             +               D V+SC+ASRNGG +D+W ID+ A  N L V ++     F+LLS
Sbjct  59    QPMPHILGQ------FDAVISCVASRNGGHEDAWAIDHAAQMNILDVAQRLAVPQFILLS  112

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ AKL FE  L+       G TYSIVRPTAFFKSL+GQ+  ++ GK ++
Sbjct  113   AICVQKPKLPFQFAKLAFEKALIAS-----GLTYSIVRPTAFFKSLSGQIPRLRAGKAFL  167

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FG+G+L ACKPIS++DL +F+ DC+ +  K N++LPIGGPG A+TP +Q + LF L G+
Sbjct  168   VFGNGELTACKPISDDDLGNFMVDCIANPAKHNKILPIGGPGPAITPRDQAQALFGLLGR  227

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               K  +VP+ ++    G L L   + P+    A+  +IG YYA ESML+W   +  Y AE
Sbjct  228   PVKLRRVPVALLRIICGGLRLAGALIPAARRKADLAEIGLYYATESMLIWQGAQRGYSAE  287

Query  1308  NTPSYGKDTLEEFFKRVLREGMA  1376
              T S G + L + +  ++R G A
Sbjct  288   LTSSTGTEHLFDHYAEIMRSGAA  310



>gb|KIN74828.1| putative nucleoside-diphosphate sugar epimerase [Sulfitobacter 
guttiformis KCTC 32187]
Length=346

 Score =   249 bits (635),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 188/333 (56%), Gaps = 21/333 (6%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              I + G+TG  GR     L   G  V+  AR  + +              GA V   D+ 
Sbjct  35    RIFMTGATGTAGRATLAALRAAGHEVVCFARSPADL--------------GAEVRIGDL-  79

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                +        G   D VVSC+ASR+G   D+  +DY+A    L   +  G   F+LLS
Sbjct  80    RSEASVAQDGLRGEHFDAVVSCIASRSGTRNDAQAVDYDANIALLRAAQTAGVPQFILLS  139

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP LEFQ AKL FE  L        G  YSIVRPTAFFKSL+GQ++ V+ GK ++
Sbjct  140   AICVQKPRLEFQHAKLAFEAKLRAS-----GMIYSIVRPTAFFKSLSGQLDRVRAGKAFL  194

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS+ DL  FI+ C+    + N++LPIGGPG A+TP++Q E LF L  +
Sbjct  195   VFGDGLLTACKPISDRDLGVFIAGCLDDPARENRILPIGGPGPAITPMDQAEALFALLDR  254

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAE  1307
               K  +VP+ +M      L L   V P++ D AE   IGRYYA ESMLVWD ++G YDA+
Sbjct  255   PLKVTRVPVALMTGVRSLLRLAGVVSPAMADKAELAGIGRYYATESMLVWDAKRGIYDAD  314

Query  1308  NTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
              TP  G DTL +F+  ++ +  +   LG+  +F
Sbjct  315   ATPETGTDTLFDFYATLIAQDRS-VALGDHSVF  346



>ref|WP_034960028.1| epimerase [Erythrobacter longus]
Length=306

 Score =   247 bits (631),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 192/317 (61%), Gaps = 15/317 (5%)
 Frame = +3

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTe  590
             + V G++G IGR V  E V RG+ V A+ R  +  +        L +L GA V   DV++
Sbjct  1     MAVAGASGTIGRAVVRECVSRGYDVTALVRSEAAAQ--------LPELEGAQVTTVDVSD  52

Query  591   lssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSA  770
               +L +  +   VP D V+SC+ASR+G  KD+  ID +A  N L+  +     HF+LLSA
Sbjct  53    PDALARVFKE-AVP-DTVISCIASRSGSPKDAKAIDLDANLNLLLGAQAARTQHFILLSA  110

Query  771   ICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVM  950
             ICVQ+P L FQRAKL FE  L      D    ++IVRPTAFFKSL+GQVE V++GKP+ +
Sbjct  111   ICVQRPRLAFQRAKLAFEAALT-----DAPIEHTIVRPTAFFKSLSGQVERVREGKPFFL  165

Query  951   FGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKE  1130
             FGDG+L ACKPIS+ DLA FI             LPIGGPG A+T   QGE+LF+ AG+E
Sbjct  166   FGDGELTACKPISDADLARFIVAQADDPKAYGATLPIGGPGPAITLKRQGEILFEAAGRE  225

Query  1131  AKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAEN  1310
              +F +VP+ +     G   L       L + AE+ +I  YYA +SMLVWD E+  YDA+ 
Sbjct  226   PRFRRVPVGLFSLFGGVFSLGAWASDWLAEKAEYARIAEYYATQSMLVWDDERRAYDADA  285

Query  1311  TPSYGKDTLEEFFKRVL  1361
             TP +G DTL + + R+L
Sbjct  286   TPEFGSDTLADHYARLL  302



>gb|EDM32385.1| hypothetical protein RTM1035_13053 [Roseovarius sp. TM1035]
Length=325

 Score =   244 bits (624),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 170/261 (65%), Gaps = 6/261 (2%)
 Frame = +3

Query  624   GVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQ  803
             G     +VSC+ASR+G   D+W +D++A   +L   +  G  H VLLSAICVQKP+L FQ
Sbjct  71    GAKFKALVSCMASRSGLPADAWAVDHDAHLVALEAAQAAGVQHMVLLSAICVQKPMLAFQ  130

Query  804   RAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKP  983
              AKL FE  L+       G  YSIVRPTA+FKSL+GQ+  V+ GKP+++FGDG+L ACKP
Sbjct  131   AAKLAFEARLIAS-----GLRYSIVRPTAYFKSLSGQIARVQAGKPFLVFGDGQLTACKP  185

Query  984   ISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIM  1163
             IS+ DL  +++ C+   D+ N+VLPIGGPG A+TP +Q + LFK  GK     +VP+ +M
Sbjct  186   ISDRDLGDYLAGCLDVPDRWNKVLPIGGPGPAITPRDQADWLFKRLGKPVSLRQVPVGMM  245

Query  1164  DFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEE  1343
             D  IG L L  +V P L   AE  +IGRYYA ESMLVWD     YDA+ TP  G+D L +
Sbjct  246   DAIIGGLSLGGRVLPRLRAKAELARIGRYYATESMLVWDAAAEAYDADATPETGQDRLFD  305

Query  1344  FFKRVLREGMAGQELGEQMIF  1406
             +++ V+  G A  +LG   +F
Sbjct  306   YYEEVI-SGRARVDLGAHAVF  325



>ref|WP_037297544.1| epimerase [Roseovarius sp. TM1035]
Length=311

 Score =   244 bits (623),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 170/261 (65%), Gaps = 6/261 (2%)
 Frame = +3

Query  624   GVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQ  803
             G     +VSC+ASR+G   D+W +D++A   +L   +  G  H VLLSAICVQKP+L FQ
Sbjct  57    GAKFKALVSCMASRSGLPADAWAVDHDAHLVALEAAQAAGVQHMVLLSAICVQKPMLAFQ  116

Query  804   RAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKP  983
              AKL FE  L+       G  YSIVRPTA+FKSL+GQ+  V+ GKP+++FGDG+L ACKP
Sbjct  117   AAKLAFEARLIAS-----GLRYSIVRPTAYFKSLSGQIARVQAGKPFLVFGDGQLTACKP  171

Query  984   ISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIM  1163
             IS+ DL  +++ C+   D+ N+VLPIGGPG A+TP +Q + LFK  GK     +VP+ +M
Sbjct  172   ISDRDLGDYLAGCLDVPDRWNKVLPIGGPGPAITPRDQADWLFKRLGKPVSLRQVPVGMM  231

Query  1164  DFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEE  1343
             D  IG L L  +V P L   AE  +IGRYYA ESMLVWD     YDA+ TP  G+D L +
Sbjct  232   DAIIGGLSLGGRVLPRLRAKAELARIGRYYATESMLVWDAAAEAYDADATPETGQDRLFD  291

Query  1344  FFKRVLREGMAGQELGEQMIF  1406
             +++ V+  G A  +LG   +F
Sbjct  292   YYEEVI-SGRARVDLGAHAVF  311



>ref|XP_002294048.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88403.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=313

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 195/326 (60%), Gaps = 27/326 (8%)
 Frame = +3

Query  414   LVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTel  593
             ++ G+TGYIGR V  E V RG+  +++ R  +    S   +D L    G+ +   DVT  
Sbjct  1     IIAGATGYIGRAVVRECVARGYHTVSLVRNTT----SAQLDDVL---FGSALVECDVTND  53

Query  594   ssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRK--FGAAHFVLLS  767
               +   +ES   P+D++VSCLAS +G   + + IDY AT + L  GR     A HFVLLS
Sbjct  54    DEMRSVLESEAPPVDLLVSCLASPSGIESEVYSIDYSATLSFLNAGRSNSVNARHFVLLS  113

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             A CV+ PLL+ Q+AKL+FE  L ++ +     TYSIVRPTAFFKS++GQ+E + DG  YV
Sbjct  114   AFCVRNPLLKLQQAKLEFEAKLQEQTD----MTYSIVRPTAFFKSVSGQLESIMDGNSYV  169

Query  948   MFGDGKLCACKPISEEDLASFISDCVL---SEDKINQVLPIGGPGKALTPLEQGEMLFKL  1118
             +FGDG +  C PI+E DLA+++ DC L    E +  +VL IGGP + L+     EM+FK 
Sbjct  170   LFGDGNVTQCNPIAEGDLAAYMCDCALESFEESRWGKVLNIGGPDEPLSNRALAEMMFKA  229

Query  1119  AGKEAKFIKVPIQIMDFAIGFLDLLVKVFPS--LEDAAEFGKIGRYYAAESMLVWDPEKG  1292
               K+ KF+ VP QI D++I  ++ + K+FPS   EDA E  KIG+YYA E ML       
Sbjct  230   INKQPKFVYVPTQIFDYSISMIETIAKIFPSQKWEDALETAKIGKYYAVEDMLT------  283

Query  1293  EYDAENTPSYGKDTLEEFFKRVLREG  1370
                 E    +G  ++ + F+++ REG
Sbjct  284   ---TEANEKFGNVSMMDHFEKIAREG  306



>ref|WP_034906302.1| epimerase [Erythrobacter litoralis]
 gb|KEO89999.1| epimerase [Erythrobacter litoralis]
Length=318

 Score =   241 bits (614),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 188/322 (58%), Gaps = 15/322 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQL--SGANVCFSD  581
              +LV G++G IGR  A  L + G  V  +      +R S S  ++   L   G  V F+D
Sbjct  8     RVLVAGASGTIGRAAARALKEAGHDVTCV------LRDSASGRESAAALVGEGCAVHFAD  61

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
             +T+ ++L             V+SC+ASR+G   D+ ++DY A    L      GA HF+L
Sbjct  62    LTDSAALAAVFAE--AEPQAVMSCIASRSGSPSDARRVDYAANLALLEAAEHAGADHFIL  119

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQ+P L FQ  KL+FE  L      D    ++IVRPTAFFKSL+GQV+ V++GKP
Sbjct  120   LSAICVQRPKLAFQHEKLRFEARLT-----DSPLAHTIVRPTAFFKSLSGQVKRVREGKP  174

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             +++FGDG+L  CKPIS+ DL  +++ CV    K + +LPIGGPG A++  +QG ML +LA
Sbjct  175   FLIFGDGELTRCKPISDADLGRYLTLCVTDPAKRDAILPIGGPGPAISLRQQGTMLCELA  234

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
             G+E  F  VP  +   A   L L         + +E+ +I  YYA ESML+ DP  GEY 
Sbjct  235   GREPAFKSVPPGMFTLASRVLGLAAPFSEWFAEKSEYARIAHYYATESMLLLDPATGEYS  294

Query  1302  AENTPSYGKDTLEEFFKRVLRE  1367
             AE TP +G DTL   ++R+L E
Sbjct  295   AEATPEFGTDTLRTHYERLLSE  316



>ref|WP_036180499.1| epimerase [Maribius sp. MOLA 401]
Length=314

 Score =   239 bits (610),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/282 (45%), Positives = 168/282 (60%), Gaps = 8/282 (3%)
 Frame = +3

Query  561   ANVCFSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKF  740
             A V  +DVT    L +++   G   D VVSCL SR G  +D+W +D++A +++L      
Sbjct  41    AEVRLADVTRPGGLAEAMGRDGA--DAVVSCLGSRTGLPQDAWAVDFDANRHALDWAEAA  98

Query  741   GAAHFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVE  920
             GAA  V LSAICVQKP L FQ AK+  E  L           + I+RPTAFFKSL+GQ+ 
Sbjct  99    GAARMVYLSAICVQKPRLVFQHAKMTMEATLRASR-----LEHVILRPTAFFKSLSGQIA  153

Query  921   LVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQG  1100
              V+ G+ +++FGDG+L ACKPIS+ DL + ++  V       + LP+GGPG ALTPL+Q 
Sbjct  154   RVRAGRRFLLFGDGRLTACKPISDRDLGAVLARAVTEPGWARRTLPVGGPGPALTPLDQA  213

Query  1101  EMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWD  1280
             E LF L  +      VP  ++  A   LD+  ++ P L   AE  +IG YYA ESMLVWD
Sbjct  214   ETLFSLLDRAPAVRHVPPGLLSGAARALDVAGRLSPGLAARAELARIGHYYATESMLVWD  273

Query  1281  PEKGEYDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
                G YDAE TP YG DTL + + RVLR G    +LG+  +F
Sbjct  274   AAAGRYDAEATPEYGADTLRDHYARVLR-GEVAVDLGDHAMF  314



>ref|WP_009159694.1| epimerase [Thalassobium sp. R2A62]
 gb|EET48631.1| NmrA family protein [Thalassobium sp. R2A62]
Length=303

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 186/335 (56%), Gaps = 38/335 (11%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              I + G+TG  GR     L   G+ V  I R     R +    D  Q L  A        
Sbjct  5     RIALFGATGTAGRGAFRALKVAGYDVTCIGR-----RDAQIIADVTQPLEIAE-------  52

Query  588   elssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLS  767
                             DVVVSCLASR+G   D+W ID+ A  N L      G   F+LLS
Sbjct  53    --------------KFDVVVSCLASRSGSTDDAWAIDHLAHLNILAWAEDTGVGQFILLS  98

Query  768   AICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYV  947
             AICVQKP L FQ+AKL FE  L +        TYSIVRPTAFFKSL+GQ++ V+  KP++
Sbjct  99    AICVQKPKLPFQQAKLAFEAALTQST-----LTYSIVRPTAFFKSLSGQIDRVRRRKPFL  153

Query  948   MFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGK  1127
             +FGDG L ACKPIS++DL  FI+ CV      NQVLPIGGPG A+TPL+Q   L    G+
Sbjct  154   VFGDGTLTACKPISDDDLGRFIAQCVDDLTLHNQVLPIGGPGDAITPLDQAAALSAFLGQ  213

Query  1128  EAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDA--AEFGKIGRYYAAESMLVWDPEKGEYD  1301
               +  +VP+ +M   I +  L +  F S + A  A+  +IG YYA ESMLVWD  +  YD
Sbjct  214   PIRIKRVPVAMM--RIIYHGLRIAGFVSSKAAAKADLARIGHYYATESMLVWDGAR--YD  269

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             A+ TPS G +TL +++ +V+ +  + Q  G+  +F
Sbjct  270   ADVTPSTGTETLFDYYAQVIADDTSVQR-GDHSVF  303



>ref|WP_040362266.1| epimerase [Congregibacter litoralis]
Length=339

 Score =   238 bits (606),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 191/337 (57%), Gaps = 16/337 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG----ANVCF  575
              +L+ G+TGYIG  VA EL+   + +I   R+      S+   DTL+  +      ++  
Sbjct  14    RVLLAGATGYIGSRVARELLTNDYDLICPVRDV-----SSEACDTLRAFASDCETGSLHL  68

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
                                +DV+VSC+ASR+GGV DS +IDY A    L    K    HF
Sbjct  69    LAADLQDPENLDRALQEYRVDVLVSCIASRSGGVADSHQIDYLANHYLLQWAVKSEVKHF  128

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
              LLSAICVQKP L FQ AKL+FE +L        G ++S VR TAFFKSL+GQ++ V  G
Sbjct  129   TLLSAICVQKPRLAFQFAKLRFESELAA-----SGLSFSSVRATAFFKSLSGQLQRVSRG  183

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KP++MFGDG L  CKPI+E DLA FI    L  D +  V  IGGPG A++PLEQ ++L +
Sbjct  184   KPFLMFGDGTLTRCKPIAEADLAHFIR-LTLESDALKGVQEIGGPGPAISPLEQAQLLSR  242

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+  +   V  +++      LD+  +    + D AEF +IG YYA ESML WD ++  
Sbjct  243   LTGQPLRTKCVSPKLLRGIAALLDIPGRFSKGIADKAEFVRIGHYYATESMLHWDKDQEA  302

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDA+ TP +G  TLE+ ++  L  G   Q LG+Q +F
Sbjct  303   YDADATPEFGTITLEDSYRAQL-AGAGDQALGDQAVF  338



>dbj|BAF46307.1| integral membrane family protein [Ipomoea nil]
Length=152

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/132 (100%), Positives = 132/132 (100%), Gaps = 0/132 (0%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK
Sbjct  3     TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  62

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             PGFCPALVSHFIILDVVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG
Sbjct  63    PGFCPALVSHFIILDVVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG  122

Query  1919  ASLAVSFFAFIV  1884
             ASLAVSFFAFIV
Sbjct  123   ASLAVSFFAFIV  134



>ref|WP_040808521.1| epimerase [gamma proteobacterium NOR5-3]
Length=327

 Score =   232 bits (591),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 192/335 (57%), Gaps = 14/335 (4%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTL--QQLSGANVCFSD  581
              +L+ G+TGYIG  VA EL+  GF++I   R+ S  +   S   ++  ++L+       D
Sbjct  4     TVLLAGATGYIGSRVARELLDHGFTLICPVRDPSTAQALRSYAASVAPERLNLLAASLQD  63

Query  582   VTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVL  761
                L++     ++     D +VSC+ASR+GG+ DS  ++Y A +N L      G  HF L
Sbjct  64    EDSLNAALHPYKA-----DAIVSCIASRSGGIADSDTVEYIANRNLLRWAAVGGVQHFTL  118

Query  762   LSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKP  941
             LSAICVQKP L FQ AKL+FE +L        G  Y+ VR TAFFKSL+GQ++ V  GKP
Sbjct  119   LSAICVQKPRLAFQFAKLRFESELAAS-----GIPYTSVRATAFFKSLSGQLQRVSRGKP  173

Query  942   YVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLA  1121
             ++MFGDG L  CKPI+E DLA FI    L    +  V  IGGPG A+TPL Q ++L +L 
Sbjct  174   FLMFGDGLLTQCKPIAESDLAHFIR-LTLERADLRGVQAIGGPGPAITPLAQAQLLARLT  232

Query  1122  GKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYD  1301
              +  +   V  +++      L +  +V   + D AEF +IG YYA ESML+WD  +  YD
Sbjct  233   RQPLRTQSVSPKLLLAIASLLSVPGRVSSRIADKAEFARIGHYYATESMLLWDDNQQAYD  292

Query  1302  AENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             A  TP +G  TLE+ ++  L  G   Q LG Q +F
Sbjct  293   AAATPEFGSITLEDSYRAQL-AGKTNQGLGAQAVF  326



>ref|XP_005768361.1| hypothetical protein EMIHUDRAFT_464355 [Emiliania huxleyi CCMP1516]
 ref|XP_005783351.1| hypothetical protein EMIHUDRAFT_426672 [Emiliania huxleyi CCMP1516]
 gb|EOD15932.1| hypothetical protein EMIHUDRAFT_464355 [Emiliania huxleyi CCMP1516]
 gb|EOD30922.1| hypothetical protein EMIHUDRAFT_426672 [Emiliania huxleyi CCMP1516]
Length=404

 Score =   232 bits (591),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 203/364 (56%), Gaps = 67/364 (18%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVT  587
              ++VVG+TGYIG+ V  E V+RG++  A+ R+ +   G         +  GA +  +DV 
Sbjct  51    KVVVVGATGYIGKAVVRESVRRGYATTAVVRDAAKAAGE-------PKFEGARIATADVC  103

Query  588   elssleksveslGVP-----IDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             +  +L  +    G P     +DVV+SCLASR+G  KDS+ IDY+AT N L   R  GA H
Sbjct  104   DPPALGAA----GSPFEKGAVDVVISCLASRSGSKKDSFAIDYQATLNCLDAARAAGARH  159

Query  753   FVLLSAICVQKP------LLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQ  914
             FVLLSA CV+         L+FQ AK++FE  L ++ E     TYSIVRPTAFFKS++GQ
Sbjct  160   FVLLSAFCVKSAERKDPYALQFQYAKMEFEAKLREQTE----MTYSIVRPTAFFKSVSGQ  215

Query  915   VELVKDGKPYVMF--GDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
             +E+V  G P+V F  G+G+   C PISE DLA+ + D V  + K N +  +GGP   L+ 
Sbjct  216   LEVVNSGAPFVYFDLGEGRCATCNPISEADLAAALVDTVADKSKENALWNLGGPDDGLSM  275

Query  1089  LEQGEMLFKLAGK-EAKFIKVPIQIMDFAIGFL---------------------DLLVK-  1199
              +QGEM+ ++ GK EAK + VPI + D  IG L                     + LVK 
Sbjct  276   KQQGEMVAEVLGKEEAKLLAVPIGLFDVIIGGLQGGADLALRASRFDAWPEGAPEWLVKG  335

Query  1200  -------VFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRV  1358
                    +  SLED+AEFG+IGRYYA E ML  DP            YG+ TL + ++R+
Sbjct  336   LASGLAGLAQSLEDSAEFGRIGRYYAVEDMLTTDPAD---------KYGRTTLRQHYERI  386

Query  1359  LREG  1370
               EG
Sbjct  387   AVEG  390



>gb|EAQ99341.2| Acyl-CoA dehydrogenase [Congregibacter litoralis KT71]
Length=714

 Score =   236 bits (602),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 191/337 (57%), Gaps = 16/337 (5%)
 Frame = +3

Query  408   NILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQLSG----ANVCF  575
              +L+ G+TGYIG  VA EL+   + +I   R+      S+   DTL+  +      ++  
Sbjct  389   RVLLAGATGYIGSRVARELLTNDYDLICPVRDV-----SSEACDTLRAFASDCETGSLHL  443

Query  576   SDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHF  755
                                +DV+VSC+ASR+GGV DS +IDY A    L    K    HF
Sbjct  444   LAADLQDPENLDRALQEYRVDVLVSCIASRSGGVADSHQIDYLANHYLLQWAVKSEVKHF  503

Query  756   VLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDG  935
              LLSAICVQKP L FQ AKL+FE +L        G ++S VR TAFFKSL+GQ++ V  G
Sbjct  504   TLLSAICVQKPRLAFQFAKLRFESELAA-----SGLSFSSVRATAFFKSLSGQLQRVSRG  558

Query  936   KPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFK  1115
             KP++MFGDG L  CKPI+E DLA FI    L  D +  V  IGGPG A++PLEQ ++L +
Sbjct  559   KPFLMFGDGTLTRCKPIAEADLAHFIR-LTLESDALKGVQEIGGPGPAISPLEQAQLLSR  617

Query  1116  LAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGE  1295
             L G+  +   V  +++      LD+  +    + D AEF +IG YYA ESML WD ++  
Sbjct  618   LTGQPLRTKCVSPKLLRGIAALLDIPGRFSKGIADKAEFVRIGHYYATESMLHWDKDQEA  677

Query  1296  YDAENTPSYGKDTLEEFFKRVLREGMAGQELGEQMIF  1406
             YDA+ TP +G  TLE+ ++  L  G   Q LG+Q +F
Sbjct  678   YDADATPEFGTITLEDSYRAQL-AGAGDQALGDQAVF  713



>ref|WP_027442586.1| epimerase [Porphyrobacter cryptus]
Length=298

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 161/245 (66%), Gaps = 5/245 (2%)
 Frame = +3

Query  636   DVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKL  815
             +VV+SC+ASR+G   D+W +D+++ +  L      GA  F+LLSAICVQKP L FQ AKL
Sbjct  59    EVVISCIASRSGAPSDAWAVDHDSNRALLAAAEAAGARQFILLSAICVQKPRLAFQHAKL  118

Query  816   KFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEE  995
              FE  L++        T++I+RPTAFFKSL+GQV  V+ GKP+++FGDG+L +CKPIS+ 
Sbjct  119   AFEAALVQSP-----ITHTIIRPTAFFKSLSGQVARVRAGKPFLLFGDGELTSCKPISDA  173

Query  996   DLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAI  1175
             DLA FI   + + +   ++LP+GGPG A+TP EQGE+LF  A + A+F  V   +   A 
Sbjct  174   DLARFILAAIDNPEAAGRILPVGGPGPAITPREQGELLFAAARRPARFRSVSPGLFAAAA  233

Query  1176  GFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKR  1355
               L L   + P     AE+ +I  YYA ESMLVWDP  G Y A+ TP +G +TL + ++R
Sbjct  234   RVLGLGAGLSPWCAAKAEYARIAHYYATESMLVWDPASGRYRADLTPEFGSETLSDHYRR  293

Query  1356  VLREG  1370
             ++ +G
Sbjct  294   LMAKG  298



>gb|EED32746.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium NOR5-3]
Length=295

 Score =   216 bits (551),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 155/257 (60%), Gaps = 7/257 (3%)
 Frame = +3

Query  636   DVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAHFVLLSAICVQKPLLEFQRAKL  815
             D +VSC+ASR+GG+ DS  ++Y A +N L      G  HF LLSAICVQKP L FQ AKL
Sbjct  45    DAIVSCIASRSGGIADSDTVEYIANRNLLRWAAVGGVQHFTLLSAICVQKPRLAFQFAKL  104

Query  816   KFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKDGKPYVMFGDGKLCACKPISEE  995
             +FE +L        G  Y+ VR TAFFKSL+GQ++ V  GKP++MFGDG L  CKPI+E 
Sbjct  105   RFESELAAS-----GIPYTSVRATAFFKSLSGQLQRVSRGKPFLMFGDGLLTQCKPIAES  159

Query  996   DLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAI  1175
             DLA FI    L    +  V  IGGPG A+TPL Q ++L +L  +  +   V  +++    
Sbjct  160   DLAHFIR-LTLERADLRGVQAIGGPGPAITPLAQAQLLARLTRQPLRTQSVSPKLLLAIA  218

Query  1176  GFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKR  1355
               L +  +V   + D AEF +IG YYA ESML+WD  +  YDA  TP +G  TLE+ ++ 
Sbjct  219   SLLSVPGRVSSRIADKAEFARIGHYYATESMLLWDDNQQAYDAAATPEFGSITLEDSYRA  278

Query  1356  VLREGMAGQELGEQMIF  1406
              L  G   Q LG Q +F
Sbjct  279   QL-AGKTNQGLGAQAVF  294



>ref|WP_022573870.1| putative nucleoside-diphosphate sugar epimerase [Rhodobacteraceae 
bacterium HIMB11]
 gb|ERL96642.1| putative nucleoside-diphosphate sugar epimerase [Rhodobacteraceae 
bacterium HIMB11]
Length=319

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 176/330 (53%), Gaps = 32/330 (10%)
 Frame = +3

Query  408   NIL-VVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ----QLSGANVC  572
             N+L V G+TGYIGR V    +KRG++V A  R  S  R    + D L+    Q       
Sbjct  4     NVLYVAGATGYIGREVVKRALKRGYTVHASVRLNS--RTVLPQNDRLKLDIIQTEQDKTA  61

Query  573   FSDVTelssleksveslGVPIDV-VVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAA  749
             F+                +P+   V+SC++SR G  KD+  IDY+     L   R   A 
Sbjct  62    FN----------------IPMGASVISCISSRTGTAKDAHNIDYKMNMALLNCARASDAN  105

Query  750   HFVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVK  929
              F++LSAICVQKP L FQ  KLKFE     +A    G  YSIVRPTA+FKSL GQ++ V+
Sbjct  106   VFLMLSAICVQKPKLAFQHTKLKFE-----DALQTSGLKYSIVRPTAYFKSLTGQIKRVE  160

Query  930   DGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEML  1109
                P++ FGDG   AC PIS+ DLA F+ + V      N++LPIGGP  ALTP +   ++
Sbjct  161   KNLPFLFFGDGTQTACTPISKRDLAEFMLNTVQKPASWNKILPIGGPQPALTPADMAAII  220

Query  1110  FKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEK  1289
              K+  K +    V  +I D     +  L  +     + +E   IG+YYA ESMLVWD   
Sbjct  221   SKIYNKPSATRSVSPKIFDVLRTLIAPLRPISRWAREKSELMNIGKYYATESMLVWDEAS  280

Query  1290  GEYDAENTPSYGKDTLEEFFKRVLREGMAG  1379
             G YDA+ TPS G+DT   F+  VL+    G
Sbjct  281   GHYDAKRTPSTGQDT---FYDHVLKMRETG  307



>ref|XP_009033859.1| hypothetical protein AURANDRAFT_20831 [Aureococcus anophagefferens]
 gb|EGB11499.1| hypothetical protein AURANDRAFT_20831 [Aureococcus anophagefferens]
Length=371

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/342 (39%), Positives = 181/342 (53%), Gaps = 45/342 (13%)
 Frame = +3

Query  399   SDINILVVGSTGYIGRFVATELVKRGFSVIAIARE--RSGIRGSNSKEDTLQQLSGANVC  572
             +D  + VVG++GYIG+ V  E V+RG+   A+ R+  R+   G+         L G +  
Sbjct  11    TDERVTVVGASGYIGKAVVRECVRRGYETTAVVRDASRASFDGATIVGAECGDLGGISRA  70

Query  573   FSDVTelssleksveslGVPIDVVVSCLASRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
             F                    DVVV CLASR+G   DS  +DYEA+ N L   RK GA H
Sbjct  71    FETAK---------------TDVVVCCLASRSGTEADSLLVDYEASVNCLEAARKCGARH  115

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             +VLLSA CV KP L FQ AKLK E  L  + +     TYS+VRPTAFFKSL+GQVE++K 
Sbjct  116   YVLLSAFCVAKPDLSFQAAKLKTEAALAGQGD----VTYSVVRPTAFFKSLSGQVEILKG  171

Query  933   GKPYVMF--GDGKLCACKPISEEDLASFISDCVLSEDKINQ----VLPIGGPGKALTPLE  1094
             G P+V F  G  +   C PISE DLA  I DCV    + ++    +  +GGP   ++  E
Sbjct  172   GGPFVYFDLGGDRSATCNPISEADLAMAIVDCVADPARSSKGGEPIWNVGGPDAGISMKE  231

Query  1095  QGEMLFKLAG-------KEAKFIKVPIQIMDFAIGFLDLLVKVF--PSLEDAAEFGKIGR  1247
             QGE++            KE   + VPI + D  +G +     +   P ++DA E G+IGR
Sbjct  232   QGELIATAIAEVDGEPRKEPWLLGVPIGVFDGIVGAIKWAYDLTGSPKVKDAWELGQIGR  291

Query  1248  YYAAESMLVWDPEKGEYDAENTPSYGKDTLEEFFKRVLREGM  1373
             YYA E ML   P +          YGK +L+E +K+V ++G 
Sbjct  292   YYAVEDMLTTAPAE---------KYGKMSLKEHYKQVAKDGQ  324



>gb|EJK67755.1| hypothetical protein THAOC_11173, partial [Thalassiosira oceanica]
Length=260

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 129/208 (62%), Gaps = 15/208 (7%)
 Frame = +3

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             ++LLSA C + PLL+ Q+AKLK E  + +++    G TYSIVRPTAFFKS++GQ+E + +
Sbjct  2     YLLLSAFCCRNPLLKLQQAKLKLEAKIAEQS----GMTYSIVRPTAFFKSVSGQLESIIE  57

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             G  YV+FGDG +  C PI+EEDLA+++ D  ++E    ++L +GGP   L+     EM+F
Sbjct  58    GNSYVLFGDGTVTHCNPIAEEDLATYMLDSAVNESMQGRILNVGGPDGPLSNKRLAEMMF  117

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPS--LEDAAEFGKIGRYYAAESMLVWDPE  1286
             +      KF+ +P  + DF+I  ++ + + FPS  +ED  E  KIG+YYA E ML     
Sbjct  118   ESVSLPQKFVYIPTSVFDFSISLIEWIARTFPSQKMEDVLETAKIGKYYAVEDMLT----  173

Query  1287  KGEYDAENTPSYGKDTLEEFFKRVLREG  1370
                  AE+   +G  T++  F R+ +EG
Sbjct  174   ----TAEDE-KFGTITVKNHFDRIAKEG  196



>ref|XP_009596742.1| PREDICTED: CASP-like protein 1 [Nicotiana tomentosiformis]
Length=203

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 135/186 (73%), Gaps = 9/186 (5%)
 Frame = -3

Query  2435  MSTEPEKV---APTGSVETEKAG--PSYKPKEYYKVTEailrllllaslvvavvvmVTSK  2271
             M+TEPEKV   A     E EKA   P+  P +Y+ V + +LRLL+ AS +V+VVVM TSK
Sbjct  1     MATEPEKVVAPAEASVAEPEKAALPPTTAPTDYFAVADVVLRLLVFASALVSVVVMSTSK  60

Query  2270  ETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGF  2091
             +TE++     PFPP+  PL AKF  SPA IYF+A LSVAG ++I++TL S Y+ L KPG 
Sbjct  61    QTEMVP---TPFPPYRAPLPAKFNHSPALIYFIAALSVAGFFSILTTLGSLYS-LTKPGC  116

Query  2090  CPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASL  1911
                ++SHFII+DV++LGIV +ATGAA  VAYIGLKGN+HVGW KVCN YGK C +LGAS+
Sbjct  117   SAKIISHFIIIDVILLGIVASATGAAAAVAYIGLKGNTHVGWGKVCNMYGKFCRYLGASI  176

Query  1910  AVSFFA  1893
              VS FA
Sbjct  177   GVSLFA  182



>gb|AFK37564.1| unknown [Medicago truncatula]
Length=169

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +3

Query  297  SKPFKLNQERFK-PVSCSAAPAVETPNVSFRSKNPSDINILVVGSTGYIGRFVATELVKR  473
            ++P K  +++ K   S S +  +ET   +FR KNP D+N+LVVGSTGYIG+FV  EL++R
Sbjct  42   NRPIKYTKQKLKLYASLSQSEQIETTPTTFRIKNPKDVNVLVVGSTGYIGKFVVKELIQR  101

Query  474  GFSVIAIARERSGIRGSNSKEDTLQQLSGANVCFSDVTelssleksveslGVPIDVVVSC  653
            GF+V AIARE+SGI+GS  KE TL +L GANVCFSDVT L   ++ +++LGV  DVVVSC
Sbjct  102  GFNVTAIAREKSGIKGSIDKETTLNELRGANVCFSDVTNLDVFDEDLKNLGVGFDVVVSC  161

Query  654  LASRNGG  674
            LASRNGG
Sbjct  162  LASRNGG  168



>ref|XP_009763390.1| PREDICTED: CASP-like protein 1 [Nicotiana sylvestris]
Length=201

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 129/182 (71%), Gaps = 9/182 (5%)
 Frame = -3

Query  2435  MSTEPEKVAPTGSV---ETEKAGP--SYKPKEYYKVTEailrllllaslvvavvvmVTSK  2271
             M+ EPEKV P       E EKA P  +  P +Y+ V + +LRLL+ AS +V+VVVM  SK
Sbjct  1     MANEPEKVVPPAEASVAEPEKAAPPPTTGPTDYFAVADVVLRLLVFASALVSVVVMSVSK  60

Query  2270  ETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGF  2091
             +TE++     PFPP+  PL AKF  SPA IYFVA  SVAG ++II+TL S Y+ L KPG 
Sbjct  61    QTEMVPT---PFPPYRAPLPAKFNHSPALIYFVAAFSVAGFFSIITTLGSLYS-LTKPGC  116

Query  2090  CPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASL  1911
                ++SHFII+DV++LGIV +ATGAA  VAYIGLKGN+HVGW KVCN YGK C +LGAS+
Sbjct  117   SAKIISHFIIIDVLLLGIVASATGAAASVAYIGLKGNTHVGWGKVCNMYGKFCRYLGASI  176

Query  1910  AV  1905
              V
Sbjct  177   GV  178



>ref|XP_011071479.1| PREDICTED: CASP-like protein 1 [Sesamum indicum]
Length=218

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 132/185 (71%), Gaps = 5/185 (3%)
 Frame = -3

Query  2438  PMSTEPEKVAPTGSVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETEL  2259
             P STE EK A     E  KA     P +Y+ V E +LR LL AS VVAVVV VTS +T+ 
Sbjct  21    PTSTEVEKEAEAPPPEV-KASADAPPVDYFAVAEVVLRFLLFASAVVAVVVTVTSNQTKQ  79

Query  2258  ISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPAL  2079
             + ++   FPPF   L AKF  SPAFIYFVA LSVAGLY+II+TL SFY LL KPG CP +
Sbjct  80    VPLQ---FPPFQASLPAKFNHSPAFIYFVAALSVAGLYSIITTLLSFYALL-KPGCCPQV  135

Query  2078  VSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSF  1899
             +SHF+I DV++LG+V +ATGAAG VAYIGL+GNSH+GW K CN Y + C H+G+S+ VS 
Sbjct  136   LSHFVIFDVLLLGVVASATGAAGAVAYIGLRGNSHLGWKKACNVYDEFCKHVGSSIFVSL  195

Query  1898  FAFIV  1884
             FA IV
Sbjct  196   FASIV  200



>ref|XP_006342778.1| PREDICTED: CASP-like protein IN26-like [Solanum tuberosum]
Length=197

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 134/187 (72%), Gaps = 17/187 (9%)
 Frame = -3

Query  2435  MSTEPEKVAP---TGSVETEKAGP---SYKPKEYYKVTEailrllllaslvvavvvmVTS  2274
             M++EPEKV P       E EKA P   + +P +Y+ V + +LRLL+ AS +V+VVVM TS
Sbjct  1     MASEPEKVVPPVEAPVAEPEKAAPPPSTTRPTDYFAVADVVLRLLVFASALVSVVVMSTS  60

Query  2273  KETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPG  2094
             KETE++    +P P       AKFTQSPA IYFV  LSVAG +++I+TL S Y+ LIKPG
Sbjct  61    KETEMLP---NPRP-------AKFTQSPALIYFVVALSVAGFFSLITTLGSLYS-LIKPG  109

Query  2093  FCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGAS  1914
              C  ++SHFI++DV++LGIV +ATGAAG V YIGLKGN++VGW ++C  YGK C +LGAS
Sbjct  110   CCAKIISHFIVIDVLLLGIVASATGAAGSVTYIGLKGNTYVGWREICTLYGKFCRYLGAS  169

Query  1913  LAVSFFA  1893
             + VS FA
Sbjct  170   IGVSLFA  176



>ref|XP_004229219.1| PREDICTED: CASP-like protein 1 [Solanum lycopersicum]
Length=196

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 132/186 (71%), Gaps = 16/186 (9%)
 Frame = -3

Query  2435  MSTEPEKVAPTGS---VETEKAGP--SYKPKEYYKVTEailrllllaslvvavvvmVTSK  2271
             M++EP KV P      VE EKA P  +  P +Y+ V + +LRLL+ AS VV+VVVM TSK
Sbjct  1     MASEPAKVVPPTEAPVVEPEKAAPPPTTWPTDYFAVADVVLRLLVFASAVVSVVVMSTSK  60

Query  2270  ETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGF  2091
             ET+++    +P P       AKFT SPA IYFVA LSVAG +++I+TL S Y+ LIKPG 
Sbjct  61    ETKMLP---NPRP-------AKFTHSPALIYFVAALSVAGFFSLITTLGSLYS-LIKPGC  109

Query  2090  CPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASL  1911
             C  ++SHFI++DV++LGIV +ATGAAG V Y+GLKGN+HV W KVC  YGK C ++GAS+
Sbjct  110   CAKIISHFIVIDVLLLGIVASATGAAGSVTYVGLKGNTHVRWGKVCTLYGKFCRYVGASI  169

Query  1910  AVSFFA  1893
              VS FA
Sbjct  170   GVSLFA  175



>emb|CDO98910.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 4/127 (3%)
 Frame = -3

Query  2273  KETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPG  2094
             K+TEL+++   PFPPF  P+ AKF  SPA IYFVA LSVAGLY IISTL S Y LL KP 
Sbjct  86    KQTELVAI---PFPPFRAPVPAKFNHSPALIYFVAALSVAGLYGIISTLLSVYALL-KPD  141

Query  2093  FCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGAS  1914
             +   L+SH +I DV++LGIV +ATGAAGGVAY+GLKGNSHVGW KVC+ Y   C HL +S
Sbjct  142   WSTRLLSHLVIFDVLLLGIVASATGAAGGVAYVGLKGNSHVGWRKVCDTYDVFCKHLASS  201

Query  1913  LAVSFFA  1893
             LA+S FA
Sbjct  202   LAISLFA  208



>ref|XP_011090848.1| PREDICTED: CASP-like protein 1 [Sesamum indicum]
Length=210

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 96/128 (75%), Gaps = 4/128 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             TSK+TELI +   P PPF+ P  AKFT SPAFIYFVA LSVAGLY  I+TL S + L  K
Sbjct  62    TSKQTELIPI---PIPPFLTPRPAKFTHSPAFIYFVAALSVAGLYGAITTLISLFALR-K  117

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P   P  +SHF+I DV++LGIV  ATG AGGVAYIGLKGN+HV W K+C+ YG+ C H+G
Sbjct  118   PASYPRFLSHFVIFDVLLLGIVAAATGTAGGVAYIGLKGNTHVQWRKICDIYGEFCRHIG  177

Query  1919  ASLAVSFF  1896
             AS+AVS F
Sbjct  178   ASIAVSLF  185



>sp|Q20BM9.1|CSPL1_PANGI RecName: Full=CASP-like protein 1 [Panax ginseng]
 gb|ABD73297.1| unknown [Panax ginseng]
Length=148

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 4/129 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T K+TELI +   PFPP+ +P ++KFT SPAFIYFVA  SVAGLY+II++L S   LL K
Sbjct  3     TGKQTELIPI---PFPPYQIPYSSKFTDSPAFIYFVAAFSVAGLYSIITSLLSGLALL-K  58

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             PG+   LVSHF+++DV++LGIV  A GAAGGV YIGL+GNSH  WTK+CN Y   C HL 
Sbjct  59    PGYAKQLVSHFVVVDVLLLGIVAAAIGAAGGVGYIGLRGNSHSRWTKICNIYDTFCQHLA  118

Query  1919  ASLAVSFFA  1893
              S+A    A
Sbjct  119   GSIAAGLIA  127



>gb|EYU43898.1| hypothetical protein MIMGU_mgv1a025880mg [Erythranthe guttata]
Length=199

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 124/180 (69%), Gaps = 7/180 (4%)
 Frame = -3

Query  2432  STEPEKVAPTGSVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETELIS  2253
             ++E EKVA     ET       K    + + E +LR LL AS +VAV+VMVTSK+T+ +S
Sbjct  6     TSETEKVAAAPPPETRAPA---KKAHTFALAEVVLRFLLFASGLVAVLVMVTSKQTKYLS  62

Query  2252  VKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVS  2073
             V   P  P+ +P +A F  SPAFIYFVA LSVAG Y +I+TL S Y  LIKPG CP ++S
Sbjct  63    V---PGIPYKIPRSAVFDHSPAFIYFVAALSVAGFYGLITTLFSLYA-LIKPGCCPKVLS  118

Query  2072  HFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFA  1893
             HF+I DV++LGIV +ATG+ G VAYIGLKGN +V W K+C+ YG  C H+GAS+AVS F 
Sbjct  119   HFVIFDVLLLGIVASATGSGGAVAYIGLKGNKYVNWGKICHMYGDFCKHVGASIAVSLFG  178



>ref|XP_011081169.1| PREDICTED: CASP-like protein 1 [Sesamum indicum]
Length=205

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 123/182 (68%), Gaps = 9/182 (5%)
 Frame = -3

Query  2426  EPEKVAPTGSVETEKAGPSYKP-KEYYKVTEailrllllaslvvavvvmVTSKETELISV  2250
             EP K AP      E   P+ KP    + + + +LR LL AS +VAV+++VTS +T+LI +
Sbjct  11    EPVKEAP----PPEMRAPAEKPLSGLFGLGDVVLRFLLSASALVAVILLVTSNQTKLIPI  66

Query  2249  KLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSH  2070
                P PP+++  TAKFTQ+PA IYF+A +SVAG Y +ISTL S Y LL +PG  P ++SH
Sbjct  67    ---PAPPYLISRTAKFTQAPALIYFIAAISVAGFYGVISTLISLYALL-RPGSFPRVLSH  122

Query  2069  FIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAF  1890
             F+I DV++LGIV  A GAAG + Y GLKGNSHV W K+CN Y   C ++ AS++V+ F  
Sbjct  123   FVIFDVLLLGIVAAAVGAAGAIGYTGLKGNSHVQWAKICNVYDYFCRNISASISVALFGS  182

Query  1889  IV  1884
             IV
Sbjct  183   IV  184



>ref|XP_002312755.2| hypothetical protein POPTR_0008s20950g [Populus trichocarpa]
 sp|B9HMP5.2|CSPLD_POPTR RecName: Full=CASP-like protein 1D1; Short=PtCASPL1D1 [Populus 
trichocarpa]
 gb|EEE90122.2| hypothetical protein POPTR_0008s20950g [Populus trichocarpa]
Length=196

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = -3

Query  2399  SVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETELISVKLDPFPPFML  2220
             S+++E+A  ++  +  Y      LR LL A+ V AVVVMVT+K+T+++ V   P  P  +
Sbjct  11    SIKSEEAPAAHPRRSNYSSVHVALRFLLFAASVTAVVVMVTAKQTKIVPV---PGLPISV  67

Query  2219  PLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILDVVMLg  2040
             PL AKF+ SPAF+YF++ LSVAGLY I++TLA+  ++++KP +    + HF +LDV+MLG
Sbjct  68    PLEAKFSDSPAFLYFISALSVAGLYGILTTLAAI-SIVLKPAYATRFLLHFALLDVLMLG  126

Query  2039  ivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIV  1884
             IV +ATGAAGGVAY+GLKGNSHV W KVCN Y K C H+G+S+AV+ FA ++
Sbjct  127   IVASATGAAGGVAYVGLKGNSHVRWGKVCNVYDKFCQHVGSSIAVALFASVL  178



>emb|CBI26108.3| unnamed protein product [Vitis vinifera]
Length=148

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             TS +T+LI+V      P ++   AKF  SPAFIYFVA LSV GLY+II+TLASF   + K
Sbjct  3     TSVQTKLIAV---AGVPVLVSNKAKFQNSPAFIYFVAALSVVGLYSIITTLASFI-FISK  58

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P      + H  I DV+MLG+  +ATG AGGVAY+GLKGNSHVGW KVCN Y K C H+G
Sbjct  59    PSCSTKTILHLAIWDVLMLGLAASATGTAGGVAYVGLKGNSHVGWNKVCNTYDKFCRHVG  118

Query  1919  ASLAVSFFAFI  1887
              S+AV+ FA I
Sbjct  119   GSIAVALFASI  129



>ref|XP_011013338.1| PREDICTED: CASP-like protein 1D1 [Populus euphratica]
Length=196

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = -3

Query  2273  KETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPG  2094
             K+TE++ +   P  P   P+ AKF+ SPAFIYF++ LSVAGLY I+STLAS   +++KP 
Sbjct  53    KQTEIVRL---PVFPLGAPVEAKFSDSPAFIYFISALSVAGLYGILSTLASI-AVVLKPA  108

Query  2093  FCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGAS  1914
             +    + HF +LDV+MLGIV +ATG AGGVAYIGLKGNSHV W K+CN Y K C H+G+S
Sbjct  109   YATRFLLHFALLDVLMLGIVASATGTAGGVAYIGLKGNSHVRWGKMCNVYDKFCQHVGSS  168

Query  1913  LAVSFFA  1893
             +AV+ FA
Sbjct  169   VAVALFA  175



>gb|KDP40020.1| hypothetical protein JCGZ_02018 [Jatropha curcas]
Length=200

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+K+TE  SV   P  PF +P+ AKF  SPAFIY VA LSVA LY+II+TLAS   ++ K
Sbjct  55    TAKQTEDASV---PGLPFRVPVEAKFNHSPAFIYLVAALSVACLYSIITTLASL-GVIAK  110

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P +    + ++ I DVV+LGIV  ATG AGGVAYIGLKGNSH GW K+CN Y K C H+G
Sbjct  111   PIYATQFLLYYTIWDVVLLGIVAAATGTAGGVAYIGLKGNSHTGWIKICNVYDKFCRHVG  170

Query  1919  ASLAVSFFAFI  1887
             +++ +S FA I
Sbjct  171   SAVGLSLFASI  181



>ref|XP_007035489.1| CASP-like protein RCOM_0679870, putative [Theobroma cacao]
 gb|EOY06415.1| CASP-like protein RCOM_0679870, putative [Theobroma cacao]
Length=196

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = -3

Query  2273  KETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPG  2094
             K+TE+  V L   P   LPL AKF+ SPA IYFVA LSV GLY+II+TLAS  ++ + P 
Sbjct  52    KQTEV--VPLPTMPTVRLPLPAKFSHSPALIYFVAALSVTGLYSIITTLASI-SVALTPA  108

Query  2093  FCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGAS  1914
             +  + +  F  LDVV +GIV +ATGAAGGVAYIGLKGN+HVGW K+CN Y K C H+G+S
Sbjct  109   YSKSFLLVFAFLDVVFVGIVASATGAAGGVAYIGLKGNNHVGWNKICNAYDKFCRHVGSS  168

Query  1913  LAVSFFAFIV  1884
             +AVS FA I+
Sbjct  169   VAVSLFAAIL  178



>ref|XP_003628900.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=463

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  1050  VLPIGGPGKALTPLEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAE  1229
             ++PIGGP  ALT  EQGE+LFKL GKE KF+KVPI IMDFAIG L + VKVFPSLED AE
Sbjct  353   IIPIGGPKNALTKTEQGEILFKLLGKEPKFLKVPIGIMDFAIGVLVVSVKVFPSLEDVAE  412

Query  1230  FGKIGRYYAAESMLVWD  1280
             F KIGRYYA ES+L+ D
Sbjct  413   FVKIGRYYAVESILILD  429



>ref|XP_002276229.1| PREDICTED: CASP-like protein 1D1 [Vitis vinifera]
 sp|A7NW79.2|CSPL7_VITVI RecName: Full=CASP-like protein 1D1; Short=VvCASPL1D1 [Vitis 
vinifera]
Length=208

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = -3

Query  2270  ETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGF  2091
             +T+LI+V      P ++   AKF  SPAFIYFVA LSV GLY+II+TLASF   + KP  
Sbjct  66    QTKLIAV---AGVPVLVSNKAKFQNSPAFIYFVAALSVVGLYSIITTLASFI-FISKPSC  121

Query  2090  CPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASL  1911
                 + H  I DV+MLG+  +ATG AGGVAY+GLKGNSHVGW KVCN Y K C H+G S+
Sbjct  122   STKTILHLAIWDVLMLGLAASATGTAGGVAYVGLKGNSHVGWNKVCNTYDKFCRHVGGSI  181

Query  1910  AVSFFAFI  1887
             AV+ FA I
Sbjct  182   AVALFASI  189



>emb|CBI26109.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 7/112 (6%)
 Frame = +3

Query  219  LSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRSKNP  398
            LSS+ L  H      P   +F +   S+    NQ RF P++ S  P VE P+ SFR KN 
Sbjct  5    LSSNVLTLH-----SPKTRSFRNCSASQFINQNQ-RFLPITASITPTVEPPS-SFRGKNA  57

Query  399  SDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQQL  554
            S+IN++VVGSTGYIG+FV  ELV RGF+VIAIARERSGIRG N KEDTL  L
Sbjct  58   SEINVVVVGSTGYIGKFVVKELVSRGFNVIAIARERSGIRGRNRKEDTLTDL  109



>ref|XP_009419511.1| PREDICTED: CASP-like protein MA4_106O17.52 [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             TSK+T+LISV + P    ++   AKF  SPAFIY VA LSV GLY+II+ L S ++ +  
Sbjct  60    TSKQTKLISVTVAPSSQILVSRDAKFQHSPAFIYLVAALSVTGLYSIITMLVSLFS-IAS  118

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P   P  +   I+ D +M G++ +ATG AG VAYIGLKGNSHV W K+CN YGK C H+G
Sbjct  119   PSPSPKTLFLLILFDTLMAGVMASATGNAGSVAYIGLKGNSHVNWNKICNMYGKFCRHVG  178

Query  1919  ASLAVSFFAFI  1887
             +S AVS  A I
Sbjct  179   SSTAVSLIASI  189



>ref|XP_003542918.1| PREDICTED: CASP-like protein 7-like isoform X1 [Glycine max]
 ref|XP_006594489.1| PREDICTED: CASP-like protein 7-like isoform X2 [Glycine max]
 gb|KHN47295.1| CASP-like protein 7 [Glycine soja]
Length=189

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 89/132 (67%), Gaps = 6/132 (5%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             +S +TE +      F   +LP  AKF  SPAF+YFVA  SV+GLY ++S LAS  +++ K
Sbjct  46    SSDQTEQVL-----FQDVLLPQPAKFKYSPAFVYFVAAFSVSGLYALVSALASI-SVIQK  99

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             PGF    + HFI  D ++LGI  +ATGAAG VAYIGLKGNSHVGW KVCN Y K C HL 
Sbjct  100   PGFKLKFLLHFIFWDALILGITASATGAAGSVAYIGLKGNSHVGWIKVCNIYDKFCRHLA  159

Query  1919  ASLAVSFFAFIV  1884
              S+AV+ F  IV
Sbjct  160   GSIAVALFGSIV  171



>ref|XP_010241335.1| PREDICTED: CASP-like protein 1D1 [Nelumbo nucifera]
Length=204

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 121/188 (64%), Gaps = 9/188 (5%)
 Frame = -3

Query  2432  STEPEKVAPTGSVETEKAGP---SYKPKEYYKVTEailrllllaslvvavvvmVTSKETE  2262
             +TE +  A  G   +E   P   S +    + V +  LR LL AS + AVVVMVTSK+TE
Sbjct  5     TTEKKPTADXGKTMSESQAPRETSSRTTGSFTVLDFSLRFLLFASTLTAVVVMVTSKQTE  64

Query  2261  LISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPA  2082
              I + L P P   +   AKF  SPAFIYFVA LSVA L+ +ISTL S   +  KP  CP+
Sbjct  65    FIPIPLLPVPA-RVAKAAKFNHSPAFIYFVAALSVACLHGLISTLTSLATIW-KP--CPS  120

Query  2081  --LVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLA  1908
               L+ H    DV+MLG+V +ATG AG VAYIGL+GNS+VGW+K+C+ Y K C H+G+S+A
Sbjct  121   KKLLLHLAFSDVLMLGLVASATGTAGSVAYIGLRGNSNVGWSKICSVYDKFCRHIGSSIA  180

Query  1907  VSFFAFIV  1884
             VS FA I+
Sbjct  181   VSLFASIL  188



>ref|XP_010666392.1| PREDICTED: CASP-like protein Ni6 [Beta vulgaris subsp. vulgaris]
Length=194

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 115/177 (65%), Gaps = 10/177 (6%)
 Frame = -3

Query  2432  STEPEKVAPTGSVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETELIS  2253
             S E EK    G+V T +A P       Y+V + ILR+LLLA+ + +VV+MVTSK+TE+I 
Sbjct  3     SMETEK----GAVPTPQAPPVAPTDNKYRVVDVILRVLLLAASIASVVLMVTSKQTEIIV  58

Query  2252  VKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVS  2073
               L   P       AKF  SPAFIY VA LSVAGLY+II+ L S  + ++KP   P L  
Sbjct  59    SPLGSRPN-----AAKFQNSPAFIYLVAALSVAGLYSIITALVSL-SYMMKPIVAPKLFW  112

Query  2072  HFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVS  1902
               +I DV++LGIV  ATG AGGV YIGLKGN+HV W K+CN Y K C H+GAS+ VS
Sbjct  113   ILLIHDVLLLGIVAAATGTAGGVGYIGLKGNTHVRWGKICNVYDKFCRHVGASIIVS  169



>ref|XP_010245386.1| PREDICTED: CASP-like protein 1D1 [Nelumbo nucifera]
Length=199

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 121/187 (65%), Gaps = 7/187 (4%)
 Frame = -3

Query  2435  MSTEPEKVAPTGS-VETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETEL  2259
             M    EK A   S  +  K   S  P   Y   +  LR+LL AS +VAVVVMVTSK+TEL
Sbjct  1     MEATTEKQATLSSESQASKEMASSSPATKYLSLDLSLRVLLFASTLVAVVVMVTSKQTEL  60

Query  2258  ISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPA-  2082
             + V+L P P F     AKF  SPA IYFVA LSVA LY+II+TL S    + KP  CP+ 
Sbjct  61    VPVRLLPMPAFGYK-AAKFNHSPATIYFVAALSVACLYSIITTLTSL-GAIWKP--CPSK  116

Query  2081  -LVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAV  1905
                   + +D++MLG+V +ATG AGGVAYIGLKGNSHVGWTK+C+ Y K C H+ +S+A+
Sbjct  117   KFFLLLVFMDLIMLGLVASATGTAGGVAYIGLKGNSHVGWTKICSVYDKFCHHVASSIAI  176

Query  1904  SFFAFIV  1884
             S FA I+
Sbjct  177   SLFASIL  183



>gb|EYU29828.1| hypothetical protein MIMGU_mgv1a016414mg [Erythranthe guttata]
Length=123

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 4/104 (4%)
 Frame = +3

Query  210  FRRLSSHFLNHHIQVNAVPYAITFPSIHFSKPFKLNQERFKPVSCSAAPAVETPNVSFRS  389
            F+ L +  L    QV   PYAI  PS+H  +P K   ++F   + SA     +    FR+
Sbjct  22   FKGLHASHLISQFQVTTAPYAIPLPSLHLHQPSKFRPKKFNLFTVSA----NSTKTHFRN  77

Query  390  KNPSDINILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRG  521
            KNP +IN+LVVGSTGYIG FV  ELV+RGF+V+AIARE+SG RG
Sbjct  78   KNPKEINVLVVGSTGYIGNFVVKELVRRGFNVVAIAREKSGTRG  121



>ref|XP_007154229.1| hypothetical protein PHAVU_003G101100g [Phaseolus vulgaris]
 gb|ESW26223.1| hypothetical protein PHAVU_003G101100g [Phaseolus vulgaris]
Length=187

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = -3

Query  2228  FMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILDVV  2049
             F+ P  AKF  SPAF+YFVA LSVAGLY+II+TLAS Y +   P     L+ +FI+LDV+
Sbjct  58    FLRP--AKFRYSPAFVYFVAALSVAGLYSIITTLASLYAIK-NPALKAKLLLYFILLDVL  114

Query  2048  MLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIV  1884
             +LGI+ +ATG AGGVAY+GLKGN HV W K+CN Y K C H+GAS+AV+ F  IV
Sbjct  115   ILGIIASATGTAGGVAYVGLKGNKHVNWNKICNVYDKFCKHVGASVAVALFGSIV  169



>ref|XP_006419661.1| hypothetical protein CICLE_v10005986mg [Citrus clementina]
 gb|ESR32901.1| hypothetical protein CICLE_v10005986mg [Citrus clementina]
Length=188

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+K+TEL+S    P  PF + + AKFT SPAFIYFVA LSVA LY+II+ LAS  +++ K
Sbjct  43    TAKQTELVSA---PGIPFRVSVKAKFTDSPAFIYFVAALSVACLYSIITMLASL-SVVSK  98

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P     L+ +F   DVVMLGIV +ATGA+GGVAYIGLKGN H  WTK+CN Y K C H+G
Sbjct  99    PASAKRLLLYFAFWDVVMLGIVASATGASGGVAYIGLKGNDHSRWTKICNVYDKYCRHIG  158

Query  1919  AS  1914
             ++
Sbjct  159   SA  160



>sp|D2KQI6.1|CSPL1_BETVM RecName: Full=CASP-like protein Ni6; AltName: Full=CASP-like 
protein 1D1; Short=BvCASPL1D1 [Beta vulgaris subsp. maritima]
 gb|ADA71986.1| Ni6 protein [Beta vulgaris subsp. maritima]
Length=194

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = -3

Query  2432  STEPEKVAPTGSVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETELIS  2253
             S E EK    G+V T +A P       Y+V + ILR+LLLA+ + +VV+MVTSK+TE+I 
Sbjct  3     SMETEK----GAVPTPQAPPVAPTDNKYRVVDVILRVLLLAASIASVVLMVTSKQTEII-  57

Query  2252  VKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVS  2073
               + PF     P  AKF  SPAFIY VA LSVAGLY+II+ L S  + + KP   P L  
Sbjct  58    --VSPFGS--RPNAAKFQNSPAFIYLVAALSVAGLYSIITALVSL-SYMRKPIVPPKLFW  112

Query  2072  HFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFA  1893
               +I DV++LGIV  ATG AGGV YIGLKGN+HV W K+ N Y K C H+GAS+ VS FA
Sbjct  113   ILLIHDVLLLGIVAAATGTAGGVGYIGLKGNTHVRWGKIRNVYDKFCRHVGASIIVSLFA  172



>ref|XP_002516872.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RT03.1|CSPL5_RICCO RecName: Full=CASP-like protein 1D1; Short=RcCASPL1D1 [Ricinus 
communis]
 gb|EEF45486.1| conserved hypothetical protein [Ricinus communis]
Length=201

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+K+TEL  V     P   +P+ AKF  SPAFIYFVA LSVA LY+II+TLAS   ++ K
Sbjct  53    TAKQTELAPVP--GVPGLRVPVEAKFNHSPAFIYFVAALSVACLYSIITTLASL-GVIAK  109

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P +    + ++ + DV+MLGIV  ATGAAGGVAYIGLKGNSH  WTK+CN Y   C H+G
Sbjct  110   PIYATKFLFYYALWDVLMLGIVAAATGAAGGVAYIGLKGNSHTRWTKICNVYDTFCKHVG  169

Query  1919  ASLAVSFFAFIV  1884
             ++LA+S  A +V
Sbjct  170   SALAISLAASVV  181



>ref|XP_010548920.1| PREDICTED: CASP-like protein 1D1 [Tarenaya hassleriana]
Length=194

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 89/132 (67%), Gaps = 4/132 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             TSK+TEL+ V   P      P  AKFT SPA IYFVA LSVA  Y+I+STLAS  + + K
Sbjct  50    TSKQTELVPV---PGTRLRFPNPAKFTDSPALIYFVAALSVACFYSIVSTLASL-SAISK  105

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P     L  +  ILDV+MLGIV +ATGA GGVAYIGLKGN HV W K+CN Y K   H+G
Sbjct  106   PSCSSILFLYLAILDVMMLGIVASATGAGGGVAYIGLKGNKHVRWGKICNIYDKFSRHVG  165

Query  1919  ASLAVSFFAFIV  1884
              S+AVS FA +V
Sbjct  166   GSIAVSLFASVV  177



>ref|XP_006489150.1| PREDICTED: CASP-like protein RCOM_0679870-like [Citrus sinensis]
Length=188

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+K+TEL++    P  P  + + AKFT SPAFIYFVA LSVA LY+II+ LAS  +++ K
Sbjct  43    TAKQTELVT---PPGIPIRVSVKAKFTDSPAFIYFVAALSVACLYSIITMLASL-SVVSK  98

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P     L+ +F   DVVMLGIV +ATGA+GGVAYIGLKGN H  WTK+CN Y K C H+G
Sbjct  99    PASAKRLLLYFAFWDVVMLGIVASATGASGGVAYIGLKGNDHSRWTKICNVYDKYCRHIG  158

Query  1919  AS  1914
             ++
Sbjct  159   SA  160



>gb|KHN03003.1| CASP-like protein 7 [Glycine soja]
Length=193

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+ +TE+I V      P  +P  AKF  SPAF+YFVA LSV GLY+II+TLAS +    K
Sbjct  50    TANQTEVIRV------PQPVPWPAKFRYSPAFVYFVAALSVTGLYSIITTLASLFA-SNK  102

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSH-VGWTKVCNKYGKLCTHL  1923
             P     L+ +FI+ D ++LGI+ +ATG AGGVAY+GLKGN H VGW K+C+ Y K C H+
Sbjct  103   PALKTKLLLYFILWDALILGIIASATGTAGGVAYLGLKGNRHVVGWNKICHVYDKFCRHV  162

Query  1922  GASLAVSFFAFIV  1884
             GAS+AV+ F  +V
Sbjct  163   GASIAVALFGSVV  175



>gb|KDO75080.1| hypothetical protein CISIN_1g029779mg [Citrus sinensis]
Length=188

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 4/122 (3%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+K+TEL+S       P  + + AKFT SPAFIYFVA LSVA LY+II+ LAS  +++ K
Sbjct  43    TAKQTELVS---PAGIPIRVSVKAKFTDSPAFIYFVAALSVACLYSIITMLASL-SVVSK  98

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLG  1920
             P     L+ +F   DVVMLGIV +ATGA+GGV YIGLKGNSH  WTK+CN Y K C H+G
Sbjct  99    PASAKRLLLYFAFWDVVMLGIVASATGASGGVGYIGLKGNSHSRWTKICNVYDKYCRHIG  158

Query  1919  AS  1914
             ++
Sbjct  159   SA  160



>ref|XP_008390731.1| PREDICTED: CASP-like protein VIT_05s0020g01830 [Malus domestica]
Length=201

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 113/181 (62%), Gaps = 13/181 (7%)
 Frame = -3

Query  2426  EPE---KVAPTGSVETEKAGPSYKPKEYYKVTEailrllllaslvvavvvmVTSKETELI  2256
             +PE   KV P  S E  +A P     +Y  + +  +R L+ A+ + +V+VMVTSK+T   
Sbjct  9     DPETATKVVPPPSKEESEATPPPPKPDYLFLADVAIRFLVFAASLTSVLVMVTSKQTVFR  68

Query  2255  SVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALV  2076
                         P+ AKF  SPAFIYFVA LSVAGLY +++TLAS  +++ KP   P L+
Sbjct  69    G---------RFPVKAKFNHSPAFIYFVAALSVAGLYALLTTLASI-SVIWKPICPPKLL  118

Query  2075  SHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFF  1896
              HF  LDV++LG+V +ATG AGGVAYIG KGN HV W KVC+ + K C H+  SLA S F
Sbjct  119   LHFAFLDVLILGLVASATGTAGGVAYIGYKGNEHVMWQKVCSAFDKYCKHIAGSLATSLF  178

Query  1895  A  1893
             A
Sbjct  179   A  179



>ref|NP_001237481.1| CASP-like protein 1D1 [Glycine max]
 sp|C6SXZ3.1|CSPL8_SOYBN RecName: Full=CASP-like protein 1D1; Short=GmCASPL1D1 [Glycine 
max]
 gb|ACU14116.1| unknown [Glycine max]
Length=193

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T  +TE+I V      P  +P  AKF  +PAF+YFVA LSV GLY+II+TLAS +    K
Sbjct  50    TGNQTEVILV------PQPVPWPAKFRYTPAFVYFVAALSVTGLYSIITTLASLFASN-K  102

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSH-VGWTKVCNKYGKLCTHL  1923
             P     L+ +FI+ D ++LGI+ +ATG AGGVAY+GLKGNSH VGW K+C+ Y K C H+
Sbjct  103   PALKTKLLPYFILWDALILGIIASATGTAGGVAYLGLKGNSHVVGWNKICHVYDKFCRHV  162

Query  1922  GASLAVSFFAFIV  1884
             GAS+AV+ F  IV
Sbjct  163   GASIAVALFGSIV  175



>gb|KHN03390.1| CASP-like protein 8 [Glycine soja]
Length=193

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 8/133 (6%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T  +TE+I   L P P   +P  AKF  +PAF+YFVA LSV GLY+II+TLAS +    K
Sbjct  50    TGNQTEVI---LVPQP---VPWPAKFRYTPAFVYFVAALSVTGLYSIITTLASLFASN-K  102

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSH-VGWTKVCNKYGKLCTHL  1923
             P     L+ +FI+ D ++LGI+ +ATG AGGVAY+GLKGNSH VGW K+C+ Y K C H+
Sbjct  103   PALKTKLLLYFILWDALILGIIASATGTAGGVAYLGLKGNSHVVGWNKICHVYDKFCRHV  162

Query  1922  GASLAVSFFAFIV  1884
             GAS+AV+ F  IV
Sbjct  163   GASIAVALFGSIV  175



>ref|NP_001238662.1| CASP-like protein 1D2 [Glycine max]
 sp|C6SVQ5.1|CSPL7_SOYBN RecName: Full=CASP-like protein 1D2; Short=GmCASPL1D2 [Glycine 
max]
 gb|ACU13328.1| unknown [Glycine max]
Length=193

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = -3

Query  2279  TSKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  2100
             T+ +TE+I V      P  +P  AKF  SPAF+YFVA LSV GLY+II+TLAS      K
Sbjct  50    TANQTEVIRV------PQPVPWPAKFRYSPAFVYFVAALSVTGLYSIITTLASLLA-SNK  102

Query  2099  PGFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSH-VGWTKVCNKYGKLCTHL  1923
             P     L+ +FI+ D ++LGI+ +ATG AGGVAY+GLKGN H VGW K+C+ Y K C H+
Sbjct  103   PALKTKLLLYFILWDALILGIIASATGTAGGVAYLGLKGNRHVVGWNKICHVYDKFCRHV  162

Query  1922  GASLAVSFFAFIV  1884
             GAS+AV+ F  +V
Sbjct  163   GASIAVALFGSVV  175



>ref|XP_010024567.1| PREDICTED: CASP-like protein 1 [Eucalyptus grandis]
Length=206

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 5/124 (4%)
 Frame = -3

Query  2276  SKETELISVKLDPFPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKP  2097
             SK+T+++  +    PP +    AKF  SPAFIYFVA LSVA LY+I++ LAS  ++++KP
Sbjct  63    SKQTKVLLRR----PPSVAFAEAKFDNSPAFIYFVAALSVACLYSIVTALASI-SVVLKP  117

Query  2096  GFCPALVSHFIILDVVMLgivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGA  1917
              F  + +  F++ DVVMLG+V +ATG AGGVAYIGLKGNSH  W K CN Y K C HL A
Sbjct  118   AFSASFLLFFVVSDVVMLGLVASATGTAGGVAYIGLKGNSHERWEKFCNVYDKFCQHLAA  177

Query  1916  SLAV  1905
             S+AV
Sbjct  178   SIAV  181



>ref|XP_010036808.1| PREDICTED: CASP-like protein 1D1 [Eucalyptus grandis]
 gb|KCW84416.1| hypothetical protein EUGRSUZ_B01267 [Eucalyptus grandis]
Length=221

 Score = 97.4 bits (241),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -3

Query  2219  PLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILDVVMLg  2040
             P+ AKF  SPA +YFVA LSVAGLY+II+ LAS  ++++ P F  +    F+I DVV+LG
Sbjct  91    PVEAKFQNSPAIVYFVAALSVAGLYSIITVLASI-SVILTPIFAASFQLFFLISDVVVLG  149

Query  2039  ivgtatgaaggvayiGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIV  1884
             +V +ATG AG V YIGLKG++H  W KVCN Y K C H+G++ AVS FA +V
Sbjct  150   LVASATGTAGTVGYIGLKGDTHANWGKVCNVYDKFCQHIGSATAVSLFAAVV  201



>ref|WP_020588900.1| hypothetical protein [Desulfobacter curvatus]
Length=290

 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 91/319 (29%), Positives = 143/319 (45%), Gaps = 51/319 (16%)
 Frame = +3

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARE-----RSGIRGSNSKEDTLQQLSGANVCF  575
             IL+ GSTGY+G ++A EL +R +   AIAR      ++ I  +   +  L        C 
Sbjct  4     ILLAGSTGYLGIYIAKELQQRSYFFRAIARSPEKLAKNDIEANEILKAELTDPDSIKKCC  63

Query  576   SDVTelssleksveslGVPIDVVVSCLA-SRNGGVKDSWKIDYEATKNSLVVGRKFGAAH  752
               V                 D+V+S +  +R         +DY+A  N L+  +K GA  
Sbjct  64    EGV-----------------DIVISTVGITRQKDGLTYMDVDYQANMNLLIEAQKSGAKK  106

Query  753   FVLLSAICVQKPLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLAGQVELVKD  932
             F+ +S +  +K     +  K+    +L  E     G  Y IVRP  FF  ++    + K+
Sbjct  107   FIYISVLNGEK----LRNLKICDAKELFVEQLKRSGIDYCIVRPNGFFSDMSEIFNMAKN  162

Query  933   GKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTPLEQGEMLF  1112
             G+ Y +FG GKL A  PI  EDLA+F   CV + +K ++ + IGGP + LT  E   M F
Sbjct  163   GRIY-LFGKGKLKA-NPIHGEDLATF---CVDAIEKPDKEVEIGGP-ETLTQNEMASMAF  216

Query  1113  KLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESMLVWDPEKG  1292
             K+ G + K   +P  I   A+  + L+         +  +G +  +    +M +  PE  
Sbjct  217   KVLGDKPKITYIPDWIRVAALKLVKLVTI-------SRFYGPVEFFMTVMAMDMLAPE--  267

Query  1293  EYDAENTPSYGKDTLEEFF  1349
                      YG  TL+E+F
Sbjct  268   ---------YGNHTLKEYF  277



>ref|WP_026738272.1| NAD-dependent dehydratase [Leptotrichia goodfellowii]
Length=290

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 95/330 (29%), Positives = 148/330 (45%), Gaps = 60/330 (18%)
 Frame = +3

Query  411   ILVVGSTGYIGRFVATELVKRGFSVIAIARERSGIRGSNSKEDTLQ----QLSGANV---  569
             I++ GSTGY+G ++ +EL+KR +SV A+ R +S I+    K   L+    +L+       
Sbjct  4     IMLAGSTGYLGSYILSELLKRNYSVKAVVRNKSKIKEEFLKNKNLEIFEAELTNPQTLKD  63

Query  570   CFSDVTelssleksveslGVPIDVVVSCLA-SRNGGVKDSWKIDYEATKNSLVVGRKF--  740
             C  DV                 DVV+S +  +R         +DY+A  N L    KF  
Sbjct  64    CCKDV-----------------DVVISTVGITRQKDGLTYMDVDYQANVNLLREAEKFVD  106

Query  741   ---GAAHFVLLSAICVQK-PLLEFQRAKLKFEGDLMKEAEDDKGFTYSIVRPTAFFKSLA  908
                    F+ +S    +K       +AK KF  +L     D     Y ++RPT FF  ++
Sbjct  107   NGKSKKRFIYISVFNEEKIENTALCKAKEKFVKELKNSRLD-----YCVIRPTGFFSDIS  161

Query  909   GQVELVKDGKPYVMFGDGKLCACKPISEEDLASFISDCVLSEDKINQVLPIGGPGKALTP  1088
                ++ + GK Y +FG G+     PI  EDLA F   CV       Q  P+GGP +  T 
Sbjct  162   EIFKMAERGKVY-LFGKGEY-RMNPIHGEDLAEF---CVNRIHSSEQEFPVGGP-EIFTQ  215

Query  1089  LEQGEMLFKLAGKEAKFIKVPIQIMDFAIGFLDLLVKVFPSLEDAAEFGKIGRYYAAESM  1268
              E   + FK++GK+ K + +  +I         L++K+   L    +FG I  +  A S+
Sbjct  216   KELSRVAFKISGKKEKIVYISDKIR-------VLILKIGKFLMPKTKFGPIEFFLNAMSI  268

Query  1269  LVWDPEKGEYDAENTPSYGKDTLEEFFKRV  1358
              +  PE           YGK T+EE+F+ +
Sbjct  269   DMVAPE-----------YGKHTIEEYFEEL  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8131442887640