BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85774_g1_i1 len=968 path=[1:0-967]

Length=968
                                                                      Score     E

ref|XP_008393427.1|  PREDICTED: probable ADP-ribosylation factor ...    260   7e-83   
ref|XP_009360077.1|  PREDICTED: probable ADP-ribosylation factor ...    259   3e-82   
ref|XP_008374850.1|  PREDICTED: probable ADP-ribosylation factor ...    258   6e-82   
ref|XP_008240150.1|  PREDICTED: probable ADP-ribosylation factor ...    258   8e-82   
ref|XP_007209663.1|  hypothetical protein PRUPE_ppa012140mg             257   1e-81   
ref|XP_009356038.1|  PREDICTED: probable ADP-ribosylation factor ...    257   2e-81   
ref|XP_010033755.1|  PREDICTED: probable ADP-ribosylation factor ...    256   5e-81   
ref|XP_010663685.1|  PREDICTED: probable ADP-ribosylation factor ...    255   1e-80   
ref|XP_010036952.1|  PREDICTED: probable ADP-ribosylation factor ...    253   3e-80   
ref|XP_007036844.1|  Calcium-dependent lipid-binding (CaLB domain...    253   4e-80   
gb|EYU24145.1|  hypothetical protein MIMGU_mgv1a018362mg                253   7e-80   
ref|XP_004299529.1|  PREDICTED: probable ADP-ribosylation factor ...    252   8e-80   
emb|CAN69475.1|  hypothetical protein VITISV_014376                     250   3e-79   Vitis vinifera
gb|KDP23927.1|  hypothetical protein JCGZ_27087                         251   3e-79   
ref|XP_002530486.1|  ARF GTPase activator, putative                     249   2e-78   Ricinus communis
ref|XP_010097555.1|  putative ADP-ribosylation factor GTPase-acti...    248   4e-78   
ref|XP_009783267.1|  PREDICTED: probable ADP-ribosylation factor ...    247   5e-78   
ref|XP_010678069.1|  PREDICTED: probable ADP-ribosylation factor ...    246   2e-77   
ref|XP_008464579.1|  PREDICTED: probable ADP-ribosylation factor ...    247   2e-77   
ref|XP_009614861.1|  PREDICTED: probable ADP-ribosylation factor ...    245   3e-77   
ref|XP_006587472.1|  PREDICTED: probable ADP-ribosylation factor ...    245   4e-77   
ref|XP_006490774.1|  PREDICTED: probable ADP-ribosylation factor ...    246   5e-77   
ref|XP_009595957.1|  PREDICTED: probable ADP-ribosylation factor ...    244   6e-77   
ref|XP_006451620.1|  hypothetical protein CICLE_v10009524mg             246   6e-77   
ref|XP_011072997.1|  PREDICTED: probable ADP-ribosylation factor ...    244   7e-77   
ref|XP_003534141.2|  PREDICTED: probable ADP-ribosylation factor ...    244   2e-76   
ref|XP_009796427.1|  PREDICTED: probable ADP-ribosylation factor ...    243   4e-76   
ref|XP_010314227.1|  PREDICTED: probable ADP-ribosylation factor ...    243   4e-76   
dbj|BAO02515.1|  predicted C2 domain containing protein                 243   4e-76   
ref|XP_009761742.1|  PREDICTED: probable ADP-ribosylation factor ...    243   6e-76   
ref|XP_003631121.1|  Pollen-specific C2 domain containing protein       242   1e-75   
emb|CDO98346.1|  unnamed protein product                                241   1e-75   
gb|AFK44826.1|  unknown                                                 241   1e-75   
gb|ACD40010.1|  pollen-specific C2 domain containing protein            242   1e-75   Nicotiana alata [flowering tobacco]
ref|XP_009628522.1|  PREDICTED: probable ADP-ribosylation factor ...    241   2e-75   
ref|XP_008453481.1|  PREDICTED: probable ADP-ribosylation factor ...    241   2e-75   
ref|XP_010533970.1|  PREDICTED: probable ADP-ribosylation factor ...    241   2e-75   
gb|ACD40015.1|  pollen-specific C2 domain containing protein            241   3e-75   Nicotiana bonariensis
ref|XP_004235813.1|  PREDICTED: probable ADP-ribosylation factor ...    240   3e-75   
ref|XP_006341525.1|  PREDICTED: probable ADP-ribosylation factor ...    240   3e-75   
ref|XP_003528987.1|  PREDICTED: probable ADP-ribosylation factor ...    240   4e-75   
ref|XP_004137503.1|  PREDICTED: probable ADP-ribosylation factor ...    241   4e-75   
ref|XP_008464514.1|  PREDICTED: probable ADP-ribosylation factor ...    243   5e-75   
emb|CDY51927.1|  BnaAnng11040D                                          239   9e-75   
gb|ACD40018.1|  pollen-specific C2 domain containing protein            239   1e-74   Nicotiana tabacum [American tobacco]
ref|XP_006346641.1|  PREDICTED: probable ADP-ribosylation factor ...    239   1e-74   
ref|XP_004503269.1|  PREDICTED: probable ADP-ribosylation factor ...    238   3e-74   
ref|XP_006365412.1|  PREDICTED: probable ADP-ribosylation factor ...    238   3e-74   
ref|XP_009145950.1|  PREDICTED: probable ADP-ribosylation factor ...    238   3e-74   
ref|XP_006406667.1|  hypothetical protein EUTSA_v10022004mg             238   4e-74   
gb|AFK34568.1|  unknown                                                 237   6e-74   
ref|XP_004235812.1|  PREDICTED: probable ADP-ribosylation factor ...    237   6e-74   
ref|XP_006299051.1|  hypothetical protein CARUB_v10015190mg             237   9e-74   
ref|NP_188425.2|  calcium-dependent lipid-binding domain-containi...    236   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891444.1|  C2 domain-containing protein                       236   2e-73   
emb|CDX75953.1|  BnaC03g40360D                                          236   3e-73   
ref|XP_006341526.1|  PREDICTED: probable ADP-ribosylation factor ...    234   4e-73   
gb|EYU33973.1|  hypothetical protein MIMGU_mgv1a014822mg                235   4e-73   
gb|KHG01667.1|  hypothetical protein F383_21926                         235   6e-73   
ref|XP_010506220.1|  PREDICTED: probable ADP-ribosylation factor ...    234   1e-72   
ref|XP_004137344.1|  PREDICTED: probable ADP-ribosylation factor ...    233   3e-72   
gb|ACD40017.1|  pollen-specific C2 domain containing protein            233   3e-72   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002534010.1|  ARF GTPase activator, putative                     233   3e-72   Ricinus communis
ref|XP_010263871.1|  PREDICTED: probable ADP-ribosylation factor ...    233   3e-72   
ref|XP_009135561.1|  PREDICTED: probable ADP-ribosylation factor ...    233   4e-72   
ref|XP_010465871.1|  PREDICTED: probable ADP-ribosylation factor ...    232   6e-72   
ref|XP_003525186.2|  PREDICTED: probable ADP-ribosylation factor ...    231   8e-72   
ref|XP_010461749.1|  PREDICTED: probable ADP-ribosylation factor ...    231   8e-72   
gb|AFK33467.1|  unknown                                                 231   8e-72   
ref|XP_006430620.1|  hypothetical protein CICLE_v10012950mg             231   9e-72   
ref|XP_010540029.1|  PREDICTED: probable ADP-ribosylation factor ...    231   1e-71   
ref|XP_006482135.1|  PREDICTED: probable ADP-ribosylation factor ...    230   2e-71   
gb|KDP33163.1|  hypothetical protein JCGZ_13428                         230   2e-71   
ref|XP_009370093.1|  PREDICTED: probable ADP-ribosylation factor ...    230   3e-71   
ref|XP_006584907.1|  PREDICTED: probable ADP-ribosylation factor ...    230   3e-71   
ref|NP_001185174.1|  calcium-dependent lipid-binding family protein     231   3e-71   
ref|XP_002275235.1|  PREDICTED: probable ADP-ribosylation factor ...    229   4e-71   Vitis vinifera
ref|NP_175292.2|  calcium-dependent lipid-binding family protein        229   5e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004241660.1|  PREDICTED: probable ADP-ribosylation factor ...    229   7e-71   
ref|XP_010461682.1|  PREDICTED: probable ADP-ribosylation factor ...    229   7e-71   
ref|XP_007152688.1|  hypothetical protein PHAVU_004G150800g             229   8e-71   
gb|KDO50844.1|  hypothetical protein CISIN_1g031128mg                   228   1e-70   
ref|XP_010274726.1|  PREDICTED: probable ADP-ribosylation factor ...    227   5e-70   
ref|XP_007033034.1|  Calcium-dependent lipid-binding (CaLB domain...    226   7e-70   
ref|XP_011084199.1|  PREDICTED: probable ADP-ribosylation factor ...    227   8e-70   
emb|CDX77307.1|  BnaC08g03520D                                          226   1e-69   
ref|XP_006304555.1|  hypothetical protein CARUB_v10011546mg             226   1e-69   
ref|XP_010500393.1|  PREDICTED: probable ADP-ribosylation factor ...    225   2e-69   
ref|XP_010032689.1|  PREDICTED: probable ADP-ribosylation factor ...    225   3e-69   
ref|XP_006390540.1|  hypothetical protein EUTSA_v10019153mg             226   3e-69   
emb|CDY47746.1|  BnaA02g16490D                                          224   4e-69   
ref|XP_004503138.1|  PREDICTED: probable ADP-ribosylation factor ...    224   5e-69   
ref|XP_010471418.1|  PREDICTED: probable ADP-ribosylation factor ...    224   5e-69   
ref|XP_008381348.1|  PREDICTED: probable ADP-ribosylation factor ...    224   5e-69   
ref|XP_007217177.1|  hypothetical protein PRUPE_ppa012484mg             224   5e-69   
ref|XP_009107346.1|  PREDICTED: probable ADP-ribosylation factor ...    224   5e-69   
ref|XP_009135560.1|  PREDICTED: probable ADP-ribosylation factor ...    225   6e-69   
emb|CDX82060.1|  BnaC02g22300D                                          224   6e-69   
ref|XP_010471417.1|  PREDICTED: probable ADP-ribosylation factor ...    224   7e-69   
gb|KHG02007.1|  hypothetical protein F383_24715                         224   8e-69   
emb|CDX95800.1|  BnaC05g35510D                                          239   9e-69   
ref|XP_010032690.1|  PREDICTED: probable ADP-ribosylation factor ...    223   9e-69   
ref|XP_006301267.1|  hypothetical protein CARUB_v10021667mg             223   1e-68   
ref|XP_009127999.1|  PREDICTED: probable ADP-ribosylation factor ...    223   1e-68   
gb|KDO50845.1|  hypothetical protein CISIN_1g031128mg                   223   1e-68   
ref|XP_010428284.1|  PREDICTED: probable ADP-ribosylation factor ...    223   2e-68   
ref|XP_008229191.1|  PREDICTED: probable ADP-ribosylation factor ...    223   2e-68   
ref|XP_002317873.1|  GTPase activating family protein                   223   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_004512742.1|  PREDICTED: probable ADP-ribosylation factor ...    223   3e-68   
emb|CDX92180.1|  BnaA05g22270D                                          238   4e-68   
gb|ACJ83963.1|  unknown                                                 222   4e-68   Medicago truncatula
ref|XP_003552975.1|  PREDICTED: probable ADP-ribosylation factor ...    222   4e-68   
ref|XP_011039132.1|  PREDICTED: probable ADP-ribosylation factor ...    221   6e-68   
ref|XP_010416168.1|  PREDICTED: probable ADP-ribosylation factor ...    221   7e-68   
ref|NP_001235515.1|  uncharacterized protein LOC100306214               221   7e-68   
ref|XP_010500394.1|  PREDICTED: probable ADP-ribosylation factor ...    221   1e-67   
gb|AGV54351.1|  ADP-ribosylation factor GTPase-activating protein...    221   1e-67   
gb|KGN63876.1|  hypothetical protein Csa_1G025080                       221   2e-67   
ref|XP_007163391.1|  hypothetical protein PHAVU_001G230800g             221   2e-67   
ref|XP_004288398.1|  PREDICTED: probable ADP-ribosylation factor ...    220   2e-67   
ref|XP_010032687.1|  PREDICTED: probable ADP-ribosylation factor ...    220   2e-67   
ref|XP_002887489.1|  C2 domain-containing protein                       219   3e-67   
gb|KEH36497.1|  calcium-dependent lipid-binding (CaLB domain) fam...    219   4e-67   
ref|NP_177499.1|  C2 domain-containing protein                          219   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284632.1|  PREDICTED: probable ADP-ribosylation factor ...    219   6e-67   Vitis vinifera
ref|XP_011073630.1|  PREDICTED: probable ADP-ribosylation factor ...    219   7e-67   
ref|XP_004145835.1|  PREDICTED: probable ADP-ribosylation factor ...    218   9e-67   
ref|XP_004160109.1|  PREDICTED: probable ADP-ribosylation factor ...    218   1e-66   
ref|XP_008457050.1|  PREDICTED: probable ADP-ribosylation factor ...    218   2e-66   
ref|XP_006383322.1|  hypothetical protein POPTR_0005s14500g             218   2e-66   
ref|XP_009370100.1|  PREDICTED: probable ADP-ribosylation factor ...    218   2e-66   
ref|XP_008381350.1|  PREDICTED: probable ADP-ribosylation factor ...    217   2e-66   
ref|XP_008353839.1|  PREDICTED: probable ADP-ribosylation factor ...    216   9e-66   
ref|XP_009381108.1|  PREDICTED: probable ADP-ribosylation factor ...    216   1e-65   
ref|XP_007216470.1|  hypothetical protein PRUPE_ppa025942mg             215   1e-65   
ref|XP_008343060.1|  PREDICTED: probable ADP-ribosylation factor ...    214   3e-65   
ref|XP_010670143.1|  PREDICTED: probable ADP-ribosylation factor ...    215   3e-65   
ref|XP_009370097.1|  PREDICTED: probable ADP-ribosylation factor ...    214   3e-65   
ref|XP_008809823.1|  PREDICTED: probable ADP-ribosylation factor ...    214   4e-65   
gb|KHG03449.1|  hypothetical protein F383_28229                         214   4e-65   
ref|XP_011021393.1|  PREDICTED: probable ADP-ribosylation factor ...    214   5e-65   
ref|XP_009381107.1|  PREDICTED: probable ADP-ribosylation factor ...    214   6e-65   
ref|XP_008368712.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    213   7e-65   
ref|XP_010109009.1|  putative ADP-ribosylation factor GTPase-acti...    213   1e-64   
ref|XP_008381349.1|  PREDICTED: probable ADP-ribosylation factor ...    213   1e-64   
ref|XP_011099467.1|  PREDICTED: probable ADP-ribosylation factor ...    212   2e-64   
ref|XP_010109014.1|  Bifunctional glutamate/proline--tRNA ligase        222   3e-64   
ref|XP_008358166.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    212   3e-64   
ref|XP_003619827.1|  Multiple C2 and transmembrane domain-contain...    212   3e-64   
ref|XP_004288393.1|  PREDICTED: probable ADP-ribosylation factor ...    211   4e-64   
ref|XP_002305199.1|  hypothetical protein POPTR_0004s08840g             211   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_009334450.1|  PREDICTED: probable ADP-ribosylation factor ...    211   6e-64   
ref|XP_010062251.1|  PREDICTED: probable ADP-ribosylation factor ...    211   6e-64   
ref|XP_010928845.1|  PREDICTED: probable ADP-ribosylation factor ...    211   7e-64   
emb|CDP02696.1|  unnamed protein product                                211   7e-64   
ref|XP_011023699.1|  PREDICTED: probable ADP-ribosylation factor ...    211   1e-63   
ref|XP_011023692.1|  PREDICTED: probable ADP-ribosylation factor ...    211   1e-63   
ref|XP_011002782.1|  PREDICTED: probable ADP-ribosylation factor ...    210   1e-63   
ref|XP_002527798.1|  ARF GTPase activator, putative                     210   1e-63   Ricinus communis
ref|XP_009612263.1|  PREDICTED: probable ADP-ribosylation factor ...    210   2e-63   
ref|XP_008789738.1|  PREDICTED: probable ADP-ribosylation factor ...    209   3e-63   
ref|XP_010916494.1|  PREDICTED: probable ADP-ribosylation factor ...    209   3e-63   
ref|XP_009370095.1|  PREDICTED: probable ADP-ribosylation factor ...    209   3e-63   
ref|XP_004231984.1|  PREDICTED: probable ADP-ribosylation factor ...    209   4e-63   
ref|XP_011023686.1|  PREDICTED: probable ADP-ribosylation factor ...    209   5e-63   
ref|XP_007160540.1|  hypothetical protein PHAVU_002G330200g             208   8e-63   
ref|XP_006379768.1|  hypothetical protein POPTR_0008s13070g             208   1e-62   
ref|XP_006357769.1|  PREDICTED: probable ADP-ribosylation factor ...    207   1e-62   
ref|XP_002312449.1|  C2 domain-containing family protein                207   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011038617.1|  PREDICTED: probable ADP-ribosylation factor ...    208   2e-62   
ref|XP_006843797.1|  hypothetical protein AMTR_s00007p00250850          207   3e-62   
ref|XP_009388652.1|  PREDICTED: probable ADP-ribosylation factor ...    207   3e-62   
ref|XP_010066605.1|  PREDICTED: probable ADP-ribosylation factor ...    207   3e-62   
ref|XP_002314800.1|  C2 domain-containing family protein                207   3e-62   Populus trichocarpa [western balsam poplar]
ref|XP_004233475.1|  PREDICTED: probable ADP-ribosylation factor ...    207   3e-62   
gb|KFK41793.1|  hypothetical protein AALP_AA2G172800                    222   4e-62   
ref|XP_007215077.1|  hypothetical protein PRUPE_ppa012537mg             206   4e-62   
ref|XP_010551808.1|  PREDICTED: probable ADP-ribosylation factor ...    206   8e-62   
ref|XP_009370094.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
ref|XP_004292368.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
ref|XP_009403742.1|  PREDICTED: probable ADP-ribosylation factor ...    204   3e-61   
ref|XP_008804356.1|  PREDICTED: probable ADP-ribosylation factor ...    204   3e-61   
gb|EYU44565.1|  hypothetical protein MIMGU_mgv1a015143mg                204   4e-61   
ref|XP_006346891.1|  PREDICTED: probable ADP-ribosylation factor ...    203   8e-61   
ref|XP_007045191.1|  Calcium-dependent lipid-binding family protein     206   1e-60   
ref|XP_009370096.1|  PREDICTED: probable ADP-ribosylation factor ...    203   1e-60   
ref|XP_004288396.1|  PREDICTED: probable ADP-ribosylation factor ...    202   1e-60   
ref|XP_009370098.1|  PREDICTED: probable ADP-ribosylation factor ...    201   5e-60   
ref|XP_010527744.1|  PREDICTED: probable ADP-ribosylation factor ...    201   6e-60   
ref|XP_010109008.1|  putative ADP-ribosylation factor GTPase-acti...    201   8e-60   
ref|XP_009413360.1|  PREDICTED: probable ADP-ribosylation factor ...    200   9e-60   
ref|XP_010032686.1|  PREDICTED: probable ADP-ribosylation factor ...    200   1e-59   
gb|KFK33274.1|  hypothetical protein AALP_AA6G353800                    200   2e-59   
ref|XP_010926484.1|  PREDICTED: probable ADP-ribosylation factor ...    199   2e-59   
ref|XP_006843793.1|  hypothetical protein AMTR_s00007p00249830          199   2e-59   
gb|KFK38033.1|  hypothetical protein AALP_AA3G061600                    208   3e-59   
ref|XP_010095718.1|  ADP-ribosylation factor GTPase-activating pr...    199   5e-59   
ref|XP_006405837.1|  hypothetical protein EUTSA_v10027968mg             198   7e-59   
ref|XP_006448228.1|  hypothetical protein CICLE_v10017596mg             198   9e-59   
ref|XP_006469315.1|  PREDICTED: probable ADP-ribosylation factor ...    198   9e-59   
gb|KDP38077.1|  hypothetical protein JCGZ_04720                         198   9e-59   
ref|XP_004289564.1|  PREDICTED: probable ADP-ribosylation factor ...    197   2e-58   
ref|XP_010435613.1|  PREDICTED: probable ADP-ribosylation factor ...    197   3e-58   
gb|KDO64606.1|  hypothetical protein CISIN_1g048685mg                   197   3e-58   
ref|XP_010264070.1|  PREDICTED: probable ADP-ribosylation factor ...    196   3e-58   
ref|XP_002868538.1|  C2 domain-containing protein                       196   4e-58   
ref|XP_006346892.1|  PREDICTED: probable ADP-ribosylation factor ...    196   5e-58   
ref|XP_004233474.1|  PREDICTED: probable ADP-ribosylation factor ...    196   5e-58   
ref|XP_010263947.1|  PREDICTED: probable ADP-ribosylation factor ...    196   6e-58   
emb|CDY27005.1|  BnaC06g12210D                                          195   1e-57   
ref|XP_009370099.1|  PREDICTED: probable ADP-ribosylation factor ...    195   1e-57   
ref|XP_006282746.1|  hypothetical protein CARUB_v10005899mg             195   2e-57   
ref|XP_009144399.1|  PREDICTED: probable ADP-ribosylation factor ...    194   2e-57   
ref|XP_010264139.1|  PREDICTED: probable ADP-ribosylation factor ...    193   3e-57   
gb|KFK41059.1|  hypothetical protein AALP_AA2G080100                    194   3e-57   
emb|CBI26876.3|  unnamed protein product                                192   4e-57   
ref|XP_009140159.1|  PREDICTED: probable ADP-ribosylation factor ...    193   5e-57   
ref|XP_010263993.1|  PREDICTED: probable ADP-ribosylation factor ...    193   5e-57   
ref|XP_010450531.1|  PREDICTED: probable ADP-ribosylation factor ...    193   6e-57   
ref|XP_009403741.1|  PREDICTED: probable ADP-ribosylation factor ...    193   7e-57   
ref|XP_010511455.1|  PREDICTED: probable ADP-ribosylation factor ...    193   8e-57   
ref|XP_006647209.1|  PREDICTED: probable ADP-ribosylation factor ...    192   8e-57   
ref|XP_009787765.1|  PREDICTED: probable ADP-ribosylation factor ...    192   9e-57   
ref|XP_009420619.1|  PREDICTED: probable ADP-ribosylation factor ...    192   9e-57   
emb|CDY01709.1|  BnaC04g30430D                                          192   1e-56   
gb|ADZ44598.1|  C2 domain-containing protein                            192   1e-56   
ref|XP_009139749.1|  PREDICTED: probable ADP-ribosylation factor ...    192   1e-56   
ref|XP_003572790.1|  PREDICTED: probable ADP-ribosylation factor ...    192   2e-56   
ref|XP_006300898.1|  hypothetical protein CARUB_v10021265mg             192   2e-56   
gb|ADZ44599.1|  C2 domain-containing protein                            192   2e-56   
ref|XP_007227534.1|  hypothetical protein PRUPE_ppa012480mg             192   2e-56   
ref|NP_198590.1|  calcium-dependent lipid-binding domain-containi...    192   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221419.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    192   2e-56   
ref|NP_564873.1|  calcium-dependent lipid-binding domain-containi...    192   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298477.1|  PREDICTED: probable ADP-ribosylation factor ...    192   2e-56   
ref|XP_009602442.1|  PREDICTED: probable ADP-ribosylation factor ...    191   4e-56   
ref|XP_009139747.1|  PREDICTED: probable ADP-ribosylation factor ...    191   5e-56   
gb|AGJ81360.1|  small C2 domain protein                                 191   5e-56   
emb|CAN67438.1|  hypothetical protein VITISV_020351                     190   6e-56   Vitis vinifera
emb|CDY11544.1|  BnaC06g31950D                                          191   6e-56   
ref|XP_008229192.1|  PREDICTED: probable ADP-ribosylation factor ...    190   6e-56   
ref|NP_001046709.1|  Os02g0327000                                       190   6e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009606380.1|  PREDICTED: probable ADP-ribosylation factor ...    190   7e-56   
ref|XP_002887025.1|  predicted protein                                  190   8e-56   
ref|XP_004298475.1|  PREDICTED: probable ADP-ribosylation factor ...    190   1e-55   
emb|CDX96152.1|  BnaA07g25790D                                          189   2e-55   
ref|XP_009105201.1|  PREDICTED: probable ADP-ribosylation factor ...    189   2e-55   
ref|NP_001288871.1|  probable ADP-ribosylation factor GTPase-acti...    189   2e-55   
gb|KFK38029.1|  hypothetical protein AALP_AA3G061000                    201   2e-55   
ref|XP_010470512.1|  PREDICTED: probable ADP-ribosylation factor ...    189   3e-55   
gb|AGJ81361.1|  small C2 domain protein                                 189   3e-55   
ref|XP_004498288.1|  PREDICTED: probable ADP-ribosylation factor ...    188   5e-55   
ref|XP_010419006.1|  PREDICTED: probable ADP-ribosylation factor ...    192   5e-55   
ref|XP_009793873.1|  PREDICTED: probable ADP-ribosylation factor ...    188   5e-55   
ref|XP_006391390.1|  hypothetical protein EUTSA_v10019623mg             192   5e-55   
ref|NP_565002.1|  Calcium-dependent lipid-binding (CaLB domain) f...    188   6e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07499.1|  BnaA07g25780D                                          187   1e-54   
ref|XP_006390839.1|  hypothetical protein EUTSA_v10019195mg             188   1e-54   
ref|XP_004150594.1|  PREDICTED: probable ADP-ribosylation factor ...    187   2e-54   
emb|CDX99693.1|  BnaC04g34500D                                          187   2e-54   
ref|XP_004952325.1|  PREDICTED: probable ADP-ribosylation factor ...    187   2e-54   
gb|EYU41340.1|  hypothetical protein MIMGU_mgv1a015009mg                187   2e-54   
ref|XP_008358047.1|  PREDICTED: probable ADP-ribosylation factor ...    187   2e-54   
ref|NP_001132168.1|  uncharacterized protein LOC100193590               186   2e-54   Zea mays [maize]
gb|AAK25852.1|AF360142_1  unknown protein                               186   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003589656.1|  ADP-ribosylation factor GTPase-activating pr...    186   3e-54   
ref|NP_001242572.1|  uncharacterized protein LOC100788395               187   3e-54   
ref|XP_006602006.1|  PREDICTED: probable ADP-ribosylation factor ...    185   3e-54   
ref|XP_009418909.1|  PREDICTED: probable ADP-ribosylation factor ...    186   4e-54   
gb|AFD22862.1|  GTPase activator ARF                                    187   5e-54   
ref|XP_010427870.1|  PREDICTED: probable ADP-ribosylation factor ...    186   5e-54   
ref|XP_006302873.1|  hypothetical protein CARUB_v10021004mg             186   5e-54   
gb|KFK41507.1|  hypothetical protein AALP_AA2G138700                    186   6e-54   
gb|KFK41508.1|  hypothetical protein AALP_AA2G138800                    185   7e-54   
ref|XP_004240994.1|  PREDICTED: probable ADP-ribosylation factor ...    185   7e-54   
ref|XP_006350734.1|  PREDICTED: probable ADP-ribosylation factor ...    185   8e-54   
ref|XP_008467129.1|  PREDICTED: probable ADP-ribosylation factor ...    185   9e-54   
ref|NP_565001.1|  calcium-dependent lipid-binding domain-containi...    186   9e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390837.1|  hypothetical protein EUTSA_v10019241mg             184   1e-53   
ref|XP_006843794.1|  hypothetical protein AMTR_s00007p00250120          184   1e-53   
ref|XP_010276305.1|  PREDICTED: probable ADP-ribosylation factor ...    183   1e-53   
ref|XP_010552702.1|  PREDICTED: probable ADP-ribosylation factor ...    185   2e-53   
ref|XP_002887328.1|  C2 domain-containing protein                       185   2e-53   
ref|XP_010427874.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    184   2e-53   
ref|XP_010926483.1|  PREDICTED: probable ADP-ribosylation factor ...    184   2e-53   
ref|XP_010419142.1|  PREDICTED: probable ADP-ribosylation factor ...    185   2e-53   
emb|CDX74562.1|  BnaA04g08270D                                          184   2e-53   
ref|XP_009105748.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    184   3e-53   
ref|XP_003553851.1|  PREDICTED: probable ADP-ribosylation factor ...    184   3e-53   
ref|XP_010427869.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    186   3e-53   
gb|ACT32453.1|  C2 domain-containing protein                            183   4e-53   
ref|XP_002887330.1|  C2 domain-containing protein                       183   4e-53   
ref|XP_010471080.1|  PREDICTED: probable ADP-ribosylation factor ...    183   5e-53   
ref|NP_001190431.1|  calcium-dependent lipid-binding domain-conta...    183   6e-53   
gb|EMT18411.1|  hypothetical protein F775_32222                         183   7e-53   
ref|XP_010471084.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    182   1e-52   
ref|XP_006586679.1|  PREDICTED: uncharacterized protein LOC100788...    182   1e-52   
gb|KHN05765.1|  Putative ADP-ribosylation factor GTPase-activatin...    182   1e-52   
ref|XP_010692569.1|  PREDICTED: probable ADP-ribosylation factor ...    182   2e-52   
ref|XP_010415770.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    181   3e-52   
gb|ACU14102.1|  unknown                                                 181   3e-52   
ref|XP_010527786.1|  PREDICTED: probable ADP-ribosylation factor ...    181   3e-52   
emb|CDY27654.1|  BnaUnng00040D                                          181   3e-52   
ref|XP_009392867.1|  PREDICTED: probable ADP-ribosylation factor ...    181   3e-52   
ref|XP_002455977.1|  hypothetical protein SORBIDRAFT_03g028370          181   3e-52   
ref|XP_009114231.1|  PREDICTED: probable ADP-ribosylation factor ...    181   3e-52   
gb|EYU24180.1|  hypothetical protein MIMGU_mgv1a018771mg                181   3e-52   
ref|XP_010066604.1|  PREDICTED: probable ADP-ribosylation factor ...    181   4e-52   
ref|NP_001288469.1|  probable ADP-ribosylation factor GTPase-acti...    181   5e-52   
ref|XP_010670144.1|  PREDICTED: probable ADP-ribosylation factor ...    180   6e-52   
ref|XP_006587473.1|  PREDICTED: probable ADP-ribosylation factor ...    180   8e-52   
ref|XP_006395883.1|  hypothetical protein EUTSA_v10004998mg             179   1e-51   
gb|KFK33376.1|  hypothetical protein AALP_AA5G005300                    179   2e-51   
ref|XP_010670148.1|  PREDICTED: probable ADP-ribosylation factor ...    179   2e-51   
ref|XP_009104934.1|  PREDICTED: probable ADP-ribosylation factor ...    179   3e-51   
ref|XP_009388888.1|  PREDICTED: probable ADP-ribosylation factor ...    178   3e-51   
ref|XP_010109013.1|  putative ADP-ribosylation factor GTPase-acti...    177   3e-51   
gb|EYU23809.1|  hypothetical protein MIMGU_mgv1a015207mg                178   4e-51   
emb|CDY70365.1|  BnaC09g52190D                                          178   4e-51   
ref|XP_009101338.1|  PREDICTED: probable ADP-ribosylation factor ...    178   7e-51   
emb|CDY17665.1|  BnaA06g34840D                                          177   8e-51   
ref|XP_006291920.1|  hypothetical protein CARUB_v10018104mg             177   9e-51   
ref|XP_009104933.1|  PREDICTED: probable ADP-ribosylation factor ...    179   9e-51   
emb|CDY70119.1|  BnaA07g38530D                                          180   1e-50   
ref|NP_178263.1|  calcium-dependent lipid-binding domain-containi...    177   1e-50   
ref|NP_001288983.1|  probable ADP-ribosylation factor GTPase-acti...    177   1e-50   
gb|AAY86774.1|  C2 domain-containing protein                            177   1e-50   
ref|XP_009129225.1|  PREDICTED: probable ADP-ribosylation factor ...    177   1e-50   
ref|XP_002876756.1|  C2 domain-containing protein                       177   1e-50   
ref|XP_010424926.1|  PREDICTED: probable ADP-ribosylation factor ...    177   2e-50   
gb|KCW64560.1|  hypothetical protein EUGRSUZ_G02165                     180   2e-50   
ref|XP_003561505.1|  PREDICTED: probable ADP-ribosylation factor ...    176   2e-50   
ref|XP_010502133.1|  PREDICTED: probable ADP-ribosylation factor ...    176   2e-50   
ref|XP_010513880.1|  PREDICTED: probable ADP-ribosylation factor ...    177   2e-50   
ref|XP_007153401.1|  hypothetical protein PHAVU_003G031900g             176   3e-50   
emb|CDP00802.1|  unnamed protein product                                176   3e-50   
ref|XP_002887329.1|  C2 domain-containing protein                       176   4e-50   
ref|XP_010670150.1|  PREDICTED: probable ADP-ribosylation factor ...    175   6e-50   
ref|XP_003528543.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    175   7e-50   
ref|XP_011070611.1|  PREDICTED: probable ADP-ribosylation factor ...    174   1e-49   
gb|EMS65900.1|  putative ADP-ribosylation factor GTPase-activatin...    174   1e-49   
ref|XP_004955323.1|  PREDICTED: probable ADP-ribosylation factor ...    174   2e-49   
gb|EMT29454.1|  hypothetical protein F775_30986                         173   2e-49   
gb|KHN08064.1|  ADP-ribosylation factor GTPase-activating protein...    173   3e-49   
ref|XP_004142273.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    172   6e-49   
emb|CCW28844.1|  putative C2 domain contatining protein                 173   6e-49   
ref|XP_010105094.1|  putative ADP-ribosylation factor GTPase-acti...    171   2e-48   
ref|XP_010045695.1|  PREDICTED: probable ADP-ribosylation factor ...    172   2e-48   
ref|XP_006657398.1|  PREDICTED: probable ADP-ribosylation factor ...    171   2e-48   
ref|NP_177237.1|  protein ENHANCED BENDING 1                            171   2e-48   
ref|XP_006416121.1|  hypothetical protein EUTSA_v10008947mg             171   2e-48   
ref|XP_006657399.1|  PREDICTED: probable ADP-ribosylation factor ...    170   4e-48   
ref|NP_001058718.1|  Os07g0108500                                       170   5e-48   
ref|XP_006604072.1|  PREDICTED: probable ADP-ribosylation factor ...    170   8e-48   
ref|XP_008229238.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    169   9e-48   
emb|CCW28850.1|  putative fatty acid elongase                           176   1e-47   
gb|AFK46959.1|  unknown                                                 170   1e-47   
ref|XP_006301188.1|  hypothetical protein CARUB_v10021587mg             169   1e-47   
ref|XP_006304266.1|  hypothetical protein CARUB_v10010496mg             169   1e-47   
ref|XP_010427873.1|  PREDICTED: probable ADP-ribosylation factor ...    169   1e-47   
gb|EPS67821.1|  hypothetical protein M569_06955                         169   2e-47   
ref|XP_010498819.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    169   2e-47   
ref|XP_008464698.1|  PREDICTED: probable ADP-ribosylation factor ...    169   2e-47   
gb|EYU24182.1|  hypothetical protein MIMGU_mgv1a019298mg                168   2e-47   
gb|AFK36306.1|  unknown                                                 168   3e-47   
gb|EYU30081.1|  hypothetical protein MIMGU_mgv1a015056mg                168   3e-47   
ref|XP_010460095.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    168   3e-47   
ref|XP_002893267.1|  C2 domain-containing protein                       167   5e-47   
ref|NP_001185175.1|  calcium-dependent lipid-binding family protein     167   6e-47   
ref|XP_004505288.1|  PREDICTED: probable ADP-ribosylation factor ...    167   8e-47   
ref|XP_010415769.1|  PREDICTED: probable ADP-ribosylation factor ...    167   8e-47   
ref|XP_009115560.1|  PREDICTED: probable ADP-ribosylation factor ...    166   1e-46   
ref|NP_173727.1|  calcium-dependent lipid-binding domain-containi...    166   2e-46   
ref|XP_010471082.1|  PREDICTED: probable ADP-ribosylation factor ...    166   3e-46   
ref|XP_010500395.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    164   3e-46   
emb|CDY71117.1|  BnaCnng71390D                                          165   3e-46   
ref|XP_010415768.1|  PREDICTED: probable ADP-ribosylation factor ...    165   4e-46   
ref|XP_004505290.1|  PREDICTED: probable ADP-ribosylation factor ...    164   6e-46   
ref|XP_008782354.1|  PREDICTED: probable ADP-ribosylation factor ...    164   7e-46   
gb|KFK44406.1|  hypothetical protein AALP_AA1G253000                    164   9e-46   
ref|XP_007157760.1|  hypothetical protein PHAVU_002G096400g             164   1e-45   
ref|XP_009626201.1|  PREDICTED: probable ADP-ribosylation factor ...    163   2e-45   
gb|KEH40567.1|  calcium-dependent lipid-binding (CaLB domain) fam...    162   2e-45   
ref|XP_010477602.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    162   3e-45   
gb|EYU24171.1|  hypothetical protein MIMGU_mgv1a026122mg                162   5e-45   
ref|XP_004957784.1|  PREDICTED: probable ADP-ribosylation factor ...    162   5e-45   
ref|XP_009402847.1|  PREDICTED: probable ADP-ribosylation factor ...    162   5e-45   
gb|EMS61908.1|  ADP-ribosylation factor GTPase-activating protein...    162   1e-44   
ref|XP_006390838.1|  hypothetical protein EUTSA_v10019195mg             160   2e-44   
emb|CDY01706.1|  BnaC04g30460D                                          163   2e-44   
ref|NP_001058717.2|  Os07g0108400                                       160   4e-44   
gb|EEC81393.1|  hypothetical protein OsI_24613                          169   4e-44   
ref|XP_003563062.1|  PREDICTED: probable ADP-ribosylation factor ...    160   4e-44   
ref|XP_002459233.1|  hypothetical protein SORBIDRAFT_02g001095          159   5e-44   
ref|NP_001148249.1|  GTPase activating protein                          159   7e-44   
gb|EYU24166.1|  hypothetical protein MIMGU_mgv1a000858mg                171   8e-44   
gb|ABK24539.1|  unknown                                                 159   9e-44   
ref|XP_009803722.1|  PREDICTED: probable ADP-ribosylation factor ...    159   1e-43   
ref|XP_002461315.1|  hypothetical protein SORBIDRAFT_02g000790          158   2e-43   
ref|XP_006657732.1|  PREDICTED: probable ADP-ribosylation factor ...    157   3e-43   
ref|XP_006588286.1|  PREDICTED: probable ADP-ribosylation factor ...    155   3e-43   
ref|XP_004955318.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    157   3e-43   
gb|EYU30082.1|  hypothetical protein MIMGU_mgv11b012631mg               157   4e-43   
ref|XP_006302875.1|  hypothetical protein CARUB_v10021004mg             156   4e-43   
ref|XP_006588282.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    154   7e-43   
ref|XP_003607906.1|  ADP-ribosylation factor GTPase-activating pr...    155   2e-42   
gb|EMT16533.1|  hypothetical protein F775_30156                         155   3e-42   
ref|NP_001132406.1|  uncharacterized protein LOC100193853               155   3e-42   
ref|XP_003557682.1|  PREDICTED: probable ADP-ribosylation factor ...    155   4e-42   
ref|XP_006395884.1|  hypothetical protein EUTSA_v10004998mg             154   9e-42   
ref|XP_010552703.1|  PREDICTED: probable ADP-ribosylation factor ...    154   1e-41   
ref|NP_001059720.1|  Os07g0501700                                       153   1e-41   
tpg|DAA59366.1|  TPA: putative MATE efflux family protein isoform 1     154   2e-41   
gb|EAZ03980.1|  hypothetical protein OsI_26119                          153   2e-41   
gb|EYU24179.1|  hypothetical protein MIMGU_mgv1a023415mg                153   2e-41   
ref|XP_006367634.1|  PREDICTED: probable ADP-ribosylation factor ...    152   3e-41   
ref|XP_004237015.1|  PREDICTED: probable ADP-ribosylation factor ...    152   3e-41   
ref|XP_008651946.1|  PREDICTED: probable ADP-ribosylation factor ...    152   4e-41   
ref|XP_002460737.1|  hypothetical protein SORBIDRAFT_02g034060          152   5e-41   
ref|XP_007157761.1|  hypothetical protein PHAVU_002G096400g             151   6e-41   
ref|XP_010533347.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    152   6e-41   
gb|EYU24164.1|  hypothetical protein MIMGU_mgv1a023048mg                151   1e-40   
ref|XP_010497835.1|  PREDICTED: probable ADP-ribosylation factor ...    148   2e-40   
gb|EMS58039.1|  ADP-ribosylation factor GTPase-activating protein...    154   2e-40   
gb|EMT32657.1|  hypothetical protein F775_07404                         150   2e-40   
tpg|DAA59402.1|  TPA: hypothetical protein ZEAMMB73_829423              151   2e-40   
ref|XP_006367963.1|  PREDICTED: probable ADP-ribosylation factor ...    150   2e-40   
gb|EYU24153.1|  hypothetical protein MIMGU_mgv1a020450mg                149   5e-40   
gb|EPS69666.1|  hypothetical protein M569_05100                         148   7e-40   
gb|EYU33138.1|  hypothetical protein MIMGU_mgv1a0151931mg               147   1e-39   
tpg|DAA62814.1|  TPA: putative calcium-dependent lipid-binding (C...    146   7e-39   
gb|KHN31574.1|  Putative ADP-ribosylation factor GTPase-activatin...    145   8e-39   
ref|XP_007153402.1|  hypothetical protein PHAVU_003G032000g             145   8e-39   
ref|XP_008653112.1|  PREDICTED: probable ADP-ribosylation factor ...    146   3e-38   
ref|XP_011075455.1|  PREDICTED: probable ADP-ribosylation factor ...    143   2e-37   
ref|XP_002462882.1|  hypothetical protein SORBIDRAFT_02g033760          142   2e-37   
gb|KDP33170.1|  hypothetical protein JCGZ_13435                         152   4e-37   
gb|EYU24160.1|  hypothetical protein MIMGU_mgv1a024244mg                140   6e-37   
gb|AFK33551.1|  unknown                                                 140   8e-37   
ref|XP_006857788.1|  hypothetical protein AMTR_s00061p00212500          140   9e-37   
gb|ABR17953.1|  unknown                                                 140   1e-36   
ref|XP_003563063.1|  PREDICTED: probable ADP-ribosylation factor ...    138   6e-36   
ref|XP_006346893.1|  PREDICTED: probable ADP-ribosylation factor ...    136   2e-35   
ref|XP_004957746.1|  PREDICTED: probable ADP-ribosylation factor ...    137   2e-35   
gb|EMT30400.1|  hypothetical protein F775_27208                         137   2e-35   
ref|XP_008439551.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   3e-35   
ref|XP_008653092.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    135   7e-35   
ref|XP_006657731.1|  PREDICTED: probable ADP-ribosylation factor ...    135   9e-35   
gb|EMS61741.1|  putative ADP-ribosylation factor GTPase-activatin...    135   2e-34   
ref|XP_009396288.1|  PREDICTED: probable ADP-ribosylation factor ...    134   2e-34   
ref|XP_010243946.1|  PREDICTED: probable ADP-ribosylation factor ...    134   2e-34   
ref|NP_001059718.1|  Os07g0500300                                       134   2e-34   
gb|EMT32329.1|  hypothetical protein F775_06095                         134   3e-34   
emb|CAA71759.1|  hypothetical protein                                   134   4e-34   
gb|EYU24176.1|  hypothetical protein MIMGU_mgv11b019519mg               132   5e-34   
ref|XP_009385341.1|  PREDICTED: probable ADP-ribosylation factor ...    133   5e-34   
dbj|BAJ86976.1|  predicted protein                                      132   8e-34   
gb|ACN85270.1|  ZAC                                                     137   8e-34   
ref|XP_004134589.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   9e-34   
gb|EYU43231.1|  hypothetical protein MIMGU_mgv1a009769mg                137   1e-33   
gb|ABR25570.1|  zac, putative                                           132   1e-33   
gb|EYU28612.1|  hypothetical protein MIMGU_mgv1a018724mg                130   1e-33   
gb|ACN85216.1|  ZAC                                                     136   1e-33   
gb|EMS64920.1|  putative ADP-ribosylation factor GTPase-activatin...    132   2e-33   
dbj|BAD35631.1|  putative zinc finger and C2 domain protein             136   2e-33   
ref|XP_008813423.1|  PREDICTED: probable ADP-ribosylation factor ...    137   2e-33   
ref|XP_008813422.1|  PREDICTED: probable ADP-ribosylation factor ...    137   2e-33   
gb|EMT20442.1|  hypothetical protein F775_02780                         131   3e-33   
gb|EYU26872.1|  hypothetical protein MIMGU_mgv1a025125mg                131   3e-33   
gb|KGN49461.1|  hypothetical protein Csa_6G525470                       136   3e-33   
gb|ACN85257.1|  ZAC                                                     135   4e-33   
ref|XP_006604073.1|  PREDICTED: probable ADP-ribosylation factor ...    130   4e-33   
gb|ACN85316.1|  ZAC                                                     135   4e-33   
gb|ACN85166.1|  ZAC                                                     135   4e-33   
ref|XP_010942608.1|  PREDICTED: probable ADP-ribosylation factor ...    130   5e-33   
gb|EEC80955.1|  hypothetical protein OsI_23669                          139   9e-33   
gb|EEE66000.1|  hypothetical protein OsJ_21940                          139   1e-32   
ref|XP_008778261.1|  PREDICTED: probable ADP-ribosylation factor ...    130   1e-32   
emb|CDP17304.1|  unnamed protein product                                134   1e-32   
ref|XP_006656236.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    135   1e-32   
gb|ACN85330.1|  ZAC                                                     132   1e-32   
gb|ACN85244.1|  ZAC                                                     133   2e-32   
ref|XP_006363654.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    133   2e-32   
gb|EPS58515.1|  hypothetical protein M569_16298                         133   2e-32   
ref|XP_010087670.1|  putative ADP-ribosylation factor GTPase-acti...    129   3e-32   
ref|XP_004139603.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    129   3e-32   
ref|XP_008464271.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    129   3e-32   
gb|AAQ54568.1|  GTPase activating protein                               126   3e-32   
ref|XP_008778260.1|  PREDICTED: probable ADP-ribosylation factor ...    129   4e-32   
ref|XP_010938593.1|  PREDICTED: probable ADP-ribosylation factor ...    132   6e-32   
ref|XP_004231566.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    132   6e-32   
gb|KCW75779.1|  hypothetical protein EUGRSUZ_D00176                     130   6e-32   
emb|CDP04538.1|  unnamed protein product                                127   8e-32   
gb|AFW76343.1|  putative calcium-dependent lipid-binding (CaLB do...    127   1e-31   
ref|XP_006854752.1|  hypothetical protein AMTR_s00063p00013660          131   1e-31   
emb|CAN79725.1|  hypothetical protein VITISV_014535                     127   1e-31   
gb|EYU24169.1|  hypothetical protein MIMGU_mgv1a024766mg                126   1e-31   
ref|XP_011012078.1|  PREDICTED: probable ADP-ribosylation factor ...    131   2e-31   
ref|XP_009401045.1|  PREDICTED: probable ADP-ribosylation factor ...    131   2e-31   
ref|XP_010929054.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    126   2e-31   



>ref|XP_008393427.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=182

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P   +  G++SLM++LLGLLR+RVKRG+NLAVRDV SSDPYVV+KMGKQ+LKTR I+KDI
Sbjct  6    PKKPAQGGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDI  65

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLS++DP   IKLTV+DHDTF+KDDKMGDAEF I P+++ALKM+LEG+PS T
Sbjct  66   NPEWNEDLTLSITDPSIPIKLTVFDHDTFSKDDKMGDAEFGISPYLEALKMNLEGVPSGT  125

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             +SR+QP R+NCLA+ESC+ WKD KV+QDMCLRLRNVE GEVE+QLQWIDLPG KGL
Sbjct  126  TVSRIQPDRANCLAEESCIQWKDGKVVQDMCLRLRNVECGEVEVQLQWIDLPGSKGL  182



>ref|XP_009360077.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=180

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P   +  G++S M++LLGLLR+ VKRG+NLAVRDV SSDPYVV+KMGKQ+LKTR I+KD+
Sbjct  4    PKKPAKGGSKSCMENLLGLLRIHVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDV  63

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSV+DP   IKLTV+DHDTF+KDDKMGDAEF I PF++ALKM+LEG+PS T
Sbjct  64   NPEWNEDLTLSVTDPSIPIKLTVFDHDTFSKDDKMGDAEFGISPFLEALKMNLEGVPSGT  123

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             +SR+QP R+NCLA+ESC+ WKD KV+QDMCLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  124  TVSRIQPDRANCLAEESCIQWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLPGSKGL  180



>ref|XP_008374850.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=182

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P + +    +SLM++LLGLLR+RVKRG+NLAVRDV SSDPYVV+KMGKQ+LKTR I+KD+
Sbjct  6    PKTPAKGSCKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDV  65

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSV+DP   IKLTVYDHDTF+KDDKMGDAEF I  +I+ALKM+LEG+PS T
Sbjct  66   NPEWNEDLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDAEFGISTYIEALKMNLEGVPSGT  125

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +++R+QP R+NCLA+ESC+ WKD KV+QDMCLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  126  IVTRIQPSRANCLAEESCILWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLPGSKGL  182



>ref|XP_008240150.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Prunus mume]
Length=182

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P + +  G++SLM++LLGLLR+RVKRG+NLAVRDV SSDPYVV+KMGKQ+LKTR I+KD+
Sbjct  5    PKTLAKGGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDV  64

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSV+DP   IKLTVYDHDTF+KDDKMGD EF I P+I+ALK++LEG+PS T
Sbjct  65   NPEWNEDLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDGEFGIVPYIEALKVNLEGVPSGT  124

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +++R+QP R+NCLA+ES + WKD KV+QDMCLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  125  IVTRIQPSRANCLAEESSILWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLPGSKGL  181



>ref|XP_007209663.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 ref|XP_007209664.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 ref|XP_007209665.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 gb|EMJ10862.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 gb|EMJ10863.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 gb|EMJ10864.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
Length=182

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P + +  G++SLM++LLGLLR+RVKRG+NLAVRDV SSDPYVV+KMGKQ+LKTR I+KD+
Sbjct  5    PKTPAKGGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDV  64

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSV+DP   IKLTVYDHDTF+KDDKMGD EF I P+I+ALKM+LEG+ S T
Sbjct  65   NPEWNEDLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDGEFGIVPYIEALKMNLEGVASGT  124

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             + R+QP R+NCLA+ESC+ WKD KV+QDMCLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  125  TVMRIQPSRANCLAEESCILWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLPGSKGL  181



>ref|XP_009356038.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=182

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P + +   ++SLM++LLGLLR+RVKRG+NLAVRDV SSDPYVV+KMGKQ+LKTR I+KD+
Sbjct  6    PKTPAKGSSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDV  65

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSV+DP   IKLTVYDHDTF+KDDKMGDAEF I  +I+ALK++LEG+PS T
Sbjct  66   NPEWNEDLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDAEFGISTYIEALKVNLEGVPSGT  125

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             ++R+QP R+NCLA+ESC+ WKD KV+QDMCLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  126  TVTRIQPSRANCLAEESCIQWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLPGSKGL  182



>ref|XP_010033755.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010033762.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010033770.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW84067.1| hypothetical protein EUGRSUZ_B00949 [Eucalyptus grandis]
 gb|KCW84068.1| hypothetical protein EUGRSUZ_B00949 [Eucalyptus grandis]
 gb|KCW84069.1| hypothetical protein EUGRSUZ_B00949 [Eucalyptus grandis]
Length=184

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P S       S+M++LLGLLR+RVKRG+NLAVRDV SSDPYVVVKM KQ+LKTR I+KD+
Sbjct  8    PPSLGGRSPMSMMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVVKMAKQKLKTRVIKKDV  67

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSVSDP   +KLTVYDHDTF+KDDKMGDAEF+IKPFI+ALKM+L+GLPS T
Sbjct  68   NPEWNEDLTLSVSDPSIPVKLTVYDHDTFSKDDKMGDAEFDIKPFIEALKMNLQGLPSGT  127

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            VI+RVQP R NCL +ESCV W + +V+QDMCLRLRNVE GEVEIQLQWI+LPG KGL
Sbjct  128  VITRVQPSRQNCLVEESCVIWSEDRVVQDMCLRLRNVECGEVEIQLQWINLPGSKGL  184



>ref|XP_010663685.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Vitis vinifera]
Length=181

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  649  MDCIPLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFI  470
            M+  P S +     SLM++LLGLLRVRVKRGINLAVRDV SSDPY V+KMGKQ+LKTR +
Sbjct  1    MESPPKSPNRTSGTSLMENLLGLLRVRVKRGINLAVRDVRSSDPYAVIKMGKQKLKTRVM  60

Query  469  RKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGL  290
            +K++NPEWNEDLTLS+SDP+  IKLTVYDHDTF+KDDKMGDAEF I P+++AL+M LEGL
Sbjct  61   KKNVNPEWNEDLTLSISDPNLPIKLTVYDHDTFSKDDKMGDAEFTINPYLEALRMHLEGL  120

Query  289  PSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            PS T+ISRVQP R NCLA+ESC+ W D +V+QD+CLRLRNVE GEVE+QLQWIDLPG KG
Sbjct  121  PSGTIISRVQPSRQNCLAEESCIVWTDGRVVQDICLRLRNVECGEVELQLQWIDLPGSKG  180

Query  109  L  107
            L
Sbjct  181  L  181



>ref|XP_010036952.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Eucalyptus grandis]
 gb|KCW48605.1| hypothetical protein EUGRSUZ_K02272 [Eucalyptus grandis]
Length=180

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV +SDPY+V+KM KQ+LKTR I+KD+NPEWNEDLTLSVSDPD  IKLTVYDHD
Sbjct  31   INLAVRDVRTSDPYIVIKMSKQKLKTRVIKKDVNPEWNEDLTLSVSDPDIPIKLTVYDHD  90

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAEF+IK FIDAL+MDL+GLPS T+ISRVQPGR+NCL++ES + W + +++
Sbjct  91   TFSKDDKMGDAEFDIKAFIDALRMDLQGLPSGTIISRVQPGRTNCLSEESSIVWSEGRIV  150

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRL+NVE GEVEIQLQWIDLPG +GL
Sbjct  151  QDMCLRLKNVECGEVEIQLQWIDLPGARGL  180



>ref|XP_007036844.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY21345.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=181

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  649  MDCIPLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFI  470
            M   P++  ++ + SLMD+LLGLLR+R+KRG+NLAVRDV SSDPYVVVKMG+Q+LKTR I
Sbjct  1    MTGSPITPQNERSTSLMDNLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGRQKLKTRVI  60

Query  469  RKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGL  290
            +KD+NPEWNEDLTLS++DP   IKLTVYDHDTF+KDDKMGDAEF+I+ +I+ALKM+L  +
Sbjct  61   KKDVNPEWNEDLTLSITDPSLPIKLTVYDHDTFSKDDKMGDAEFDIRTYIEALKMNLGEI  120

Query  289  PSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            PS T+IS+VQPGR+NCLA+ES + WKD KV+QD+CLRLRNVE GEVEIQLQWIDLPG KG
Sbjct  121  PSGTIISKVQPGRNNCLAEESTIDWKDGKVVQDICLRLRNVECGEVEIQLQWIDLPGSKG  180

Query  109  L  107
            L
Sbjct  181  L  181



>gb|EYU24145.1| hypothetical protein MIMGU_mgv1a018362mg [Erythranthe guttata]
Length=185

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  625  SDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEW  446
            S+  TQSLMDSLLGLLR+RVKRGINLAVRDV SSDPYVVV+MGKQR+KTR IRKDINPEW
Sbjct  13   SESPTQSLMDSLLGLLRIRVKRGINLAVRDVRSSDPYVVVRMGKQRMKTRVIRKDINPEW  72

Query  445  NEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISR  266
            NEDLTLSVSDP   + LTVYDHDTF+ DDKMGDAEF+I+PFI+ +KM   GLP+ T+I+R
Sbjct  73   NEDLTLSVSDPKHPVSLTVYDHDTFSMDDKMGDAEFDIRPFIEGMKMHPNGLPNGTIITR  132

Query  265  VQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            + P RSNCL++ES V W+D +V+QDMCLRL+NVE GE+E+QLQWIDLPGCKGL
Sbjct  133  IYPSRSNCLSEESSVVWRDGRVMQDMCLRLKNVECGEIELQLQWIDLPGCKGL  185



>ref|XP_004299529.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=179

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  616  GTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNED  437
            G++SLM++LLGLLR+RVKRG+NLAVRDV SSDPY+V+KMGKQ+LKTR I+KD+NPEWNED
Sbjct  9    GSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYIVIKMGKQKLKTRVIKKDVNPEWNED  68

Query  436  LTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQP  257
            LTLSV+DP   +KLTVYDHDTF+KDDKMGDAEF+I P+I+ALKMD  G+PS T+I+RVQP
Sbjct  69   LTLSVTDPSIPVKLTVYDHDTFSKDDKMGDAEFDIVPYIEALKMDYGGIPSGTIITRVQP  128

Query  256  GRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             R NCL++ESCV W + KVIQD+CLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  129  CRQNCLSEESCVRWSEGKVIQDLCLRLRNVECGEVEIQLQWIDLPGSKGL  178



>emb|CAN69475.1| hypothetical protein VITISV_014376 [Vitis vinifera]
 emb|CBI15582.3| unnamed protein product [Vitis vinifera]
Length=165

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPY V+KMGKQ+LKTR ++K++NPEWNEDLTLS+SDP+  IKLTVYDHD
Sbjct  16   INLAVRDVRSSDPYAVIKMGKQKLKTRVMKKNVNPEWNEDLTLSISDPNLPIKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAEF I P+++AL+M LEGLPS T+ISRVQP R NCLA+ESC+ W D +V+
Sbjct  76   TFSKDDKMGDAEFTINPYLEALRMHLEGLPSGTIISRVQPSRQNCLAEESCIVWTDGRVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+CLRLRNVE GEVE+QLQWIDLPG KGL
Sbjct  136  QDICLRLRNVECGEVELQLQWIDLPGSKGL  165



>gb|KDP23927.1| hypothetical protein JCGZ_27087 [Jatropha curcas]
Length=184

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            +LM+SLLGLLR+RVKRG+NLAVRDV SSDPYVVVKMG+Q+LKTR I+KD+NPEWNEDLTL
Sbjct  18   TLMESLLGLLRIRVKRGVNLAVRDVRSSDPYVVVKMGRQKLKTRVIKKDVNPEWNEDLTL  77

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            S++DP+  IKL VYDHDTF+KDDKMGDAE ++KP+I ALKM+L G+PS TVISR+QPGR 
Sbjct  78   SITDPNLPIKLIVYDHDTFSKDDKMGDAEIDVKPYIQALKMNLAGVPSGTVISRMQPGRH  137

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+E+C+T+ D KVIQD CLRLRNVE GEVE+QLQWIDLPG KGL
Sbjct  138  NCLAEETCITYVDGKVIQDFCLRLRNVECGEVEVQLQWIDLPGSKGL  184



>ref|XP_002530486.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF31909.1| ARF GTPase activator, putative [Ricinus communis]
Length=183

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P SG    + SLM++LLGLLR+RVKRG+NLAVRDV SSDPY+VVKMGKQ+LKTR I+KD+
Sbjct  8    PESGKKT-SSSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYIVVKMGKQKLKTRVIKKDV  66

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NPEWNEDLTLSV DP   +KLTVYDHDTF+KDDKMGDAEF+I+P+I+AL+M+L G P+ T
Sbjct  67   NPEWNEDLTLSVIDPTLPVKLTVYDHDTFSKDDKMGDAEFDIRPYIEALRMNLAGFPTGT  126

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +I R+QP R NCL++E+C+T+ D KV+QD+CLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  127  IIKRIQPSRQNCLSEETCITYTDGKVVQDLCLRLRNVECGEVEIQLQWIDLPGSKGL  183



>ref|XP_010097555.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXB69087.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=186

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -2

Query  604  LMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLS  425
            LMD+LLGLLR+RVKRGINLAVRDV SSDPYVVVKMGKQ+LKTR I+KD+NPEWNEDLTLS
Sbjct  21   LMDNLLGLLRIRVKRGINLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLS  80

Query  424  VSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSN  245
            V+DP   +KLTVYDHDTF+ DDKMGDAEF+IK +I+ALKM+LEGLPS T+I+R+QP R N
Sbjct  81   VTDPKLPVKLTVYDHDTFSMDDKMGDAEFDIKAYIEALKMNLEGLPSGTIITRIQPSRQN  140

Query  244  CLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            CL +ES + W + KVIQD+CLRLRNVE GEVE+QLQWIDLPG KGL
Sbjct  141  CLVEESSIMWNEGKVIQDLCLRLRNVECGEVEVQLQWIDLPGSKGL  186



>ref|XP_009783267.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana sylvestris]
Length=165

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKMGKQ+LKTR ++KD+NPEWNEDLTLSV+DP+  +KLTVYDHD
Sbjct  16   VNLAVRDVRSSDPYVVVKMGKQKLKTRVVKKDVNPEWNEDLTLSVADPNLPVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+KDDKMGDAEF+IKPF++ALKM+L GLP  T+I+R+QP RSNCLA+ES V WKD +V+
Sbjct  76   LFSKDDKMGDAEFDIKPFLEALKMNLTGLPGGTIITRIQPCRSNCLAEESNVVWKDGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GEVE+QLQWI+LPG +GL
Sbjct  136  QDMCLRLRNVECGEVELQLQWINLPGSRGL  165



>ref|XP_010678069.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Beta vulgaris subsp. vulgaris]
Length=185

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINP  452
            SG      SLM++LLGLLRV++ RGINLA+RDV +SDPYVV+KMGKQ+LKTR I+KD+NP
Sbjct  11   SGRPSSGSSLMENLLGLLRVKIIRGINLAIRDVRTSDPYVVIKMGKQKLKTRVIKKDVNP  70

Query  451  EWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVI  272
            EWNEDLTLSVSDP+  I+LTVYDHD F+KDDKMG+AEF+I PFIDALKM+L+ LPS T+I
Sbjct  71   EWNEDLTLSVSDPNLPIQLTVYDHDMFSKDDKMGEAEFDISPFIDALKMNLDSLPSGTLI  130

Query  271  SRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            SRVQP R NCLA+ES + W + +VIQ++CLRL+NVE GEVE+QLQWIDLPGCKGL
Sbjct  131  SRVQPCRKNCLAEESKIMWTESRVIQNICLRLKNVECGEVELQLQWIDLPGCKGL  185



>ref|XP_008464579.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Cucumis melo]
Length=194

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -2

Query  604  LMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLS  425
            LM+SLLGLLR+R+ RG+NLAVRDV SSDPY+VVKM KQ+LKTR I+KDINPEWNEDLTLS
Sbjct  29   LMESLLGLLRIRIIRGVNLAVRDVRSSDPYIVVKMSKQKLKTRVIKKDINPEWNEDLTLS  88

Query  424  VSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSN  245
            V+DP+A +KLTVYDHDTF+ DDKMGDAEF I P+I+ALKMDL GLPS T++SRVQP R N
Sbjct  89   VTDPNALVKLTVYDHDTFSMDDKMGDAEFEIGPYIEALKMDLSGLPSGTIVSRVQPSRQN  148

Query  244  CLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            CLA+ES + W + KV+Q++CLRLRNVE GE+EIQLQWIDLPG KGL
Sbjct  149  CLAEESGIVWVEGKVVQNICLRLRNVECGELEIQLQWIDLPGSKGL  194



>ref|XP_009614861.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
Length=165

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKMGKQ+LKTR I+KD+NPEWNEDLTLSV+DP+  +KLTVYDHD
Sbjct  16   VNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSVADPNLPVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+KDDKMGDAEF+IKPF++ALKM+L GLP  T+I+R+QP RSNCLA+E  V WKD +V+
Sbjct  76   LFSKDDKMGDAEFDIKPFLEALKMNLTGLPGGTIITRIQPCRSNCLAEECNVVWKDGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GEVE+QLQWI+LPG +GL
Sbjct  136  QDMCLRLRNVECGEVELQLQWINLPGSRGL  165



>ref|XP_006587472.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Glycine max]
 gb|KHN23718.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=176

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  625  SDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEW  446
            SD   +SLM++LLGLLRVRVKRG+NLAVRDV SSDPYVV+KM  Q+LKTR I+KD+NPEW
Sbjct  4    SDSTPKSLMENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYNQKLKTRVIKKDVNPEW  63

Query  445  NEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISR  266
            NEDLTLSV +P+  IKLTVYDHDTF+KDDKMGDAEF+I PFI+ALKM+L GLP+ TV++R
Sbjct  64   NEDLTLSVINPNHKIKLTVYDHDTFSKDDKMGDAEFDIFPFIEALKMNLTGLPNGTVVTR  123

Query  265  VQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +QP + NCLADESC+T+ + KV+QDM LRL+NVE GEVEIQLQWIDLPG KGL
Sbjct  124  IQPSKHNCLADESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDLPGSKGL  176



>ref|XP_006490774.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Citrus sinensis]
 gb|KDO63829.1| hypothetical protein CISIN_1g028875mg [Citrus sinensis]
Length=202

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 164/202 (81%), Gaps = 5/202 (2%)
 Frame = -2

Query  697  LSFPTAYKKTKHK-PCAMDCIPLS--GSDDGTQ--SLMDSllgllrvrvkrGINLAVRDV  533
            +  P  Y K  H  P  +D    +  G+ DG +  SLM++LLGLLR+R+KRG+NLAVRDV
Sbjct  1    MRIPCIYSKGDHNNPLMVDSPKQTAMGTGDGVRRTSLMETLLGLLRIRIKRGVNLAVRDV  60

Query  532  LSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKM  353
             SSDPYVVVKMGKQ+LKTR I+KD+NPEWNEDLTLS++DP+  I LTVYDHD F+KDD+M
Sbjct  61   RSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSITDPNVPITLTVYDHDLFSKDDRM  120

Query  352  GDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLR  173
            GDAEF+IK +I+ALKM+L+ LP+ T+ISRV P R NCL+++SCV WK+ KV+QD+ LRLR
Sbjct  121  GDAEFDIKTYIEALKMNLDSLPTGTIISRVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLR  180

Query  172  NVERGEVEIQLQWIDLPGCKGL  107
            NVE GE+EIQLQWIDLPG KGL
Sbjct  181  NVECGELEIQLQWIDLPGSKGL  202



>ref|XP_009595957.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
Length=164

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDLTLSVSDP+ ++KLTVYDHD
Sbjct  16   VNLAVRDVRSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVSDPNLTVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+IKPF+DALKM+L+GLP  TVI+RV P RSNCLA+E+ V W+D+KV+
Sbjct  76   MFSMDDKMGDAEFDIKPFLDALKMNLDGLPCGTVITRVTPCRSNCLAEETKVVWQDNKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            QDMCLRLRNVE GEVE+QLQWIDLPG K
Sbjct  136  QDMCLRLRNVECGEVELQLQWIDLPGSK  163



>ref|XP_006451620.1| hypothetical protein CICLE_v10009524mg [Citrus clementina]
 gb|ESR64860.1| hypothetical protein CICLE_v10009524mg [Citrus clementina]
Length=202

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 164/202 (81%), Gaps = 5/202 (2%)
 Frame = -2

Query  697  LSFPTAYKKTKHK-PCAMDCIPLS--GSDDGTQ--SLMDSllgllrvrvkrGINLAVRDV  533
            +  P  Y K  H  P  +D    +  G+ DG +  SLM++LLGLLR+R+KRG+NLAVRDV
Sbjct  1    MRIPCIYSKGDHNNPLMVDSPKQTAMGTGDGVRRTSLMETLLGLLRIRIKRGVNLAVRDV  60

Query  532  LSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKM  353
             SSDPYVVVKMGKQ+LKTR I+KD+NPEWNEDLTLS++DP+  I LTVYDHD F+KDD+M
Sbjct  61   RSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSITDPNVPITLTVYDHDLFSKDDRM  120

Query  352  GDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLR  173
            GDAEF+IK +I+ALKM+L+ LP+ T+ISRV P R NCL+++SCV WK+ KV+QD+ LRLR
Sbjct  121  GDAEFDIKTYIEALKMNLDSLPTGTIISRVMPSRHNCLSEQSCVVWKEGKVVQDLILRLR  180

Query  172  NVERGEVEIQLQWIDLPGCKGL  107
            NVE GE+EIQLQWIDLPG KGL
Sbjct  181  NVECGELEIQLQWIDLPGSKGL  202



>ref|XP_011072997.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Sesamum indicum]
Length=165

 Score =   244 bits (623),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVV+KMGKQ+LKTR IRKD+NPEWNEDLTLSVSDP   I LTV+DHD
Sbjct  16   INLAVRDVRSSDPYVVIKMGKQKLKTRVIRKDVNPEWNEDLTLSVSDPGRPISLTVFDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMG+A+F+I+PFI+A++M LEGLP  TVI+++QP R+NCL++ES V WKD +V+
Sbjct  76   TFSKDDKMGEAQFDIEPFIEAVRMKLEGLPDGTVITKIQPSRNNCLSEESTVVWKDGRVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRL+NVE GEVEIQLQWI+LPG KGL
Sbjct  136  QDMCLRLKNVECGEVEIQLQWIELPGSKGL  165



>ref|XP_003534141.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Glycine max]
Length=204

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  625  SDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEW  446
            SD   +SLM++LLGLLRVRVKRG+NLAVRDV SSDPYVV+KM  Q+LKTR I+KD+NPEW
Sbjct  32   SDSTPKSLMENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYNQKLKTRVIKKDVNPEW  91

Query  445  NEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISR  266
            NEDLTLSV +P+  IKLTVYDHDTF+KDDKMGDAEF+I PFI+ALKM+L GLP+ TV++R
Sbjct  92   NEDLTLSVINPNHKIKLTVYDHDTFSKDDKMGDAEFDIFPFIEALKMNLTGLPNGTVVTR  151

Query  265  VQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +QP + NCLADESC+T+ + KV+QDM LRL+NVE GEVEIQLQWIDLPG KGL
Sbjct  152  IQPSKHNCLADESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDLPGSKGL  204



>ref|XP_009796427.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana sylvestris]
Length=165

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDLTLSVSDP+  +KLTVYDHD
Sbjct  16   VNLAVRDVRSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVSDPNLPVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF IKPF+DALKM+L+GLP  TVISRV P RSNCL++E+ V W+D+KV+
Sbjct  76   MFSMDDKMGDAEFEIKPFLDALKMNLDGLPCGTVISRVTPCRSNCLSEETKVVWQDNKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            QDMCLRLRNVE GEVE+QLQWIDLPG K
Sbjct  136  QDMCLRLRNVECGEVELQLQWIDLPGSK  163



>ref|XP_010314227.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=178

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
            +G    TQSLMD+L+GLLR+++K+G+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  3    TGGGSATQSLMDNLMGLLRIKIKKGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  62

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNEDLTLSVSDP   +KLTVYDHDTFT DDKMGDAEF+IK F++ALKM+L GLPS TV
Sbjct  63   PEWNEDLTLSVSDPSLPVKLTVYDHDTFTMDDKMGDAEFDIKSFVEALKMNLHGLPSGTV  122

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            I+RV P R+NCLA+ES V W D KV+QDM LRLRNVE GEVE+QLQWIDLPG K
Sbjct  123  ITRVLPCRTNCLAEESRVIWDDGKVVQDMILRLRNVECGEVELQLQWIDLPGTK  176



>dbj|BAO02515.1| predicted C2 domain containing protein [Nicotiana alata]
Length=188

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
            +G+   T+SLMD+LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  13   AGAASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  72

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNE+LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IKPFI+ALKM+L+GLPS TV
Sbjct  73   PEWNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFIEALKMNLDGLPSGTV  132

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            I+RV P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI+LPG K L
Sbjct  133  ITRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELPGSKIL  188



>ref|XP_009761742.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana sylvestris]
 gb|ACD40011.1| pollen-specific C2 domain containing protein [Nicotiana sp. variant 
'Rastroensis']
Length=188

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
            +G+   T+SLMD+LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  13   AGAASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  72

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNE+LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IKPF++ALKM+L+GLPS TV
Sbjct  73   PEWNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTV  132

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            I+RV P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI+LPG K L
Sbjct  133  ITRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELPGSKIL  188



>ref|XP_003631121.1| Pollen-specific C2 domain containing protein [Medicago truncatula]
 gb|AET05597.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=182

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINP  452
            +G  D  +SLM+ LLGLLR+R+KRG+NLAVRDV +SDPY VVKMGKQRLKT  I+KD+NP
Sbjct  7    NGGGDSGKSLMEDLLGLLRIRIKRGVNLAVRDVNTSDPYAVVKMGKQRLKTHVIKKDVNP  66

Query  451  EWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVI  272
            EWNEDLTLS++DP    KLTVYD+DTF+KDDKMGDAEF++ P+I+ALK +LEGLP  T+I
Sbjct  67   EWNEDLTLSITDPVVPFKLTVYDYDTFSKDDKMGDAEFDLSPYIEALKTNLEGLPEGTII  126

Query  271  SRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +R+QP R NCL++ESC+T+ D KV+QD+ LRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  127  TRIQPCRQNCLSEESCITYSDGKVVQDVVLRLRNVECGEVEIQLQWIDLPGAKGL  181



>emb|CDO98346.1| unnamed protein product [Coffea canephora]
Length=164

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV +SDPYVVVKMGKQ+LKTR I KD+NPEWNEDLTLSVSDP+  +KLTVYDHD
Sbjct  16   VNLAVRDVRTSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVSDPNIPVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+KDDKMG+AEF+IK FI+ALKM L GLP+ T++SRV P R+NCL++ESCV WKD K+ 
Sbjct  76   MFSKDDKMGEAEFDIKAFIEALKMKLNGLPNGTIVSRVIPLRTNCLSEESCVIWKDGKIT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GEVEIQLQWIDLPG KGL
Sbjct  136  QDMCLRLRNVECGEVEIQLQWIDLPG-KGL  164



>gb|AFK44826.1| unknown [Lotus japonicus]
Length=168

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV +SDPYVVVKMGKQ+LKTR I KDINPEWNEDLTLS++DP     LTVYDHD
Sbjct  16   VNLAVRDVNTSDPYVVVKMGKQKLKTRVIHKDINPEWNEDLTLSITDPFKPFVLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAEF++ PFI+ALKM+LEGLPS T+++RVQP R+NCLA+ESC+T  D KV+
Sbjct  76   TFSKDDKMGDAEFDLSPFIEALKMNLEGLPSGTIVTRVQPCRTNCLAEESCITVNDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GEVEIQLQWIDLPG KGL
Sbjct  136  QDVVLRLRHVECGEVEIQLQWIDLPGAKGL  165



>gb|ACD40010.1| pollen-specific C2 domain containing protein [Nicotiana alata]
 gb|ACD40012.1| pollen-specific C2 domain containing protein [Nicotiana forgetiana]
 gb|ACD40013.1| pollen-specific C2 domain containing protein [Nicotiana langsdorffii]
 gb|ACD40014.1| pollen-specific C2 domain containing protein [Nicotiana mutabilis]
 gb|ACD40016.1| pollen-specific C2 domain containing protein [Nicotiana longiflora]
Length=187

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
             G+   T+SLMD+LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  12   GGAASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  71

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNE+LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IKPF++ALKM+L+GLPS TV
Sbjct  72   PEWNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTV  131

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            I+RV P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI+LPG K L
Sbjct  132  ITRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELPGSKIL  187



>ref|XP_009628522.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
 ref|XP_009628523.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
 ref|XP_009628524.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
Length=186

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = -2

Query  628  GSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDINP  452
            G+   T+SLMD+LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDINP
Sbjct  12   GAASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINP  71

Query  451  EWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVI  272
            EWNE+LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IKPF++ALKM+L+GLPS TVI
Sbjct  72   EWNEELTLSVSDPTLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTVI  131

Query  271  SRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +RV P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI+LPG K L
Sbjct  132  TRVLPCRTNCLAEESRVVWQDDKVVQDMILRLRNVECGEVELQLQWIELPGSKIL  186



>ref|XP_008453481.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Cucumis melo]
Length=180

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  637  PLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDI  458
            P S    G  SLM++LLGLLR+R+ RG+NLAVRDV SSDPYVVVKMGKQ+LKTR I+KD+
Sbjct  5    PTSPKSGGRLSLMENLLGLLRIRIIRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDV  64

Query  457  NPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDT  278
            NP WNEDLTLSVSDP+  IKLTVYDHDTF+KDDKMG AEF+IK F++ALKM+L+ LPS T
Sbjct  65   NPVWNEDLTLSVSDPNLPIKLTVYDHDTFSKDDKMGYAEFDIKAFMEALKMNLKNLPSGT  124

Query  277  VISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
             I+R+ P R NCLA+ESCV WKD KV+QD+ LRLRNVE GEVE+QLQWI+LP  KG
Sbjct  125  TITRMLPARQNCLAEESCVVWKDGKVVQDIYLRLRNVECGEVEVQLQWINLPSSKG  180



>ref|XP_010533970.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=184

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMDSLLGLLR+RV RG+NLAVRDV SSDPYVVVKMG+Q+LKTR + KD+NPEWNEDL
Sbjct  16   TTSLMDSLLGLLRIRVIRGVNLAVRDVRSSDPYVVVKMGRQKLKTRVVYKDVNPEWNEDL  75

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+DP+ ++ LTVYDHDTF+KDDKMGDAEF IK +++AL+M LE LPS T+I+R+ P 
Sbjct  76   TLSVTDPNLNVLLTVYDHDTFSKDDKMGDAEFEIKSYVEALRMQLEDLPSGTIITRITPS  135

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLADES +TW D K++QD+ LRLR+VE GEVE+QLQWIDLPG KGL
Sbjct  136  RHNCLADESHITWSDGKLVQDLFLRLRHVECGEVEVQLQWIDLPGSKGL  184



>gb|ACD40015.1| pollen-specific C2 domain containing protein [Nicotiana bonariensis]
Length=187

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
             G+   T+SLMD LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  12   GGAASATKSLMDRLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  71

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNE+LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IKPF++ALKM+L GLPS TV
Sbjct  72   PEWNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLYGLPSGTV  131

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            I+RV P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI+LPG K L
Sbjct  132  ITRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELPGSKIL  187



>ref|XP_004235813.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Solanum lycopersicum]
Length=165

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVVVKM KQ+LKTR ++KD+NPEWNEDLTLSV+DP+  + LTVYDHD
Sbjct  16   INLAVRDVRSSDPYVVVKMAKQKLKTRVVKKDVNPEWNEDLTLSVADPNLPVMLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+KDDKMGDAEF+I+PF++ALKM+L GLP  T+I+R+QP RSNCL++ES V W+D +V+
Sbjct  76   IFSKDDKMGDAEFDIRPFLEALKMNLSGLPGGTIITRIQPCRSNCLSEESNVVWQDGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GE+E+QLQWI+LPG +GL
Sbjct  136  QDMCLRLRNVECGEIELQLQWINLPGSRGL  165



>ref|XP_006341525.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Solanum tuberosum]
Length=165

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVVVKM KQ+LKTR ++KD+NPEWNEDLTLSV+DP+  + LTVYDHD
Sbjct  16   INLAVRDVRSSDPYVVVKMAKQKLKTRVVKKDVNPEWNEDLTLSVADPNLPVMLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+KDDKMGDAEF+I+PF++ALKM+L GLP  T+I+R+QP RSNCL++ES V W+D +V+
Sbjct  76   MFSKDDKMGDAEFDIRPFLEALKMNLSGLPGGTIITRIQPCRSNCLSEESNVVWQDGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GE+E+QLQWI+LPG +GL
Sbjct  136  QDMCLRLRNVECGEIELQLQWINLPGSRGL  165



>ref|XP_003528987.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Glycine max]
 gb|KHN44628.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=176

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  625  SDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEW  446
            SD   +SLM++LLGLLRVRVKRG+NLAVRDV SSDPYVV+KM +Q+LKTR I+KD+NPEW
Sbjct  4    SDSTPKSLMENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYRQKLKTRVIKKDVNPEW  63

Query  445  NEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISR  266
            NEDLTLSV +P+  +KLTVYDHDTF+KDDKMGDAEF+I PFI+ALKM+L GL + TV++R
Sbjct  64   NEDLTLSVINPNHKVKLTVYDHDTFSKDDKMGDAEFDILPFIEALKMNLTGLANGTVVTR  123

Query  265  VQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +QP + NCL DESC+T+ + KV+QDM LRL+NVE GEVEIQLQWIDLPG KG+
Sbjct  124  IQPSKHNCLVDESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDLPGSKGI  176



>ref|XP_004137503.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 ref|XP_004161839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 gb|KGN64176.1| hypothetical protein Csa_1G042830 [Cucumis sativus]
Length=190

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -2

Query  604  LMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLS  425
            LM+SLLGLLRVR+ RG+NLAVRDV SSDPY+VVKM  Q+LKTR I+KDINPEWNEDLTLS
Sbjct  25   LMESLLGLLRVRIIRGVNLAVRDVRSSDPYIVVKMSNQKLKTRVIKKDINPEWNEDLTLS  84

Query  424  VSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSN  245
            V+DP+A +KLTVYDHDTF+ DDKMGDAEF I  +I+ALKMDL GLPS T++++VQP R N
Sbjct  85   VTDPNALVKLTVYDHDTFSMDDKMGDAEFEIGSYIEALKMDLSGLPSGTIVTKVQPSRQN  144

Query  244  CLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            CLA+ES + W + KV+Q++CLRLRNVE GE+EIQLQWIDLPG KGL
Sbjct  145  CLAEESGIVWNEGKVVQNICLRLRNVECGELEIQLQWIDLPGSKGL  190



>ref|XP_008464514.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Cucumis melo]
Length=276

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  604  LMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLS  425
            LM+SLLGLLR+R+ RG+NLAVRDV SSDPY+VVKM KQ+LKTR I+KDINPEWNEDLTLS
Sbjct  29   LMESLLGLLRIRIIRGVNLAVRDVRSSDPYIVVKMSKQKLKTRVIKKDINPEWNEDLTLS  88

Query  424  VSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSN  245
            V+DP+A +KLTVYDHDTF+ DDKMGDAEF I P+I+ALKMDL GLPS T++SRVQP R N
Sbjct  89   VTDPNALVKLTVYDHDTFSMDDKMGDAEFEIGPYIEALKMDLSGLPSGTIVSRVQPSRQN  148

Query  244  CLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            CLA+ES + W + KV+Q++CLRLRNVE GE+EIQLQWIDLPG K 
Sbjct  149  CLAEESGIVWVEGKVVQNICLRLRNVECGELEIQLQWIDLPGSKA  193



>emb|CDY51927.1| BnaAnng11040D [Brassica napus]
Length=177

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMD LLGLLR+R+KRG+NLAVRD+ SSDPY+VVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  9    TSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYIVVKMGKQKLKTRVINKDVNPEWNEDL  68

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+DP  ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GLPS T+++ VQP 
Sbjct  69   TLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGTIVTTVQPS  128

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLA+ES VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  129  RRNCLAEESKVTWIDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  177



>gb|ACD40018.1| pollen-specific C2 domain containing protein [Nicotiana tabacum]
Length=188

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = -2

Query  616  GTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDINPEWNE  440
             T+SLMD+LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDINPEWNE
Sbjct  18   ATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPEWNE  77

Query  439  DLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQ  260
            +LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF IKPF++ALKM+L+GLPS TVI+RV 
Sbjct  78   ELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFYIKPFVEALKMNLDGLPSGTVITRVL  137

Query  259  PGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI+LPG K L
Sbjct  138  PCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELPGSKIL  188



>ref|XP_006346641.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=181

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
             G    T+SLMD+LLGLLR+++K+G+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  6    GGGGSATKSLMDNLLGLLRIKIKKGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  65

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNEDLTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IK F++ALKM+L GLPS TV
Sbjct  66   PEWNEDLTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKSFVEALKMNLHGLPSGTV  125

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            I+RV P R+NCLA+ES V W D KV+QDM LRLRNVE GEVE+QLQWIDLPG K
Sbjct  126  ITRVLPCRTNCLAEESRVIWDDGKVVQDMILRLRNVECGEVELQLQWIDLPGSK  179



>ref|XP_004503269.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cicer arietinum]
Length=176

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  634  LSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDIN  455
            + G  +  +SLM+ LLGLLR+R+KRG+NLAVRDV +SDPYVVVKMGKQ+LKTR I+KDIN
Sbjct  1    MEGEGNSGKSLMEDLLGLLRIRIKRGVNLAVRDVNTSDPYVVVKMGKQKLKTRVIKKDIN  60

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNEDLTLSV+DP     LTVYDHDTFT DDKMGDAEF++ P+IDALKM+L  +P+ TV
Sbjct  61   PEWNEDLTLSVTDPVLPFILTVYDHDTFTADDKMGDAEFDLSPYIDALKMNLADIPNGTV  120

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            I+R+QP R NCLA+ESC+T  D K++QD+ LRLRNVE GE+EIQLQWIDLPG KGL
Sbjct  121  ITRIQPSRQNCLAEESCITCTDGKIVQDVVLRLRNVECGELEIQLQWIDLPGSKGL  176



>ref|XP_006365412.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Solanum tuberosum]
Length=165

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVVVKMGKQ+LKTR I+KD+NPEWNEDLTLSVSD +  +KLTVYDHD
Sbjct  16   INLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSVSDANLPVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+IKPF+DALKM+L+ LP  TVI+R  P R+NCL++ES VTW+D++V+
Sbjct  76   MFSMDDKMGDAEFDIKPFLDALKMNLDSLPCGTVITRATPCRANCLSEESKVTWQDNQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GEVE+QLQWID+PG K L
Sbjct  136  QDMCLRLRNVECGEVELQLQWIDIPGSKRL  165



>ref|XP_009145950.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
Length=172

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLM++LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  4    TGSLMNNLLGLLRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDL  63

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+DP  ++ LTVYDHD F+KDDKMGDAEF IKP+I+ALKM L+GLPS T+++ VQP 
Sbjct  64   TLSVTDPTLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALKMHLDGLPSGTIVTTVQPC  123

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLA+ES VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  124  RRNCLAEESKVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  172



>ref|XP_006406667.1| hypothetical protein EUTSA_v10022004mg [Eutrema salsugineum]
 gb|ESQ48120.1| hypothetical protein EUTSA_v10022004mg [Eutrema salsugineum]
Length=177

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMD LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  9    TSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDL  68

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+D + ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GLPS T+++ VQP 
Sbjct  69   TLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGTIVTTVQPS  128

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLA+ES VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  129  RRNCLAEESRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  177



>gb|AFK34568.1| unknown [Lotus japonicus]
Length=168

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV +SDPYVVVKMGKQ+LKTR I KDINPEWNEDLTLS++DP     LTVYDHD
Sbjct  16   VNLAVRDVNTSDPYVVVKMGKQKLKTRVIHKDINPEWNEDLTLSITDPVKPFVLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAEF+  PFI+ALKM+LEGLPS T+++R+QP R+NCLA+ESC+   D KV+
Sbjct  76   TFSKDDKMGDAEFDPSPFIEALKMNLEGLPSGTIVTRIQPCRTNCLAEESCIAVNDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GEVEIQLQWIDLPG KGL
Sbjct  136  QDVVLRLRHVECGEVEIQLQWIDLPGAKGL  165



>ref|XP_004235812.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=165

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSD YVV++M +Q+LKTR I+KD+NPEWNEDLTLSV+DP+  + LTVYDHD
Sbjct  16   VNLAVRDVRSSDTYVVIQMAEQKLKTRVIKKDVNPEWNEDLTLSVADPNLPVMLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            +F+KDDKMGDAEF+IKP I+ALKM+L GLP  T+I+R+QP RSNCL+ ES + WKD +V+
Sbjct  76   SFSKDDKMGDAEFDIKPLIEALKMNLSGLPEGTIITRIQPSRSNCLSGESNIVWKDGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDMCLRLRNVE GEVE+QLQWI++PG KGL
Sbjct  136  QDMCLRLRNVECGEVELQLQWINIPGSKGL  165



>ref|XP_006299051.1| hypothetical protein CARUB_v10015190mg [Capsella rubella]
 gb|EOA31949.1| hypothetical protein CARUB_v10015190mg [Capsella rubella]
Length=177

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMD LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  9    TSSLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDL  68

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+D + ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GLPS T+I+ VQP 
Sbjct  69   TLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGTIITTVQPS  128

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLA+ S VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  129  RHNCLAEASRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  177



>ref|NP_188425.2| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 ref|XP_002883099.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 pdb|4V29|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Car4 In 
Complex With Two Calcium Ions
 pdb|4V29|B Chain B, The Crystal Structure Of Arabidopsis Thaliana Car4 In 
Complex With Two Calcium Ions
 dbj|BAB02719.1| GTPase activating protein-like [Arabidopsis thaliana]
 gb|AAY17416.1| At3g17980 [Arabidopsis thaliana]
 gb|ABR46206.1| At3g17980 [Arabidopsis thaliana]
 gb|EFH59358.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE76031.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=177

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMD LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  9    TSSLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDL  68

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+D + ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GLPS T+++ V+P 
Sbjct  69   TLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGTIVTTVKPS  128

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLA+ES VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  129  RRNCLAEESRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  177



>ref|XP_002891444.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67703.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMDSLLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ++KTR I KD+NPEWNEDLTL
Sbjct  4    SLMDSLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMGKQKMKTRVIYKDVNPEWNEDLTL  63

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SVSDP+ ++ LTVYD+DTFTKDDKMGDAEF IKPF++ALKM L  LPS T+++ VQP R 
Sbjct  64   SVSDPNLTVLLTVYDYDTFTKDDKMGDAEFVIKPFVNALKMHLHDLPSGTIVTTVQPSRD  123

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES V W D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  124  NCLAEESRVIWSDGKLVQDIVLRLRHVECGEVEAQLQWIDLPGSKGL  170



>emb|CDX75953.1| BnaC03g40360D [Brassica napus]
Length=177

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMD LLGLLR+R++RG+NLAVRD+ SSDPY+VVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  9    TSSLMDDLLGLLRIRIRRGVNLAVRDINSSDPYIVVKMGKQKLKTRVISKDVNPEWNEDL  68

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+DP  ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GL S T+++ VQP 
Sbjct  69   TLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLLSGTIVTTVQPS  128

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R NCLA+ES VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  129  RRNCLAEESKVTWIDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  177



>ref|XP_006341526.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=165

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSD YVVV+M KQ+LKTR IRKD+NPEWNEDLTLSV+DP+  + LTV+DHD
Sbjct  16   VNLAVRDVRSSDTYVVVQMAKQKLKTRVIRKDVNPEWNEDLTLSVADPNLPVMLTVFDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            +F+ DDKMGD EF+IKP I+ALKM+L GLP  T+I+R+QP RSNCL++ES V WKD +V+
Sbjct  76   SFSNDDKMGDTEFDIKPLIEALKMNLSGLPDGTIITRIQPSRSNCLSEESNVVWKDGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+MCLRLRNVE GEVE+QLQWI++PG KGL
Sbjct  136  QNMCLRLRNVECGEVELQLQWINIPGSKGL  165



>gb|EYU33973.1| hypothetical protein MIMGU_mgv1a014822mg [Erythranthe guttata]
Length=177

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVV+KMGKQ+LKTR IRK++NPEWNEDLTLS++DP+ +I LTVYDHD
Sbjct  28   INLAVRDVRSSDPYVVIKMGKQKLKTRVIRKNVNPEWNEDLTLSIADPNHTISLTVYDHD  87

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMG AEF+I+PFI+A+KM L+GLP  T+I+++QP R+NCL++ES V WK+ KV+
Sbjct  88   TFSLDDKMGVAEFDIRPFIEAIKMKLDGLPDGTIITKIQPSRTNCLSEESSVIWKEGKVV  147

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q M LRL+NVE GEVEI+LQWID+PG +GL
Sbjct  148  QGMMLRLKNVECGEVEIELQWIDIPGSRGL  177



>gb|KHG01667.1| hypothetical protein F383_21926 [Gossypium arboreum]
Length=181

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            + SLMD+LLGLLR+R+KRG+NLAVRDV SSDPYVVVK+ KQ+LKTR I+KD+NPEWNEDL
Sbjct  12   SSSLMDNLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKLDKQKLKTRVIKKDVNPEWNEDL  71

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLS++DP   IKLTVYDHDTF+KDDKMG+AE +I+P+I+ALK+D++ +P+ T I+RVQP 
Sbjct  72   TLSITDPSTPIKLTVYDHDTFSKDDKMGNAEIDIRPYIEALKVDVDDIPNGTTIARVQPC  131

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R+NCL++ES +T  D KV+QD+CLRLRNVE GEVEIQLQWI+LPG KGL
Sbjct  132  RTNCLSEESAITLVDRKVVQDICLRLRNVECGEVEIQLQWIELPGSKGL  180



>ref|XP_010506220.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
 ref|XP_010487708.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=177

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDLTL
Sbjct  11   SLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTL  70

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SV+D + ++ LTVYDHD F+KDDKMGDAEF IKP+I AL+M L+GLPS T+++ VQP R 
Sbjct  71   SVTDSNLNVLLTVYDHDMFSKDDKMGDAEFEIKPYIQALRMQLDGLPSGTIVTTVQPSRH  130

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA++S VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  131  NCLAEQSQVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  177



>ref|XP_004137344.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 ref|XP_004160416.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
Length=181

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKMGKQ+LKTR I+KD+NP WNEDLTLSVSDP+  IKLTVYDHD
Sbjct  33   VNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPVWNEDLTLSVSDPNLPIKLTVYDHD  92

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMG AEF+IK F++ALKM+L+ L S T I+R+ P R NCLA+ESCV WKD KV+
Sbjct  93   TFSKDDKMGYAEFDIKAFMEALKMNLKNLSSGTTITRMLPARQNCLAEESCVVWKDGKVV  152

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            QD+ LRLRNVE GEVEIQLQWI+LP  KG
Sbjct  153  QDIYLRLRNVECGEVEIQLQWINLPNFKG  181



>gb|ACD40017.1| pollen-specific C2 domain containing protein [Nicotiana plumbaginifolia]
Length=179

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  631  SGSDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGK-QRLKTRFIRKDIN  455
             G+   T+SLMD+LLGLLR+++KRG+NLAVRDV +SDPY VVKMGK Q+LKTR I+KDIN
Sbjct  12   GGAASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  71

Query  454  PEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTV  275
            PEWNE+LTLSVSDP   +KLTVYDHDTF+ DDKMGDAEF+IKPF++ALKM+L+GLPS TV
Sbjct  72   PEWNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTV  131

Query  274  ISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWI  131
            I+RV P R+NCLA+ES V W+D KV+QDM LRLRNVE GEVE+QLQWI
Sbjct  132  ITRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWI  179



>ref|XP_002534010.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF28372.1| ARF GTPase activator, putative [Ricinus communis]
Length=169

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDVL+SDPY+VVK+GKQ+LKTR ++K+INPEWNEDLTLS+S+P+  +K+ VYD D
Sbjct  20   VNLAIRDVLTSDPYIVVKLGKQKLKTRVVKKNINPEWNEDLTLSISNPNLPVKIGVYDRD  79

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF++DDKMGDAEF+I PF++ALKM L+GLPS T+I+R+QP R NCLA+ES V W D KV+
Sbjct  80   TFSRDDKMGDAEFDIHPFLEALKMHLQGLPSGTIITRIQPSRENCLAEESHVLWVDGKVV  139

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GE+E+QLQWID+PG +GL
Sbjct  140  QNLFLRLRNVECGEIELQLQWIDIPGSRGL  169



>ref|XP_010263871.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Nelumbo nucifera]
Length=182

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV+SSDPY+V+KMGKQ+LKTR ++K+INPEWNEDLTLSV+DP+  IKLTVYD D
Sbjct  33   INLAVRDVVSSDPYIVIKMGKQKLKTRVMKKNINPEWNEDLTLSVADPELPIKLTVYDKD  92

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDA+ +IKPF++A+KM L  LPS T+I RVQP R NCLA+ESC+ W+D KV+
Sbjct  93   KFSLDDKMGDADIDIKPFLEAVKMHLVNLPSGTIIQRVQPNRQNCLAEESCIIWQDGKVV  152

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRL+NVE GEVE+QLQWID+PG +G+
Sbjct  153  QDMYLRLKNVESGEVELQLQWIDIPGSRGI  182



>ref|XP_009135561.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Brassica rapa]
Length=177

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            T SLMD LLGLLR+R+KRG+NLAVRD+ SSDPY+VVKMGKQ+LKTR I KD+NPEWNEDL
Sbjct  9    TSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYIVVKMGKQKLKTRVINKDVNPEWNEDL  68

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            TLSV+DP  ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GLPS T+++ V P 
Sbjct  69   TLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGTIVATVHPS  128

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            R+NCLA+ES VTW D K++Q+  LRLR+ E GEVE QL WIDLPG KGL
Sbjct  129  RANCLAEESRVTWIDGKLVQERVLRLRHAECGEVEAQLHWIDLPGSKGL  177



>ref|XP_010465871.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=176

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ++KTR I KD+NPEWNEDLTL
Sbjct  10   SLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKVKTRVINKDVNPEWNEDLTL  69

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SV+D + ++ LTVYDHD F+KDDKMGDAEF IKP+I AL+M L+GLPS T+++ VQP R 
Sbjct  70   SVTDSNLNVLLTVYDHDMFSKDDKMGDAEFEIKPYIQALRMQLDGLPSGTIVTTVQPSRH  129

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA++S VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  130  NCLAEQSQVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  176



>ref|XP_003525186.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Glycine max]
 gb|KHN10537.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Glycine soja]
Length=165

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV +SDPY VVKMGKQ+LKTR I+KD+NPEW EDLTLSV+DP     LTVYDHD
Sbjct  16   VNLAVRDVNTSDPYCVVKMGKQKLKTRVIKKDVNPEWKEDLTLSVTDPVHPFILTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAEF+I  +I+ALKM+LE LPS T+I+R+QP R NCLA+ESC+T+ + K+I
Sbjct  76   TFSKDDKMGDAEFDISAYIEALKMNLEDLPSGTIITRIQPSRQNCLAEESCITYSNGKII  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD  LRLR+VE GEVEIQLQWIDLPG KGL
Sbjct  136  QDAVLRLRHVECGEVEIQLQWIDLPGSKGL  165



>ref|XP_010461749.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=165

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR I  ++NPEWNEDLTLSV+DP+ ++ LTVYDHD
Sbjct  16   VNLAVRDLHSSDPYVVVKMGKQKLKTRVIYHNVNPEWNEDLTLSVTDPNLTVLLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFTKDDKMGDAEF IKPF++A+KM L  LPS T+++ VQP R NCLA+ES V W D K+I
Sbjct  76   TFTKDDKMGDAEFMIKPFVNAVKMQLHDLPSGTIVTTVQPSRDNCLAEESRVIWSDGKLI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GE+E QLQWIDLPG KGL
Sbjct  136  QDLVLRLRHVECGEIEAQLQWIDLPGSKGL  165



>gb|AFK33467.1| unknown [Lotus japonicus]
Length=165

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKM  Q+LKTR I+KD+NPEWNEDLTLSV DP  S+ LTVYDHD
Sbjct  16   VNLAVRDVRSSDPYVVVKMYNQKLKTRVIKKDVNPEWNEDLTLSVIDPHHSVLLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAEF I P+I+ALKM++ GLP+ TVI R+QP + NCLADESC+ +   K+I
Sbjct  76   TFSKDDKMGDAEFEIFPYIEALKMNVTGLPNGTVIKRIQPSKENCLADESCIYYNSGKII  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLR+VE GEVEI L WIDLPG KGL
Sbjct  136  QDMILRLRHVECGEVEISLHWIDLPGSKGL  165



>ref|XP_006430620.1| hypothetical protein CICLE_v10012950mg [Citrus clementina]
 gb|ESR43860.1| hypothetical protein CICLE_v10012950mg [Citrus clementina]
Length=165

 Score =   231 bits (589),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV+SSDPYVV+KMGKQ+LKTR ++ ++NPEWNEDLTLS+SDP+  IKLTVYD D
Sbjct  16   VNLAVRDVVSSDPYVVIKMGKQKLKTRVVKNNVNPEWNEDLTLSISDPNLPIKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++ALKM LEGLP+ T+++++QP R NCLA+ES + W D K++
Sbjct  76   TFSLDDKMGDAEFYITPFLEALKMRLEGLPNGTIVTKIQPSRENCLAEESHIVWTDGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEV+IQL+WID+PG +GL
Sbjct  136  QNLFLRLRNVEVGEVKIQLEWIDIPGSRGL  165



>ref|XP_010540029.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=168

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLM++L+GLLRVRVK G+NLAVRDV SSDPYVV+++G+Q+LKTR ++KD+NPEWNEDLT 
Sbjct  2    SLMENLMGLLRVRVKCGVNLAVRDVRSSDPYVVLRVGRQKLKTRVVKKDVNPEWNEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +++DP+  ++LTVYDHD F+KDDKMGDAE +I P+I+AL+M+L GLP  T+I+R+QP R 
Sbjct  62   TITDPNLPVQLTVYDHDLFSKDDKMGDAEIDIGPYIEALRMELSGLPDGTIITRIQPRRC  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ESCV W   +++QD+CLRLRNVE GEV++QLQWIDLPG KGL
Sbjct  122  NCLAEESCVRWSGGRIVQDLCLRLRNVECGEVQVQLQWIDLPGSKGL  168



>ref|XP_006482135.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Citrus sinensis]
Length=165

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV+SSDPYVV+KMGKQ+LKTR ++ ++NPEWNEDLTLS+SD +  IKLTVYD D
Sbjct  16   VNLAVRDVVSSDPYVVIKMGKQKLKTRVVKNNVNPEWNEDLTLSISDSNLPIKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++ALKM LEGLP+ T+++++QP R NCLA+ES + W D K++
Sbjct  76   TFSPDDKMGDAEFYITPFLEALKMRLEGLPNGTIVTKIQPSRENCLAEESHIVWTDGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEVEIQL+WID+PG +GL
Sbjct  136  QNLFLRLRNVEVGEVEIQLEWIDIPGSRGL  165



>gb|KDP33163.1| hypothetical protein JCGZ_13428 [Jatropha curcas]
Length=165

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV+SSDPYVVVKMGKQ+LKTR +++++NPEWNEDLTLS+ +P+  IK+ VYD D
Sbjct  16   INLAVRDVMSSDPYVVVKMGKQKLKTRVVKQNVNPEWNEDLTLSIENPNLPIKIVVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF++DDKMGDAEF+I+PF++A+KM LE LPS T+I+R+QP R NCLADES + W + KVI
Sbjct  76   TFSRDDKMGDAEFDIRPFLEAVKMRLEDLPSGTIITRIQPNRQNCLADESQIIWVEGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEVE+QLQWID+PG +GL
Sbjct  136  QNIILRLRNVECGEVELQLQWIDVPGIRGL  165



>ref|XP_009370093.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   230 bits (586),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NLAVRD+ SSDPYVVVKMGKQ+LKTR ++K +NPEWNEDLTLSV+DP   IKL VYD DT
Sbjct  17   NLAVRDIRSSDPYVVVKMGKQKLKTRVVKKTVNPEWNEDLTLSVADPSLPIKLFVYDKDT  76

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            F+ DDKMGDAEF I PF+ AL++ L+G+PS T+ISR QP R NCLA+ESC+ + D +++Q
Sbjct  77   FSLDDKMGDAEFEIGPFVQALRVGLQGVPSGTIISRFQPSRQNCLAEESCIVYTDGQIVQ  136

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +MC+RLRNVE GE+E+QLQWID+PG +GL
Sbjct  137  NMCIRLRNVESGELELQLQWIDVPGSRGL  165



>ref|XP_006584907.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Glycine max]
 gb|KHN00147.1| Putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Glycine soja]
Length=165

 Score =   230 bits (586),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV +SDPYVVVKMGKQ+LKTR I+KD+NPEW EDLTLSV+DP     LTVYD+D
Sbjct  16   VNLAVRDVNTSDPYVVVKMGKQKLKTRVIKKDVNPEWKEDLTLSVTDPIHPFILTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+KDDKMGDAE +I  +I+ALKM+LE LPS T+I+R+QP R NCLA+ESC+T+ + KVI
Sbjct  76   TFSKDDKMGDAECDISAYIEALKMNLEDLPSGTIITRIQPSRQNCLAEESCITYSNGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GEVEIQLQWI+LPG KGL
Sbjct  136  QDLVLRLRHVESGEVEIQLQWINLPGSKGL  165



>ref|NP_001185174.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AAF79703.1|AC020889_11 T1N15.21 [Arabidopsis thaliana]
 gb|AEE32320.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=200

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 155/201 (77%), Gaps = 18/201 (9%)
 Frame = -2

Query  691  FPTAYKKT------KHKPCAMDCIPLSGSDDGTQSLMDSllgllrvrvkrGINLAVRDVL  530
            FPT+ +K       KHK   M             SLMDSLLGLLR+R+KRG+NLAVRD+ 
Sbjct  12   FPTSLRKINLVAGEKHKDRRMK-----------PSLMDSLLGLLRIRIKRGVNLAVRDLN  60

Query  529  SSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMG  350
            SSDPYVVVKM KQ+LKTR I K++NPEWNEDLTLSVSDP+ ++ LTVYD+DTFTKDDKMG
Sbjct  61   SSDPYVVVKMAKQKLKTRVIYKNVNPEWNEDLTLSVSDPNLTVLLTVYDYDTFTKDDKMG  120

Query  349  DAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRN  170
            DAEF IKPF++ALKM L  LPS T+++ VQP R NCLA+ES V W D K++QD+ LRLR+
Sbjct  121  DAEFGIKPFVNALKMHLHDLPSGTIVTTVQPSRDNCLAEESRVIWSDGKLVQDIVLRLRH  180

Query  169  VERGEVEIQLQWIDLPGCKGL  107
            VE GEVE QLQWIDLPG KGL
Sbjct  181  VECGEVEAQLQWIDLPG-KGL  200



>ref|XP_002275235.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Vitis vinifera]
 emb|CBI33522.3| unnamed protein product [Vitis vinifera]
Length=165

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA RDVLSSDPYV+V+MGKQ+LKTR + K++NPEWNEDLTLSV D +  +K+ VYD D
Sbjct  16   VNLAKRDVLSSDPYVIVRMGKQKLKTRVVNKNVNPEWNEDLTLSVDDTNLPVKIFVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++AL+M+L GLPS T+I+RVQP R NCLA+ESC+ W + KV+
Sbjct  76   TFSLDDKMGDAEFQIGPFVEALRMELNGLPSGTIITRVQPNRENCLAEESCIIWTEGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEVE+QLQWID+PG +GL
Sbjct  136  QNLVLRLRNVESGEVELQLQWIDIPGSRGL  165



>ref|NP_175292.2| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|ACF88483.1| At1g48590 [Arabidopsis thaliana]
 gb|AEE32319.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=169

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMDSLLGLLR+R+KRG+NLAVRD+ SSDPYVVVKM KQ+LKTR I K++NPEWNEDLTL
Sbjct  4    SLMDSLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMAKQKLKTRVIYKNVNPEWNEDLTL  63

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SVSDP+ ++ LTVYD+DTFTKDDKMGDAEF IKPF++ALKM L  LPS T+++ VQP R 
Sbjct  64   SVSDPNLTVLLTVYDYDTFTKDDKMGDAEFGIKPFVNALKMHLHDLPSGTIVTTVQPSRD  123

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES V W D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  124  NCLAEESRVIWSDGKLVQDIVLRLRHVECGEVEAQLQWIDLPG-KGL  169



>ref|XP_004241660.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Solanum lycopersicum]
Length=165

 Score =   229 bits (583),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVVVKMG Q+LKTR I+KD+NPEWNE LTLSVSD +  +KLTVYDHD
Sbjct  16   INLAVRDVRSSDPYVVVKMGNQKLKTRVIKKDVNPEWNEYLTLSVSDANLPVKLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+IKPF+DALKM+L+ LP  TVI+R  P R+NCL++ES VTW+D++V+
Sbjct  76   RFSMDDKMGDAEFDIKPFLDALKMNLDSLPCGTVITRETPCRTNCLSEESKVTWQDNQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+CLRLRNVE GEVE+QLQWI++PG K L
Sbjct  136  QDLCLRLRNVECGEVELQLQWINIPGSKRL  165



>ref|XP_010461682.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=165

 Score =   229 bits (583),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR I  ++NPEWNEDLTLSV+DP+ ++ LTVYDHD
Sbjct  16   VNLAVRDLNSSDPYVVVKMGKQKLKTRVIYHNVNPEWNEDLTLSVTDPNLTVLLTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFTKDDKMGDAEF IKPF++A+KM L  LPS T+++ VQ  R NCLA+ES V W D K+I
Sbjct  76   TFTKDDKMGDAEFTIKPFVNAVKMQLHDLPSGTIVTTVQSSRDNCLAEESRVIWSDGKLI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GE+E QLQWIDLPG KGL
Sbjct  136  QDLVLRLRHVECGEIEAQLQWIDLPGSKGL  165



>ref|XP_007152688.1| hypothetical protein PHAVU_004G150800g [Phaseolus vulgaris]
 gb|ESW24682.1| hypothetical protein PHAVU_004G150800g [Phaseolus vulgaris]
Length=176

 Score =   229 bits (584),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  610  QSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLT  431
            +SLM++LLGLLRVRVKRGINLAVRDV SSDPYVV+KM  Q+LKTRFIRKD+NPEWNEDLT
Sbjct  9    KSLMENLLGLLRVRVKRGINLAVRDVRSSDPYVVIKMFNQKLKTRFIRKDVNPEWNEDLT  68

Query  430  LSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGR  251
            LS+ DP+  +KL VYDHDTF+KDD+MGDAEF+I PFI+ALK ++ GLP+ TVI R QP  
Sbjct  69   LSIIDPNHQVKLIVYDHDTFSKDDRMGDAEFDIFPFIEALKSNITGLPNGTVIKRTQPSA  128

Query  250  SNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             N LADESC+T  + K++QDM LRL+NVE GEVEIQLQWIDLPG KG+
Sbjct  129  ENFLADESCITCVNGKLVQDMILRLQNVECGEVEIQLQWIDLPGSKGI  176



>gb|KDO50844.1| hypothetical protein CISIN_1g031128mg [Citrus sinensis]
Length=165

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV+SSDPYVV+KMGKQ+LKTR ++ ++NPEWNEDLTLS+SD +  IKLTVYD D
Sbjct  16   VNLAVRDVVSSDPYVVIKMGKQKLKTRVVKNNVNPEWNEDLTLSISDSNLPIKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++ALKM LEGLP+ T+++++QP R NCLA+ES + W D K++
Sbjct  76   TFSLDDKMGDAEFYITPFLEALKMRLEGLPNGTIVTKIQPSRENCLAEESHIVWTDGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEV+IQL+WID+PG +GL
Sbjct  136  QNLFLRLRNVEVGEVKIQLEWIDIPGSRGL  165



>ref|XP_010274726.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nelumbo nucifera]
Length=165

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPY+V+KMGKQ+LKTR ++K+INPEWNEDLTLSVSDP   +KLTVYD D
Sbjct  16   VNLAVRDVRSSDPYLVIKMGKQKLKTRVVKKNINPEWNEDLTLSVSDPKLPVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMG AE +I+PF++A+KMDL   PS TVI+R  P R NCLA+ESC+ W+D KVI
Sbjct  76   TFSLDDKMGQAELDIRPFLEAVKMDLRNYPSGTVITRELPSRQNCLAEESCIVWQDGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPG  119
            QD+C+RL+NVERGEVE+Q QWI LPG
Sbjct  136  QDVCVRLKNVERGEVELQFQWIKLPG  161



>ref|XP_007033034.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY03960.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=165

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV+SSDPYVVV+MGKQ+LKTR I+K+ NPEWN+DLTLS++D    +KL VYD D
Sbjct  16   VNLAVRDVVSSDPYVVVRMGKQKLKTRVIKKNTNPEWNDDLTLSIADQSLPVKLAVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PFI+A+KM LEGLPS TVI ++QP R NCL+++SC+ W + KV+
Sbjct  76   TFSFDDKMGDAEFEIGPFIEAVKMHLEGLPSGTVIKKIQPSRQNCLSEDSCIIWSNGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWI +PG +GL
Sbjct  136  QNMFLRLRNVESGEVELQLQWIHVPGSRGL  165



>ref|XP_011084199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Sesamum indicum]
Length=189

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVVV+MGKQ+LKTR I KDINPEWNEDLTLSVSDP+  + LTV+DHD
Sbjct  40   INLAVRDVRSSDPYVVVRMGKQKLKTRVINKDINPEWNEDLTLSVSDPNHPVSLTVFDHD  99

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD MGDAEF I  F++A+ M L+G+P  T+I++VQP R+NCLA+ESC+ W D +V+
Sbjct  100  TFSPDDPMGDAEFRITQFLEAVSMQLDGVPDGTIITKVQPCRANCLAEESCIVWTDGQVL  159

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            QDMCLRL+NVE GE+EIQLQWI LPG K
Sbjct  160  QDMCLRLKNVECGELEIQLQWIQLPGSK  187



>emb|CDX77307.1| BnaC08g03520D [Brassica napus]
Length=170

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            S+M+SLLGLLR+RVKRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I  D+NPEWNEDLTL
Sbjct  4    SMMESLLGLLRIRVKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYNDVNPEWNEDLTL  63

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SV+DP+  + LTVYDHDTFTKDDKMGDAEF IKP+I+AL M L+ LP  T+++ VQP R 
Sbjct  64   SVTDPNLKVLLTVYDHDTFTKDDKMGDAEFEIKPYINALTMHLQDLPCGTIVTTVQPSRD  123

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ S + W D K+IQ++ LRL++VE GEVE+QLQWIDLPG KGL
Sbjct  124  NCLAEGSRIIWSDGKLIQEIVLRLKHVECGEVEVQLQWIDLPGSKGL  170



>ref|XP_006304555.1| hypothetical protein CARUB_v10011546mg [Capsella rubella]
 gb|EOA37453.1| hypothetical protein CARUB_v10011546mg [Capsella rubella]
Length=170

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I  ++NPEWNEDLTL
Sbjct  4    SLMDNLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYNNVNPEWNEDLTL  63

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SV+DP  ++ LTVYDHDTFTKDDKMGDAEF IK F++A+KM L  LPS T+++ VQP R 
Sbjct  64   SVTDPSLTVLLTVYDHDTFTKDDKMGDAEFKIKSFVNAVKMHLHDLPSGTIVTTVQPSRD  123

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES V W D K+IQD+ LRL++VE GE+E QLQWIDLP  KGL
Sbjct  124  NCLAEESRVIWTDGKLIQDLVLRLKHVECGEIEAQLQWIDLPRAKGL  170



>ref|XP_010500393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
Length=168

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR I  ++NPEWNEDLTLSV+DP+ ++ LTVYDHD
Sbjct  16   VNLAVRDLHSSDPYVVVKMGKQKLKTRVIYHNVNPEWNEDLTLSVTDPNLTVLLTVYDHD  75

Query  376  TFTKDDK---MGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDH  206
            TFTKDDK   MGDAEF IKPF++A+KM L  LPS T+++ VQP R NCLA+ES V W D 
Sbjct  76   TFTKDDKMGDMGDAEFIIKPFVNAVKMQLHDLPSGTIVTTVQPSRDNCLAEESRVIWSDG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K+IQD+ LRLR+VE GE+E QLQWIDLPG KGL
Sbjct  136  KLIQDLVLRLRHVECGEIEAQLQWIDLPGSKGL  168



>ref|XP_010032689.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW52143.1| hypothetical protein EUGRSUZ_J01589 [Eucalyptus grandis]
Length=165

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY V++MGK +LKTR +++++NPEWN+DLTLS++DP  SIKL VYD D
Sbjct  16   VNLAIRDIRSSDPYAVIRMGKHKLKTRVVKRNLNPEWNDDLTLSIADPSLSIKLMVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAE +I PF+D L+M L+ +PS TVI+RV+PGR NCLA+ESC+ W+D KV+
Sbjct  76   NFSLDDKMGDAEIHIAPFLDTLRMRLDDVPSGTVITRVKPGRDNCLAEESCIVWRDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLRNVE GEVE+QL+WID+PG +GL
Sbjct  136  QDMVLRLRNVEHGEVELQLEWIDIPGSRGL  165



>ref|XP_006390540.1| hypothetical protein EUTSA_v10019153mg [Eutrema salsugineum]
 gb|ESQ27826.1| hypothetical protein EUTSA_v10019153mg [Eutrema salsugineum]
Length=201

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDL  434
            + SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKTR ++K++NP+W EDL
Sbjct  33   SMSLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNVNPQWEEDL  92

Query  433  TLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPG  254
            T +V+DP+  + L VYDHD F+KDDKMGDAE ++ P+I+AL+M+L GLP  T+I+ + P 
Sbjct  93   TFTVTDPNLPLNLVVYDHDFFSKDDKMGDAEIDLNPYIEALRMELSGLPDGTIITTIHPS  152

Query  253  RSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            RSNCLA+ES + W + +++Q++CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  153  RSNCLAEESFIRWSNDRIVQNICLRLRNVERGEVEIELQWIDLPGSKGL  201



>emb|CDY47746.1| BnaA02g16490D [Brassica napus]
Length=168

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKT+ ++K+INP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNINPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+IS + P RS
Sbjct  62   TVTDPNLPLNLVVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGTIISTIHPNRS  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q  CLRLRNVERGEVE++LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWSNDRIVQSFCLRLRNVERGEVELELQWIDLPGSKGL  168



>ref|XP_004503138.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cicer arietinum]
Length=167

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KMGKQ+LKTR ++K++NPEWNEDLTLS+SDP   I L VYD D
Sbjct  18   VNLAIRDVVSSDPYVVIKMGKQKLKTRVVKKNLNPEWNEDLTLSISDPRTPISLHVYDKD  77

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+I PF++A+KM LEGLP++T++++VQP R NCLA+ES +  KD K  
Sbjct  78   MFSMDDKMGDAEFDIGPFVEAVKMRLEGLPNETIVTKVQPCRKNCLAEESHIVLKDGKYF  137

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QL WID+PG KGL
Sbjct  138  QNMVLRLRNVESGEVELQLNWIDIPGSKGL  167



>ref|XP_010471418.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Camelina sativa]
Length=168

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKTR ++K+INP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+I+ + P R 
Sbjct  62   TVTDPNLPLTLIVYDHDLFSKDDKMGDAEIDLKPYIEALRMELSGLPEGTIITTIGPNRG  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q++CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLPGSKGL  168



>ref|XP_008381348.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=165

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NLAVRD+ SSDPYVVVKMGKQ+LKTR ++K +NPEWNEDLTLSV+DP   IKL VYD DT
Sbjct  17   NLAVRDIRSSDPYVVVKMGKQKLKTRVVKKTVNPEWNEDLTLSVADPSLPIKLFVYDKDT  76

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            F+ DDKMGDAEF I PF+ AL++ L+G+P  T+ISR QP R NCLA+ESC+   D +V+Q
Sbjct  77   FSLDDKMGDAEFEIGPFVQALRVGLQGVPXGTIISRFQPSRQNCLAEESCIVXTDGQVVQ  136

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +MC+RLRNVE GE+ +QLQWID+PG +GL
Sbjct  137  NMCIRLRNVESGELXLQLQWIDVPGSRGL  165



>ref|XP_007217177.1| hypothetical protein PRUPE_ppa012484mg [Prunus persica]
 gb|EMJ18376.1| hypothetical protein PRUPE_ppa012484mg [Prunus persica]
Length=167

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLS--SDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYD  383
            +NLA+RDV +  SDPYVV+KMGKQ+LKTR ++   NPEWNEDLTLS++DP   + + VYD
Sbjct  16   VNLAIRDVTARTSDPYVVIKMGKQKLKTRVVKNSTNPEWNEDLTLSIADPTLPVNIHVYD  75

Query  382  HDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             DTFT DDKMGDAEF I PF++AL+M ++G+PS TV+SRVQP R NCLA+ESC+ + D +
Sbjct  76   KDTFTLDDKMGDAEFEIGPFLEALRMRVQGVPSGTVLSRVQPSRQNCLAEESCIIYTDGQ  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            V+Q+MC+RLRNVERGE+E+QLQWID+PG +GL
Sbjct  136  VVQNMCIRLRNVERGELELQLQWIDIPGSRGL  167



>ref|XP_009107346.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 emb|CDY16452.1| BnaA08g03150D [Brassica napus]
Length=170

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            S+M+SLLGLLR+RVKRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I  D+NPEWNEDLTL
Sbjct  4    SMMESLLGLLRIRVKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYNDVNPEWNEDLTL  63

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SV+DP   + LTVYDHDTFTKDDKMGDAEF IKP+I+AL M L+ LP  T+++ VQP R 
Sbjct  64   SVTDPSLKVLLTVYDHDTFTKDDKMGDAEFEIKPYINALTMHLQDLPCGTIVTTVQPSRD  123

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ S + W D K++QD+ LRL++VE GEVE+QL+WIDLPG KGL
Sbjct  124  NCLAEGSRIIWSDGKLVQDIVLRLKHVECGEVEVQLKWIDLPGSKGL  170



>ref|XP_009135560.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Brassica rapa]
Length=187

 Score =   225 bits (573),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = -2

Query  613  TQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQ----------RLKTRFIRK  464
            T SLMD LLGLLR+R+KRG+NLAVRD+ SSDPY+VVKMGKQ          +LKTR I K
Sbjct  9    TSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYIVVKMGKQVHTIYHRIFTKLKTRVINK  68

Query  463  DINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPS  284
            D+NPEWNEDLTLSV+DP  ++ LTVYDHD F+KDDKMGDAEF IKP+I+AL+M L+GLPS
Sbjct  69   DVNPEWNEDLTLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPS  128

Query  283  DTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             T+++ V P R+NCLA+ES VTW D K++Q+  LRLR+ E GEVE QL WIDLPG KGL
Sbjct  129  GTIVATVHPSRANCLAEESRVTWIDGKLVQERVLRLRHAECGEVEAQLHWIDLPGSKGL  187



>emb|CDX82060.1| BnaC02g22300D [Brassica napus]
Length=168

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKT+ ++K++NP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNVNPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+IS + P RS
Sbjct  62   TVTDPNLPLNLVVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGTIISTIHPNRS  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q  CLRLRNVERGEVE++LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWSNDRIVQSFCLRLRNVERGEVELELQWIDLPGSKGL  168



>ref|XP_010471417.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Camelina sativa]
Length=173

 Score =   224 bits (571),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKTR ++K+INP+W EDLT 
Sbjct  7    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTF  66

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+I+ + P R 
Sbjct  67   TVTDPNLPLTLIVYDHDLFSKDDKMGDAEIDLKPYIEALRMELSGLPEGTIITTIGPNRG  126

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q++CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  127  NCLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLPGSKGL  173



>gb|KHG02007.1| hypothetical protein F383_24715 [Gossypium arboreum]
Length=165

 Score =   224 bits (570),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDVL+SDPYVV++MGKQ+LKTR I+K++NPEWN+DLTLS++D    +KLTVYD D
Sbjct  16   VNLAVRDVLTSDPYVVIRMGKQKLKTRVIKKNVNPEWNDDLTLSIADLSLPVKLTVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I P ++A+KM LEGLP+ T+I++VQP R NCL+ ESC+ W + KV+
Sbjct  76   TFSLDDKMGDAEFEIGPLVNAVKMRLEGLPNGTIITKVQPSRENCLSQESCIIWNNGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLRNVE GEV++QL+WI +PG +GL
Sbjct  136  QDMFLRLRNVETGEVDLQLEWIHVPGSRGL  165



>emb|CDX95800.1| BnaC05g35510D [Brassica napus]
Length=765

 Score =   239 bits (611),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLM++LLGLLR+R+KRG+NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDLTL
Sbjct  599  SLMNNLLGLLRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTL  658

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            SV+DP  ++ LTVYDHD F+KDDKMGDAEF IKP+I+ALKM L+GLPS T+++ VQP R 
Sbjct  659  SVTDPTLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALKMHLDGLPSGTIVTTVQPCRR  718

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES VTW D K++QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  719  NCLAEESKVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL  765



>ref|XP_010032690.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010032691.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW52144.1| hypothetical protein EUGRSUZ_J01590 [Eucalyptus grandis]
Length=166

 Score =   223 bits (569),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV SSDPYVV++MGKQ+LK+R I+++ NPEWN+DLTLS++DP   +K+ VYD D
Sbjct  16   VNLAIRDVRSSDPYVVIRMGKQKLKSRVIKQNTNPEWNDDLTLSITDPGLPVKVLVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I PF++AL+   +G+P+ TVI+RV P R NCLA+ESC+ W D KV+
Sbjct  76   TFSLDDKMGDAEFHIGPFLEALRAPTDGVPNGTVIARVPPSRENCLAEESCIVWSDSKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLRNVERGEVE+QLQWID+PG +GL
Sbjct  136  QDMVLRLRNVERGEVELQLQWIDVPGSRGL  165



>ref|XP_006301267.1| hypothetical protein CARUB_v10021667mg [Capsella rubella]
 gb|EOA34165.1| hypothetical protein CARUB_v10021667mg [Capsella rubella]
Length=168

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKTR ++K+INP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDA  ++KP+I+AL+M+L GLP  T+I+ + P R 
Sbjct  62   TVTDPNHPLTLIVYDHDLFSKDDKMGDAAIDLKPYIEALRMELSGLPEGTIITTIGPNRG  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W +++++Q++CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWINNRIVQNICLRLRNVERGEVEIELQWIDLPGSKGL  168



>ref|XP_009127999.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=168

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKT+ ++K+INP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNINPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDA+ ++KP+I+AL+M+L GLP  T+IS + P RS
Sbjct  62   TVTDPNLPLNLVVYDHDFFSKDDKMGDAQIDLKPYIEALRMELSGLPDGTIISTIHPNRS  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q  CLRLRNVERGEVE++LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWSNDRIVQSFCLRLRNVERGEVELELQWIDLPGSKGL  168



>gb|KDO50845.1| hypothetical protein CISIN_1g031128mg [Citrus sinensis]
Length=164

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV+SSDPYVV+KMGKQ LKTR ++ ++NPEWNEDLTLS+SD +  IKLTVYD D
Sbjct  16   VNLAVRDVVSSDPYVVIKMGKQ-LKTRVVKNNVNPEWNEDLTLSISDSNLPIKLTVYDKD  74

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++ALKM LEGLP+ T+++++QP R NCLA+ES + W D K++
Sbjct  75   TFSLDDKMGDAEFYITPFLEALKMRLEGLPNGTIVTKIQPSRENCLAEESHIVWTDGKLV  134

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEV+IQL+WID+PG +GL
Sbjct  135  QNLFLRLRNVEVGEVKIQLEWIDIPGSRGL  164



>ref|XP_010428284.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=168

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKTR ++K+INP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMG+AE ++KP+I+AL+M+L GLP  T+I+ + P R 
Sbjct  62   TVTDPNLPLTLIVYDHDLFSKDDKMGNAEIDLKPYIEALRMELSGLPEGTIITTIGPNRG  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q++CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLPGSKGL  168



>ref|XP_008229191.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Prunus mume]
Length=167

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = -2

Query  553  NLAVRDVLS--SDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDH  380
            NLA+RDV +  SDPYVV+KMGKQ+LKTR ++K  NPEWNEDLTLS++DP   + + VYD 
Sbjct  17   NLAIRDVTARTSDPYVVIKMGKQKLKTRVVKKSTNPEWNEDLTLSIADPTLPVNIHVYDK  76

Query  379  DTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            DTFT DDKMGDAEF I PF++AL++ ++G+PS TV+SRVQP R NCLA+ESC+ + D +V
Sbjct  77   DTFTLDDKMGDAEFEIGPFLEALRVRVQGVPSGTVLSRVQPNRQNCLAEESCIIYTDGQV  136

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +Q+MC+RLRNVERGE+E+QLQWID+PG +GL
Sbjct  137  VQNMCIRLRNVERGELELQLQWIDIPGSRGL  167



>ref|XP_002317873.1| GTPase activating family protein [Populus trichocarpa]
 gb|EEE96093.1| GTPase activating family protein [Populus trichocarpa]
Length=165

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVV++MG Q+LKTR I+KD+NP WNEDLTLSV+DP+  +KL VYDHD
Sbjct  16   INLAVRDVRSSDPYVVIRMGNQKLKTRVIKKDVNPHWNEDLTLSVTDPNLPVKLIVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             FTKDDKMG+AEF+I+PFI+ LKM+L G+ S TVI+R+QP R NCL+++SC+ + D KV+
Sbjct  76   LFTKDDKMGEAEFDIRPFIETLKMNLAGVSSGTVITRIQPSRQNCLSEDSCIIYSDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRL+NVE GE+EIQLQWI  P  +G 
Sbjct  136  QDLYLRLKNVECGELEIQLQWITFPSSRGF  165



>ref|XP_004512742.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Cicer arietinum]
Length=176

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  610  QSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLT  431
            +SLM++LLGLLR+RVKRG+NLAVRDV SSDPY+V+KM  Q+LKTR I+KD+NPEWNEDLT
Sbjct  9    KSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYLVIKMYNQKLKTRVIKKDVNPEWNEDLT  68

Query  430  LSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGR  251
            LS+ DP+  + LTVYDHDTF+KDDKMGDA+F+I  +I+AL+M++ GL + TV+ R+QP  
Sbjct  69   LSIIDPNHQVSLTVYDHDTFSKDDKMGDADFDISAYIEALRMNVTGLANGTVLKRIQPSN  128

Query  250  SNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             NCLADESC+ + + K+IQDM LRL+NVE GEVEI L WIDLPG KGL
Sbjct  129  QNCLADESCIYYTNGKIIQDMILRLQNVECGEVEISLHWIDLPGSKGL  176



>emb|CDX92180.1| BnaA05g22270D [Brassica napus]
Length=798

 Score =   238 bits (608),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR I KD+NPEWNEDLTLSV+DP  ++ LTVYDHD
Sbjct  649  VNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVTDPTLTVLLTVYDHD  708

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+KDDKMGDAEF IKP+I+ALKM L+GLPS T+++ VQP R NCLA+ES VTW D K++
Sbjct  709  MFSKDDKMGDAEFEIKPYIEALKMHLDGLPSGTIVTTVQPCRRNCLAEESKVTWVDGKLV  768

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GEVE QLQWIDLPG KGL
Sbjct  769  QDLVLRLRHVECGEVEAQLQWIDLPGSKGL  798



>gb|ACJ83963.1| unknown [Medicago truncatula]
 gb|AFK42924.1| unknown [Medicago truncatula]
 gb|KEH34667.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=165

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KM KQ+LKTR ++K++NPEWNEDLTLS+SDP   I L VYD D
Sbjct  16   VNLAIRDVVSSDPYVVIKMAKQKLKTRVVKKNLNPEWNEDLTLSISDPHTPIHLYVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I PF +A+KM L GLP++ +++RVQP R NCLA+ES + WKD K+ 
Sbjct  76   TFSLDDKMGDAEFDIGPFFEAVKMRLAGLPNEAIVTRVQPSRQNCLAEESHIVWKDGKIF  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            Q+M LRLRNVE GEVE+QL W+D+PG K
Sbjct  136  QNMVLRLRNVECGEVELQLHWVDIPGSK  163



>ref|XP_003552975.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoformX1 [Glycine max]
 gb|KHN07551.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Glycine soja]
Length=165

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KMG+Q+LKTR ++K++NPEWN+DLTLS+SDP A I L VYD D
Sbjct  16   VNLAIRDVVSSDPYVVIKMGRQKLKTRVVKKNLNPEWNDDLTLSISDPHAPIHLHVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PFI+A+KM L GLP++T++++V P R NCLA+ES +  KD KV+
Sbjct  76   TFSMDDKMGDAEFFIGPFIEAVKMRLSGLPNNTIVTKVLPSRQNCLAEESHIMLKDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QL WID+PG + L
Sbjct  136  QNMVLRLRNVESGEVELQLHWIDIPGSRHL  165



>ref|XP_011039132.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Populus euphratica]
Length=165

 Score =   221 bits (564),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVV++MG Q+LKTR I+KD+NP WNEDLTLSV+DP+  +KL VYDHD
Sbjct  16   INLAVRDVRSSDPYVVIRMGNQKLKTRVIKKDVNPHWNEDLTLSVTDPNLPVKLIVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             FTKDDKMG+AE +I+PFI+ LKM+L GL S TVI+R+QP R NCL+++SC+ + D KV+
Sbjct  76   LFTKDDKMGEAEIDIRPFIETLKMNLAGLSSGTVITRIQPSRQNCLSEDSCIIYSDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRL+NVE GE+EIQLQWI  P  +G 
Sbjct  136  QDLYLRLKNVECGELEIQLQWITFPSSRGF  165



>ref|XP_010416168.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=168

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKTR ++K+INP+W EDLT 
Sbjct  2    SLMDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+I+ + P R 
Sbjct  62   TVTDPNLPLTLIVYDHDLFSKDDKMGDAEIDLKPYIEALRMELSGLPEGTIITTIGPNRG  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q++CLRL NVERGEVEI+LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWINDRIVQNICLRLGNVERGEVEIELQWIDLPGSKGL  168



>ref|NP_001235515.1| uncharacterized protein LOC100306214 [Glycine max]
 gb|ACU14285.1| unknown [Glycine max]
 gb|KHN17942.1| Putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Glycine soja]
Length=165

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KMGKQ+LKTR + K++NPEWN+DLTLS+SDP A I L VYD D
Sbjct  16   VNLAIRDVVSSDPYVVIKMGKQKLKTRVVNKNLNPEWNDDLTLSISDPHAPIHLHVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PFI+A+KM L  LP++T++++V P R N LA+ES + WKD KV+
Sbjct  76   TFSMDDKMGDAEFFIGPFIEAVKMRLSSLPNNTIVTKVLPSRQNSLAEESHIVWKDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QL WID+PG + L
Sbjct  136  QNMVLRLRNVETGEVELQLHWIDIPGSRHL  165



>ref|XP_010500394.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Camelina sativa]
Length=169

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 128/154 (83%), Gaps = 4/154 (3%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ-RLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDH  380
            +NLAVRD+ SSDPYVVVKMGKQ +LKTR I  ++NPEWNEDLTLSV+DP+ ++ LTVYDH
Sbjct  16   VNLAVRDLHSSDPYVVVKMGKQQKLKTRVIYHNVNPEWNEDLTLSVTDPNLTVLLTVYDH  75

Query  379  DTFTKDDKMGD---AEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKD  209
            DTFTKDDKMGD   AEF IKPF++A+KM L  LPS T+++ VQP R NCLA+ES V W D
Sbjct  76   DTFTKDDKMGDMGDAEFIIKPFVNAVKMQLHDLPSGTIVTTVQPSRDNCLAEESRVIWSD  135

Query  208  HKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             K+IQD+ LRLR+VE GE+E QLQWIDLPG KGL
Sbjct  136  GKLIQDLVLRLRHVECGEIEAQLQWIDLPGSKGL  169



>gb|AGV54351.1| ADP-ribosylation factor GTPase-activating protein AGD11-like 
protein [Phaseolus vulgaris]
Length=165

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KMGKQ+LKTR ++K++NPEWN+DLTLS+SDP   I L VYD D
Sbjct  16   VNLAIRDVVSSDPYVVIKMGKQKLKTRVVKKNLNPEWNDDLTLSISDPHTPIHLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDA+F+I PF +A+KM L GLP++T++++V P R NCLA+ES + WKD KV+
Sbjct  76   TFSMDDKMGDADFSIVPFTEAVKMRLAGLPNNTIVTKVLPSRQNCLAEESHIVWKDGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRL+NVE GEVE+QL WID+PG + L
Sbjct  136  QNMVLRLKNVESGEVELQLNWIDIPGSRHL  165



>gb|KGN63876.1| hypothetical protein Csa_1G025080 [Cucumis sativus]
Length=201

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 129/169 (76%), Gaps = 20/169 (12%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKL------  395
            +NLAVRDV SSDPYVVVKMGKQ+LKTR I+KD+NP WNEDLTLSVSDP+  IKL      
Sbjct  33   VNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPVWNEDLTLSVSDPNLPIKLGSSKRS  92

Query  394  --------------TVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQP  257
                          TVYDHDTF+KDDKMG AEF+IK F++ALKM+L+ L S T I+R+ P
Sbjct  93   FLVSDGIFHGRHTSTVYDHDTFSKDDKMGYAEFDIKAFMEALKMNLKNLSSGTTITRMLP  152

Query  256  GRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
             R NCLA+ESCV WKD KV+QD+ LRLRNVE GEVEIQLQWI+LP  KG
Sbjct  153  ARQNCLAEESCVVWKDGKVVQDIYLRLRNVECGEVEIQLQWINLPNFKG  201



>ref|XP_007163391.1| hypothetical protein PHAVU_001G230800g [Phaseolus vulgaris]
 gb|ESW35385.1| hypothetical protein PHAVU_001G230800g [Phaseolus vulgaris]
Length=189

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KMGKQ+LKTR ++K++NPEWN+DLTLS+SDP   I L VYD D
Sbjct  40   VNLAIRDVVSSDPYVVIKMGKQKLKTRVVKKNLNPEWNDDLTLSISDPHTPIHLQVYDKD  99

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDA+F+I PF +A+KM L GLP++T++++V P R NCLA+ES + WKD KV+
Sbjct  100  TFSMDDKMGDADFSIVPFTEAVKMRLAGLPNNTIVTKVLPSRQNCLAEESHIVWKDGKVV  159

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRL+NVE GEVE+QL WID+PG + L
Sbjct  160  QNMVLRLKNVESGEVELQLNWIDIPGSRHL  189



>ref|XP_004288398.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=163

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 125/150 (83%), Gaps = 2/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            ++LAVRD+ SSDPY++VKMGKQ+LKTR +++++NPEWNE LTL+VSDP+  +KL VYD D
Sbjct  16   VDLAVRDMTSSDPYIIVKMGKQKLKTRVVKRNVNPEWNEKLTLTVSDPNIPVKLFVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDAEF I  F+  L+M LEGLP  T+I+RVQP R NCLA+ESC+ W + KV+
Sbjct  76   TFTFDDKMGDAEFEIATFVKVLQMRLEGLPEGTIIARVQPTRQNCLAEESCIIWSNGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVERGEVE+QLQWI +P  KGL
Sbjct  136  QNMVLRLRNVERGEVELQLQWIHVP--KGL  163



>ref|XP_010032687.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010032688.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW52142.1| hypothetical protein EUGRSUZ_J01588 [Eucalyptus grandis]
Length=165

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV SSDPYVV++ GK +LKTR +++++NPEWN++LTL+++DP  SI+L VYD D
Sbjct  16   VNLAIRDVRSSDPYVVIRTGKHKLKTRVVKRNLNPEWNDELTLAIADPSLSIELMVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAE +I PF+DAL+M L+ +PS TVI+RV+PGR NCLA+ES + W++ KV+
Sbjct  76   KFSLDDKMGDAEIHIVPFLDALRMRLDDVPSGTVITRVKPGRDNCLAEESSIVWRNGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLRNVERGEVE+QL+WID+PG +GL
Sbjct  136  QDMVLRLRNVERGEVELQLEWIDIPGSRGL  165



>ref|XP_002887489.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63748.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SL+D+LLG+LRVRVKRG+NLAVRDV SSDPYVV+K+G+Q+LKT+ ++K++NP+W EDL+ 
Sbjct  2    SLLDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNVNPQWEEDLSF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+IS + P R 
Sbjct  62   TVTDPNLPLTLIVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGTIISTIGPSRG  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q++CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLPGSKGL  168



>gb|KEH36497.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=164

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYV++KMGKQ+LKTR ++K++NP+WN+DLTL++SDP   I L VYD D
Sbjct  15   VNLAIRDVISSDPYVIIKMGKQKLKTRVVKKNLNPKWNDDLTLTISDPHTPIHLHVYDKD  74

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+I PF++A+KM L+GLP+DT+I+RVQP R NCLA ES +  K+ KV+
Sbjct  75   RFSMDDKMGDAEFDISPFVEAVKMRLQGLPNDTIITRVQPSRQNCLAGESHIVLKNGKVV  134

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q + LRLRNVE GEVEIQL WID+PG K L
Sbjct  135  QKLVLRLRNVECGEVEIQLHWIDIPGSKAL  164



>ref|NP_177499.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAG51808.1|AC079676_3 hypothetical protein; 22552-21875 [Arabidopsis thaliana]
 gb|AEE35478.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=168

 Score =   219 bits (558),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRV+RG+NLAVRDV SSDPYVV+K+G+Q+LKT+ +++++NP+W EDL+ 
Sbjct  2    SLMDNLLGILRVRVQRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKQNVNPQWQEDLSF  61

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+IS + P R 
Sbjct  62   TVTDPNLPLTLIVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGTIISTIGPSRG  121

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES + W + +++Q +CLRLRNVERGEVEI+LQWIDLPG KGL
Sbjct  122  NCLAEESYIRWINDRIVQHICLRLRNVERGEVEIELQWIDLPGSKGL  168



>ref|XP_002284632.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Vitis vinifera]
 emb|CAN75112.1| hypothetical protein VITISV_043576 [Vitis vinifera]
Length=166

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD  SSDPYV V MG+Q+LKTR ++ + NPEWNE+LTLS++D D  I L VYD D
Sbjct  16   INLAVRDARSSDPYVAVTMGEQKLKTRVVKDNCNPEWNEELTLSIADTDVPINLVVYDSD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDAE +IKP+++ LKM LE LP+ TVISRVQP R+NCLADESC  W + K+ 
Sbjct  76   TFTLDDKMGDAEIDIKPYVECLKMGLENLPTGTVISRVQPSRTNCLADESCCVWDNGKIR  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLRNVE GEVE+Q++WI++PGC+GL
Sbjct  136  QDMLLRLRNVECGEVEVQIEWINIPGCRGL  165



>ref|XP_011073630.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Sesamum indicum]
Length=165

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA RD  SSDPYV+V+MGKQ+LKTR ++K++NPEWNE+LTLS++DP+  +KL VYD D
Sbjct  16   INLAKRDATSSDPYVIVRMGKQKLKTRVVKKNVNPEWNEELTLSIADPNLPVKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+IK F++ALKM LE +PS T+I++V+P R NCL++ES + W++ KVI
Sbjct  76   TFSLDDKMGDAEFDIKSFLEALKMHLEDVPSGTIITKVKPTRENCLSEESTIVWENGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q M LRLRNVE GE+E+QLQWID+PG +GL
Sbjct  136  QRMFLRLRNVECGEIELQLQWIDVPGSRGL  165



>ref|XP_004145835.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 gb|KGN57815.1| hypothetical protein Csa_3G316280 [Cucumis sativus]
Length=165

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYV+ KMGKQ+LKTR ++++INPEWNEDLTLS+ DP   + + VYD D
Sbjct  16   VNLAVRDVSSSDPYVIFKMGKQKLKTRVVKQNINPEWNEDLTLSIQDPSLPVNVLVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+++PF++A+KM L  LPS T+I ++QP R NCL++ESC+ W + +VI
Sbjct  76   LFSLDDKMGDAEFDVRPFVEAVKMRLNNLPSGTIIRKIQPSRENCLSEESCIIWVNGQVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q M LRLRNVE GE+E+QLQWID+PG +GL
Sbjct  136  QKMFLRLRNVESGEIELQLQWIDIPGSRGL  165



>ref|XP_004160109.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
Length=165

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYV+ KMGKQ+LKTR ++++INPEWNEDLTLS+ DP   + + VYD D
Sbjct  16   VNLAVRDVSSSDPYVIFKMGKQKLKTRVVKQNINPEWNEDLTLSIQDPSLPVNVLVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+++PF++A+KM L  LPS T+I ++QP R NCL++ESC+ W + +VI
Sbjct  76   LFSLDDKMGDAEFDVRPFVEAVKMRLNNLPSGTIIRKIQPSRENCLSEESCIIWVNGQVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q M LRLRNVE GE+E+QLQWID+PG +GL
Sbjct  136  QKMFLRLRNVESGEIELQLQWIDIPGSRGL  165



>ref|XP_008457050.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Cucumis melo]
Length=165

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYV+ KMGKQ+LKTR ++++INPEWNEDLTLS+ DP   + + VYD D
Sbjct  16   VNLAVRDVCSSDPYVIFKMGKQKLKTRVVKQNINPEWNEDLTLSIQDPSLPVNVLVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF+++PF++A+KM L  LPS T+I ++QP R NCL++ESC+ W + +VI
Sbjct  76   LFSLDDKMGDAEFDVRPFVEAVKMRLNNLPSGTIIRKIQPSRENCLSEESCIIWVNGQVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q M LRLRNVE GE+E+QLQWID+PG +GL
Sbjct  136  QKMFLRLRNVESGEIELQLQWIDIPGSRGL  165



>ref|XP_006383322.1| hypothetical protein POPTR_0005s14500g [Populus trichocarpa]
 gb|ERP61119.1| hypothetical protein POPTR_0005s14500g [Populus trichocarpa]
Length=165

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            I+LA+RD+ SSDPYVVVKMGKQ+LKTR I+++INPEWN+DLTLSV DP+  + + VYD D
Sbjct  16   IDLAIRDIRSSDPYVVVKMGKQKLKTRVIKQNINPEWNDDLTLSVVDPNLPVLIKVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I+ FI+ +KM L+ LP+ T+IS++QP R NCLA+ESC+ W + KVI
Sbjct  76   TFSLDDKMGDAEFDIRQFIEVVKMQLDNLPTGTIISKIQPSRENCLAEESCIVWANGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLR+VE GEVE+QL+WID+PG +G+
Sbjct  136  QNMFLRLRHVESGEVELQLEWIDIPGSRGM  165



>ref|XP_009370100.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD++SSDPYVVVKMGKQ+LKT  +++++NPEWNE LTLSV++P+  I L+VYD D
Sbjct  16   VNLAVRDLISSDPYVVVKMGKQKLKTGVVKRNVNPEWNERLTLSVTEPNIPITLSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI  L+M LEGLP  TV+++VQP R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAEFDIALFIKVLRMQLEGLPDGTVLTKVQPSRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEVELQLQWIDVPSSRGL  165



>ref|XP_008381350.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Malus domestica]
Length=165

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR ++K++NPEWNE LTLSV+DP+  I+L+VYD D
Sbjct  16   VNLAVRDMXSSDPYVVVKMGKQKLKTRVVKKNVNPEWNEKLTLSVADPNLPIRLSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I  FI  L+M LEGLP  T+I++VQP R NCLA+ES + W   KV+
Sbjct  76   TFSFDDKMGDAEFEIGTFIKVLRMGLEGLPDGTIITKVQPSRKNCLAEESYIVWSKGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             +M LRLRNVE GEVE+QLQWI++P  +GL
Sbjct  136  XNMVLRLRNVECGEVELQLQWINVPSSRGL  165



>ref|XP_008353839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=165

 Score =   216 bits (549),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR +++++NPEW+E LTLSV++P   I L+VYD D
Sbjct  16   VNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSVTEPSLPITLSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI  L+M LEGLP  TVI++VQP R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAEFDIALFIQVLRMRLEGLPDGTVITKVQPSRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GE+E+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEIELQLQWIDVPSSRGL  165



>ref|XP_009381108.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Musa acuminata subsp. malaccensis]
Length=162

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYV++KMGKQ+LKTR I+++ NP WNE+LTLSV DP   ++L VYD D
Sbjct  13   VNLAVRDLRSSDPYVILKMGKQKLKTRVIKRNTNPIWNEELTLSVEDPALPVRLEVYDKD  72

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD MG+AEF+I+PF++A++M+L+G+P+ T+I++V PGR NCLADES + W D KV+
Sbjct  73   TFSLDDPMGNAEFDIRPFVEAVRMNLQGVPNGTMITKVAPGRQNCLADESAIYWSDGKVL  132

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRL++VERGEVE+QLQW+ +PG  GL
Sbjct  133  QDLVLRLKDVERGEVELQLQWVSIPGASGL  162



>ref|XP_007216470.1| hypothetical protein PRUPE_ppa025942mg [Prunus persica]
 gb|EMJ17669.1| hypothetical protein PRUPE_ppa025942mg [Prunus persica]
Length=165

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPY V+KMGKQ++KTR ++K++NPEWNEDLTLSV+DP+  I+L VYD D
Sbjct  16   VNLAVRDMRSSDPYAVIKMGKQKVKTRVVKKNVNPEWNEDLTLSVADPNLPIRLCVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF +  FI  LKM LEGLP  T+I++VQP R NCLA+ES + W   K++
Sbjct  76   TFSFDDKMGDAEFEVATFIKVLKMRLEGLPDGTIITKVQPNRQNCLAEESYIVWSKGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QL+WID+P  KGL
Sbjct  136  QNMVLRLRNVECGEVELQLKWIDVPTSKGL  165



>ref|XP_008343060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=165

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR +++++NPEW+E LTLSV++P   I L VYD D
Sbjct  16   VNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSVTEPXLPITLXVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI  L+M LEGLP  TVI++VQP R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAEFDIALFIQVLRMRLEGLPDGTVITKVQPSRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GE+E+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEIELQLQWIDVPSSRGL  165



>ref|XP_010670143.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Beta vulgaris subsp. vulgaris]
Length=173

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYV+V++GKQ+LKTR I+K +NPEWNEDLTL V DP+  ++L VYDHD
Sbjct  24   INLAVRDVKSSDPYVIVRLGKQKLKTRIIKKSLNPEWNEDLTLCVMDPNEPVRLFVYDHD  83

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+++PF+DA+K + +G P  TVI ++ P R NC+A+ESC+ WKD KV 
Sbjct  84   TFSLDDKMGDAEFDMRPFLDAVKSNSQGAPDGTVIRKLIPDRQNCIAEESCIVWKDGKVT  143

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            Q+M LRLRNVE GE+E+QLQWIDLP  +G
Sbjct  144  QNMFLRLRNVECGEIELQLQWIDLPSSRG  172



>ref|XP_009370097.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD++SSDPYVVVKMGKQ+LKT  +++++NPEW+E LTLSV++P+  ++L+VYD D
Sbjct  16   VNLAVRDLISSDPYVVVKMGKQKLKTGVVKRNVNPEWDERLTLSVTEPNLPMELSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI  L+M LEGLP  TV+++VQP R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAEFDIALFIKVLRMQLEGLPDGTVLTKVQPSRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEVELQLQWIDVPSSRGL  165



>ref|XP_008809823.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Phoenix dactylifera]
Length=166

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVV++MG+Q+LKTR I+K+ NP WNE+LTLSV DP   ++L VYD D
Sbjct  17   VNLAVRDVRSSDPYVVLRMGRQKLKTRTIQKNTNPVWNEELTLSVEDPPPPVRLQVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD MGDAEF+I+PF++A++MD EG+P+ T+I++V+P R NCLA+ES + W D KVI
Sbjct  77   TFSFDDPMGDAEFDIQPFLEAVRMDPEGVPNGTIITKVRPNRQNCLAEESLIYWSDGKVI  136

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GEVE+QLQWI +PG +GL
Sbjct  137  QDLVLRLRNVECGEVELQLQWISIPGARGL  166



>gb|KHG03449.1| hypothetical protein F383_28229 [Gossypium arboreum]
Length=176

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV +SDPYVVV+MG QRLKT+ I KD+NP WNEDLTL ++DP   IKLTV+D+D
Sbjct  19   INLAVRDVRTSDPYVVVRMGTQRLKTKVINKDVNPVWNEDLTLPITDPGEPIKLTVFDYD  78

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD+MGDAEF+I+ F+ AL+MD    P  T++++VQP R NCLA+ES V  K+ KV+
Sbjct  79   TFSMDDEMGDAEFDIQAFVQALRMDYADFPDGTILAKVQPCRKNCLAEESVVVVKEGKVL  138

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+CLRLRNVE GEVE+QL+WI++PGCKG+
Sbjct  139  QDLCLRLRNVECGEVELQLEWIEVPGCKGV  168



>ref|XP_011021393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Populus euphratica]
Length=165

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            I+LA+RD+ SSDPYVVVKMGKQ+LKTR I+++INPEWN+DLTLSV DP+  + + VYD D
Sbjct  16   IDLAIRDIRSSDPYVVVKMGKQKLKTRVIKQNINPEWNDDLTLSVVDPNLPVLIKVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I+ FI+ +KM L+ LPS T+I ++QP R NCLA+ESC+ W + KVI
Sbjct  76   TFSLDDKMGDAEFDIRQFIEVVKMQLDNLPSGTIIRKIQPTRENCLAEESCIVWANGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLR+VE GEVE+QL+WID+PG  G+
Sbjct  136  QNMFLRLRHVESGEVELQLEWIDIPGSWGM  165



>ref|XP_009381107.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Musa acuminata subsp. malaccensis]
Length=166

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD +SSDPYV+++MG Q+LKTR I+++ NP WNE+LTLSV DP   ++L VYD D
Sbjct  17   VNLAVRDFISSDPYVILRMGNQKLKTRVIKRNTNPIWNEELTLSVEDPALPVRLEVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD MG+AEF+I+PF++A++M+L+G+P+ T+I++V PGR NCLADES + W D KV+
Sbjct  77   TFSLDDPMGNAEFDIRPFVEAVRMNLQGVPNGTMITKVAPGRQNCLADESAIYWSDGKVL  136

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRL++VERGEVE+QLQW+ +PG  GL
Sbjct  137  QDLVLRLKDVERGEVELQLQWVSIPGASGL  166



>ref|XP_008368712.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD11 [Malus domestica]
Length=165

 Score =   213 bits (543),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR +++++NPEW+E LTLSV++P   I L+VYD D
Sbjct  16   VNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSVTEPSLPITLSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI  L+M LEGLP  TVI++VQP + NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAEFDIALFIQVLRMRLEGLPDGTVITKVQPXQENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GE+E+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEIELQLQWIDVPSSRGL  165



>ref|XP_010109009.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXC20649.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=165

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV++K+G+Q+LKTR ++K++NPEWNE LTLSVSDP+  IKL VYD D
Sbjct  16   VNLAIRDTRSSDPYVLLKLGRQKLKTRVVKKNLNPEWNELLTLSVSDPNTPIKLFVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++ALKM L+GLP  T+IS+ QP R NCLA+ES + + + K++
Sbjct  76   TFSFDDKMGDAEFEIGPFLNALKMRLQGLPDGTIISKAQPTRKNCLAEESRIVFSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GEVE+QLQWID+P  KGL
Sbjct  136  QDLVLRLRNVECGEVELQLQWIDVPTSKGL  165



>ref|XP_008381349.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Malus domestica]
Length=166

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ-RLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDH  380
            +NLAVRD+ SSDPYVVVKMGKQ +LKTR ++K++NPEWNE LTLSV+DP+  I+L+VYD 
Sbjct  16   VNLAVRDMXSSDPYVVVKMGKQQKLKTRVVKKNVNPEWNEKLTLSVADPNLPIRLSVYDK  75

Query  379  DTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            DTF+ DDKMGDAEF I  FI  L+M LEGLP  T+I++VQP R NCLA+ES + W   KV
Sbjct  76   DTFSFDDKMGDAEFEIGTFIKVLRMGLEGLPDGTIITKVQPSRKNCLAEESYIVWSKGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            + +M LRLRNVE GEVE+QLQWI++P  +GL
Sbjct  136  VXNMVLRLRNVECGEVELQLQWINVPSSRGL  166



>ref|XP_011099467.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Sesamum indicum]
Length=165

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            I LAVRD  SSDPYV+V+MGKQ+LKTR ++K++NPEWNE+LTL++SDP+  IKL VYD D
Sbjct  16   IKLAVRDTRSSDPYVIVRMGKQKLKTRVVKKNVNPEWNEELTLTISDPNLPIKLQVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT+DDKMGDAEF+IK F+D LKM L+ +PS TVI  V+P R NCLA+ES + W++ KV 
Sbjct  76   TFTRDDKMGDAEFDIKEFVDVLKMHLDNVPSGTVIKNVKPNRENCLAEESSIVWENGKVT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q M LRLRNVE GE+E+QL WI++PG + L
Sbjct  136  QHMFLRLRNVECGEIELQLHWIEVPGSRCL  165



>ref|XP_010109014.1| Bifunctional glutamate/proline--tRNA ligase [Morus notabilis]
 gb|EXC20654.1| Bifunctional glutamate/proline--tRNA ligase [Morus notabilis]
Length=499

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV+SSDPYVV+KMGKQ+LKTR + K +NPEWNEDLTLS++DP   I L VYD D
Sbjct  16   VNLAIRDVVSSDPYVVIKMGKQKLKTRVVNKCVNPEWNEDLTLSIADPTLPIHLLVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PFI+ALKM L GLPS T+I++V P R NCLA+ES + W D K++
Sbjct  76   TFSLDDKMGDAEFEIGPFIEALKMRLAGLPSGTIITKVHPSRQNCLAEESRILWTDGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCK  113
            Q++CLRLRNVE GE+E+QL+WID+PG +
Sbjct  136  QNLCLRLRNVESGEIELQLEWIDIPGSR  163



>ref|XP_008358166.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD11 [Malus domestica]
Length=165

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR +++++NPEW+E LTLSV++P+  I L+VYD D
Sbjct  16   LNLAVRDLTSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSVAEPNLPITLSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDK G+AEF+I  FI  L+M LEGLP  T++ +VQP R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKXGEAEFDIALFIKVLRMQLEGLPDGTILXKVQPSRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEVELQLQWIDVPSSRGL  165



>ref|XP_003619827.1| Multiple C2 and transmembrane domain-containing protein [Medicago 
truncatula]
 gb|AES76045.1| calcium-dependent ARF-type GTPase activating family protein [Medicago 
truncatula]
Length=177

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  610  QSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLT  431
            +SLM++LLGLLRVRVKRG+NLAVRDV SSDPYVV+KM  Q+LKT   +K++NPEWNEDLT
Sbjct  10   KSLMENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYNQKLKTHVKKKNVNPEWNEDLT  69

Query  430  LSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGR  251
            LSV DP+  + LTVYDHDTF+KDDKMGDA F+   FI+AL+M++ GL + TV+ R+ P +
Sbjct  70   LSVIDPNHPVTLTVYDHDTFSKDDKMGDAVFDASTFIEALRMNVTGLANGTVLKRIPPSK  129

Query  250  SNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
             NCLA+ESC+ + + K+IQDM LRL+NVE GEVEI L WIDLPG KGL
Sbjct  130  HNCLAEESCIYYSNGKIIQDMILRLQNVECGEVEITLHWIDLPGSKGL  177



>ref|XP_004288393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Fragaria vesca subsp. vesca]
Length=165

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NLAVRDV SSDPYVVV MGKQ+LKTR ++K +NPEWNEDLTLS+SD    I + VYD DT
Sbjct  17   NLAVRDVRSSDPYVVVNMGKQKLKTRVVKKSVNPEWNEDLTLSISDSSHPIHIAVYDKDT  76

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            FT+DDKMGDAE  I PF++A++M L+G+ +  V SRV+P + NCLA++SC+ + D  +IQ
Sbjct  77   FTQDDKMGDAEIEIGPFLEAIRMRLDGVANGMVASRVEPSKENCLAEQSCIIYSDGNIIQ  136

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +M +RLRNVE GEVE+QLQWI++PG +GL
Sbjct  137  NMTVRLRNVESGEVELQLQWINIPGSRGL  165



>ref|XP_002305199.1| hypothetical protein POPTR_0004s08840g [Populus trichocarpa]
 gb|ABK92911.1| unknown [Populus trichocarpa]
 gb|EEE85710.1| hypothetical protein POPTR_0004s08840g [Populus trichocarpa]
Length=165

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYVVVKMGKQ+LKTR I+++INPEWN+DLTLS+ DP   + + VYD D
Sbjct  16   VNLAVRDVCSSDPYVVVKMGKQKLKTRVIKQNINPEWNDDLTLSIVDPKLPVLIRVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI+ +KM L+ LPS T+I ++QP R NCLA+ESC+ W   K++
Sbjct  76   TFSLDDKMGDAEFDISQFIEVVKMRLDNLPSGTIIRKIQPSRENCLAEESCIVWATGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRL++VE GEVE+QL+WID+PG +GL
Sbjct  136  QNLFLRLKHVETGEVELQLEWIDIPGSRGL  165



>ref|XP_009334450.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKTR +++++NPEW+E LTLSV++P+  I L VYD D
Sbjct  16   VNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSVTEPNIPITLFVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDA F+I  F++ L+M  EGLP  TVI++VQP R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAHFDIAQFVEVLRMRSEGLPDGTVITKVQPSRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GE+E+QLQWID+P  +GL
Sbjct  136  QNMILRLRNVECGEIELQLQWIDVPSSRGL  165



>ref|XP_010062251.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Eucalyptus grandis]
 gb|KCW69362.1| hypothetical protein EUGRSUZ_F02846 [Eucalyptus grandis]
Length=165

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV SSDPY++VK GKQ+LKTR IRK+ NPEWNEDLTL+V+D +  ++L VYD D
Sbjct  16   VNLAIRDVKSSDPYIIVKFGKQKLKTRVIRKNTNPEWNEDLTLTVADHNLPVQLFVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
              + DDKMGDAEF I PF++AL+M L+ LPS T+I+RV P R NCLADES V W D KV+
Sbjct  76   RLSFDDKMGDAEFEIGPFVEALRMRLDELPSGTIITRVLPTRQNCLADESRVVWADGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GE+E++L+W D+PG +GL
Sbjct  136  QEMVLRLRNVESGEIELRLEWTDIPGSRGL  165



>ref|XP_010928845.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Elaeis guineensis]
Length=165

 Score =   211 bits (537),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA RD   SDPYVV++MG+Q+LKT   +K++NPEWNEDLTLSVSDP  +I+L V+D D
Sbjct  16   VNLAYRDTRGSDPYVVLRMGRQKLKTSVKKKNVNPEWNEDLTLSVSDPTQTIRLEVFDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF++DD+MGDAEF I+ F++A++MDL GLP+ T+I+ V+P R+NCL+ +S + WKD ++ 
Sbjct  76   TFSRDDRMGDAEFGIQSFLEAVRMDLSGLPNGTIITTVRPARNNCLSGDSSIVWKDGRIT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GEVE+QLQW+ +PG  GL
Sbjct  136  QDLVLRLRNVESGEVELQLQWVSIPGAAGL  165



>emb|CDP02696.1| unnamed protein product [Coffea canephora]
Length=166

 Score =   211 bits (537),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ-RLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDH  380
            +NLA+RDV SSDPY++V+MGKQ +LKTR ++K++NPEWNEDLTLS++DP   IKL V+D 
Sbjct  16   VNLAIRDVRSSDPYIIVRMGKQQKLKTRVVKKNVNPEWNEDLTLSIADPSIPIKLQVFDK  75

Query  379  DTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            DTF+ DDKMGDAEF+I PFI+A++M LE +PS TVI+ V+P R NCLA++S + W++ KV
Sbjct  76   DTFSFDDKMGDAEFDIGPFIEAVRMRLENIPSGTVITNVKPSRQNCLAEDSNIVWENGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
             Q M LRLRNVERGEVE++L+WID+PG  G
Sbjct  136  KQHMFLRLRNVERGEVELRLEWIDIPGSMG  165



>ref|XP_011023699.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X3 [Populus euphratica]
Length=171

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  601  MDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSV  422
            MDS LGLLR+RVKRG+NLAVRD+ SSDPYVV+ MG Q+LKTR ++K+ NP WNE+LTLS+
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  421  SDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNC  242
            +D +  I LTV+D DTFT DDKMG+A  +I+P+I +LKM L+ LP   V+SRVQP ++NC
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDIQPYIASLKMGLQNLPKGCVVSRVQPSQNNC  120

Query  241  LADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            LADESC+ W D K++QDM LRLRNVE GEV IQ++WID+PGC+GL
Sbjct  121  LADESCIVWDDGKLLQDMVLRLRNVESGEVMIQIEWIDVPGCRGL  165



>ref|XP_011023692.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Populus euphratica]
Length=173

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  601  MDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSV  422
            MDS LGLLR+RVKRG+NLAVRD+ SSDPYVV+ MG Q+LKTR ++K+ NP WNE+LTLS+
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  421  SDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNC  242
            +D +  I LTV+D DTFT DDKMG+A  +I+P+I +LKM L+ LP   V+SRVQP ++NC
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDIQPYIASLKMGLQNLPKGCVVSRVQPSQNNC  120

Query  241  LADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            LADESC+ W D K++QDM LRLRNVE GEV IQ++WID+PGC+GL
Sbjct  121  LADESCIVWDDGKLLQDMVLRLRNVESGEVMIQIEWIDVPGCRGL  165



>ref|XP_011002782.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Populus euphratica]
Length=165

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDP VVVKMGKQ+LKTR ++K+INPEWN+DLTLS+ DP   + + VYD D
Sbjct  16   VNLAVRDVCSSDPDVVVKMGKQKLKTRVVKKNINPEWNDDLTLSIVDPKLPVLIRVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I  FI+ +KM L+ LPS T+I ++QP R NCLA+ESC+ W + KV+
Sbjct  76   TFSLDDKMGDAEFDISQFIEVVKMRLDNLPSGTIIRKIQPNRENCLAEESCIVWANGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLR+VE GEVE+QL+WID+PG +GL
Sbjct  136  QNLFLRLRHVETGEVELQLEWIDIPGSRGL  165



>ref|XP_002527798.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF34608.1| ARF GTPase activator, putative [Ricinus communis]
Length=171

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ +SDP+VVV MG Q LKTR ++K+ NPEWNE+LTLS+ DP   IKL V+D D
Sbjct  16   VNLAVRDLGASDPFVVVNMGHQTLKTRVVKKNCNPEWNEELTLSIEDPIVPIKLAVFDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDA  +IKP+I +LKM L+ LP+  V+SRVQP + NCLADESC+ W + K+ 
Sbjct  76   TFTLDDKMGDAHIDIKPYIASLKMGLQTLPNGCVVSRVQPSKDNCLADESCIVWNNGKIT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL*IDEI  92
            QDM LRLRNVE GEVE+Q++WID+PGC+ L ++ I
Sbjct  136  QDMHLRLRNVESGEVEVQVEWIDVPGCRTLEVEGI  170



>ref|XP_009612263.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana tomentosiformis]
Length=165

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RDV SSDPYVVV++G+Q+LKTR ++K++NPEWNEDLTLS+++P   IKL VYD D
Sbjct  16   INLAIRDVTSSDPYVVVRLGRQKLKTRVVKKNVNPEWNEDLTLSITEPIQPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAE +I PFIDA++   E +P+ T+I++++P R NC ++ESC+ W++ +V+
Sbjct  76   IFSLDDKMGDAELDIFPFIDAVRKRFENIPNGTIITKIKPSRENCFSEESCIVWENGQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ +RLRNVERGE+E+QL+WID+P  KGL
Sbjct  136  QNVFIRLRNVERGEIELQLRWIDIPNSKGL  165



>ref|XP_008789738.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Phoenix dactylifera]
Length=165

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA RD   SDPY+V++MG+Q+LKT   +K++NPEWNEDLTLSVSDP  +I+L V+D D
Sbjct  16   VNLAYRDTRGSDPYIVLRMGRQKLKTSVKKKNVNPEWNEDLTLSVSDPTQTIRLEVFDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F++DD+MGDAEF ++ F++A++MDL GLPS T+I+ V+P R+NCLA ES + WKD ++ 
Sbjct  76   IFSRDDRMGDAEFEMQSFLEAVRMDLSGLPSGTIITTVKPERTNCLAGESPIVWKDGRIT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GEVE+QLQW+ +PG  GL
Sbjct  136  QDLVLRLRNVESGEVELQLQWVSIPGAAGL  165



>ref|XP_010916494.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Elaeis guineensis]
Length=166

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV SSDPYV+++MG+Q+LKTR I+++ NPEWNEDLTLSV DP   ++L VYD D
Sbjct  17   VNLAVRDVRSSDPYVILQMGRQKLKTRTIKRNTNPEWNEDLTLSVEDPTLPVRLQVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD MG+AEF+I+PF++A++M+ E +P+ T+I++V P R NCLA+ES + W D KV 
Sbjct  77   TFSSDDPMGNAEFDIQPFLEAVRMNPEAVPNGTIITKVVPNRQNCLAEESRIYWSDGKVT  136

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GEVE+QLQWI +PG +GL
Sbjct  137  QDIVLRLRNVECGEVELQLQWISIPGARGL  166



>ref|XP_009370095.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Pyrus x bretschneideri]
Length=165

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVV MGKQ+LKTR ++K++NPEWNE +TLSV+D    I+L+VYD D
Sbjct  16   VNLAVRDMRSSDPYVVVNMGKQKLKTRVVKKNVNPEWNEKVTLSVADAILPIRLSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I  FI  L+M L GLP  T+I++VQP R NCLA+ES + W   KV+
Sbjct  76   TFSFDDKMGDAEFEIGTFIKVLRMGLVGLPDGTIITKVQPSRKNCLAEESYIVWSKGKVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWI++P  +GL
Sbjct  136  QNMVLRLRNVECGEVELQLQWINVPSSRGL  165



>ref|XP_004231984.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=165

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RDV +SDPYVVV+MGKQ+LKTR ++K++NPEWNE+LTLS+++P   IKL VYD D
Sbjct  16   INLAIRDVTTSDPYVVVRMGKQKLKTRVVKKNLNPEWNEELTLSITEPILPIKLHVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAE +I+PFIDA +   + +PS T+I++++P R NC ++ES + W++ +V+
Sbjct  76   IFSLDDKMGDAEVDIQPFIDAARKRYKNIPSGTIITKIKPSRQNCFSEESSIVWENDQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ +RLRNVERGE+E+QLQWID+PG KG+
Sbjct  136  QNVFIRLRNVERGEIELQLQWIDIPGSKGV  165



>ref|XP_011023686.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Populus euphratica]
Length=181

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  601  MDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSV  422
            MDS LGLLR+RVKRG+NLAVRD+ SSDPYVV+ MG Q+LKTR ++K+ NP WNE+LTLS+
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  421  SDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNC  242
            +D +  I LTV+D DTFT DDKMG+A  +I+P+I +LKM L+ LP   V+SRVQP ++NC
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDIQPYIASLKMGLQNLPKGCVVSRVQPSQNNC  120

Query  241  LADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            LADESC+ W D K++QDM LRLRNVE GEV IQ++WID+PGC+GL
Sbjct  121  LADESCIVWDDGKLLQDMVLRLRNVESGEVMIQIEWIDVPGCRGL  165



>ref|XP_007160540.1| hypothetical protein PHAVU_002G330200g [Phaseolus vulgaris]
 gb|ESW32534.1| hypothetical protein PHAVU_002G330200g [Phaseolus vulgaris]
Length=166

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            ++LA+RDV +SDPYVVVKM KQ+LKT  I+KDINPEWNEDLT SV+DP   + +TVYDHD
Sbjct  16   VDLAIRDVSTSDPYVVVKMDKQKLKTSVIKKDINPEWNEDLTFSVTDPSCPLIMTVYDHD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF+I P+I+A+KM+++ LP+ T+I+R+ P R+NCLA+ESCV +++ K++
Sbjct  76   TFSMDDKMGDAEFDISPYIEAVKMEVDDLPNGTIITRMLPCRTNCLAEESCVVYENGKIL  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLR+VE GE+E QL+WI LPG K L
Sbjct  136  QNVVLRLRHVECGELEFQLEWISLPGAKSL  165



>ref|XP_006379768.1| hypothetical protein POPTR_0008s13070g [Populus trichocarpa]
 gb|ERP57565.1| hypothetical protein POPTR_0008s13070g [Populus trichocarpa]
Length=173

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -2

Query  601  MDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSV  422
            MDS LGLLR+RVKRG+NLAVRD+ SSDPYVV+ MG Q+LKTR ++K+ NP WNE+LTLS+
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  421  SDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNC  242
            +D +  I LTV+D DTFT DDKMG+A  +++P+I +LKM L+ LP   V+SRVQP ++NC
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDLQPYIASLKMGLQNLPKGCVVSRVQPSQNNC  120

Query  241  LADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            LADESC+ W D K+ QDM LRLRNVE GEV IQ++WID+PGC+GL
Sbjct  121  LADESCIVWDDGKLHQDMILRLRNVESGEVTIQIEWIDVPGCRGL  165



>ref|XP_006357769.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=165

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RDV +SDPYVVV+MGKQ+LKTR ++K++NPEWNE+LTLS+++P   I L VYD D
Sbjct  16   INLAIRDVTTSDPYVVVRMGKQKLKTRVVKKNLNPEWNEELTLSITEPILPINLHVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAE +I PFIDA++   + +PS T+I++++P R NCL++ES + W++ +V+
Sbjct  76   IFSLDDKMGDAEIDIHPFIDAVRKRYKNIPSGTIITKIKPSRQNCLSEESPIVWENDQVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ +RLRNVERGE+E+QLQWID+PG KG+
Sbjct  136  QNVFIRLRNVERGEIELQLQWIDIPGSKGV  165



>ref|XP_002312449.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89816.1| C2 domain-containing family protein [Populus trichocarpa]
Length=171

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -2

Query  601  MDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSV  422
            MDS LGLLR+RVKRG+NLAVRD+ SSDPYVV+ MG Q+LKTR ++K+ NP WNE+LTLS+
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  421  SDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNC  242
            +D +  I LTV+D DTFT DDKMG+A  +++P+I +LKM L+ LP   V+SRVQP ++NC
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDLQPYIASLKMGLQNLPKGCVVSRVQPSQNNC  120

Query  241  LADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            LADESC+ W D K+ QDM LRLRNVE GEV IQ++WID+PGC+GL
Sbjct  121  LADESCIVWDDGKLHQDMILRLRNVESGEVTIQIEWIDVPGCRGL  165



>ref|XP_011038617.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Populus euphratica]
Length=181

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NLAVRD+ +SDPYVV+ MGKQ+LKTR ++K+ NPEWNE++TLS++D +  I LTV+D D 
Sbjct  17   NLAVRDLGTSDPYVVITMGKQKLKTRVVKKNCNPEWNEEITLSITDLNVPINLTVFDKDR  76

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            FT DDKMG+AE +IK +I +LKM L+ LP+  V+SRV+P R+NCLADESCV W + K++Q
Sbjct  77   FTVDDKMGEAEIDIKAYIASLKMGLQNLPNGCVVSRVKPSRNNCLADESCVVWDNGKILQ  136

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKGL*IDEIVPP  83
            DM LRLRNVE GEV IQ++WI++PGC+GL I +   P
Sbjct  137  DMILRLRNVESGEVMIQIEWINVPGCRGLEIGDREAP  173



>ref|XP_006843797.1| hypothetical protein AMTR_s00007p00250850 [Amborella trichopoda]
 gb|ERN05472.1| hypothetical protein AMTR_s00007p00250850 [Amborella trichopoda]
Length=166

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+LSSDPYV++ MGKQRLKTR I+++ NP WNE+LTL VS+P   IK  VYD D
Sbjct  17   VNLAVRDLLSSDPYVILSMGKQRLKTRVIKRNTNPTWNENLTLVVSNPIMPIKFRVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF++DDKMGDAE +I+PF++A+ MDL+G+PS T+I ++ P R NCLA+ SC++W+ + V+
Sbjct  77   TFSRDDKMGDAELDIQPFMEAVNMDLKGVPSGTIIRKLIPSRQNCLAEVSCISWEVNTVV  136

Query  196  QDMCLRLRNVERGEVEIQLQWI  131
            QD+CLRLRNVERGEVE+QL+WI
Sbjct  137  QDVCLRLRNVERGEVELQLKWI  158



>ref|XP_009388652.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYV++KMGKQ+LKTR I+ + NP WNE+LTL V DP   ++L VYD D
Sbjct  24   VNLAVRDLWSSDPYVILKMGKQKLKTRVIKCNTNPVWNEELTLYVEDPTLPVRLEVYDKD  83

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD+MG+AEF+I PF++A+KM+LEGLP+ T+I +V P R NCLA+ES V W D +V+
Sbjct  84   TFSLDDRMGNAEFDIHPFVEAVKMNLEGLPNGTIIRKVVPCRRNCLAEESHVYWSDGEVV  143

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            QD+ LRLRNVERGEVE+QL WI +PG  G
Sbjct  144  QDLVLRLRNVERGEVELQLHWISIPGSGG  172



>ref|XP_010066605.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
Length=166

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INL VRD LSSDPYVVV M  Q+LKTR ++ + NPEWN++LTLS++DP   I LTVYD D
Sbjct  16   INLVVRDSLSSDPYVVVSMADQKLKTRVVKNNCNPEWNDELTLSITDPSIPICLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMG+A+ +IKP++DA++M L+ LP+ T I+RVQP ++NCLADESC+ WKD K+ 
Sbjct  76   TFTVDDKMGEAKIDIKPYLDAIEMRLQNLPTPTTIARVQPSKTNCLADESCIVWKDGKIY  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPG  119
            QDM LRL NVE GEVE+QL+WIDL G
Sbjct  136  QDMMLRLANVETGEVEVQLEWIDLSG  161



>ref|XP_002314800.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00971.1| C2 domain-containing family protein [Populus trichocarpa]
Length=171

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NLAVRD+ +SDPY V+ MGKQ+LKTR ++K+ NPEWNE+LTLS++D +  I LTV+D D 
Sbjct  17   NLAVRDLGTSDPYAVITMGKQKLKTRVVKKNCNPEWNEELTLSITDLNVPINLTVFDKDR  76

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            FT DDKMG+AE +IK +I +LKM L+ LP+  V+SR++P R+NCLADESCV W + K++Q
Sbjct  77   FTVDDKMGEAEIDIKAYIASLKMGLQNLPNGCVVSRIKPSRNNCLADESCVVWDNGKILQ  136

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            DM LRLRNVE GEV IQ++W+++PGC+GL
Sbjct  137  DMILRLRNVESGEVMIQIEWMNVPGCRGL  165



>ref|XP_004233475.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=166

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD+ SSDPYVVV+MGKQ+LKTR ++K++NPEWNEDLTL V+ P   IKL VYD D
Sbjct  16   INLAIRDLRSSDPYVVVRMGKQKLKTRVVKKNVNPEWNEDLTLGVAQPILPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMD-LEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            TF++DDKMGDAE +I PFIDA++M   + +P+  +ISR+ P R NC ++ESC+ +++ KV
Sbjct  76   TFSRDDKMGDAELDIVPFIDAVRMTRYKNIPNGVIISRIMPNRQNCYSEESCIVYENGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +Q+  LRLRNVERGE+++QLQWI +PG K L
Sbjct  136  VQNAFLRLRNVERGEIQLQLQWIHIPGSKNL  166



>gb|KFK41793.1| hypothetical protein AALP_AA2G172800 [Arabis alpina]
Length=808

 Score =   222 bits (565),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  607  SLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTL  428
            SLMD+LLG+LRVRVKRGINLAVRDV SSDPYVV+K+G+Q+LKT+ ++K++NP+W EDLT 
Sbjct  642  SLMDNLLGILRVRVKRGINLAVRDVCSSDPYVVLKLGRQKLKTKVVKKNVNPKWEEDLTF  701

Query  427  SVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRS  248
            +V+DP+  + L VYDHD F+KDDKMGDAE ++KP+I+AL+M+L GLP  T+IS + P R 
Sbjct  702  TVTDPNLPLNLIVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGTIISTINPSRG  761

Query  247  NCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            NCLA+ES V   + ++IQ++CLRLRNVERGEVE++LQWIDLPG KGL
Sbjct  762  NCLAEESYVRCINDRIIQNICLRLRNVERGEVEVELQWIDLPGSKGL  808



>ref|XP_007215077.1| hypothetical protein PRUPE_ppa012537mg [Prunus persica]
 gb|EMJ16276.1| hypothetical protein PRUPE_ppa012537mg [Prunus persica]
Length=165

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVV+KMGKQ+LKTR +++++NPEW+E LTLSV+D +  I + VYD D
Sbjct  16   VNLAVRDMRSSDPYVVIKMGKQKLKTRVVKRNVNPEWDESLTLSVADANLPIMVCVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I  FI ALKM  EGL   T+I RV+P R NCLA+ESC+ W + K++
Sbjct  76   TFSFDDKMGDAEFEIGSFITALKMRSEGLTDGTIIDRVKPNRENCLAEESCIIWSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q++ LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  QNLVLRLRNVECGEVELQLQWIDVPSSRGL  165



>ref|XP_010551808.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=167

 Score =   206 bits (523),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV SSDPY VV+MGKQ+LKTR ++K++NPEWNEDLTLSV+DP   +K+TVYD D
Sbjct  16   VNLAIRDVSSSDPYAVVRMGKQKLKTRVVKKNVNPEWNEDLTLSVTDPTLPVKITVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F+ DD+MG+AEF I  F++A+K+   L GLP  T+I +VQP R NCL++ES + W   K
Sbjct  76   IFSADDRMGEAEFTIGTFLEAIKIRHQLGGLPEGTIIMKVQPTRENCLSEESQIVWSKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            ++QDM LRLR+VE GEVE+QL+WID+PG +G+
Sbjct  136  IVQDMFLRLRHVECGEVELQLEWIDIPGSRGI  167



>ref|XP_009370094.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Pyrus x bretschneideri]
Length=166

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ-RLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDH  380
            +NLAVRD+ SSDPYVVV MGKQ +LKTR ++K++NPEWNE +TLSV+D    I+L+VYD 
Sbjct  16   VNLAVRDMRSSDPYVVVNMGKQQKLKTRVVKKNVNPEWNEKVTLSVADAILPIRLSVYDK  75

Query  379  DTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            DTF+ DDKMGDAEF I  FI  L+M L GLP  T+I++VQP R NCLA+ES + W   KV
Sbjct  76   DTFSFDDKMGDAEFEIGTFIKVLRMGLVGLPDGTIITKVQPSRKNCLAEESYIVWSKGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +Q+M LRLRNVE GEVE+QLQWI++P  +GL
Sbjct  136  VQNMVLRLRNVECGEVELQLQWINVPSSRGL  166



>ref|XP_004292368.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=163

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            ++LA+RD++SSDPY++V+MGK +LKTR +++ +NPEW+E LTL+VSDP+  +KL VYD D
Sbjct  16   VDLALRDMISSDPYIIVEMGKHKLKTRLVKRSVNPEWDEKLTLTVSDPNIPVKLFVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDAEF I  F++ ++M LEGLP  T+I++VQP R NCLA+ESC+   + K++
Sbjct  76   TFTFDDKMGDAEFEIATFVEVVQMLLEGLPEGTIIAKVQPTRQNCLAEESCIILSNGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLP  122
            Q+M LRLRNVERGEVE+QL WI +P
Sbjct  136  QNMVLRLRNVERGEVELQLHWIHVP  160



>ref|XP_009403742.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Musa acuminata subsp. malaccensis]
Length=166

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRDV +SDPYVV++MGKQ+LKTR I+K+ NP WNEDLTL + DP   ++L V+D D
Sbjct  17   VNLAVRDVTTSDPYVVLRMGKQKLKTRVIKKNTNPVWNEDLTLCIEDPSLPVRLQVFDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             FTKDD MG AEF+I+PF++A+KM+ +G+P  T+I +V P R NCLA+ES V W   +V 
Sbjct  77   RFTKDDAMGHAEFDIRPFLEAVKMNPQGVPEGTIIRKVVPCRQNCLAEESVVRWCHGQVT  136

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRL++VERGEVE+QLQW+D+PG KGL
Sbjct  137  QDLALRLKDVERGEVELQLQWVDIPGAKGL  166



>ref|XP_008804356.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Phoenix dactylifera]
Length=165

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +N+A RD   SDPYVV+++G Q+LKT   +K+ NPEWNE+LTLSVSDP  +I+L V+D D
Sbjct  16   VNIAYRDTRGSDPYVVLRLGHQKLKTSVKKKNNNPEWNEELTLSVSDPTQTIRLEVFDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DD+MGDAEF I+PF +A+KMDL GLP+ T+++ V+P R+NCL+ ES + WKD +V 
Sbjct  76   TFSGDDRMGDAEFEIQPFFEAVKMDLTGLPNGTIVTTVKPERNNCLSGESVILWKDGRVT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            QD+ LRLRNVE GEVE+QLQW+ +PG  G
Sbjct  136  QDLVLRLRNVESGEVELQLQWVSIPGAAG  164



>gb|EYU44565.1| hypothetical protein MIMGU_mgv1a015143mg [Erythranthe guttata]
Length=167

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD +SSDPYV+V+M KQ+LKTR ++K++NPEWNE+LTL++SDP+  IKL VYD D
Sbjct  16   INLAIRDAISSDPYVIVRMAKQKLKTRVVKKNLNPEWNEELTLTISDPNIPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDA F+IK F++A+KM LE +PS T++++V+P R NCL+++S + W++ KV 
Sbjct  76   TFTLDDKMGDAYFSIKEFVEAVKMKLENIPSGTIVTKVRPNRENCLSEDSFIKWENGKVT  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLP  122
            Q M LRL NVE GE+E+QL WID+P
Sbjct  136  QSMFLRLNNVECGEIELQLHWIDIP  160



>ref|XP_006346891.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=166

 Score =   203 bits (516),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD+ SSDPYVVV+MGKQ+LKTR ++K++NPEWN+DLTL V+ P   IKL VYD D
Sbjct  16   INLAIRDLRSSDPYVVVRMGKQKLKTRVVKKNVNPEWNDDLTLCVAQPILPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMD-LEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            TF++DDKMGDAE +I PFIDA++M   + +P+  +ISR+ P R NC ++ESC+ +++ KV
Sbjct  76   TFSRDDKMGDAEIDIIPFIDAVRMTRYKNIPNGVIISRIMPNRQNCYSEESCIVYENGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +Q+  LRLRNVERGE+++QLQWI +PG K L
Sbjct  136  VQNAFLRLRNVERGEIQLQLQWIHIPGSKNL  166



>ref|XP_007045191.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
 gb|EOY01023.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
Length=269

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD +SSDPYVV+ MG Q+LKTR ++ + NPEWN++LTLS++DP+  I LTVYD D
Sbjct  96   INLAIRDTVSSDPYVVLIMGHQKLKTRVVKNNCNPEWNDELTLSINDPNVPIILTVYDKD  155

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
            TFT DD+MG+AE +IKP+I ALKM   L+ LP+   + R+QPGR+NCLADES + W D K
Sbjct  156  TFTVDDQMGNAEIDIKPYIAALKMGKGLQNLPNGCALKRIQPGRTNCLADESSIVWNDGK  215

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            + QDM LRL+NVE GEV IQL+WI++PGCKGL
Sbjct  216  ITQDMHLRLKNVECGEVLIQLEWIEIPGCKGL  247



>ref|XP_009370096.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKT  +++++NP W+E LTLSV++P+  I L VYD D
Sbjct  16   VNLAVRDMRSSDPYVVVKMGKQKLKTGVVKRNVNPVWDETLTLSVTEPNLPITLCVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF I  F+  L+M LEGL   TVI++VQP R NCLA+ESC+ W   K++
Sbjct  76   RFSFDDKMGDAEFEIALFVKVLRMRLEGLLDGTVIAKVQPNRENCLAEESCIIWSKGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  QNMALRLRNVECGEVELQLQWIDVPSSRGL  165



>ref|XP_004288396.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=165

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYV+VKM KQ+LKTR ++K +NPEWNE LTLS+ DP   I ++VYD D
Sbjct  16   VNLAVRDMRSSDPYVIVKMSKQKLKTRVVKKSVNPEWNEQLTLSIVDPSLPILVSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDA+F I PFI A+KM+ + L    +IS+VQ  + NCLA+ESC+ +   K++
Sbjct  76   TFSFDDKMGDAQFEIGPFIKAMKMNFQDLQDGAIISKVQANKQNCLAEESCIIYSKGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRL+NVE GEVE+QLQWID+P  KGL
Sbjct  136  QNMVLRLKNVECGEVELQLQWIDIPSSKGL  165



>ref|XP_009370098.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Pyrus x bretschneideri]
Length=165

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVVVKMGKQ+LKT  +++++NP W+E L LSV++P+  I L VYD D
Sbjct  16   VNLAVRDMRSSDPYVVVKMGKQKLKTGVVKRNVNPVWDETLALSVTEPNLPITLCVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F+ DDKMGDAEF I  F+  L+M LEGL   TVI++VQP R NCLA+ESC+ W   K++
Sbjct  76   RFSFDDKMGDAEFEIALFVKVLRMRLEGLLDGTVIAKVQPNRENCLAEESCIIWSKGKLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            Q+M LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  QNMALRLRNVECGEVELQLQWIDVPSSRGL  165



>ref|XP_010527744.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=167

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 122/152 (80%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RDV SSDPYVVV+MGKQ+LKTR ++K++NPEWNEDLTLSV+DP   + +TVYD D
Sbjct  16   VNLAIRDVSSSDPYVVVRMGKQKLKTRVVKKNVNPEWNEDLTLSVADPTLPVTITVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F+ DDKMG+AEF I PF++A+K+   L  +P  +VI +VQP R NCL++ES + W   K
Sbjct  76   LFSADDKMGEAEFKIGPFLEAVKIRHQLGLVPEGSVIMKVQPNRENCLSEESQIVWSKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            + QDM LRLRNVE GEV++QL+WI++PG +G+
Sbjct  136  IAQDMFLRLRNVECGEVQLQLEWIEVPGSRGI  167



>ref|XP_010109008.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXC20648.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=170

 Score =   201 bits (510),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 122/152 (80%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD +SSDPYVVV+MGKQ+LKTR +++++NPEWN+ LTLSV+DP+  +KL VYD D
Sbjct  16   VNLAIRDSISSDPYVVVRMGKQKLKTRVVKRNVNPEWNDFLTLSVTDPNTPVKLFVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
            TF+ DDKMGDAEF I PF  A+KM   L+GLP  T+IS+V+  R NC+A+ES +   + K
Sbjct  76   TFSFDDKMGDAEFEIGPFFKAVKMGLQLQGLPDGTIISKVEANRQNCVAEESKILVSNDK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            V+Q+M LRLRNVE GEVE+QLQWID+P  K L
Sbjct  136  VVQNMVLRLRNVECGEVELQLQWIDVPTSKAL  167



>ref|XP_009413360.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=165

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA RD   SDPYVV++MG Q+LKT   + ++NP WNEDLTLSVS+P   IKL VYD D
Sbjct  16   VNLAYRDARGSDPYVVMRMGGQKLKTSVKKHNVNPVWNEDLTLSVSEPLRPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF++DDKMGDAE +I+PF++A+KM+  GLP+ T+I  + P R NCLA+ES + WKD  ++
Sbjct  76   TFSRDDKMGDAEIDIQPFVEAVKMNFSGLPNGTIIKTLTPNRQNCLAEESAIVWKDDMIV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GE+E+QL WI++PG  GL
Sbjct  136  QDVVLRLRNVESGELELQLNWINIPGALGL  165



>ref|XP_010032686.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Eucalyptus grandis]
 gb|KCW52141.1| hypothetical protein EUGRSUZ_J01587 [Eucalyptus grandis]
Length=167

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRDV SSDPYVVV+MGKQ+L+TR +RK++NPEWNE+LTLSV+DPD  +KL VYD D
Sbjct  16   INLAVRDVRSSDPYVVVRMGKQKLRTRVVRKNLNPEWNENLTLSVADPDLPVKLAVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F+ DDKMGDAEF+I+P ++A++M  DL+GL   TV+ RV P R NCLA+ESC+   + K
Sbjct  76   RFSLDDKMGDAEFDIRPLLEAVRMAADLQGLEDGTVVKRVLPNRQNCLAEESCIIVSNGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWI  131
            V+Q M LRLRNVE GE+++QLQW+
Sbjct  136  VVQHMFLRLRNVECGEIQLQLQWV  159



>gb|KFK33274.1| hypothetical protein AALP_AA6G353800 [Arabis alpina]
Length=168

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVV+  GKQ+LKTR ++  INPEWN+DLTLSV+DP++ +KLTVYD D
Sbjct  16   VNLAIRDISSSDPYVVIHYGKQKLKTRVVKHSINPEWNDDLTLSVTDPNSPVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLE-GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG AEF+I P+++A+K    LE GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LFSADDKMGQAEFHIAPYLEAIKFRHKLEGGLPNGTIIMKIQPSRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVE+QL+WID+PG +G+
Sbjct  136  KIVQNMFLRLQHVECGEVELQLEWIDVPGSRGI  168



>ref|XP_010926484.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Elaeis guineensis]
Length=165

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NLAVRD  SSDPYVV++MGKQ+LKTR I+K INP WNEDLTLSV DP   ++L VYD DT
Sbjct  18   NLAVRDTWSSDPYVVLRMGKQKLKTRAIKKCINPVWNEDLTLSVEDPTLLVRLEVYDKDT  77

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            F+ DD MG+AEF+I+ F++A+KM+  G+P+ T+I++V P R NC+ADES + W D KV+Q
Sbjct  78   FSFDDPMGNAEFDIERFLEAVKMNPVGVPNGTIITKVVPNRQNCIADESPIYWSDGKVVQ  137

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            D+ LRLRNVE GEVE+QLQW+ +PG +G
Sbjct  138  DLVLRLRNVECGEVELQLQWVSVPGSRG  165



>ref|XP_006843793.1| hypothetical protein AMTR_s00007p00249830 [Amborella trichopoda]
 gb|ERN05468.1| hypothetical protein AMTR_s00007p00249830 [Amborella trichopoda]
Length=165

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYVV+ MGKQ+LKTR I K++NP WNE+LT S+S P   +KL VYD D
Sbjct  16   VNLAVRDIRSSDPYVVLTMGKQKLKTRVIEKNVNPVWNEELTFSISHPILPVKLNVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
             F++DDKMGDAEF I+ F+++++++LEG+ S TVI +V P R NCLA+ES + W D KVI
Sbjct  76   IFSRDDKMGDAEFEIESFMESVRLNLEGVRSGTVIRKVAPCRQNCLAEESLIRWVDGKVI  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+CLRLRNVE GEVE+QL+WI++    G+
Sbjct  136  QDLCLRLRNVECGEVELQLEWINVSRSMGI  165



>gb|KFK38033.1| hypothetical protein AALP_AA3G061600 [Arabis alpina]
Length=474

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  625  SDDGTQSLMDSllgllrvrvkrGINLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEW  446
            SD   +S + SLLGLLR+RVKRGINLAVRD+ SSDPYV+VKMGK RLKT  I  D+NPEW
Sbjct  302  SDVPRKSFVSSLLGLLRIRVKRGINLAVRDLFSSDPYVIVKMGKLRLKTPVICCDVNPEW  361

Query  445  NEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISR  266
            NEDL   V+DP+ ++ LTVYDHDTFT DDKMGDAE  IKP++DALKM LEGLP   +++ 
Sbjct  362  NEDLIFPVTDPNLTVFLTVYDHDTFTPDDKMGDAEIVIKPYLDALKMKLEGLPCGFIVTT  421

Query  265  VQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +QP R NCLA  S + W D K++QD+ L+LR+VE GEVE+QLQWID+P  KGL
Sbjct  422  IQPSRKNCLAKASQIIWNDGKLVQDLILKLRHVECGEVEVQLQWIDIPDSKGL  474



>ref|XP_010095718.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Morus 
notabilis]
 gb|EXB62018.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Morus 
notabilis]
Length=199

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ--RLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYD  383
            +NLAVRD LSSDPYV+V MG+Q  +LKTR ++ + NPEWN++LTLS++D +  I LTV+D
Sbjct  14   VNLAVRDTLSSDPYVLVTMGEQACKLKTRVVKNNCNPEWNDELTLSITDLETPITLTVFD  73

Query  382  HDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             DT T DDKMGDAE +IKP+I+ LKM LE  P  +V+ R+QP   NCL+DES   W + K
Sbjct  74   RDTLTSDDKMGDAEIDIKPYIECLKMGLENRPDGSVVKRIQPSHENCLSDESSCVWTNGK  133

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL*IDE  95
            ++QDMCLRLRNVE G++ +Q++WI+ PGCKGL  DE
Sbjct  134  IVQDMCLRLRNVECGKIVVQIEWINFPGCKGLIGDE  169



>ref|XP_006405837.1| hypothetical protein EUTSA_v10027968mg [Eutrema salsugineum]
 gb|ESQ47290.1| hypothetical protein EUTSA_v10027968mg [Eutrema salsugineum]
Length=168

 Score =   198 bits (503),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKTR I+  +NPEWN+DLTLSV+DP+  IKLTVYD D
Sbjct  16   VNLAIRDISSSDPYVVVHSGKQKLKTRVIKHSVNPEWNDDLTLSVTDPNLPIKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLE-GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEFNI  +++A+K    LE GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LFSADDKMGEAEFNIATYLEAIKFRHKLEGGLPNGTIIMKIQPSRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVE+QL+WID+PG +G+
Sbjct  136  KLVQNMFLRLQHVECGEVELQLEWIDVPGSRGI  168



>ref|XP_006448228.1| hypothetical protein CICLE_v10017596mg [Citrus clementina]
 gb|ESR61468.1| hypothetical protein CICLE_v10017596mg [Citrus clementina]
Length=165

 Score =   198 bits (503),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD LSSDPYVV+ MGKQ++KT  I  + NP WN DLTL + DP+  + LTVYD D
Sbjct  13   INLAVRDALSSDPYVVITMGKQKMKTHVINSNCNPVWNCDLTLPIRDPNLPVHLTVYDKD  72

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMG+A  +IKP+I  LKM LE LP+   I ++QP R+NCL DES + W + K+ 
Sbjct  73   TFSVDDKMGEANIDIKPYIACLKMGLENLPNGCAIKKIQPTRTNCLLDESSIIWNNGKIT  132

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRL NVE GEVEIQL W+++PGCKGL
Sbjct  133  QDMSLRLNNVECGEVEIQLDWVEVPGCKGL  162



>ref|XP_006469315.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Citrus sinensis]
Length=172

 Score =   198 bits (503),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD LSSDPYVV+ MGKQ++KT  I  + NP WN DLTL + DP+  + LTVYD D
Sbjct  20   INLAVRDALSSDPYVVITMGKQKMKTHVINSNCNPVWNCDLTLPIRDPNLPVHLTVYDKD  79

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMG+A  +IKP+I  LKM LE LP+   I ++QP R+NCL DES + W + K+ 
Sbjct  80   TFSVDDKMGEANIDIKPYIACLKMGLENLPNGCAIKKIQPTRTNCLLDESSIIWNNGKIT  139

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRL NVE GEVEIQL W+++PGCKGL
Sbjct  140  QDMSLRLNNVECGEVEIQLDWVEVPGCKGL  169



>gb|KDP38077.1| hypothetical protein JCGZ_04720 [Jatropha curcas]
Length=171

 Score =   198 bits (503),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  553  NLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDT  374
            NL  RDV  SDPYVVV M    LKT  ++ + NPEWNE+LTLSV+D D  I+LTV+D D 
Sbjct  17   NLVDRDVGGSDPYVVVTMEPHTLKTGVVKNNCNPEWNEELTLSVTDVDVPIRLTVFDKDK  76

Query  373  FTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQ  194
            FT DDK+GDAE +IKP+I  LKM LE LP+  V+SRVQP R+NCLADES + W + K+IQ
Sbjct  77   FTADDKIGDAEIDIKPYIKILKMGLENLPNGCVVSRVQPNRTNCLADESHMVWNNGKIIQ  136

Query  193  DMCLRLRNVERGEVEIQLQWIDLPGCKGL*IDEI  92
            +M LRLRNVE GEVE+QL+WI +PGCKGL I+ +
Sbjct  137  NMPLRLRNVESGEVEVQLEWIHVPGCKGLEIERL  170



>ref|XP_004289564.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=168

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPY++VKMGKQ+LKTR ++K +NPEWNE LTLS+ DPD  I ++VYD D
Sbjct  16   VNLAVRDMRSSDPYLIVKMGKQKLKTRVVKKSLNPEWNEQLTLSIVDPDLPILVSVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSD--TVISRVQPGRSNCLADESCVTWKDHK  203
            TF+ DDKMGDA+F I PF  A+K   +GL      +IS+VQ  + NCLA+ESC+ +   K
Sbjct  76   TFSFDDKMGDAQFEIGPFFKAMKTGFQGLQDQDGAIISKVQVNKQNCLAEESCIIYSKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            ++Q+M LRLRNVE GEVE+QLQWID+P  KG
Sbjct  136  LVQNMVLRLRNVECGEVELQLQWIDIPSSKG  166



>ref|XP_010435613.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=168

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY+VV  GKQ+LKTR ++  +NPEWN+ LTLSV+DP+  +KLTVYD+D
Sbjct  16   VNLAIRDISSSDPYIVVHFGKQKLKTRVVKHSVNPEWNDLLTLSVTDPNLPVKLTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEF+I P+I+A+K   +   GLPS T+I +++P R NCL++ES + W   
Sbjct  76   VFSADDKMGEAEFHIGPYIEAIKFCHQLGPGLPSGTIIRKIEPSRKNCLSEESHIVWNQD  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEIQL+W+++PG +G+
Sbjct  136  KIVQNMFLRLQHVECGEVEIQLEWVNVPGARGI  168



>gb|KDO64606.1| hypothetical protein CISIN_1g048685mg [Citrus sinensis]
Length=172

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD LSSDPYVV+ MGKQ++KT  I  + NP WN DLTL + DP+  + LTVYD D
Sbjct  20   INLAVRDALSSDPYVVITMGKQKMKTHVINSNCNPVWNCDLTLPIRDPNLPVHLTVYDKD  79

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMG+A  +IKP+I  LKM LE LP+   I ++QP R NCL DES + W + K+ 
Sbjct  80   TFSVDDKMGEANIDIKPYIACLKMGLENLPNGCAIKKIQPTRINCLLDESSIIWNNGKIT  139

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRL NVE GEVEIQL W+++PGCKGL
Sbjct  140  QDMSLRLNNVECGEVEIQLDWVEVPGCKGL  169



>ref|XP_010264070.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X4 [Nelumbo nucifera]
Length=145

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  520  PYV-VVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDA  344
            P+V + ++  Q+LKTR ++K+INPEWNEDLTLSV+DP+  IKLTVYD D F+ DDKMGDA
Sbjct  7    PHVGLQRLNFQKLKTRVMKKNINPEWNEDLTLSVADPELPIKLTVYDKDKFSLDDKMGDA  66

Query  343  EFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVE  164
            + +IKPF++A+KM L  LPS T+I RVQP R NCLA+ESC+ W+D KV+QDM LRL+NVE
Sbjct  67   DIDIKPFLEAVKMHLVNLPSGTIIQRVQPNRQNCLAEESCIIWQDGKVVQDMYLRLKNVE  126

Query  163  RGEVEIQLQWIDLPGCKGL  107
             GEVE+QLQWID+PG +G+
Sbjct  127  SGEVELQLQWIDIPGSRGI  145



>ref|XP_002868538.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44797.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKTR ++  +NPEWN+DLTLSV+DP+  IKLTVYD+D
Sbjct  16   VNLAIRDISSSDPYVVVHSGKQKLKTRVVKHSVNPEWNDDLTLSVTDPNLPIKLTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEF+I PF++A+K   +   GLPS T+I +++P R NCL++ES +     
Sbjct  76   LFSADDKMGEAEFHIGPFLEAIKFCHQLGPGLPSGTIIRKIEPSRKNCLSEESHIVLNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVE+QL+WID+PG +G+
Sbjct  136  KIVQNMFLRLQHVECGEVELQLEWIDVPGARGI  168



>ref|XP_006346892.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like isoform X1 [Solanum tuberosum]
Length=162

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD+ SSDPYVVV MGKQ+LKTR ++K++NPEWNEDLTL +S+P   IKL VYD D
Sbjct  16   INLAIRDLRSSDPYVVVTMGKQKLKTRVVKKNVNPEWNEDLTLCISEPILPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMD-LEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            TF+ DDKMGDAE ++ PFIDA++M   + +P+  ++SR+ P R NC ++ESC+ +++ KV
Sbjct  76   TFSYDDKMGDAELDVVPFIDAVRMTRFKNIPNGVILSRIMPNRQNCYSEESCIVYENGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPG  119
            +Q++ LRLRNVE GE+++QLQWID+P 
Sbjct  136  VQNVFLRLRNVECGEIQLQLQWIDVPS  162



>ref|XP_004233474.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=166

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD+ SSDPYVVV MGKQ+LKTR ++K++NPEWNEDLTL +++P   IKL VYD D
Sbjct  16   INLAIRDLRSSDPYVVVTMGKQKLKTRVVKKNVNPEWNEDLTLCITEPILPIKLQVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMD-LEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            TF+ DDKMGDAE +I PFIDA+ M   + +P+  +ISR+ P R NC ++ES + ++D KV
Sbjct  76   TFSYDDKMGDAELDIVPFIDAVTMTRFKNIPNGVIISRIMPSRQNCYSEESRIVYEDGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +Q+  LRLRNVE GE+E+QLQWID+P  K L
Sbjct  136  VQNAFLRLRNVECGEIELQLQWIDVPSSKNL  166



>ref|XP_010263947.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Nelumbo nucifera]
Length=163

 Score =   196 bits (497),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -2

Query  493  QRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDA  314
            Q+LKTR ++K+INPEWNEDLTLSV+DP+  IKLTVYD D F+ DDKMGDA+ +IKPF++A
Sbjct  35   QKLKTRVMKKNINPEWNEDLTLSVADPELPIKLTVYDKDKFSLDDKMGDADIDIKPFLEA  94

Query  313  LKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQW  134
            +KM L  LPS T+I RVQP R NCLA+ESC+ W+D KV+QDM LRL+NVE GEVE+QLQW
Sbjct  95   VKMHLVNLPSGTIIQRVQPNRQNCLAEESCIIWQDGKVVQDMYLRLKNVESGEVELQLQW  154

Query  133  IDLPGCKGL  107
            ID+PG +G+
Sbjct  155  IDIPGSRGI  163



>emb|CDY27005.1| BnaC06g12210D [Brassica napus]
Length=168

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKT  I++ +NPEWN+DLTLSV+DP+  IKLTVYD D
Sbjct  16   VNLAIRDISSSDPYVVVHSGKQKLKTHVIKQSVNPEWNDDLTLSVTDPNQPIKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEF+I  +++A+K   +   GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LFSADDKMGEAEFSIATYLEAVKYRPKVEGGLPNGTIIMKIQPTRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEIQL+WID+PG KG+
Sbjct  136  KLVQNMFLRLQHVECGEVEIQLEWIDVPGSKGI  168



>ref|XP_009370099.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Pyrus x bretschneideri]
Length=170

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 5/155 (3%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ-----RLKTRFIRKDINPEWNEDLTLSVSDPDASIKLT  392
            +NLAVRD+ SSDPYVVVKMGKQ     +LKT  +++++NP W+E L LSV++P+  I L 
Sbjct  16   VNLAVRDMRSSDPYVVVKMGKQVFIWLKLKTGVVKRNVNPVWDETLALSVTEPNLPITLC  75

Query  391  VYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWK  212
            VYD D F+ DDKMGDAEF I  F+  L+M LEGL   TVI++VQP R NCLA+ESC+ W 
Sbjct  76   VYDKDRFSFDDKMGDAEFEIALFVKVLRMRLEGLLDGTVIAKVQPNRENCLAEESCIIWS  135

Query  211  DHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
              K++Q+M LRLRNVE GEVE+QLQWID+P  +GL
Sbjct  136  KGKLVQNMALRLRNVECGEVELQLQWIDVPSSRGL  170



>ref|XP_006282746.1| hypothetical protein CARUB_v10005899mg [Capsella rubella]
 gb|EOA15644.1| hypothetical protein CARUB_v10005899mg [Capsella rubella]
Length=168

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKTR ++  INPEWN+ LTLSV+DP   IKLTVYD+D
Sbjct  16   VNLAIRDLNSSDPYVVVHSGKQKLKTRVVKHSINPEWNDLLTLSVTDPSLPIKLTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG AEF+I P+I+A+K   +   GLP+ T+I +++P R+NCL++ES + W   
Sbjct  76   VFSADDKMGQAEFHIGPYIEAIKFCHQVGPGLPNGTIIRKLEPSRNNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEIQL+W+D+PG +G+
Sbjct  136  KIVQNMFLRLQHVECGEVEIQLEWVDVPGSRGI  168



>ref|XP_009144399.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 emb|CDY38572.1| BnaA05g13010D [Brassica napus]
Length=168

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKT  I+  +NPEWN+DLTLSV+DP+  IKLTVYD D
Sbjct  16   VNLAIRDISSSDPYVVVHSGKQKLKTHVIKHSVNPEWNDDLTLSVTDPNLPIKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEF+I  +++A+K   +   GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LFSADDKMGEAEFSIATYLEAVKYRPKVEGGLPNGTIIMKIQPTRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEIQL+WID+PG KG+
Sbjct  136  KLVQNMFLRLQHVECGEVEIQLEWIDVPGSKGI  168



>ref|XP_010264139.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X5 [Nelumbo nucifera]
Length=136

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  493  QRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDA  314
             +LKTR ++K+INPEWNEDLTLSV+DP+  IKLTVYD D F+ DDKMGDA+ +IKPF++A
Sbjct  8    HKLKTRVMKKNINPEWNEDLTLSVADPELPIKLTVYDKDKFSLDDKMGDADIDIKPFLEA  67

Query  313  LKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQW  134
            +KM L  LPS T+I RVQP R NCLA+ESC+ W+D KV+QDM LRL+NVE GEVE+QLQW
Sbjct  68   VKMHLVNLPSGTIIQRVQPNRQNCLAEESCIIWQDGKVVQDMYLRLKNVESGEVELQLQW  127

Query  133  IDLPGCKGL  107
            ID+PG +G+
Sbjct  128  IDIPGSRGI  136



>gb|KFK41059.1| hypothetical protein AALP_AA2G080100 [Arabis alpina]
Length=167

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MGKQ+L+TR ++K++NPEWNEDLTLS++DP   +K+ VYD D
Sbjct  16   VNLAIRDSSSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSITDPTLPVKILVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DDKMGDA F+I PF++A+++   L GLP  TVI ++Q  R NCL++ES + W   K
Sbjct  76   WFSRDDKMGDAVFHIDPFLEAIRIQNQLGGLPDGTVIMKIQASRQNCLSEESKIVWHKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPG  119
            ++Q+M LRL+NVERGEVE+QL+WID+ G
Sbjct  136  IVQNMFLRLQNVERGEVELQLEWIDVSG  163



>emb|CBI26876.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  502  MGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPF  323
            MG+Q+LKTR ++ + NPEWNE+LTLS++D D  I L VYD DTFT DDKMGDAE +IKP+
Sbjct  1    MGEQKLKTRVVKDNCNPEWNEELTLSIADTDVPINLVVYDSDTFTLDDKMGDAEIDIKPY  60

Query  322  IDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQ  143
            ++ LKM LE LP+ TVISRVQP R+NCLADESC  W + K+ QDM LRLRNVE GEVE+Q
Sbjct  61   VECLKMGLENLPTGTVISRVQPSRTNCLADESCCVWDNGKIRQDMLLRLRNVECGEVEVQ  120

Query  142  LQWIDLPGCKGL  107
            ++WI++PGC+GL
Sbjct  121  IEWINIPGCRGL  132



>ref|XP_009140159.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=168

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPY+V   GKQ+LKTR I+  INPEWN++LTLSV+DP+ S+KLTVYD D
Sbjct  16   VNLAIRDTSSSDPYIVFYSGKQKLKTRVIKHSINPEWNDELTLSVTDPNLSVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEG-LPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEF+I P+++A+K+   LEG LP+ T+I +VQP R NCL++ES +     
Sbjct  76   LFSADDKMGEAEFSIAPYLEAIKLRHKLEGQLPNGTIIMKVQPTRQNCLSEESHILLNQD  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVE+QL+WID+PG KG 
Sbjct  136  KLVQNMFLRLQHVECGEVELQLEWIDVPGSKGF  168



>ref|XP_010263993.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X3 [Nelumbo nucifera]
Length=162

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -2

Query  493  QRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDA  314
            ++LKTR ++K+INPEWNEDLTLSV+DP+  IKLTVYD D F+ DDKMGDA+ +IKPF++A
Sbjct  34   KKLKTRVMKKNINPEWNEDLTLSVADPELPIKLTVYDKDKFSLDDKMGDADIDIKPFLEA  93

Query  313  LKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQW  134
            +KM L  LPS T+I RVQP R NCLA+ESC+ W+D KV+QDM LRL+NVE GEVE+QLQW
Sbjct  94   VKMHLVNLPSGTIIQRVQPNRQNCLAEESCIIWQDGKVVQDMYLRLKNVESGEVELQLQW  153

Query  133  IDLPGCKGL  107
            ID+PG +G+
Sbjct  154  IDIPGSRGI  162



>ref|XP_010450531.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=168

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKTR ++  +NPEWN+ LTLSV+DP+  +KLTVYD+D
Sbjct  16   VNLAIRDLSSSDPYVVVHFGKQKLKTRVVKHSVNPEWNDLLTLSVTDPNLPVKLTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
             F+ DDKMG+AEF+I P+I+A+K   +   GLPS T+I +++P R NCL++ES + W   
Sbjct  76   VFSPDDKMGEAEFHIGPYIEAIKFCHQLGPGLPSGTIIRKIEPSRKNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEIQL+W+++ G +G+
Sbjct  136  KIVQNMFLRLQHVECGEVEIQLEWVNVTGARGI  168



>ref|XP_009403741.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 121/166 (73%), Gaps = 16/166 (10%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQ----------------RLKTRFIRKDINPEWNEDLTLS  425
            +NLAVRDV +SDPYVV++MGKQ                +LKTR I+K+ NP WNEDLTL 
Sbjct  17   VNLAVRDVTTSDPYVVLRMGKQWFSLRFFFSFFFILLQKLKTRVIKKNTNPVWNEDLTLC  76

Query  424  VSDPDASIKLTVYDHDTFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSN  245
            + DP   ++L V+D D FTKDD MG AEF+I+PF++A+KM+ +G+P  T+I +V P R N
Sbjct  77   IEDPSLPVRLQVFDKDRFTKDDAMGHAEFDIRPFLEAVKMNPQGVPEGTIIRKVVPCRQN  136

Query  244  CLADESCVTWKDHKVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            CLA+ES V W   +V QD+ LRL++VERGEVE+QLQW+D+PG KGL
Sbjct  137  CLAEESVVRWCHGQVTQDLALRLKDVERGEVELQLQWVDIPGAKGL  182



>ref|XP_010511455.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=167

 Score =   193 bits (490),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+R+  SSDPYV+V+MGKQ+L+TR ++K++NPEWNEDLTLS++DP   I + VYD D
Sbjct  16   VNLAIRNSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSITDPTLPINIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DDKMGDA F+I PF++A+++  +L GLP  TVI ++Q  R NCL++ES + W   K
Sbjct  76   WFSRDDKMGDAVFHIDPFLEAIRIQNELGGLPEGTVIMKIQASRQNCLSEESKIVWHKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGC  116
            ++Q+M LRL+NVERGEV++QL+WID+ G 
Sbjct  136  IVQNMFLRLQNVERGEVQLQLEWIDVSGA  164



>ref|XP_006647209.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Oryza brachyantha]
Length=165

 Score =   192 bits (489),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYV+V+MGKQ+LKTR I+K  NPEWN++LTLS+ DP   ++L VYD D
Sbjct  17   VNLAVRDLRSSDPYVIVRMGKQKLKTRVIKKTTNPEWNDELTLSIEDPAVPVRLEVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF  DD MG+AE +I+P ++ +KM +EG+  DTV+ +V P R NCLA+ES +   + KV 
Sbjct  77   TFI-DDAMGNAELDIRPLVEVVKMKIEGVADDTVVKKVAPNRQNCLAEESAIYISEGKVK  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GE+E+QLQW+D+PG KG+
Sbjct  136  QDVVLRLRDVECGEIELQLQWVDIPGSKGV  165



>ref|XP_009787765.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
Length=167

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD   SDPYVV+ MG Q++KTR I+++INP WNE+L+L++ DP   I LTVYD D
Sbjct  15   INLAVRDAFGSDPYVVITMGGQKVKTRVIKENINPVWNEELSLALYDPSLPITLTVYDKD  74

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDA+ +IKP+IDA+ M LEGLP    + RVQP R NCL+DESC+ W++ K+ 
Sbjct  75   TFTADDKMGDAKIDIKPYIDAINMGLEGLPDGVRVDRVQPNRDNCLSDESCIVWENGKMT  134

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            Q+M LRL++VE GE+EIQ++ I+  G +G
Sbjct  135  QNMILRLQHVECGEIEIQIELINAQGRRG  163



>ref|XP_009420619.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=165

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA RD   SDPYVV++MG Q+LKT   + ++NP WNEDLTLSVS+P   I + VYD D
Sbjct  16   VNLAYRDATGSDPYVVIRMGHQKLKTSVKKHNVNPVWNEDLTLSVSEPIQPITIKVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDAE +I+ F++A+KM+L  LP  T+I+ V+P R NC ADES + WKD +V+
Sbjct  76   TFTPDDKMGDAEIDIQAFVEAVKMNLSDLPDGTIITTVKPNRKNCFADESPIAWKDGRVV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLRNVE GE+E+QL W  +PG  G 
Sbjct  136  QDVILRLRNVESGELELQLLWTSIPGAPGF  165



>emb|CDY01709.1| BnaC04g30430D [Brassica napus]
Length=168

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKTR ++  +NPEWN+ LTLSV+DP+  +KL VYD+D
Sbjct  16   VNLAIRDISSSDPYVVVHSGKQKLKTRVVKHSLNPEWNDHLTLSVTDPNLPVKLMVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLE-GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEFNI  +++A+K    LE GLP  T+I ++QP R NCL++ES + W   
Sbjct  76   VLSADDKMGEAEFNIAQYLEAIKFRHTLEGGLPDGTIIMKIQPSRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEIQL+WID+PG +G+
Sbjct  136  KLVQNMFLRLQHVECGEVEIQLEWIDIPGSRGI  168



>gb|ADZ44598.1| C2 domain-containing protein [Brassica napus]
Length=168

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY+V   G ++LKT  +++ +NPEWN+DLTLSV+DP+  +KLTVYD D
Sbjct  16   VNLAIRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWNDDLTLSVTDPNLPVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEF+I P+++A+K   +   GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNRQNCLSEESHIVWNHG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M +RL+NVE GEVE+QL+WID+PG +G+
Sbjct  136  KLVQNMFIRLQNVETGEVELQLEWIDVPGSRGI  168



>ref|XP_009139749.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 emb|CDX74561.1| BnaA04g08280D [Brassica napus]
Length=168

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY+V   G ++LKT  +++ +NPEWN+DLTLSV+DP+  +KLTVYD D
Sbjct  16   VNLAIRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWNDDLTLSVTDPNLPVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEF+I P+++A+K   +   GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNRQNCLSEESHIVWNHG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M +RL+NVE GEVE+QL+WID+PG +G+
Sbjct  136  KLVQNMFIRLQNVETGEVELQLEWIDVPGSRGI  168



>ref|XP_003572790.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brachypodium distachyon]
Length=165

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVV++MGKQ+LKTR I+K  NPEWN++LTLS+ DP+  I+L V+D D
Sbjct  17   VNLAIRDLCSSDPYVVIRMGKQKLKTRVIKKTTNPEWNDELTLSIEDPEVPIRLDVFDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF  DD MG+AE +I+P ++ +KM L+G+P +TV+ ++ P R NCLA+ES +   +  V 
Sbjct  77   TFI-DDAMGNAELDIQPLVEVVKMKLQGVPENTVVKKLVPNRQNCLAEESAIRISEGAVK  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM LRLRNVE GE+E+QL+WID+PG KG+
Sbjct  136  QDMVLRLRNVECGEIELQLEWIDIPGSKGV  165



>ref|XP_006300898.1| hypothetical protein CARUB_v10021265mg [Capsella rubella]
 gb|EOA33796.1| hypothetical protein CARUB_v10021265mg [Capsella rubella]
Length=167

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MGKQ+L+TR ++K +NPEWNEDLTLS+SDP   +K+ VYD D
Sbjct  16   VNLAIRDSQSSDPYVIVRMGKQKLRTRVMKKILNPEWNEDLTLSISDPTLPVKIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DDKMGDA F I PF++A+++  +L GLP  TVI ++Q  R NCL++ES + W   K
Sbjct  76   WFSRDDKMGDAVFYIDPFLEAIRIQNELGGLPDGTVIMKIQASRQNCLSEESKILWNKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGC  116
            ++Q+M LRL+NVERGEV++QL+WID+ G 
Sbjct  136  IVQNMFLRLQNVERGEVQLQLEWIDVSGA  164



>gb|ADZ44599.1| C2 domain-containing protein [Brassica napus]
Length=168

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY+V   G ++LKT  +++ +NPEWN+DLTLSV+DP+  +KLTVYD D
Sbjct  16   VNLAIRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWNDDLTLSVTDPNLPVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEF+I P+++A+K   +   GLP  T+I ++QP R NCL++ES + W   
Sbjct  76   LLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPHGTIIMKIQPNRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M +RL+NVE GEVE+QL+WID+PG +G+
Sbjct  136  KLVQNMFIRLQNVETGEVELQLEWIDVPGSRGI  168



>ref|XP_007227534.1| hypothetical protein PRUPE_ppa012480mg [Prunus persica]
 gb|EMJ28733.1| hypothetical protein PRUPE_ppa012480mg [Prunus persica]
Length=168

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD  +SDPYVVV MG Q+LKT+ I+K+ NP+WNE+LTLS+++ + +I L VYD D
Sbjct  16   INLAVRDTKTSDPYVVVTMGSQKLKTKVIKKNCNPQWNEELTLSITNLEENIHLEVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            T T DDKMGDA+ +IKP+++ LKM L+ LP    + +VQP R+NCL+ ESC  W++ K++
Sbjct  76   TLTVDDKMGDADIDIKPYVECLKMGLDVLPKGCAVKKVQPNRTNCLSSESCCVWENGKIV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM L+L NVE GE+ +Q++WI LPG KGL
Sbjct  136  QDMILKLNNVECGEIVLQIEWIHLPGSKGL  165



>ref|NP_198590.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB08320.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL67050.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45023.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31823.1| unknown protein [Arabidopsis thaliana]
 gb|AED94225.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=168

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY+VV  GKQ+LKTR ++  +NPEWN+DLTLSV+DP+  IKLTVYD+D
Sbjct  16   VNLAIRDISSSDPYIVVHCGKQKLKTRVVKHSVNPEWNDDLTLSVTDPNLPIKLTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEF+I PFI+A+K   +   GLP+ T+I +++P R NCL++ S +     
Sbjct  76   LLSADDKMGEAEFHIGPFIEAIKFAHQLGPGLPNGTIIKKIEPSRKNCLSESSHIVLNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVE+QL+WID+PG +G+
Sbjct  136  KIVQNMFLRLQHVECGEVELQLEWIDVPGSRGI  168



>ref|XP_008221419.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Prunus mume]
Length=168

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD  +SDPYVVV MG Q+LKT+ I+K+ NP+WNE+LTLS+++ + +I L VYD D
Sbjct  16   INLAVRDTKTSDPYVVVTMGSQKLKTKVIKKNCNPQWNEELTLSITNFEENIHLEVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            T T DDKMGDA+ +IKP+++ +KM L+ LP    + +VQP R+NCL+ ESC  W++ K++
Sbjct  76   TLTVDDKMGDADIDIKPYVECIKMGLDVLPKGCAVKKVQPNRTNCLSSESCCVWENGKIV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QDM L+L+NVE GE+ +Q++WI LPG KGL
Sbjct  136  QDMILKLKNVECGEIVLQIEWIHLPGSKGL  165



>ref|NP_564873.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG52156.1|AC020665_1 hypothetical protein; 53078-54254 [Arabidopsis thaliana]
 gb|AEE34500.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=174

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MGKQ+L+TR ++K++N EWNEDLTLSV+DP   +K+ VYD D
Sbjct  16   VNLAIRDSQSSDPYVIVRMGKQKLRTRVMKKNLNTEWNEDLTLSVTDPTLPVKIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DDKMGDA F+I PF++A+++   L GLP  TVI ++Q  R NCL++ES + W   K
Sbjct  76   RFSRDDKMGDAIFHIDPFLEAIRIQNQLGGLPEGTVIMKIQASRQNCLSEESKIVWHKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGC  116
            ++Q+M L+L+NVERGE+E+QL+WID+ G 
Sbjct  136  IVQNMFLKLQNVERGEIELQLEWIDVSGA  164



>ref|XP_004298477.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Fragaria vesca subsp. vesca]
Length=173

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD ++SDPY+VV MG+ RLKTR I+K++NPEWNE+LTLS++D +  I L VYD D
Sbjct  17   INLAVRDYVTSDPYIVVTMGRHRLKTRVIKKNLNPEWNEELTLSMTDINEPILLNVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
              T DD MGDA  +IKP+++ LK+  +LE LP    + +VQP R+NCLA ESC TW + K
Sbjct  77   HITHDDPMGDAVVDIKPYVECLKLAAELEKLPDGCALKKVQPSRNNCLATESCCTWHEGK  136

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +IQDM L+LRNVE GEV +Q++WID+PG KGL
Sbjct  137  IIQDMRLKLRNVECGEVVVQIEWIDVPGSKGL  168



>ref|XP_009602442.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana tomentosiformis]
Length=167

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD   SDPYVV+ MG Q++KTR I+++ NP WNE+L+L++ DP   I LTVYD D
Sbjct  15   INLAVRDAFGSDPYVVITMGGQKVKTRVIKENCNPVWNEELSLALYDPSLPITLTVYDKD  74

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDA+ +IKP+IDA+ M LEGLP    + RVQP R NCL+DESC+ W++ K+ 
Sbjct  75   TFTADDKMGDAKIDIKPYIDAINMGLEGLPDGVKVDRVQPNRDNCLSDESCIIWENGKMT  134

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKG  110
            Q+M LRL++VE GE+EIQ++ ID  G +G
Sbjct  135  QNMILRLQHVECGEIEIQVELIDAQGRRG  163



>ref|XP_009139747.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
Length=168

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPYVVV  GKQ+LKTR ++  +NP+WN+ LTLSV+DP+  +KLTVYD+D
Sbjct  16   VNLAIRDISSSDPYVVVHSGKQKLKTRVVKHSLNPDWNDHLTLSVTDPNLPVKLTVYDYD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEFNI  +++A+K       GLP  T+I ++QP R NCL++ES + W   
Sbjct  76   LLSADDKMGEAEFNIAAYLEAIKFRYALEGGLPDGTIIMKIQPSRQNCLSEESHIVWNQG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M LRL++VE GEVEI L+WID+PG +G+
Sbjct  136  KLVQNMFLRLQHVECGEVEIHLEWIDIPGSRGI  168



>gb|AGJ81360.1| small C2 domain protein [Brassica napus]
Length=168

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD+ SSDPY+V   G ++L+T  +++ +NPEWN+DLTLSV+DP+  +KLTVYD D
Sbjct  16   VNLAIRDIASSDPYIVFHFGNKKLETHVVKQSVNPEWNDDLTLSVTDPNLPVKLTVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLE---GLPSDTVISRVQPGRSNCLADESCVTWKDH  206
              + DDKMG+AEF+I P+++A+K   +   GLP+ T+I ++QP R NCL++ES + W   
Sbjct  76   LLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNRQNCLSEESHIVWNHG  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            K++Q+M +RL+NVE GEVE+QL+WID+PG +G+
Sbjct  136  KLVQNMFIRLQNVETGEVELQLEWIDVPGSRGI  168



>emb|CAN67438.1| hypothetical protein VITISV_020351 [Vitis vinifera]
Length=148

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA RDVLSSDPYV+V+MGKQ+LKTR + K++NPEWNEDLTLSV D +  +K+ VYD D
Sbjct  16   VNLAKRDVLSSDPYVIVRMGKQKLKTRVVNKNVNPEWNEDLTLSVDDTNLPVKIFVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I PF++AL+M+L GLPS T+I+RVQP R NCLA+ESC+ W + KV+
Sbjct  76   TFSLDDKMGDAEFQIGPFVEALRMELNGLPSGTIITRVQPNRENCLAEESCIIWTEGKVV  135

Query  196  QDMCLRLR  173
            Q++ LRL+
Sbjct  136  QNLVLRLQ  143



>emb|CDY11544.1| BnaC06g31950D [Brassica napus]
Length=185

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD  SSDPYVVV +G Q+LKTR I  + NP WNE LTLS+ D +  I+LTVYD D
Sbjct  17   INLAIRDSTSSDPYVVVTLGNQKLKTRVINSNCNPVWNEQLTLSIKDVNDPIRLTVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDA--LKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F+ DDKMGDAE +++PF++A  +++D + LP+   I R++PGR+NCLA+ES +TW + K
Sbjct  77   RFSGDDKMGDAEIDMRPFLEAHQMELDFQKLPNGCAIKRIRPGRTNCLAEESSITWSNGK  136

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            + QDM LRLRNVE GE+EI L+W D PGCKGL
Sbjct  137  IKQDMILRLRNVECGELEIMLEWTDGPGCKGL  168



>ref|XP_008229192.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Prunus mume]
Length=162

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            + LAVRD+ SSDPYVV+KMGKQ++KT+ ++K++NPEWNEDLTLSV+DP+  I+L VYD D
Sbjct  16   VKLAVRDMRSSDPYVVIKMGKQKVKTKVVKKNVNPEWNEDLTLSVADPNLPIRLYVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF+ DDKMGDAEF I  FI  LKM LEGLP  T+I++VQP R NCLA+ES + W   +++
Sbjct  76   TFSFDDKMGDAEFEIATFIKVLKMRLEGLPDGTIITKVQPNRQNCLAEESYIVWSKGQLV  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLP  122
            Q+M LRLRNVE GEVE+QLQWID+P
Sbjct  136  QNMVLRLRNVECGEVELQLQWIDIP  160



>ref|NP_001046709.1| Os02g0327000 [Oryza sativa Japonica Group]
 dbj|BAD15699.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAD16390.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF08623.1| Os02g0327000 [Oryza sativa Japonica Group]
 gb|EAY85639.1| hypothetical protein OsI_07012 [Oryza sativa Indica Group]
 gb|EAZ22831.1| hypothetical protein OsJ_06508 [Oryza sativa Japonica Group]
 gb|ABU62827.1| G-protein binding protein [Oryza sativa Japonica Group]
 dbj|BAG96469.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=165

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLAVRD+ SSDPYV+V+MGKQ+LKTR I+K  NPEWN++LTLS+ DP   ++L VYD D
Sbjct  17   VNLAVRDLRSSDPYVIVRMGKQKLKTRVIKKTTNPEWNDELTLSIEDPAVPVRLEVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TF  DD MG+AE +I+P ++ +KM +EG+  +TV+ +V P R NCLA+ES +   + KV 
Sbjct  77   TFI-DDAMGNAELDIRPLVEVVKMKIEGVADNTVVKKVVPNRQNCLAEESTIYISEGKVK  135

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ LRLR+VE GE+E+QLQW+D+PG KG+
Sbjct  136  QDVVLRLRDVECGEIELQLQWVDIPGSKGV  165



>ref|XP_009606380.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana tomentosiformis]
Length=166

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD  SSDPYVVV+MG+Q+L+TR ++K++NPEWN+DLTL +++P   IKL VYD D
Sbjct  16   INLAIRDFRSSDPYVVVRMGRQKLRTRVVKKNVNPEWNDDLTLCIAEPILPIKLIVYDKD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKMD-LEGLPSDTVISRVQPGRSNCLADESCVTWKDHKV  200
            TF++DDKMGDAE +I PFI+A +   ++ +P+ T+I+++ P R NC ++ESC+  ++ KV
Sbjct  76   TFSRDDKMGDAELDIVPFINAARTKRVKNIPNGTIIAKIIPNRQNCYSEESCIASENGKV  135

Query  199  IQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +Q++ LRLRNVE GE+E++LQWID+PG K L
Sbjct  136  VQNVFLRLRNVECGEIELRLQWIDIPGSKCL  166



>ref|XP_002887025.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63284.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MGKQ+L+TR ++K++NPEWNEDLTLSV+DP   +K+ VYD D
Sbjct  16   VNLAIRDSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSVTDPTLPVKIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTW-KDH  206
             F++DDKMGDA F+I PF++A+++   L GLP  TVI ++Q  R NCL++ES + W K  
Sbjct  76   WFSRDDKMGDAVFHIDPFLEAIRIQNQLGGLPDGTVIMKIQASRQNCLSEESKIVWHKGK  135

Query  205  KVIQDMCLRLRNVERGEVEIQLQWIDL  125
            K++Q+M LRL+NVERGEVE+QL+WID+
Sbjct  136  KIVQNMFLRLQNVERGEVELQLEWIDV  162



>ref|XP_004298475.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=173

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD ++SDPY++V MG+ RLKTR I+ ++NPEWNE+LTLS++D +  I L VYD D
Sbjct  17   INLAVRDYVTSDPYIIVTMGRHRLKTRVIKNNLNPEWNEELTLSMTDINEPILLNVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             FT+DD MGDA  +IKP+++ LK+  +LE LP    + +VQP R+NCLA  SC TW + K
Sbjct  77   RFTRDDPMGDAVVDIKPYVECLKLAPELEKLPDGCALKKVQPSRNNCLATGSCCTWHEGK  136

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            +IQDM L+LRNVE GEV +Q++WID+PG KGL
Sbjct  137  IIQDMRLKLRNVECGEVVVQIEWIDVPGSKGL  168



>emb|CDX96152.1| BnaA07g25790D [Brassica napus]
Length=175

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MG+Q+L+TR ++K++NPEWNEDLTLS+SDP   IK+ VYD D
Sbjct  16   VNLAIRDSKSSDPYVIVRMGQQKLRTRVVKKNLNPEWNEDLTLSISDPILPIKIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DDKMGDA F+I PF++A+++     GLP  TVI ++Q  R NCL++ES + W + K
Sbjct  76   WFSRDDKMGDAFFHIDPFLEAIRIQNQFRGLPEGTVIMKIQASRQNCLSEESKIVWNNGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL*IDEIVP  86
            ++Q+M L+L+NVE GEVE+QL+WID+ G   +   E+V 
Sbjct  136  IVQNMFLKLQNVECGEVELQLEWIDVSGLLSINEHEVVA  174



>ref|XP_009105201.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=175

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MG+Q+L+TR ++K++NPEWNEDLTLS+SDP   IK+ VYD D
Sbjct  16   VNLAIRDSKSSDPYVIVRMGQQKLRTRVVKKNLNPEWNEDLTLSISDPVLPIKIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DDKMGDA F+I PF++A+++     GLP  TVI ++Q  R NCL++ES + W + K
Sbjct  76   WFSRDDKMGDAFFHIDPFLEAIRIQNQFRGLPEGTVIMKIQASRQNCLSEESKIVWNNGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPG  119
            ++Q+M L+L+NVE GEVE+QL+WID+ G
Sbjct  136  IVQNMFLKLQNVECGEVELQLEWIDVSG  163



>ref|NP_001288871.1| probable ADP-ribosylation factor GTPase-activating protein AGD13 
[Brassica rapa]
 gb|ADK63412.1| C2 domain-containing protein [Brassica rapa]
 emb|CDX96278.1| BnaA07g28890D [Brassica napus]
Length=185

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLA+RD  SSDPYVVV +G Q+LKTR I  + NP WNE LTLS+ D +  I+LTVYD D
Sbjct  17   INLAIRDSTSSDPYVVVTLGNQKLKTRVINSNCNPVWNEQLTLSIKDVNDPIRLTVYDKD  76

Query  376  TFTKDDKMGDAEFNIKPFIDA--LKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F+ DDKMGD E +++PF++A  +++D + LP+   I R++PGR+NCLA+ES +TW + K
Sbjct  77   RFSGDDKMGDGEIDMRPFLEAHQMELDFQKLPNGCAIKRIRPGRTNCLAEESSITWSNGK  136

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            + QDM LRLRNVE GE+EI L+W D PGCKGL
Sbjct  137  IKQDMILRLRNVECGELEIMLEWTDGPGCKGL  168



>gb|KFK38029.1| hypothetical protein AALP_AA3G061000 [Arabis alpina]
Length=612

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            INLAVRD+ SSDPYV++KMGK RL+T  I  D+NPEWNEDL   V+DP+ ++ LTVYDHD
Sbjct  463  INLAVRDLFSSDPYVIIKMGKLRLETPVICCDVNPEWNEDLIFPVTDPNLTVFLTVYDHD  522

Query  376  TFTKDDKMGDAEFNIKPFIDALKMDLEGLPSDTVISRVQPGRSNCLADESCVTWKDHKVI  197
            TFT DDKMGDAE  IKP++DALKM LEGLP   +++ +QP   N LA+ S + W D K++
Sbjct  523  TFTPDDKMGDAEIAIKPYLDALKMKLEGLPCGFIVNTIQPSLENFLAEASQIIWDDGKLV  582

Query  196  QDMCLRLRNVERGEVEIQLQWIDLPGCKGL  107
            QD+ L+LR+VE GEVE+QLQWID+P  KGL
Sbjct  583  QDLILKLRHVECGEVEVQLQWIDIPDTKGL  612



>ref|XP_010470512.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=167

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 118/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  556  INLAVRDVLSSDPYVVVKMGKQRLKTRFIRKDINPEWNEDLTLSVSDPDASIKLTVYDHD  377
            +NLA+RD  SSDPYV+V+MGKQ+L+TR ++K++NPEWNE LTLS++DP   I + VYD D
Sbjct  16   VNLAIRDSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEGLTLSITDPTLPINIMVYDRD  75

Query  376  TFTKDDKMGDAEFNIKPFIDALKM--DLEGLPSDTVISRVQPGRSNCLADESCVTWKDHK  203
             F++DD MGDA F+I PF++A+++  +L GLP  TVI ++Q  R NCL++ES + W   K
Sbjct  76   WFSRDDTMGDAVFHIDPFLEAIRIQNELGGLPEGTVIMKIQASRQNCLSEESKIVWHKGK  135

Query  202  VIQDMCLRLRNVERGEVEIQLQWIDLPGC  116
            ++Q+M LRL+NVERGEV++QL+WI++ G 
Sbjct  136  IVQNMFLRLQNVERGEVQLQLEWINVSGA  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2146230378139