BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85768_g1_i1 len=1557 path=[1535:0-1556]

Length=1557
                                                                      Score     E

ref|XP_009607668.1|  PREDICTED: vicilin-like antimicrobial peptid...    320   2e-99   
ref|XP_004247186.1|  PREDICTED: vicilin-like antimicrobial peptid...    319   3e-99   
ref|XP_009786980.1|  PREDICTED: vicilin-like antimicrobial peptid...    316   2e-97   
ref|XP_006349767.1|  PREDICTED: vicilin-like antimicrobial peptid...    314   5e-97   
gb|AAK15089.1|AF240006_1  7S globulin                                   312   5e-95   Sesamum indicum [beniseed]
gb|EYU23233.1|  hypothetical protein MIMGU_mgv1a024110mg                310   2e-94   
gb|EYU40904.1|  hypothetical protein MIMGU_mgv1a003248mg                308   2e-93   
ref|XP_011082575.1|  PREDICTED: vicilin-like antimicrobial peptid...    299   4e-90   
gb|ABO36677.1|  vicilin                                                 295   3e-89   Pistacia vera [pistachio]
emb|CBI28721.3|  unnamed protein product                                282   9e-86   
ref|XP_008386543.1|  PREDICTED: sucrose-binding protein-like            278   3e-83   
ref|XP_009367697.1|  PREDICTED: sucrose-binding protein-like            277   5e-83   
gb|AAL86739.1|AF441864_1  48-kDa glycoprotein precursor                 274   6e-82   Corylus avellana [European hazelnut]
ref|XP_010054529.1|  PREDICTED: sucrose-binding protein-like            276   8e-82   
gb|KDO68672.1|  hypothetical protein CISIN_1g040805mg                   273   1e-80   
ref|XP_006444033.1|  hypothetical protein CICLE_v10024281mg             271   4e-80   
ref|XP_009417381.1|  PREDICTED: globulin-1 S allele-like                266   3e-79   
ref|XP_008235388.1|  PREDICTED: sucrose-binding protein-like            268   3e-79   
gb|AAM73730.2|AF395894_1  vicilin-like protein                          267   2e-78   Anacardium occidentale [maranon]
gb|KHG24948.1|  Vicilin-like antimicrobial peptides 2-1                 267   3e-78   
gb|AAM73729.1|AF395893_1  vicilin-like protein                          266   3e-78   Anacardium occidentale [maranon]
ref|XP_003632318.2|  PREDICTED: vicilin-like antimicrobial peptid...    273   5e-78   
ref|XP_010679084.1|  PREDICTED: vicilin-like antimicrobial peptid...    265   2e-77   
ref|XP_007200965.1|  hypothetical protein PRUPE_ppa004438mg             263   4e-77   
ref|XP_009370838.1|  PREDICTED: sucrose-binding protein-like            259   3e-76   
ref|XP_010256229.1|  PREDICTED: vicilin-like antimicrobial peptid...    258   8e-75   
ref|XP_009417380.1|  PREDICTED: globulin-1 S allele-like                256   9e-75   
ref|XP_008355465.1|  PREDICTED: sucrose-binding protein-like            256   1e-74   
gb|KDP21423.1|  hypothetical protein JCGZ_21894                         256   2e-74   
ref|XP_002524752.1|  nucleolar protein nop56, putative                  253   4e-73   Ricinus communis
ref|XP_004292578.1|  PREDICTED: vicilin-like antimicrobial peptid...    252   5e-73   
ref|XP_010086607.1|  Sucrose-binding protein                            249   5e-72   
ref|XP_009413881.1|  PREDICTED: globulin-1 S allele-like                246   2e-71   
ref|XP_008350065.1|  PREDICTED: sucrose-binding protein-like            245   2e-70   
emb|CBI28722.3|  unnamed protein product                                252   3e-69   
gb|EYU41459.1|  hypothetical protein MIMGU_mgv1a003361mg                243   7e-69   
ref|XP_006650381.1|  PREDICTED: globulin-1 S allele-like                241   2e-68   
gb|KGN44776.1|  hypothetical protein Csa_7G380130                       237   1e-67   
ref|XP_010695493.1|  PREDICTED: vicilin-like antimicrobial peptid...    240   1e-67   
ref|XP_008451293.1|  PREDICTED: sucrose-binding protein-like            237   2e-67   
ref|XP_011090693.1|  PREDICTED: vicilin-like antimicrobial peptid...    239   3e-67   
ref|XP_009771136.1|  PREDICTED: vicilin-like antimicrobial peptid...    238   2e-65   
gb|ACN34339.1|  unknown                                                 233   2e-65   Zea mays [maize]
sp|Q9SPL3.1|AMP23_MACIN  RecName: Full=Vicilin-like antimicrobial...    234   3e-65   Macadamia integrifolia [macadamia nut]
emb|CAA41809.1|  vicilin-like embryo storage protein                    233   3e-65   Zea mays [maize]
gb|AAS07324.1|  putative globulin (with alternative splicing)           232   6e-65   Oryza sativa Japonica Group [Japonica rice]
sp|Q9SPL4.1|AMP22_MACIN  RecName: Full=Vicilin-like antimicrobial...    233   2e-64   Macadamia integrifolia [macadamia nut]
sp|Q9SPL5.1|AMP21_MACIN  RecName: Full=Vicilin-like antimicrobial...    232   2e-64   Macadamia integrifolia [macadamia nut]
ref|XP_009595711.1|  PREDICTED: vicilin-like antimicrobial peptid...    234   3e-64   
ref|XP_009595712.1|  PREDICTED: vicilin-like antimicrobial peptid...    234   4e-64   
gb|AAF18269.1|AF066055_1  vicilin-like protein precursor                229   9e-64   Juglans regia
ref|NP_001105887.1|  globulin-1 S allele precursor                      227   5e-63   Zea mays [maize]
gb|AAM54366.1|  vicilin seed storage protein                            224   1e-62   Juglans nigra
ref|XP_004247580.1|  PREDICTED: vicilin GC72-A                          226   1e-62   
ref|XP_010911186.1|  PREDICTED: vicilin-like antimicrobial peptid...    224   3e-62   
ref|XP_010938562.1|  PREDICTED: globulin-1 S allele                     222   5e-62   
ref|XP_006839012.1|  hypothetical protein AMTR_s00002p00272040          223   7e-62   
gb|ABV49593.1|  7S vicilin                                              227   8e-62   Carya illinoinensis [pecan]
gb|ABV49590.1|  7S vicilin                                              227   1e-61   Carya illinoinensis [pecan]
ref|XP_002464118.1|  hypothetical protein SORBIDRAFT_01g012640          223   2e-61   Sorghum bicolor [broomcorn]
ref|XP_010256228.1|  PREDICTED: vicilin-like antimicrobial peptid...    220   6e-61   
ref|XP_006383667.1|  hypothetical protein POPTR_0005s23390g             220   9e-61   
ref|XP_006360765.1|  PREDICTED: vicilin-like antimicrobial peptid...    219   5e-60   
gb|AEO27685.1|  seed storage protein vicilin A                          218   6e-60   
gb|AEO27686.1|  seed storage protein vicilin A                          217   1e-59   
gb|AEO27683.1|  seed storage protein vicilin A                          216   2e-59   
ref|XP_009771135.1|  PREDICTED: vicilin-like antimicrobial peptid...    213   3e-59   
gb|AEO27682.1|  seed storage protein vicilin A                          216   3e-59   
gb|KHN18868.1|  Sucrose-binding protein                                 212   7e-59   
ref|XP_009407076.1|  PREDICTED: vicilin-like antimicrobial peptid...    216   1e-58   
gb|KHG06468.1|  hypothetical protein F383_32629                         216   1e-58   
ref|XP_003536630.1|  PREDICTED: sucrose-binding protein-like            213   1e-58   
sp|P09799.1|VCLA_GOSHI  RecName: Full=Vicilin GC72-A; AltName: Fu...    215   1e-58   Gossypium hirsutum [American cotton]
dbj|BAA34056.1|  PV100                                                  217   3e-58   Cucurbita maxima [Boston marrow]
gb|AAA32936.1|  embryo globulin                                         214   4e-58   Hordeum vulgare [barley]
ref|XP_009605859.1|  PREDICTED: vicilin-like antimicrobial peptid...    210   4e-58   
ref|NP_001276308.1|  sucrose-binding protein precursor                  212   6e-58   
gb|AAF05723.1|AF191299_1  sucrose binding protein homolog S-64          211   8e-58   Glycine max [soybeans]
gb|AEO27684.1|  seed storage protein vicilin A                          211   1e-57   
ref|NP_001237244.1|  sucrose-binding protein 2 precursor                210   1e-57   
ref|XP_011032788.1|  PREDICTED: vicilin-like antimicrobial peptid...    211   3e-57   
ref|XP_008439368.1|  PREDICTED: vicilin                                 214   3e-57   
emb|CAA72090.1|  P54 protein                                            209   3e-57   Pisum sativum [garden pea]
ref|XP_010108323.1|  Vicilin-like antimicrobial peptides 2-1            212   3e-56   
ref|XP_004134437.1|  PREDICTED: vicilin-like antimicrobial peptid...    211   5e-56   
ref|XP_004162195.1|  PREDICTED: vicilin-like antimicrobial peptid...    205   6e-56   
gb|AGU37285.1|  7S globulin precursor isoform 2                         209   7e-56   
gb|AFM30909.1|  globulin-3A                                             207   7e-56   
gb|ACJ65514.1|  globulin 3                                              207   8e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004146991.1|  PREDICTED: vicilin-like antimicrobial peptid...    203   2e-55   
emb|CAC27161.1|  putative sucrose binding protein                       204   2e-55   Vicia faba var. minor [tick bean]
gb|KDP40207.1|  hypothetical protein JCGZ_02205                         206   3e-55   
emb|CAA44873.1|  vicilin-like storage protein                           203   3e-55   Picea glauca
gb|KGN56960.1|  hypothetical protein Csa_3G146460                       209   4e-55   
gb|AAB01554.1|  vicilin-like storage protein                            202   8e-55   Picea glauca
pdb|4LEJ|A  Chain A, Crystal Structure Of The Korean Pine (pinus ...    200   1e-54   
ref|XP_004981475.1|  PREDICTED: globulin-1 S allele-like                201   2e-54   
ref|XP_004247670.1|  PREDICTED: vicilin-like antimicrobial peptid...    199   3e-54   
gb|AHC94918.1|  vicilin                                                 200   4e-54   
ref|XP_002517098.1|  Vicilin GC72-A precursor, putative                 203   5e-54   Ricinus communis
gb|EMS66832.1|  Globulin-1 S allele                                     198   7e-53   
gb|EMT20973.1|  Globulin-1 S allele                                     199   7e-53   
ref|XP_004495184.1|  PREDICTED: sucrose-binding protein-like            197   8e-53   
ref|XP_010938152.1|  PREDICTED: vicilin-like antimicrobial peptid...    199   9e-53   
ref|XP_003590610.1|  Vicilin-like antimicrobial peptides 2-2            197   1e-52   
gb|AAK28402.1|AF250228_1  7S globulin                                   198   2e-52   Elaeis guineensis
gb|AAA72622.1|  alpha globulin B                                        198   2e-52   
ref|XP_006650713.1|  PREDICTED: globulin-1 S allele-like                195   4e-52   
gb|AEB33715.1|  conglutin beta 4                                        197   4e-52   
gb|AEO27690.1|  seed storage protein vicilin B                          196   5e-52   
gb|KFK40533.1|  hypothetical protein AALP_AA2G008100                    195   6e-52   
ref|XP_007225266.1|  hypothetical protein PRUPE_ppa001515mg             198   1e-51   
ref|NP_001173574.1|  Os03g0663800                                       192   2e-51   
gb|AEO27691.1|  seed storage protein vicilin B                          195   2e-51   
gb|AEO27687.1|  seed storage protein vicilin B                          193   5e-51   
ref|XP_003536525.1|  PREDICTED: beta-conglycinin, alpha chain-like      194   5e-51   
gb|AEB33716.1|  conglutin beta 5                                        195   6e-51   
prf||1410330B  vicilin gene B                                           193   1e-50
emb|CAI84850.2|  vicilin-like protein                                   192   1e-50   Lupinus albus
gb|KHG06467.1|  Vicilin C72                                             193   1e-50   
gb|AEO27688.1|  seed storage protein vicilin B                          192   1e-50   
gb|ABR21771.1|  conglutin beta                                          192   1e-50   Lupinus angustifolius
ref|XP_004496703.1|  PREDICTED: convicilin-like                         192   3e-50   
gb|AEB33718.1|  conglutin beta 7                                        192   3e-50   
gb|AEB33713.1|  conglutin beta 2                                        192   4e-50   
prf||1713472A  convicilin                                               192   4e-50
sp|P09801.1|VCLB_GOSHI  RecName: Full=Vicilin C72; AltName: Full=...    191   4e-50   Gossypium hirsutum [American cotton]
gb|EAY91281.1|  hypothetical protein OsI_12896                          190   5e-50   Oryza sativa Indica Group [Indian rice]
prf||1306412A  storage protein C72                                      191   5e-50
ref|XP_008665579.1|  PREDICTED: globulin-1 S allele-like                188   8e-50   
gb|AEB33717.1|  conglutin beta 6                                        191   1e-49   
emb|CAA96513.1|  convicilin precursor                                   190   1e-49   Vicia narbonensis
emb|CAP06316.1|  cvc                                                    190   1e-49   Pisum fulvum
ref|XP_008775109.1|  PREDICTED: globulin-1 S allele                     190   1e-49   
gb|EEC76319.1|  hypothetical protein OsI_13867                          187   2e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_002466310.1|  hypothetical protein SORBIDRAFT_01g005440          187   3e-49   Sorghum bicolor [broomcorn]
gb|AAS97865.1|  beta-conglutin precursor                                188   4e-49   Lupinus albus
ref|XP_009369870.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin-like       189   4e-49   
dbj|BAF47690.1|  beta-conglycinin alpha' subunit                        188   4e-49   Glycine soja [wild soybean]
ref|XP_008224279.1|  PREDICTED: vicilin GC72-A-like                     191   5e-49   
pdb|1UIK|A  Chain A, Crystal Structure Of Soybean Beta-Conglycini...    185   6e-49   
ref|XP_004496705.1|  PREDICTED: convicilin-like isoform X2              187   9e-49   
ref|XP_006419988.1|  hypothetical protein CICLE_v10006494mg             188   1e-48   
ref|XP_007144650.1|  hypothetical protein PHAVU_007G173600g             186   2e-48   
ref|XP_004496704.1|  PREDICTED: convicilin-like isoform X1              187   2e-48   
prf||1905429A  major storage protein                                    187   2e-48
ref|XP_010026941.1|  PREDICTED: vicilin C72                             188   2e-48   
gb|KHN02730.1|  Beta-conglycinin, alpha' chain                          187   2e-48   
ref|XP_007034812.1|  Vicilin-A, putative                                186   2e-48   
gb|AAM33459.2|  globulin-like protein                                   184   4e-48   Oryza sativa Japonica Group [Japonica rice]
sp|P13915.1|CVCA_PEA  RecName: Full=Convicilin; Flags: Precursor        186   5e-48   Pisum sativum [garden pea]
emb|CAP06309.1|  convicilin                                             184   1e-47   Lens nigricans
gb|ACG48473.1|  globulin-1 S allele precursor                           182   1e-47   Zea mays [maize]
gb|AEB33714.1|  conglutin beta 3                                        184   2e-47   
ref|XP_009335336.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin C72        185   2e-47   
dbj|BAA74452.2|  alpha' subunit of beta-conglycinin                     183   2e-47   Glycine max [soybeans]
emb|CAB82855.1|  convicilin                                             184   3e-47   Pisum sativum [garden pea]
dbj|BAE02726.1|  beta-conglycinin alpha prime subunit                   184   3e-47   Glycine max [soybeans]
dbj|BAC78524.1|  prepro beta-conglycinin alpha prime subunit            184   3e-47   Glycine max [soybeans]
gb|KEH43849.1|  vicilin 47 kDa protein                                  184   3e-47   
tpg|DAA37931.1|  TPA: hypothetical protein ZEAMMB73_015593              183   3e-47   
ref|NP_001051533.1|  Os03g0793700                                       181   4e-47   Oryza sativa Japonica Group [Japonica rice]
gb|ABH09130.1|  beta-conglycinin alpha'-subunit                         183   4e-47   Glycine max [soybeans]
gb|AAO45103.1|  beta-conglycinin alpha' subunit                         179   4e-47   Glycine max [soybeans]
ref|NP_001237316.1|  beta-conglycinin alpha prime subunit precursor     183   5e-47   
dbj|BAA23360.2|  alpha subunit of beta conglycinin                      182   6e-47   Glycine max [soybeans]
ref|XP_004493035.1|  PREDICTED: vicilin-like                            180   7e-47   
dbj|BAE44299.1|  beta-conglycinin alpha subunit                         182   8e-47   Glycine max [soybeans]
sp|P13916.2|GLCA_SOYBN  RecName: Full=Beta-conglycinin, alpha cha...    182   1e-46   Glycine max [soybeans]
ref|XP_003556051.1|  PREDICTED: beta-conglycinin, alpha chain           182   1e-46   
dbj|BAE02727.1|  beta-conglycinin alpha subunit                         182   1e-46   Glycine max [soybeans]
gb|KHN15747.1|  Beta-conglycinin, alpha chain                           182   1e-46   
dbj|BAK39718.1|  beta-conglycinin alpha subunit                         182   1e-46   
ref|XP_003624145.1|  Convicilin                                         179   2e-46   
emb|CAP06332.1|  convicilin                                             181   2e-46   Vicia ervilia
emb|CAP06333.1|  convicilin                                             179   2e-46   Vicia narbonensis
ref|XP_004492829.1|  PREDICTED: vicilin-like isoform X1                 178   3e-46   
emb|CAP06331.1|  convicilin                                             180   3e-46   Vicia articulata [one-flower vetch]
ref|NP_001236856.1|  beta-conglycinin alpha-subunit precursor           181   3e-46   
ref|XP_010466550.1|  PREDICTED: vicilin C72-like                        179   4e-46   
ref|XP_010511540.1|  PREDICTED: vicilin C72-like                        178   6e-46   
ref|XP_010551719.1|  PREDICTED: vicilin                                 177   7e-46   
ref|XP_008382112.1|  PREDICTED: vicilin-like                            179   1e-45   
emb|CAP06329.1|  convicilin                                             177   1e-45   Vicia peregrina
gb|ACB05815.1|  conglutin beta                                          179   1e-45   Lupinus angustifolius
gb|AEB33712.1|  conglutin beta 1                                        179   1e-45   
ref|XP_004493034.1|  PREDICTED: vicilin-like                            176   2e-45   
ref|XP_003624149.1|  Provicilin                                         176   2e-45   
ref|XP_006299670.1|  hypothetical protein CARUB_v10015858mg             177   2e-45   
emb|CAR78997.1|  convicilin storage protein 1                           177   3e-45   Lotus japonicus
ref|XP_004492830.1|  PREDICTED: vicilin-like isoform X2                 175   3e-45   
ref|XP_010466552.1|  PREDICTED: vicilin C72-like                        176   4e-45   
ref|XP_003624154.1|  Convicilin                                         176   4e-45   
emb|CAR78993.1|  convicilin storage protein 1                           177   4e-45   Lotus japonicus
emb|CAP06322.1|  convicilin                                             176   4e-45   Lathyrus clymenum var. clymenum
ref|XP_010488296.1|  PREDICTED: vicilin C72-like                        176   5e-45   
emb|CAP06324.1|  convicilin                                             176   5e-45   Lathyrus ochrus
ref|XP_003624150.1|  Convicilin                                         175   6e-45   
emb|CAP06325.1|  convicilin                                             175   1e-44   Lathyrus aphaca [yellow pea]
emb|CAP06330.1|  convicilin                                             175   1e-44   Vicia lutea [yellow vetch]
ref|XP_010511547.1|  PREDICTED: vicilin C72-like                        174   1e-44   
gb|ABG02262.1|  8S globulin beta isoform precursor                      174   1e-44   Vigna radiata [mung bean]
gb|KDP42507.1|  hypothetical protein JCGZ_00304                         173   2e-44   
emb|CAP06311.1|  convicilin                                             174   2e-44   Pisum sativum var. pumilio [Syrian fodder pea]
emb|CAP06319.1|  convicilin                                             174   2e-44   Lathyrus tingitanus
emb|CAP06323.1|  convicilin                                             174   2e-44   Lathyrus latifolius [everlasting-pea]
emb|CAP06328.1|  cvc                                                    175   3e-44   Vicia villosa
emb|CAP06315.1|  cvc                                                    174   3e-44   Pisum sativum subsp. elatius [wild pea]
pdb|1IPK|A  Chain A, Crystal Structures Of Recombinant And Native...    172   3e-44   
pdb|1UIJ|A  Chain A, Crystal Structure Of Soybean Beta-Conglycini...    172   4e-44   
emb|CAP06320.1|  cvc                                                    174   4e-44   Lathyrus cicera [red pea]
emb|CBK38917.1|  vicilin 47k                                            172   4e-44   Pisum sativum [garden pea]
emb|CAP06321.1|  convicilin                                             174   5e-44   Lathyrus sativus [chickling vetch]
sp|Q43358.1|VCL_THECC  RecName: Full=Vicilin; Flags: Precursor          173   8e-44   Theobroma cacao [chocolate]
emb|CAP06310.1|  convicilin                                             172   8e-44   Pisum sativum subsp. sativum
sp|P13918.2|VCLC_PEA  RecName: Full=Vicilin; Flags: Precursor           172   8e-44   Pisum sativum [garden pea]
emb|CAB89812.1|  convicilin                                             172   9e-44   Lens culinaris
sp|P25974.1|GLCB_SOYBN  RecName: Full=Beta-conglycinin, beta chai...    171   1e-43   Glycine max [soybeans]
emb|CAA68708.1|  vicilin precursor                                      171   1e-43   Pisum sativum [garden pea]
emb|CBK38920.1|  vicilin 47k                                            171   1e-43   Pisum sativum [garden pea]
dbj|BAD98463.1|  beta-conglycinin beta subunit                          170   1e-43   Glycine max [soybeans]
emb|CAP06318.1|  cvc                                                    172   1e-43   Lathyrus annuus
emb|CAP06313.1|  cvc                                                    172   2e-43   Pisum sativum subsp. sativum
emb|CAP06326.1|  cvc                                                    172   2e-43   Vicia disperma
emb|CAP06334.1|  convicilin                                             171   3e-43   Vicia faba [broad bean]
gb|KHN15750.1|  Beta-conglycinin, beta chain                            170   3e-43   
emb|CBK38919.1|  vicilin 47k                                            170   3e-43   Pisum sativum [garden pea]
ref|XP_006406142.1|  hypothetical protein EUTSA_v10021982mg             171   3e-43   
emb|CAP06312.1|  cvc                                                    171   3e-43   Pisum abyssinicum [Abyssinian pea]
ref|XP_003624146.1|  Convicilin                                         170   3e-43   
emb|CAF25232.1|  Vicilin                                                169   3e-43   Pisum sativum [garden pea]
sp|P11827.1|GLCAP_SOYBN  RecName: Full=Beta-conglycinin, alpha' c...    172   4e-43   Glycine max [soybeans]
emb|CAP06327.1|  cvc                                                    171   4e-43   Vicia bithynica
emb|CAA47814.1|  vicilin 47kD protein                                   169   4e-43   Pisum sativum [garden pea]
emb|CBK38921.1|  vicilin 47k                                            169   4e-43   Pisum sativum [garden pea]
pdb|1IPJ|A  Chain A, Crystal Structures Of Recombinant And Native...    168   6e-43   
emb|CAF25233.1|  Vicilin                                                167   1e-42   Pisum sativum [garden pea]
ref|XP_003556052.1|  PREDICTED: beta-conglycinin, beta chain-like       168   1e-42   
emb|CBK38922.1|  vicilin 47k                                            167   2e-42   Pisum sativum [garden pea]
gb|KHN02728.1|  Beta-conglycinin, beta chain                            165   2e-42   
ref|XP_008224282.1|  PREDICTED: vicilin C72                             169   3e-42   
ref|XP_009369890.1|  PREDICTED: beta-conglycinin, beta chain-like       169   4e-42   
ref|NP_001236872.1|  beta-conglycinin beta-subunit precursor            166   5e-42   
gb|ACU18513.1|  unknown                                                 166   6e-42   Glycine max [soybeans]
ref|XP_007225626.1|  hypothetical protein PRUPE_ppa003838mg             168   6e-42   
emb|CAR78998.1|  convicilin storage protein 2                           168   8e-42   Lotus japonicus
emb|CAD87731.1|  allergen Len c 1.0102                                  165   9e-42   Lens culinaris
emb|CAP06317.1|  cvc                                                    166   2e-41   Lathyrus hirsutus [hairy vetchling]
ref|NP_566714.1|  protein PAP85                                         165   2e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK53446.1|  beta-conglycinin beta subunit                          164   3e-41   
pdb|3SMH|A  Chain A, Crystal Structure Of Major Peanut Allergen A...    162   6e-41   
emb|CAD87730.1|  allergen Len c 1.0101                                  162   7e-41   Lens culinaris
emb|CAP06335.1|  convicilin                                             164   9e-41   Vicia faba [broad bean]
dbj|BAK53447.1|  beta-conglycinin beta subunit                          162   1e-40   
emb|CCW28760.1|  seed storage protein Ara h1                            164   1e-40   
emb|CDY34239.1|  BnaA01g24560D                                          163   1e-40   
pdb|3S7E|A  Chain A, Crystal Structure Of Ara H 1                       162   1e-40   
sp|P43237.1|ALL11_ARAHY  RecName: Full=Allergen Ara h 1, clone P1...    164   1e-40   Arachis hypogaea [goober]
emb|CAA44494.1|  vicilin                                                162   2e-40   Theobroma cacao [chocolate]
ref|XP_009108737.1|  PREDICTED: provicilin                              162   2e-40   
ref|XP_007050543.1|  Nucleolar protein nop56, putative                  158   6e-40   
emb|CAR78994.1|  convicilin storage protein 2                           162   8e-40   Lotus japonicus
emb|CAA96514.1|  vicilin precursor                                      159   2e-39   Vicia narbonensis
gb|AAT00597.1|  conarachin                                              160   4e-39   Arachis hypogaea [goober]
ref|XP_003559611.1|  PREDICTED: globulin-1 S allele                     159   6e-39   
pdb|2EAA|A  Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-3     157   6e-39   
ref|XP_008390981.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin GC72-A     156   8e-39   
dbj|BAF56571.1|  7S globulin-2                                          157   9e-39   Vigna angularis [azuki bean]
ref|XP_002885515.1|  cupin family protein                               158   9e-39   
gb|EMS62417.1|  Globulin-1 S allele                                     158   9e-39   
sp|P43238.1|ALL12_ARAHY  RecName: Full=Allergen Ara h 1, clone P4...    159   1e-38   Arachis hypogaea [goober]
sp|P08438.1|VCL_VICFA  RecName: Full=Vicilin; Flags: Precursor          157   1e-38   Vicia faba [broad bean]
emb|CAA68525.1|  vicilin precursor                                      157   1e-38   Vicia faba [broad bean]
sp|P02854.1|VCLB_PEA  RecName: Full=Provicilin; AltName: Full=Typ...    156   1e-38   Pisum sativum [garden pea]
emb|CAP19902.1|  Vicilin protein                                        156   2e-38   Vigna unguiculata
gb|AAZ06661.1|  seed storage protein B                                  156   2e-38   Vigna luteola
emb|CDY55260.1|  BnaCnng28630D                                          156   2e-38   
gb|AAZ06660.1|  seed storage protein A                                  155   2e-38   Vigna luteola
gb|ACJ65515.1|  globulin 3B                                             156   3e-38   Triticum aestivum [Canadian hard winter wheat]
gb|AAF13476.1|AF113045_1  vicilin                                       150   5e-38   
ref|XP_009413946.1|  PREDICTED: globulin-1 S allele-like                151   1e-37   
gb|AAF13485.1|AF113054_1  vicilin                                       147   4e-37   
ref|XP_010268558.1|  PREDICTED: vicilin-like antimicrobial peptid...    151   5e-37   
gb|AAF13481.1|AF113050_1  vicilin                                       147   5e-37   
ref|XP_002308744.2|  hypothetical protein POPTR_0006s00440g             148   6e-37   
gb|AAF13475.1|AF113044_1  vicilin                                       147   7e-37   
pdb|2EA7|A  Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-1     151   9e-37   
gb|AAF13467.1|AF113036_1  vicilin                                       146   9e-37   
gb|AAF13487.1|AF113056_1  vicilin                                       144   3e-36   
gb|AAT00596.1|  conarachin                                              149   4e-36   
emb|CAA90652.1|  vicilin; 7S globulin                                   149   4e-36   
gb|AAF13490.1|AF113059_1  vicilin                                       144   5e-36   
sp|P50477.1|CANA_CANEN  RecName: Full=Canavalin; Flags: Precursor       149   5e-36   
emb|CAA33172.1|  canavalin                                              149   8e-36   
gb|AAF13489.1|AF113058_1  vicilin                                       144   8e-36   
ref|XP_010652019.1|  PREDICTED: vicilin-like antimicrobial peptid...    144   1e-35   
sp|P10562.1|CANA_CANGL  RecName: Full=Canavalin; Flags: Precursor       148   1e-35   
gb|AAF13486.1|AF113055_1  vicilin                                       142   2e-35   
gb|AAF13472.1|AF113041_1  vicilin                                       142   2e-35   
gb|AAF13468.1|AF113037_1  vicilin                                       140   1e-34   
gb|AAF13471.1|AF113040_1  vicilin                                       140   1e-34   
gb|AAF13465.1|AF113034_1  vicilin                                       138   7e-34   
gb|AAF13482.1|AF113051_1  vicilin                                       138   8e-34   
gb|AAF13464.1|AF113033_1  vicilin                                       138   9e-34   
ref|XP_004247581.2|  PREDICTED: vicilin C72-like                        139   9e-34   
gb|AAF13466.1|AF113035_1  vicilin                                       135   7e-33   
gb|AAF13470.1|AF113039_1  vicilin                                       135   8e-33   
gb|ABG02261.1|  8S globulin alpha' isoform precursor                    139   8e-33   
sp|Q43617.1|PHS2_PHALU  RecName: Full=Phaseolin; Flags: Precursor       139   9e-33   
gb|EMT09885.1|  Globulin-1 S allele                                     139   1e-32   
ref|XP_007143290.1|  hypothetical protein PHAVU_007G059800g             140   1e-32   
gb|AAF13469.1|AF113038_1  vicilin                                       134   2e-32   
gb|ABW23574.1|  8S globulin alpha subunit                               138   3e-32   
gb|AAF13488.1|AF113057_1  vicilin                                       132   7e-32   
gb|AAF13479.1|AF113048_1  vicilin                                       132   1e-31   
gb|ABG02260.1|  8S globulin alpha isoform precursor                     136   2e-31   
gb|AAF13477.1|AF113046_1  vicilin                                       131   2e-31   
gb|AAF13484.1|AF113053_1  vicilin                                       131   2e-31   
gb|ABR21772.1|  conglutin beta                                          135   3e-31   
gb|ABB13526.1|  BLAD                                                    129   3e-31   
gb|AAF13474.1|AF113043_1  vicilin                                       129   7e-31   
pdb|2CV6|A  Chain A, Crystal Structure Of 8salpha Globulin, The M...    133   8e-31   
sp|P80463.2|PHS1_PHALU  RecName: Full=Phaseolin; Flags: Precursor       132   1e-30   
ref|XP_010276227.1|  PREDICTED: vicilin-like antimicrobial peptid...    127   1e-30   
ref|XP_010228589.1|  PREDICTED: globulin-1 S allele-like                133   2e-30   
gb|AAF13463.1|AF113032_1  vicilin                                       127   4e-30   
gb|AAF13473.1|AF113042_1  vicilin                                       127   4e-30   
gb|AAF13483.1|AF113052_1  vicilin                                       127   4e-30   
gb|KEH43848.1|  vicilin 47 kDa protein                                  130   2e-29   
prf||1502201A  vicilin                                                  129   2e-29
ref|XP_007143289.1|  hypothetical protein PHAVU_007G059800g             130   3e-29   
gb|AAD10375.1|  globulin-like protein                                   129   4e-29   
gb|AAF13462.1|AF113031_1  vicilin                                       124   5e-29   
emb|CAB38247.1|  unnamed protein product                                122   1e-28   
gb|ADQ53858.1|  Ara h 1 allergen                                        128   3e-28   
emb|CAA91188.1|  vicilin                                                122   6e-28   
ref|XP_009413947.1|  PREDICTED: globulin-1 S allele-like                122   9e-28   
pdb|2PHL|A  Chain A, The Structure Of Phaseolin At 2.2 Angstroms ...    124   1e-27   
sp|P02853.2|PHSB_PHAVU  RecName: Full=Phaseolin, beta-type; Flags...    124   1e-27   
gb|AGT55546.1|  phaseolin                                               123   2e-27   
gb|ACU17936.1|  unknown                                                 120   3e-27   
gb|AAA99534.1|  phaseolin                                               122   4e-27   
emb|CAA26789.1|  unnamed protein product                                122   4e-27   
ref|XP_007143292.1|  hypothetical protein PHAVU_007G060000g             121   6e-27   
emb|CAA36853.1|  alpha-phaseolin                                        122   8e-27   
gb|AAM81249.1|AF513725_1  vicilin-like storage protein                  122   9e-27   
sp|P13919.2|CVCB_PEA  RecName: Full=Convicilin; Flags: Precursor        120   1e-26   
gb|AAC04316.1|  phaseolin                                               120   2e-26   
gb|EAZ29742.1|  hypothetical protein OsJ_13801                          121   2e-26   
gb|AHW49410.1|  alpha-phaseolin                                         120   3e-26   
ref|XP_010086606.1|  Sucrose-binding protein                            118   4e-26   
gb|ABS89028.1|  globulin-1                                              116   4e-26   
gb|ABF98040.1|  Cupin family protein, expressed                         119   4e-26   
ref|XP_010242496.1|  PREDICTED: vicilin-like antimicrobial peptid...    117   5e-26   
gb|AHW49422.1|  alpha-phaseolin                                         118   2e-25   
gb|ABS89047.1|  globulin-1                                              114   2e-25   
gb|ABS89073.1|  globulin-1                                              114   2e-25   
gb|AHW49407.1|  alpha-phaseolin                                         117   2e-25   
gb|ABS89064.1|  globulin-1                                              114   2e-25   
gb|ABS89092.1|  globulin-1                                              114   2e-25   
gb|AHW49431.1|  alpha-phaseolin                                         117   2e-25   
gb|ABS89057.1|  globulin-1                                              114   2e-25   
gb|AHW49420.1|  alpha-phaseolin                                         117   2e-25   
gb|ABS89031.1|  globulin-1                                              114   3e-25   
ref|XP_009413945.1|  PREDICTED: globulin-1 S allele-like                115   4e-25   
gb|AHW49419.1|  alpha-phaseolin                                         117   4e-25   
gb|ABS89078.1|  globulin-1                                              113   6e-25   
gb|ABS89030.1|  globulin-1                                              113   6e-25   
gb|ABS89077.1|  globulin-1                                              113   7e-25   
gb|AHW49404.1|  alpha-phaseolin                                         116   8e-25   
gb|ABS89043.1|  globulin-1                                              112   9e-25   
gb|EAZ28885.1|  hypothetical protein OsJ_12925                          115   1e-24   
gb|KDO74521.1|  hypothetical protein CISIN_1g0394412mg                  114   1e-24   
gb|AHW49416.1|  alpha-phaseolin                                         115   2e-24   
gb|AHW49411.1|  alpha-phaseolin                                         114   2e-24   
gb|AHW49409.1|  alpha-phaseolin                                         114   2e-24   
gb|AHW49426.1|  alpha-phaseolin                                         114   3e-24   
gb|AHW49430.1|  alpha-phaseolin                                         114   3e-24   
gb|AHW49432.1|  alpha-phaseolin                                         114   3e-24   
emb|CAA91187.1|  vicilin                                                115   3e-24   
gb|AHW49425.1|  alpha-phaseolin                                         114   3e-24   
gb|AHW49423.1|  alpha-phaseolin                                         114   3e-24   
gb|AHW49421.1|  alpha-phaseolin                                         114   4e-24   
ref|XP_010254445.1|  PREDICTED: vicilin-like antimicrobial peptid...    108   5e-24   
gb|AHW49413.1|  alpha-phaseolin                                         113   6e-24   
gb|AHW49408.1|  alpha-phaseolin                                         113   7e-24   
gb|ABS89035.1|  globulin-1                                              110   8e-24   
gb|ABS89083.1|  globulin-1                                              109   1e-23   
gb|ABS89101.1|  globulin-1                                              109   1e-23   
gb|ABS89056.1|  globulin-1                                              109   1e-23   
gb|AHW49433.1|  alpha-phaseolin                                         112   1e-23   
gb|AHW49434.1|  alpha-phaseolin                                         112   1e-23   
gb|ABS89048.1|  globulin-1                                              109   1e-23   
gb|ABS89099.1|  globulin-1                                              109   2e-23   
gb|AHW49415.1|  alpha-phaseolin                                         112   2e-23   
ref|XP_010261317.1|  PREDICTED: provicilin                              111   2e-23   
gb|AAC23610.1|  beta-type phaseolin storage protein                     112   2e-23   
gb|AHW49405.1|  alpha-phaseolin                                         112   2e-23   
ref|XP_002988968.1|  hypothetical protein SELMODRAFT_129041             112   2e-23   
gb|ABS89084.1|  globulin-1                                              108   2e-23   
gb|ABS89082.1|  globulin-1                                              108   2e-23   
gb|AHW49428.1|  alpha-phaseolin                                         111   3e-23   
gb|ABS89097.1|  globulin-1                                              108   3e-23   
gb|ABS89096.1|  globulin-1                                              108   3e-23   
gb|ABS89074.1|  globulin-1                                              108   3e-23   
gb|ABS89038.1|  globulin-1                                              108   3e-23   
gb|ABS89079.1|  globulin-1                                              108   3e-23   
gb|ABS89054.1|  globulin-1                                              108   3e-23   
ref|XP_010046432.1|  PREDICTED: vicilin-like antimicrobial peptid...    111   4e-23   
gb|ABS89046.1|  globulin-1                                              108   4e-23   
gb|ABS89068.1|  globulin-1                                              108   4e-23   
gb|ABS89076.1|  globulin-1                                              108   4e-23   
gb|ABS89062.1|  globulin-1                                              108   4e-23   
gb|ABS89102.1|  globulin-1                                              108   4e-23   
gb|ABS89063.1|  globulin-1                                              108   4e-23   
gb|ABS89050.1|  globulin-1                                              108   4e-23   
gb|ABS89103.1|  globulin-1                                              108   5e-23   
gb|ABS89095.1|  globulin-1                                              108   5e-23   
gb|ABS89036.1|  globulin-1                                              108   5e-23   
gb|ABS89039.1|  globulin-1                                              108   5e-23   
gb|ABS89088.1|  globulin-1                                              108   5e-23   
gb|ABS89081.1|  globulin-1                                              108   5e-23   
gb|ACJ65513.1|  globulin 3C                                             109   5e-23   
gb|ACC97140.1|  globulin-1                                              107   5e-23   
gb|ABS89080.1|  globulin-1                                              108   5e-23   
gb|ACC97138.1|  globulin-1                                              107   5e-23   
gb|ABS89027.1|  globulin-1                                              107   5e-23   
gb|ABR67869.1|  globulin-1                                              107   5e-23   
gb|ABS89065.1|  globulin-1                                              107   6e-23   
gb|ACC97139.1|  globulin-1                                              107   6e-23   
gb|ABR67870.1|  globulin-1                                              107   6e-23   
gb|ABS89058.1|  globulin-1                                              107   6e-23   
gb|ABS89098.1|  globulin-1                                              107   8e-23   
gb|KCW85694.1|  hypothetical protein EUGRSUZ_B02472                     111   8e-23   
gb|ABS89026.1|  globulin-1                                              107   9e-23   
gb|ABS89040.1|  globulin-1                                              107   9e-23   
gb|ABS89053.1|  globulin-1                                              107   9e-23   
gb|ABS89044.1|  globulin-1                                              107   1e-22   
gb|ABS89055.1|  globulin-1                                              107   1e-22   
gb|ABS89106.1|  globulin-1                                              107   1e-22   
ref|XP_008463915.1|  PREDICTED: LOW QUALITY PROTEIN: globulin-1 S...    111   1e-22   
sp|P07219.1|PHSA_PHAVU  RecName: Full=Phaseolin, alpha-type; Flag...    109   1e-22   
gb|ABS89066.1|  globulin-1                                              106   2e-22   
gb|ABS89049.1|  globulin-1                                              106   2e-22   
gb|ABR16441.1|  unknown                                                 109   2e-22   
gb|ABK80758.1|  7S globulin precursor                                   109   3e-22   
ref|XP_004149563.1|  PREDICTED: vicilin-like antimicrobial peptid...    109   4e-22   
gb|ABK24863.1|  unknown                                                 108   4e-22   
ref|XP_004163383.1|  PREDICTED: vicilin-like antimicrobial peptid...    109   4e-22   
ref|XP_002313331.2|  hypothetical protein POPTR_0009s05950g             108   4e-22   
ref|XP_003557965.1|  PREDICTED: vicilin                                 109   4e-22   
ref|XP_007143287.1|  hypothetical protein PHAVU_007G0597001g            107   4e-22   
gb|AAC31456.1|  globulin-1                                              104   5e-22   
gb|AAC31464.1|  globulin-1                                              104   7e-22   
gb|ABS89045.1|  globulin-1                                              104   1e-21   
gb|AAK20352.1|AF329810_1  globulin 1                                    103   2e-21   
ref|XP_002975077.1|  hypothetical protein SELMODRAFT_102742             105   2e-21   
gb|AAK20341.1|AF329799_1  globulin 1                                    102   2e-21   
gb|AAC31466.1|  globulin-1                                              103   2e-21   
gb|AAC31455.1|  globulin-1                                              102   3e-21   
gb|AAK20344.1|AF329802_1  globulin 1                                    102   3e-21   
gb|AAK20334.1|AF329792_1  globulin 1                                    102   3e-21   
gb|AAK20335.1|AF329793_1  globulin 1                                    102   3e-21   
gb|AAC31460.1|  globulin-1                                              102   3e-21   
gb|ABS89042.1|  globulin-1                                              102   4e-21   
ref|XP_010689593.1|  PREDICTED: vicilin-like antimicrobial peptid...    106   4e-21   
gb|AAK20351.1|AF329809_1  globulin 1                                    102   4e-21   
emb|CAP06314.1|  cvc                                                    105   5e-21   
ref|XP_010104126.1|  Vicilin-like antimicrobial peptides 2-2            105   5e-21   
gb|EMT30208.1|  Vicilin-like antimicrobial peptides 2-2                 105   5e-21   
gb|AAC31472.1|  globulin-1                                              101   8e-21   
gb|AAC31469.1|  globulin-1                                              101   1e-20   
gb|AAC31470.1|  globulin-1                                              101   1e-20   
gb|AAC31471.1|  globulin-1                                              101   1e-20   
gb|AAC31462.1|  globulin-1                                              100   1e-20   
gb|KHG30193.1|  Vicilin-like antimicrobial peptides 2-2                 104   1e-20   
gb|AAC31474.1|  globulin-1                                              100   1e-20   
gb|AAC31458.1|  globulin-1                                              100   1e-20   
gb|ABS89070.1|  globulin-1                                              100   2e-20   
ref|XP_006424635.1|  hypothetical protein CICLE_v10028266mg             103   2e-20   
ref|XP_011025519.1|  PREDICTED: vicilin-like antimicrobial peptid...    103   2e-20   
gb|AAS07325.1|  putative globulin (with alternative splicing)           100   2e-20   
ref|XP_009416713.1|  PREDICTED: vicilin-like antimicrobial peptid...    103   3e-20   
gb|AAC31459.1|  globulin-1                                              100   3e-20   
gb|ABS89052.1|  globulin-1                                              100   3e-20   
pir||T10443  probable major protein body membrane protein MP27 / ...    103   5e-20
ref|XP_010034297.1|  PREDICTED: vicilin-like antimicrobial peptid...    102   6e-20   
gb|AAC31457.1|  globulin-1                                            99.0    8e-20   
gb|AAC31461.1|  globulin-1                                            98.6    9e-20   
gb|AAC31468.1|  globulin-1                                            98.6    1e-19   
pdb|1CAU|A  Chain A, Determination Of Three Crystal Structures Of...  97.1    1e-19   
emb|CAN60323.1|  hypothetical protein VITISV_002857                     101   1e-19   
pdb|1DGR|A  Chain A, Refined Crystal Structure Of Canavalin From ...  96.7    1e-19   
ref|XP_009342359.1|  PREDICTED: vicilin-like antimicrobial peptid...    102   1e-19   
ref|XP_010244960.1|  PREDICTED: vicilin-like antimicrobial peptid...    100   2e-19   
dbj|BAJ87938.1|  predicted protein                                      101   2e-19   
emb|CBI16272.3|  unnamed protein product                                100   2e-19   
gb|AAC31477.1|  globulin-1                                            97.8    2e-19   
gb|AAC31467.1|  globulin-1                                            97.8    2e-19   
gb|AAC31478.1|  globulin-1                                            97.8    2e-19   



>ref|XP_009607668.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
tomentosiformis]
Length=499

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/401 (43%), Positives = 259/401 (65%), Gaps = 36/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ + F T   +     R+LP+F++RS L +GI++YR+A L    QTF+VPNH DA+
Sbjct  97    PYVFEDQHFITGIKTQHGRIRVLPKFTERSKLLKGIENYRVAILEANPQTFIVPNHWDAD  156

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG++ ++R+  + SFNI  GDV+R+  GTT Y++N +N +K  L    L+  
Sbjct  157   AVLFVAQGRGTLNLVRRGKRNSFNIRPGDVIRVHAGTTAYLINRENNEK--LVIAKLLNP  214

Query  998   ISTPGRFQFFSGAAGKK-PVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             +STPG+F+ F G  G++ P SF+N FS E LE+ALN + + +QR LFG+ Q EG  ++ +
Sbjct  215   VSTPGQFEHFFGPGGRENPESFYNAFSSEILESALNVRRDRLQR-LFGQ-QREGVIIRAS  272

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEV  645
             EEQ+R++SQ  +EGGI PF G+      S+N++  + + SNQYG +YEV  +H++ L+++
Sbjct  273   EEQIRAMSQH-EEGGIWPFGGESKG---SVNIYRQRPSQSNQYGQLYEVDGSHYRQLEDL  328

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
             D++ +F NIT+GGMLGP ++SRAT++AVV++GEG+ EM CP                   
Sbjct  329   DISVSFANITQGGMLGPVYSSRATKIAVVVDGEGYFEMACPHLASESGSRGRQSRGSERE  388

Query  518   ----NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT  351
                 + YQ VR++L+ GMVV+IP G+P VNVA++N  ++LQ   F+IN R NE V LAG 
Sbjct  389   TRIGSGYQKVRARLRRGMVVIIPAGHPVVNVASNN--QNLQLVCFNINARNNEIVPLAGR  446

Query  350   NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             NN+  +L   A +L F  G     V  +F SQ  ELFF+ P
Sbjct  447   NNVMSQLEREAMELGF--GVPAREVEEIFRSQQEELFFQGP  485



>ref|XP_004247186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=469

 Score =   319 bits (818),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/393 (44%), Positives = 257/393 (65%), Gaps = 28/393 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  E F     +     R+LP+F++RS L +GI++YR A L    +TFVVPNH DA+
Sbjct  79    PYVFNEEHFIMGIETEHGRIRVLPKFNERSKLLKGIENYRFAILEANPKTFVVPNHWDAD  138

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+++++R+  + SFNI  GDV+++  GTT Y++N D+ +K+ +    L+R 
Sbjct  139   AVLFVAQGRGTLSLVRKGKRNSFNIRRGDVIKVCAGTTAYLINRDDNEKLLIA--KLLRP  196

Query  998   ISTPGRFQFFSGAAGKK-PVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             +STPG F+ F G  G++ P SF++ FS E LEAALNT+ + +QR LFG+P+ EG  ++ +
Sbjct  197   VSTPGHFEHFFGPGGRQNPESFYSAFSSEILEAALNTRKDRLQR-LFGQPR-EGVIIRAS  254

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEV  645
             EEQ+R +SQ  +EGGI PF G+      S+N++  + + SNQYG  Y+V  +++K L+++
Sbjct  255   EEQIRVMSQH-EEGGIWPFGGESKG---SVNIYKQRPLRSNQYGQFYQVDESNYKQLEDL  310

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------NNYQ  507
             D++  F NITEGGM+GP +NSRAT++AVV++GEG+ EM CP               ++YQ
Sbjct  311   DISINFANITEGGMVGPIYNSRATKIAVVVQGEGYFEMACPHLASKFTSSHETRIGSSYQ  370

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              VRSKL+ GMV+VIPPG+P+V V ++N  ++LQ   F++N R NE V LAG NN+  +L 
Sbjct  371   KVRSKLRRGMVLVIPPGHPFVGVTSTN--QNLQIVGFNVNARDNEIVPLAGRNNVMSQLE  428

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               A +L F  G     V  +F SQ  E FF+ P
Sbjct  429   REALELGF--GLPAREVEQIFRSQQEEFFFQGP  459



>ref|XP_009786980.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=497

 Score =   316 bits (809),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/401 (43%), Positives = 256/401 (64%), Gaps = 36/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ + F T   +     R+LP+F++RS L +GI++YR+A L    QTF+VPNH DA+
Sbjct  95    PYVFEDQHFITGIKTQHGRIRVLPKFTERSKLLKGIENYRVAILEANPQTFIVPNHWDAD  154

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG++ ++R+  + SFNI  GDV+R+  GTT Y++N DN +K  L    L+  
Sbjct  155   AVLFVAQGRGTLNLVRRGKRNSFNIRAGDVIRVHAGTTAYLINRDNNEK--LVIAKLLNP  212

Query  998   ISTPGRFQFFSGAAGKK-PVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             +STPG+F+ F G  G++ P SF+N FS E LE+ALN + + +QR LFG+ Q EG  ++ +
Sbjct  213   VSTPGQFEHFFGPGGRENPESFYNAFSSEILESALNVRRDRLQR-LFGQ-QREGVIIRAS  270

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEV  645
             EEQ+R++SQ  +EGGI PF G+      S+N++  + + SNQYG +YEV  +H++ L+++
Sbjct  271   EEQIRAMSQH-EEGGIWPFGGESKG---SVNLYRQRPLQSNQYGQLYEVDGSHYRQLEDL  326

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
             D++ +  NIT+GGM GP ++SRAT++AVV++GEG+ EM CP                   
Sbjct  327   DISVSLANITQGGMFGPAYSSRATKIAVVVDGEGYFEMACPHLASESGSRGRQSRGSERE  386

Query  518   ----NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT  351
                 + YQ VR++L+ GMVV+IP G+P VNVA++N  ++LQ   F+IN R NE V LAG 
Sbjct  387   TRIGSGYQKVRARLRRGMVVIIPAGHPVVNVASNN--QNLQVVCFNINARNNEIVPLAGR  444

Query  350   NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             NN+  +L   A +L F  G     V  +F SQ  E FF+ P
Sbjct  445   NNVMSQLEREAMELGF--GIPAREVEEIFRSQQEEFFFQGP  483



>ref|XP_006349767.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=474

 Score =   314 bits (804),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 173/399 (43%), Positives = 255/399 (64%), Gaps = 34/399 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  E F T   +     R+LP+FS+RS L +GI++YR A L    +TFVVPNH DA+
Sbjct  78    PYVFNEEHFITGIKTEHGRIRVLPKFSERSKLLKGIENYRFAILEANPKTFVVPNHWDAD  137

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+++++R+  + SFNI  GDV+++  GTT Y++N D+ +K+ +    L+R 
Sbjct  138   AVLFVAQGRGTLSLVRKGKRNSFNIGRGDVIKVCAGTTAYLINRDDNEKLLIA--KLLRP  195

Query  998   ISTPGRFQFFSGAAGKK-PVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             +STPG+F+ F G  G++ P SF++ FS + LEAALNT+ + +QR LFG+P+ EG  ++ +
Sbjct  196   VSTPGQFEHFFGPGGRENPQSFYSAFSSDILEAALNTRKDRLQR-LFGQPR-EGVIIRAS  253

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEV  645
             EEQ+R +SQ  +EGGI PF G+      S+N++  + + SNQYG  Y+V  + +K L+++
Sbjct  254   EEQIRVMSQH-EEGGIWPFGGESKG---SVNIYKQRPLQSNQYGQFYQVDDSTYKQLEDL  309

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
             D++  F NITEGGMLGP ++SRAT++AVV+EGEG+ EM CP                   
Sbjct  310   DISLNFANITEGGMLGPIYSSRATKIAVVVEGEGYFEMACPHLASESESGKRQGSKETET  369

Query  518   --NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                 YQ V SKL+ GMV+VIP G+P+V VA++N  ++LQ   F++N R NE V LAG NN
Sbjct  370   RIGRYQKVSSKLRRGMVLVIPAGHPFVAVASTN--QNLQIVGFNVNARNNEIVPLAGRNN  427

Query  344   LFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             +  +L   A +L F  G     V  +F SQ  E FF+ P
Sbjct  428   VMSQLEREALELGF--GLPAREVEQIFQSQQEEFFFQGP  464



>gb|AAK15089.1|AF240006_1 7S globulin [Sesamum indicum]
Length=585

 Score =   312 bits (799),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 251/393 (64%), Gaps = 28/393 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ + F T   +     R+L +F+DRS+L  GI++YR+A L  E QTF+VPNH DAE
Sbjct  195   PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+++++RQD +ES NI +GD+L+I  GTT Y++N DN +++ L    L++ 
Sbjct  255   SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVL--AKLLQP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG F+ F GA G+ P SFF  FS E LEAA NT+ + +QR+ FG+ Q +G  +K +E
Sbjct  313   VSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRI-FGQ-QRQGVIVKASE  370

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S+  +EGGI PF G+      +IN++  + T SNQYG ++EV  + ++ L ++D
Sbjct  371   EQVRAMSRH-EEGGIWPFGGESKG---TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLD  426

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------------KNNYQ  507
             +  +  NIT+G M  P +NS+AT++A+V++GEG+ EM CP               + +YQ
Sbjct  427   LTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ  486

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              V S+L  G VV+IP G+P+V VA+SN  ++LQ   F++N   NE+  LAG  N+  +L 
Sbjct  487   RVASRLTRGTVVIIPAGHPFVAVASSN--QNLQVLCFEVNANNNEKFPLAGRRNVMNQLE  544

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               AK+L+F  G     V  V  SQ  E FFK P
Sbjct  545   REAKELAF--GMPAREVEEVSRSQQEEFFFKGP  575



>gb|EYU23233.1| hypothetical protein MIMGU_mgv1a024110mg [Erythranthe guttata]
Length=592

 Score =   310 bits (795),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 254/388 (65%), Gaps = 23/388 (6%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+   F T   +     R+LP+F+DRS L +GI++YR+A L  E QTF+VPNH DA+
Sbjct  208   PYVFEERHFFTGMETQHGRLRILPKFTDRSKLLKGIENYRVAILEAEPQTFIVPNHWDAD  267

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+V+++RQ+ +ESFNI +GD+ RI  GTT Y++N D+ +K+ L    L++ 
Sbjct  268   TLIFVANGRGAVSLMRQERRESFNIKQGDIFRINAGTTAYLINRDSNQKLVLA--KLLQP  325

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG+F+ F GA G+ P SF+  FS E LEAA NT+ + +QR LFG+ Q++G  +K +E
Sbjct  326   VNTPGQFEAFFGAGGENPESFYTAFSNEILEAAFNTRRDRLQR-LFGQ-QKQGVIIKASE  383

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S   +EGGI PF G+      + N++  + + SN+YG ++EV ++ F+ L ++D
Sbjct  384   EQVRAMSHH-EEGGIWPFGGESKG---TFNLYDQRPSHSNEYGQLFEVDSSQFRQLRDLD  439

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------NNYQTVRSK  492
             +  +  NIT+G M+ P +NS++T++ VV++GEG+ EM CP             Y+ V S+
Sbjct  440   IAVSLANITQGAMIAPSYNSKSTKITVVVDGEGYFEMACPHISQQQQGAGQRGYEKVSSR  499

Query  491   LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKD  312
             LK G VVV+P G+P+V VA++N  ++LQ   F++N   NE+ TLAG  N+  +L   AK+
Sbjct  500   LKRGTVVVVPAGHPFVAVASNN--QNLQLLCFEVNAYNNEKFTLAGRRNVMNQLEREAKE  557

Query  311   LSFAAGSDKESVNVVFGSQPLELFFKAP  228
             L+F  G     V+ +F +Q  E FFK P
Sbjct  558   LAF--GMPAREVDEIFRNQKEEFFFKGP  583



>gb|EYU40904.1| hypothetical protein MIMGU_mgv1a003248mg [Erythranthe guttata]
Length=597

 Score =   308 bits (789),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 255/400 (64%), Gaps = 33/400 (8%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q P+VF+   F T   +     R+LP+F+DRS L +GI++YR+A L  E QTF+VPNH D
Sbjct  201   QNPYVFEERHFFTGMETQHGRLRILPKFTDRSKLLKGIENYRVAILEAEPQTFIVPNHWD  260

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A+ +  V  GRG+V+++RQ+ +ESFNI +GD+ RI  GTT Y++N D+ +K+ L    L+
Sbjct  261   ADTLIFVANGRGAVSLMRQERRESFNIKQGDIFRINAGTTAYLINRDSNQKLVLA--KLL  318

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
             + ++TPG+F+ F GA G+ P SF+  FS + LEAA NT+ + +QR LFG+ Q++G  +K 
Sbjct  319   QPVNTPGQFEAFFGAGGENPESFYTAFSNDILEAAFNTRRDRLQR-LFGQ-QKQGVIIKA  376

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDE  648
             +EEQ+R++S   +EGGI PF G+      + N++  + + SN+YG ++EV ++ F+ L +
Sbjct  377   SEEQVRAMSHH-EEGGIWPFGGESKG---TFNLYDQRPSHSNEYGQLFEVDSSQFRQLRD  432

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----------------  519
             +D+  +  NIT+G M+ P +NS++T++ VV++GEG+ EM CP                  
Sbjct  433   LDIAISLANITQGAMIAPSYNSKSTKITVVVDGEGYFEMACPHISQSQSQGGRQQRQQQG  492

Query  518   ---NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTN  348
                  Y+ V S+LK G VVV+P G+P+V VA++N  ++LQ   F++N   NE+ TLAG  
Sbjct  493   AGQRGYEKVSSRLKRGTVVVVPAGHPFVAVASNN--QNLQLLCFEVNAYNNEKFTLAGRR  550

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             N+  +L   AK+L+F  G     V+ +F SQ  E FFK P
Sbjct  551   NVMNQLEREAKELAF--GMPAREVDEIFRSQKEEFFFKGP  588



>ref|XP_011082575.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Sesamum indicum]
Length=580

 Score =   299 bits (765),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 244/393 (62%), Gaps = 33/393 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ + F T   +     R+L +F+DRS+L  GI++YR+A L  E QTF+VPNH DAE
Sbjct  195   PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+++++RQD +ES NI +GD+L+I  GTT Y++N DN +++ L    L++ 
Sbjct  255   SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVL--AKLLQP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG F+ F GA G+ P SFF  FS E LEAA NT+ + +QR+ FG+ Q +G  +    
Sbjct  313   VSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRI-FGQ-QRQGVIVXXX-  369

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
                  +S+  +EGGI PF G+      +IN++  + T SNQYG +YEV  + ++ L ++D
Sbjct  370   ----XMSRH-EEGGIWPFGGESKG---TINIYQQRPTHSNQYGQLYEVDASQYRQLRDLD  421

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------------KNNYQ  507
             +  +  NIT+G M  P +NS+AT++A+V++GEG+ EM CP               + +YQ
Sbjct  422   LTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ  481

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              V S+L  G VV+IP G+P+V VA+SN  ++LQ   F++N   NE+  LAG  N+  +L 
Sbjct  482   RVASRLTRGTVVIIPAGHPFVAVASSN--QNLQVLCFEVNANNNEKFPLAGRRNVMNQLE  539

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               AK+L+F  G     V  VF SQ  E FFK P
Sbjct  540   REAKELAF--GMPAREVEEVFRSQQEEFFFKGP  570



>gb|ABO36677.1| vicilin [Pistacia vera]
Length=519

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/391 (41%), Positives = 242/391 (62%), Gaps = 25/391 (6%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ E F T+  + +    +LP+F+ RS L  G++ YRLAFL+   Q FVVPNH DA+
Sbjct  128   PYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDAD  187

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  IR++ +ES N+ +GD++RI  GT  YIVNTD  +K  L    L++ 
Sbjct  188   SIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEK--LYIVKLLQP  245

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG ++ F G  G+ P SF+  FSRE LEAAL T  + ++++   E Q+EG  +K ++
Sbjct  246   VNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLF--EKQDEGAIVKASK  303

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S+ G+   I PF G  T    + N+F    + SN YG ++E     + PL E+D
Sbjct  304   EQIRAMSRRGEGPSIWPFTGKSTG---TFNLFKKDPSQSNNYGQLFESEFKDYPPLQELD  360

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----KN--------NYQTV  501
             +  ++VNIT+GGM GPF+NSRAT++A+V+ GEG LE+ CP     KN        +Y+ +
Sbjct  361   IMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKKL  420

Query  500   RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNA  321
              S ++T  V V+P G+P+V VA+ N  ++L+   F++N  GN R TLAG  N+   +   
Sbjct  421   SSSIRTDSVFVVPAGHPFVTVASGN--QNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKE  478

Query  320   AKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             AK+L+F   +  E V+ VFG Q  E FF+ P
Sbjct  479   AKELAFK--TKGEEVDKVFGKQDEEFFFQGP  507



>emb|CBI28721.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 151/387 (39%), Positives = 233/387 (60%), Gaps = 17/387 (4%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q P+VFQ + +     + E   ++L RF  RS L  G+K+YR  +L    QTFV+P H D
Sbjct  15    QNPYVFQDQHYTASLETNEGRIKILQRFHQRSRLLRGLKNYRFVYLEANPQTFVLPAHLD  74

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             AE +  V  GRG+++++ Q  +ESFNI +GD++RI  GTT Y++N D  KK  L    L+
Sbjct  75    AEAVVYVASGRGTLSLVSQGKRESFNIKQGDIVRIRAGTTIYMINRDKNKK--LRIAKLL  132

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
             + ++ P  FQ F G AG+ P SF+  FS E L +AL  + + +QRV+  + Q +G  +K 
Sbjct  133   QPVALPDEFQPFYGPAGENPQSFYRAFSEELLSSALKVEQDRVQRVI--KQQNKGVIVKA  190

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDE  648
             +E+Q+++LSQ  +E G+ PF    T   R  N+   + ++SN+YG ++E     F+ L +
Sbjct  191   SEQQIQALSQR-EESGMFPFPFGSTESKRVFNLLSKEPSISNRYGRLHEADANEFQQLQD  249

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------NYQTVRSKL  489
             +D+  ++ NIT+G M GPFFN+RAT++AVV++GEG++EM CP         +YQ + S L
Sbjct  250   MDIAVSYSNITKGSMEGPFFNTRATKIAVVVKGEGYMEMACPHQQQQSASPHYQRLSSPL  309

Query  488   KTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDL  309
             K GM+ V+P G+P + VA +N  ++L+   FD+N   N R +LAG  N+   L   AK+L
Sbjct  310   KRGMLFVVPAGHPLIVVAGNN--RNLEIVCFDVNAENNRRESLAGDKNIVNALEKEAKEL  367

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAP  228
             +F+  +    V+ VF  Q    FF  P
Sbjct  368   AFSIPA--REVDEVFAKQNEWWFFPGP  392



>ref|XP_008386543.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=485

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/388 (39%), Positives = 227/388 (59%), Gaps = 19/388 (5%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ + FET+  + E   ++L +F++RSDL  GI+++R+ FL+ E   FV P H DA+
Sbjct  94    PYFFEDQHFETRVQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDAD  153

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GR ++ ++R++ KES N+  GD+ RIP GT  YI+N D+ ++  L    L+++
Sbjct  154   CVLFVCQGRPTITLVREEKKESHNLERGDLFRIPAGTPFYILNRDDNER--LHIVQLLKA  211

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG ++ F  A G+ P SFF  FS E L+AA  T    + R LFG+ Q  G  ++ ++
Sbjct  212   VSTPGEYEAFHSAGGQDPESFFKAFSPEVLQAAFKTDRNKLDR-LFGQ-QTRGSIIRASK  269

Query  818   EQLRSLSQEGDEGGIR-----PFRGDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFKP  657
             EQ++ +SQ+   GG       PF G E +   S N+F  H +  N++G ++E     FK 
Sbjct  270   EQVQRMSQQHGHGGSEGIWPLPFHGGELTSKDSFNLFKKHPSQENKFGRLFEADFKDFKQ  329

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----YQTVRSK  492
             L E D+  +F NIT G M GPFFNSRAT+++VVL+GEG  EM CP        YQ +R  
Sbjct  330   LQEFDLLVSFANITRGAMEGPFFNSRATKISVVLDGEGHFEMACPHRQKSSPTYQKMRGD  389

Query  491   LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKD  312
             L+ G V V P G+P   +A+ N   +LQ   F++N R N    L G NN+  +    AK+
Sbjct  390   LRRGAVFVAPAGHPVTTIASRN--NNLQLLCFEVNARDNIMFPLVGKNNVVSQFDRQAKE  447

Query  311   LSFAAGSDKESVNVVFGSQPLELFFKAP  228
             LSF   + +  V  +F +Q  ELFF+ P
Sbjct  448   LSFDVPASE--VESIFNNQKDELFFEGP  473



>ref|XP_009367697.1| PREDICTED: sucrose-binding protein-like [Pyrus x bretschneideri]
Length=481

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 152/388 (39%), Positives = 227/388 (59%), Gaps = 19/388 (5%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ + FET+  + E   ++L +F++RSDL  GI+++R+ FL+ E   FV P H DA+
Sbjct  91    PYFFEDQHFETRVQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDAD  150

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GR ++ V++++ KES N+  GD+ RIP GT  YI+N D  ++  L    L+++
Sbjct  151   CVLFVFQGRPTITVVKEEKKESHNLERGDLFRIPAGTPFYILNRDENER--LHIVKLLKT  208

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG ++ F  A G+ P SFF  FS E L+AA  T    + R LFG+ Q  G  ++ ++
Sbjct  209   VSTPGEYEAFYSAGGQDPESFFKAFSPEVLQAAFKTDRNKLDR-LFGQ-QRRGSIIRASK  266

Query  818   EQLRSLSQEGDEGGIR-----PFRGDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFKP  657
             EQ++ +SQ+   GG       PF G E+S   S N+F  H +  N++G ++E     FK 
Sbjct  267   EQVQRMSQQHGHGGSEGIWPLPFHGGESSSKDSFNLFKKHASQENKFGRLFEADFKDFKQ  326

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----YQTVRSK  492
             L E D+  +F NIT G M GPFFNSRAT+++VVL+GEG  EM CP        YQ +   
Sbjct  327   LQEFDLLVSFANITRGAMEGPFFNSRATKISVVLDGEGHFEMACPHRQKSSPTYQKMSGD  386

Query  491   LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKD  312
             L+ G V V P G+P   +A+ N   +LQ   F++N R N R  L G NN+  +    AK+
Sbjct  387   LRRGAVFVAPAGHPVTIIASRN--NNLQLLCFEVNARDNIRFPLVGKNNVVSQFDRQAKE  444

Query  311   LSFAAGSDKESVNVVFGSQPLELFFKAP  228
             LSF   + +  V  +F +Q  ELFF+ P
Sbjct  445   LSFNVPASE--VESIFNNQKDELFFEGP  470



>gb|AAL86739.1|AF441864_1 48-kDa glycoprotein precursor [Corylus avellana]
Length=448

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 234/386 (61%), Gaps = 22/386 (6%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VFQ E FE++  + E   ++L  F+ RS L  GI+++RLA L     TF+ P H DAE
Sbjct  61    PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAE  120

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI-LIR  1002
              +  V  GR ++ ++R++ +ESFN+  GD++RIP GT  Y++N D  +K+   F + +++
Sbjct  121   LVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKL---FIVKILQ  177

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              +S PG F+ F GA G+ P SF+  FS E LEAAL  + E +++V FGE Q +G  +K +
Sbjct  178   PVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-FGE-QSKGSIVKAS  235

Query  821   EEQLRSLSQEGDEGGIR--PFRGDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFKPLD  651
              E++R+LSQ  +EG  R  PF G+ +     IN+   H + SNQ+G +YE      K L 
Sbjct  236   REKIRALSQH-EEGPPRIWPFGGESSG---PINLLHKHPSQSNQFGRLYEAHPDDHKQLQ  291

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----KNNYQTVRSKLK  486
             ++D+  +F NIT+G M GP++NSRAT+++VV+EGEG+ EM CP       +YQ + ++L+
Sbjct  292   DLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLR  351

Query  485   TGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLS  306
              G+V V P G+P   +A+ N   +LQ   F++N  GN R  LAG  N+  +    AK+L+
Sbjct  352   RGVVFVAPAGHPVAVIASQN--NNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELA  409

Query  305   FAAGSDKESVNVVFGSQPLELFFKAP  228
             F   S +  V  +F +Q    FF  P
Sbjct  410   FNLPSRE--VERIFKNQDQAFFFPGP  433



>ref|XP_010054529.1| PREDICTED: sucrose-binding protein-like [Eucalyptus grandis]
 gb|KCW76785.1| hypothetical protein EUGRSUZ_D01140 [Eucalyptus grandis]
Length=566

 Score =   276 bits (707),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 155/402 (39%), Positives = 236/402 (59%), Gaps = 34/402 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF RE F+    +      +LP+F+ RS L  GI+++RLA L  E  TF VP+H D +
Sbjct  161   PYVFDREHFKAIVETEHGRVSVLPKFTKRSKLLRGIENFRLALLEAEPNTFEVPSHWDTD  220

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  +V GRG++ ++RQ+ ++S NI EGD++R+  GT  Y++N D  +K+ +    L+R 
Sbjct  221   AVLFIVEGRGTITLVRQNKRQSINIEEGDIVRVEAGTPVYMINRDQNQKLIIA--QLLRP  278

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ P +F+ F G  G+ P SF+  FS E LEAAL T    ++R LFG+ Q++G  +K + 
Sbjct  279   VNLPSQFEAFYGTGGQNPESFYTAFSWEVLEAALKTDRNKLER-LFGQ-QQQGAIVKASR  336

Query  818   EQLRSLSQEGDEGGIRPFRGDET--SK-NRSINVF-PHKTVSNQYGVIYEVGTTHFKPLD  651
             EQ+ +LS   +EGG  PF G E+  SK +RS N+F  H + +NQ+G +Y      FK L+
Sbjct  337   EQIEALSGH-EEGGRWPFGGGESHGSKGSRSFNLFNKHPSHANQHGQLYIADRDDFKELE  395

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------------  519
             ++DV  +F NIT+G M+GP++NSRAT+++ V EGEG+LEMGCP                 
Sbjct  396   DMDVMISFANITQGSMIGPYYNSRATKISFVTEGEGYLEMGCPHLSSSRSKHSRHQKQQG  455

Query  518   -----NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
                    YQ VR++L+ G   ++P G+P   +A+ N   +LQ   F++N   N R  LAG
Sbjct  456   GGGGGRTYQKVRAQLRRGTAFIVPAGHPVAAIASKNS--NLQIACFEVNAENNVRYPLAG  513

Query  353   TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               N+   +   AK+L+F   S    V+ +F SQ  E FF  P
Sbjct  514   KRNIIDLMEREAKELAFNFPS--RDVDRIFKSQDEEFFFAGP  553



>gb|KDO68672.1| hypothetical protein CISIN_1g040805mg [Citrus sinensis]
Length=540

 Score =   273 bits (698),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/376 (38%), Positives = 230/376 (61%), Gaps = 32/376 (9%)
 Frame = -2

Query  1292  LPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLGRGSVAVIRQDGKES  1113
             LP+F+ RS L  G++ YRL  L+   QTFV P H DA+ +  V  G+G++ VIR++ +ES
Sbjct  163   LPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRES  222

Query  1112  FNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQFFSGAAGKKPVSFF  933
             +N+  GD++R+P G T Y+ NTD+ +K+ +  F  I+SI+ PG+++ F GA G+ P SF 
Sbjct  223   YNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKF--IKSINLPGQYEAFYGAGGENPESFL  280

Query  932   NGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDE  753
               FS E LE+A  TK ++++RVLF   Q++G  +K +++Q+R+LS+  +   I PF G+ 
Sbjct  281   RAFSWEILESAFKTKRDSLERVLF--QQDQGAMVKASKQQIRALSRSQEGPSIWPFAGES  338

Query  752   TSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRA  576
                  + N+F  + + SN +G ++E  +  F+PL+++D+  ++ NI++G M  PF+NSR+
Sbjct  339   RG---TFNLFGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFYNSRS  395

Query  575   TQVAVVLEGEGWLEMGCP--------------------KNNYQTVRSKLKTGMVVVIPPG  456
             T+VAVV+ G+G++E+ CP                       Y  V S+++T    ++P G
Sbjct  396   TKVAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYIVPAG  455

Query  455   YPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESV  276
             +P V VA+ N   +L+   F+IN  GN R  LAG N +F  + + AK+L+F   +D+  V
Sbjct  456   HPVVTVASQN--NNLEVVCFEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADE--V  511

Query  275   NVVFGSQPLELFFKAP  228
               VFG+Q  + FFK P
Sbjct  512   ERVFGNQDQDWFFKGP  527



>ref|XP_006444033.1| hypothetical protein CICLE_v10024281mg [Citrus clementina]
 gb|ESR57273.1| hypothetical protein CICLE_v10024281mg [Citrus clementina]
Length=540

 Score =   271 bits (694),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/376 (37%), Positives = 229/376 (61%), Gaps = 32/376 (9%)
 Frame = -2

Query  1292  LPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLGRGSVAVIRQDGKES  1113
             LP+F+ RS L  G++ YRL  L+   QTFV P H DA+ +  V  G+G++ VIR++ +ES
Sbjct  163   LPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRES  222

Query  1112  FNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQFFSGAAGKKPVSFF  933
             +N+  GD++R+P G T Y+ NTD+ +K+ +  F  I+SI+ PG+++ F GA G+ P SF 
Sbjct  223   YNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKF--IKSINLPGQYEAFYGAGGENPESFL  280

Query  932   NGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDE  753
               FS E LE+A  TK ++++RVLF   Q++G  +K +++Q+R+LS+  +   I PF G+ 
Sbjct  281   RAFSWEILESAFKTKRDSLERVLF--QQDQGAMVKASKQQIRALSRSQEGPSIWPFAGES  338

Query  752   TSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRA  576
                  + N+F  + + SN +G ++E  +  F+PL+++D+  ++ NI++G M  PF+NSR+
Sbjct  339   RG---TFNLFGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFYNSRS  395

Query  575   TQVAVVLEGEGWLEMGCP--------------------KNNYQTVRSKLKTGMVVVIPPG  456
             T+ AVV+ G+G++E+ CP                       Y  V S+++T    ++P G
Sbjct  396   TKAAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYIVPAG  455

Query  455   YPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESV  276
             +P V VA+ N   +L+   F+IN  GN R  LAG N +F  + + AK+L+F   +D+  V
Sbjct  456   HPVVTVASQN--NNLEVVCFEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADE--V  511

Query  275   NVVFGSQPLELFFKAP  228
               VFG+Q  + FFK P
Sbjct  512   ERVFGNQDQDWFFKGP  527



>ref|XP_009417381.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/397 (38%), Positives = 226/397 (57%), Gaps = 32/397 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F    +E  + S    F++L RFS RS+L  GI++YRLA +  E +TF++P+H DAE
Sbjct  30    PYYFGERSYEHWSRSEHGRFKVLERFSRRSELLIGIENYRLAIMEAEPETFIMPSHWDAE  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V+ GRG++ ++ ++ +ES  I  GD++RIP G   Y +N    K   L   +L+  
Sbjct  90    EVFYVMEGRGTITLLHEENRESHEIKRGDIMRIPAGVIVYAIN--KAKNERLHIAMLLHP  147

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG F+ F GAAG  P SF+N FS   LEAA NT  + ++R+   E Q++G  +K+TE
Sbjct  148   ISTPGHFEEFFGAAGSNPESFYNSFSNGVLEAAFNTPRDRLERLF--ERQKKGEIIKITE  205

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R+LSQ    GG R         N   N+   + + +N+YG +YE  ++ +  L ++D
Sbjct  206   EQIRALSQTTGFGGGR----HSARSNEPYNLLQKRPSHANEYGELYEARSSDYHRLQDLD  261

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----------------  513
             V+ +  NI+E  M+ P +NSRAT++A+V+EG G  EM CP+ +                 
Sbjct  262   VDVSIANISERSMMAPSYNSRATKLAMVVEGRGHFEMVCPRRSGDSRRSEDATEPEGQQR  321

Query  512   --YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLF  339
               Y+TVRS++  G V VIPPG+P   VA +N  ++L+   F I    N +  LAG NN+ 
Sbjct  322   VRYRTVRSEVSRGSVFVIPPGHPVTAVAAAN--ENLEVLCFGIRAGRNRKCYLAGKNNVM  379

Query  338   LKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               L   AK LSF  G+  E V  VF +QP  +F   P
Sbjct  380   NLLDREAKQLSF--GAPAEEVQEVFDAQPESVFLPGP  414



>ref|XP_008235388.1| PREDICTED: sucrose-binding protein-like [Prunus mume]
Length=508

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 148/405 (37%), Positives = 237/405 (59%), Gaps = 37/405 (9%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q P+ F+ E FET+  + E  F++L +F++RSDL   I++YR+ FL+ +   FV P+H D
Sbjct  104   QNPYFFEDEHFETRVQTEEGRFQLLQKFTERSDLLRAIENYRIGFLVTKPHAFVAPSHFD  163

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL-  1008
             A+ +  V  GR +V ++R + +E+ N+  GD+ RIP GT  Y+VN D  +K+    FI+ 
Sbjct  164   ADTVLFVFQGRPAVTIVRGEKRETHNLERGDLFRIPAGTPVYMVNRDENEKL----FIVN  219

Query  1007  -IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFL  831
              ++ +S PG ++ F  A G+ P SFF  FS + L+AAL T+   ++R LFG+ Q +G   
Sbjct  220   FMKPVSVPGEYEAFYAAGGENPESFFKAFSPQVLQAALKTEMNKLER-LFGQ-QRQGSIT  277

Query  830   KVTEEQLRSLSQEGDEGGIR---PFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHF  663
             + ++EQ++ LSQ+  +GG     PF G ++S + + N+F  H + +N++G ++E     F
Sbjct  278   RASKEQIKKLSQQHGQGGSEGFWPFHGGQSSSD-AFNLFSKHPSQANKFGRLFEADFNDF  336

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN----------  513
             K L ++D+  +F NIT+G M+GPFFNSRAT+++ VL+GEG+ EM CP  +          
Sbjct  337   KQLQDLDLLVSFANITQGAMVGPFFNSRATKISFVLDGEGYFEMACPHVSSTGRQEQQPQ  396

Query  512   ----------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
                       YQ +   L+ G V V P G+P   +A+ N   +LQ   F++N   N RV 
Sbjct  397   PQQRQKSSPRYQKISGNLRRGAVFVAPAGHPMTAIASRN--SNLQIICFEVNAHDNIRVP  454

Query  362   LAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             LAG  N+  +    AK+L+F   +    V+ +F +Q  E FF+ P
Sbjct  455   LAGKKNVVSQFDREAKELAFNVPA--REVDRIFNNQDDEFFFEGP  497



>gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occidentale]
Length=538

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/385 (37%), Positives = 234/385 (61%), Gaps = 18/385 (5%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ E+F T+  + +    +LP+F+ +S L   ++ YRLA L+   Q FVVP+H DA+
Sbjct  152   PYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDAD  211

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  I ++ +ES N+ +GD++ I  GT  YI N D  +K+ L  F  +R 
Sbjct  212   SIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQF--LRP  269

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG F+ F G  G+ P SF+  FS E LEAAL T  +T++++   E Q++G  +K ++
Sbjct  270   VNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLF--EKQDQGTIMKASK  327

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             EQ+R++S+ G+   I PF  + T   +     P +  SN+YG ++E     + PL+++D+
Sbjct  328   EQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ--SNKYGQLFEAERIDYPPLEKLDM  385

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------NNYQTVRSKLKT  483
               ++ NIT+GGM  PF+NSRAT++A+V+ GEG +E+ CP          +Y+ +R++++ 
Sbjct  386   VVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKKLRARIRK  445

Query  482   GMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSF  303
               V ++P G+P+  VA+ N  ++L+   F++N  GN R TLAG  N+   +   AK+L+F
Sbjct  446   DTVFIVPAGHPFATVASGN--ENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAF  503

Query  302   AAGSDKESVNVVFGSQPLELFFKAP  228
                 + E V+ VFG Q  E FF+ P
Sbjct  504   KM--EGEEVDKVFGKQDEEFFFQGP  526



>gb|KHG24948.1| Vicilin-like antimicrobial peptides 2-1 [Gossypium arboreum]
Length=542

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/399 (38%), Positives = 239/399 (60%), Gaps = 32/399 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ + F T   +G+    +L +F+  SD+  GI++YRLA L+   ++FVVPNH DA 
Sbjct  145   PYVFEDKHFSTAIKTGKGRVDLLTKFTHNSDILRGIENYRLALLVASPKSFVVPNHFDAN  204

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI-LIR  1002
              I  V  GRG++ +I +D +ESFNI  GD++ +  GT  Y++N D+ +K+   F + L++
Sbjct  205   AIFVVTQGRGTLTLIHEDKRESFNIETGDIIYVRAGTPLYLINRDDDEKL---FIVKLLQ  261

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              I+ P  ++ F GA G KP SF+  FS E LEAAL T  + +++  F + Q +GPFL+ +
Sbjct  262   PINQPDHYEVFYGAGGAKPESFYETFSTEILEAALKTSRDKLEK--FFDKQGKGPFLEAS  319

Query  821   EEQLRSLS--QEGDE-GGIRPFRGDETSKNRSINVFPHKTVS--NQYGVIYEVGTTHFKP  657
             +EQ+ ++S  +EG + GG+ PF G E+    + N+F  +  S  N+YG ++EV    FK 
Sbjct  320   KEQIEAMSSHEEGSKGGGLWPF-GSESKSESAFNLFRKRQPSHCNRYGQLFEVEEDEFKR  378

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------  519
             L + D+  ++VNIT+G M  PF+NSRA ++A+V++GEG+ EM  P               
Sbjct  379   LKDFDLRVSYVNITKGCMSAPFYNSRAIKIAIVVKGEGYFEMVSPPVSPKSSQEDSAGRK  438

Query  518   --NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
               + YQ + S+L++  V V+P G+P+V VA+ N   +L+   F++N   N R  LAG  N
Sbjct  439   SGSRYQKISSRLRSDTVFVVPAGHPFVTVASRN--NNLEILCFEVNIENNVRYLLAGEGN  496

Query  344   LFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                +    AK+L+F   S +E V+ +FG+Q  E FF  P
Sbjct  497   YVQQFEKEAKELAFK--SKEEEVDRIFGNQDEEFFFPGP  533



>gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occidentale]
Length=536

 Score =   266 bits (681),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/385 (37%), Positives = 234/385 (61%), Gaps = 18/385 (5%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ E+F T+  + +    +LP+F+ +S L   ++ YRLA L+   Q FVVP+H DA+
Sbjct  150   PYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDAD  209

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  I ++ +ES N+ +GD++ I  GT  YI N D  +K+ L  F  +R 
Sbjct  210   SIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQF--LRP  267

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG F+ F G  G+ P SF+  FS E LEAAL T  +T++++   E Q++G  +K ++
Sbjct  268   VNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLF--EKQDQGTIMKASK  325

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             EQ+R++S+ G+   I PF  + T   +     P +  SN+YG ++E     + PL+++D+
Sbjct  326   EQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ--SNKYGQLFEAERIDYPPLEKLDM  383

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------NNYQTVRSKLKT  483
               ++ NIT+GGM  PF+NSRAT++A+V+ GEG +E+ CP          +Y+ +R++++ 
Sbjct  384   VVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKKLRARIRK  443

Query  482   GMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSF  303
               V ++P G+P+  VA+ N  ++L+   F++N  GN R TLAG  N+   +   AK+L+F
Sbjct  444   DTVFIVPAGHPFATVASGN--ENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAF  501

Query  302   AAGSDKESVNVVFGSQPLELFFKAP  228
                 + E V+ VFG Q  E FF+ P
Sbjct  502   KM--EGEEVDKVFGKQDEEFFFQGP  524



>ref|XP_003632318.2| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Vitis vinifera]
Length=843

 Score =   273 bits (697),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 150/403 (37%), Positives = 232/403 (58%), Gaps = 35/403 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VFQ + +     + E   ++L RF  RS L  G+K+YR  +L    QTFV+P H DAE
Sbjct  162   PYVFQDQHYTASLETNEGRIKILQRFHQRSRLLRGLKNYRFVYLEANPQTFVLPAHLDAE  221

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+++++ Q  +ESFNI +GD++RI  GTT Y++N D  KK  L    L++ 
Sbjct  222   AVVYVASGRGTLSLVSQGKRESFNIKQGDIVRIRAGTTIYMINRDKNKK--LRIAKLLQP  279

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ P  FQ F G AG+ P SF+  FS E L +AL  + + +QRV+  + Q +G  +K +E
Sbjct  280   VALPDEFQPFYGPAGENPQSFYRAFSEELLSSALKVEQDRVQRVI--KQQNKGVIVKASE  337

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             +Q+++LSQ  +E G+ PF    T   R  N+   + ++SN+YG ++E     F+ L ++D
Sbjct  338   QQIQALSQR-EESGMFPFPFGSTESKRVFNLLSKEPSISNRYGRLHEADANEFQQLQDMD  396

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
             +  ++ NIT+G M GPFFN+RAT++AVV++GEG++EM CP                    
Sbjct  397   IAVSYSNITKGSMEGPFFNTRATKIAVVVKGEGYMEMACPHVSQQQQGQGQSTGEQRREQ  456

Query  518   ------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                    +YQ + S LK GM+ V+P G+P + VA +N  ++L+   FD+N   N R +LA
Sbjct  457   QQQSASPHYQRLSSPLKRGMLFVVPAGHPLIVVAGNN--RNLEIVCFDVNAENNRRESLA  514

Query  356   GTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             G  N+   L   AK+L+F+  +    V+ VF  Q    FF  P
Sbjct  515   GDKNIVNALEKEAKELAFSIPA--REVDEVFAKQNEWWFFPGP  555



>ref|XP_010679084.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=551

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/405 (37%), Positives = 229/405 (57%), Gaps = 38/405 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+   F T+  S E   ++L +F+ RS LF+GI++YR+       QTFVVPNH DA+
Sbjct  145   PYVFEDHHFSTKFKSKEGRVKVLKKFNKRSKLFKGIQNYRVIIFEANPQTFVVPNHWDAD  204

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G+V+++  D ++SFNI  G V+ IP G T Y++N  N  K+ L    LI  
Sbjct  205   SVFFVAQGEGTVSLVYTDRRDSFNIKRGHVMVIPAGVTAYLINRGNNDKLVL--VKLINP  262

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +S PG+F+ F G  G+ P SFFN FS + L AA  T  + ++R+     Q EG  ++ +E
Sbjct  263   VSNPGKFESFFGPGGENPESFFNAFSTDILGAAFKTSGDKVKRIF--SQQHEGAIIRASE  320

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R+L+ E  + G  PF G  + ++   N+       SN++G ++EV +  ++ L +++
Sbjct  321   EQIRALTHE--KSGHWPFGGKGSKESGPFNLLKQSPRESNEFGTLFEVDSNDYRQLRDLN  378

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN------------------  516
             +  +F NIT+G M  P +NSRAT++AVVL G G+ EM CP                    
Sbjct  379   IALSFANITQGSMHTPLYNSRATKIAVVLNGRGYFEMACPHVSKSGHQQHRHRQHGGKSS  438

Query  515   ---------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
                      +Y+ + S+L+ GMV V+PPG+P+V +A+ N  ++L+   F+IN   N +  
Sbjct  439   RGEEETTPIHYEKIFSELRQGMVFVVPPGHPFVTLASEN--ENLELICFEINAENNHKFP  496

Query  362   LAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             LAG  N+       AK+L+FA  S  E V+ VF +Q  + FFK P
Sbjct  497   LAGQRNIMKNFEREAKELAFA--SSAEVVDQVFENQEEDFFFKGP  539



>ref|XP_007200965.1| hypothetical protein PRUPE_ppa004438mg [Prunus persica]
 gb|EMJ02164.1| hypothetical protein PRUPE_ppa004438mg [Prunus persica]
Length=510

 Score =   263 bits (671),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/407 (36%), Positives = 233/407 (57%), Gaps = 39/407 (10%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q P+ F+ E FET+  + E  F++L +F++RSDL   I++YR+ FL+ +   FV P H D
Sbjct  104   QNPYFFEDEHFETRVQTEEGRFQLLQKFTERSDLLRAIENYRIGFLVTKPHAFVAPCHFD  163

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL-  1008
             A+ +  V  GR +V ++R + +E+ N+  GD+ RIP GT  Y+VN D  +K+    FI+ 
Sbjct  164   ADTVLFVFQGRPAVTIVRGEKRETHNLEHGDLFRIPAGTPVYMVNRDENEKL----FIVN  219

Query  1007  -IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFL  831
              ++ +S PG ++ F  A G+ P SFF  FS + L+AAL T+   ++R LFG+ Q +G   
Sbjct  220   FMKPVSVPGEYEAFYAAGGENPESFFKAFSPQVLQAALKTEINKLER-LFGQ-QRQGSIT  277

Query  830   KVTEEQLRSLSQEGDEGGIR---PFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHF  663
             + ++EQ++ LSQ+  +GG     PF G ++S + + N+F  H + +N++G ++E     F
Sbjct  278   RASKEQIKKLSQQHGQGGSEGFWPFHGGQSSSD-AFNLFSKHPSQANKFGRLFEADFNDF  336

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------  519
             K L ++D+  +F NIT+G M+GP+FNSRAT+++ VL+GEG+ EM CP             
Sbjct  337   KQLQDLDLLVSFANITQGAMVGPYFNSRATKISFVLDGEGYFEMACPHVSSTGRQEPQPQ  396

Query  518   ----------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                         YQ +   L+ G V V P G+P   +A+ N   +LQ   F++N   N R
Sbjct  397   PQPQQRRKSSPRYQKISGNLRRGAVFVAPAGHPMTAIASRN--SNLQIICFEVNAHDNIR  454

Query  368   VTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             V L G  N+  +    AK L+F   +    V+ +F +Q  E FF+ P
Sbjct  455   VPLVGKKNVVSQFDREAKQLAFNVPA--REVDRIFNNQDDEFFFEGP  499



>ref|XP_009370838.1| PREDICTED: sucrose-binding protein-like [Pyrus x bretschneideri]
Length=476

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 151/393 (38%), Positives = 226/393 (58%), Gaps = 20/393 (5%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ + FET+  + E   ++L +F++RSDL  GI+++R+ FL+ E   FV P H DA+
Sbjct  85    PYFFEDQHFETRIQTEEGSVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVSPTHLDAD  144

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  G  ++ ++R + KES N+  GD+ RIP GT  Y++N D  +K  L    L ++
Sbjct  145   SILFVFQGGPTITMVRGEKKESHNLERGDLFRIPAGTPFYVLNRDENEK--LHIVELFKT  202

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG +  F  + G+ P SFF  FS E L+AA  T    + R LFG+ Q  G  ++ ++
Sbjct  203   VSTPGEYASFHSSGGQDPESFFRAFSPEVLQAAFKTDRNKLDR-LFGQ-QRRGSIIRASK  260

Query  818   EQLRSLSQEGDEGGIR-----PFR-GDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFK  660
             EQ++ +SQ+   GG       PF  GDE+S   S N+F  H +  N++G ++E     FK
Sbjct  261   EQVQRMSQQHGHGGGEGIWPLPFHGGDESSSKDSFNLFKKHPSHENKFGRLFEADFNDFK  320

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----YQTVRS  495
              L E ++  +F NIT GGM GP+FNSRAT+++VVL+GEG+ EM CP        YQ +  
Sbjct  321   QLQEFNLVVSFANITRGGMAGPYFNSRATKISVVLDGEGYFEMACPHRQKSSPTYQKMSG  380

Query  494   KLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAK  315
              L+ G V V P G+P   +A+ N   +LQ   F++N   N R  L G NN+  +    AK
Sbjct  381   DLRRGAVFVAPAGHPVTTIASRN--NNLQVLCFEVNAHDNIRFPLVGKNNVVSQFDRQAK  438

Query  314   DLSFAAGSDKESVNVVFGSQPLELFFKAPPSSL  216
             +LSF   + +  V  +F +Q  ELFF+ P   L
Sbjct  439   ELSFNVPASE--VESIFNNQKDELFFEGPNDQL  469



>ref|XP_010256229.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=542

 Score =   258 bits (658),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 228/406 (56%), Gaps = 37/406 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F  + F+T+  + E   ++L RFS+R +   GI+ YRLA +     TFV P HEDA+
Sbjct  133   PYLFDEKSFKTRFQTEEGNIKVLERFSERLEFLRGIESYRLAIIKASPNTFVTPCHEDAD  192

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG + ++R D +ESF I +GDV+ IP GT  Y +N DN +K+ +   +L   
Sbjct  193   VVFFVTWGRGVITLVRNDNRESFKIQKGDVMMIPAGTVVYFINNDNHEKLFIAKLLL--P  250

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG F+ F G  G+ P SF+  FS E LEAALN + + ++R+L    Q++G  +K ++
Sbjct  251   ISTPGHFEAFFGPGGENPESFYRAFSTEVLEAALNVRKDKLKRLL--GRQDKGVIIKASD  308

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ++SLSQ     G + +  D+       N+F  + + SN YG  YEV    FK L  +D
Sbjct  309   EQIKSLSQHASSRGGQFWPFDKRETKGPFNLFNKRPSQSNNYGQFYEVKPGEFKQLQGLD  368

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
             +  +F+NI+ G M GP++NSRAT+VAVV+EG G+ EM CP                    
Sbjct  369   IAVSFLNISSGAMSGPYYNSRATKVAVVIEGNGYYEMACPHSSSSSGGRHGGSEGGSSSR  428

Query  518   -NNYQT---VRSKLKTGM-----VVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERV  366
              +++Q    VR +  +G      V ++P G+P V VA+S   ++LQ   F+I G  NE+ 
Sbjct  429   FHHHQDQGGVRYRKMSGFLAPESVFLVPAGHPVVTVASS--GQNLQIVCFEIKGEKNEKY  486

Query  365   TLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              +AG NN+   L   AK+LS+   +  + V+ +   Q   LFF  P
Sbjct  487   MVAGENNIIKYLEKEAKELSYNIPA--KEVDEILSKQSESLFFPGP  530



>ref|XP_009417380.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=483

 Score =   256 bits (653),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 144/397 (36%), Positives = 226/397 (57%), Gaps = 33/397 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F    +E  + S    F +L RF+ RS+L  G+++YRLA +  E +TF++P H DAE
Sbjct  77    PYFFGDRSYEQWSRSEHGRFEVLERFARRSELLVGVENYRLAVMEAEPETFIMPRHWDAE  136

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V+ GRG++ ++ ++ +E+ +I  GD++ IP G   Y +N    +K  L   IL+  
Sbjct  137   EVFYVMEGRGTITLLHENNRETHDIKRGDIIWIPAGAIVYAINKARNEK--LRVAILLHP  194

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG  + F GAAG+ P +FF  FS E LEAA +T  E ++R+   E Q  G F+K+TE
Sbjct  195   ISTPGHVEEFYGAAGRNPETFFASFSDEVLEAAFDTPSEKLERLF--EKQRRGEFIKMTE  252

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R+LSQ   EGG    R  E       N+  ++ + SN++G ++EVG   ++ L ++D
Sbjct  253   EQMRALSQSTGEGGWPLARSTEP-----YNLLQNRPSHSNEHGQLHEVGANEYQQLQDLD  307

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----------------  513
             V+ +  NI+E  M+ P +NS +T++A+V++G G++EM CP  +                 
Sbjct  308   VDVSIANISERSMMAPNYNSLSTKLAMVVQGRGYIEMACPSRSGESRRSEETTESEPQQR  367

Query  512   --YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLF  339
               Y+TVRS++  G V VIP G+P   VA  N  ++L+  +F +    N    LAG NN+ 
Sbjct  368   VLYRTVRSRVSRGSVFVIPAGHPVAAVAARN--ENLEVLFFGVRAAQNRNYYLAGRNNVL  425

Query  338   LKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              +L   AK+L+F  G   E V+ V  +QP  +F   P
Sbjct  426   NRLDREAKELAF--GVPAEEVDEVLHAQPESVFLPGP  460



>ref|XP_008355465.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=490

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 227/409 (56%), Gaps = 36/409 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ + FET+  + E   ++L +F++RSDL  GI+++R+ FL+ E   FV P H DA+
Sbjct  83    PYFFEDQHFETRIQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDAD  142

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GR ++  +R + KES N+  GD+ RIP GT  Y++N D  +K  L    L ++
Sbjct  143   SILFVFQGRPTIXTVRGEKKESXNLERGDLFRIPAGTPFYVLNRDENEK--LHIVELFKT  200

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG +  F  A G+ P SFF  FS E L+AA  T    + R LFG+ +  G  ++ ++
Sbjct  201   VSTPGEYAAFHSAGGQDPESFFRAFSPEVLQAAFKTDRNKLDR-LFGQXR-RGSIIRASK  258

Query  818   EQLRSLSQEGDEGGIR-----PFR-GDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFK  660
             EQ++ +SQ+   GG +     PF  GDE+S   S N+F  H +  N++G ++E     FK
Sbjct  259   EQVQRMSQQHGHGGGKGIWPLPFHGGDESSSKDSFNLFKKHPSHENKFGRLFEADFNDFK  318

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----------  513
              L E ++  +F NIT GGM GP+FNSRAT+++VVL+GEG+ EM CP  +           
Sbjct  319   QLQEFNLVVSFANITRGGMAGPYFNSRATKISVVLDGEGYFEMACPHXDSRGRQRQSSGR  378

Query  512   ----------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
                       YQ +   L+ G V V P G+P   +A+ N    LQ   F++N   N R  
Sbjct  379   SQQRQKSSPTYQXMSGDLRRGAVFVAPAGHPXTTIASRN--NXLQVLCFEVNAHDNIRFP  436

Query  362   LAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSSL  216
             L G NN+  +    AK+LSF   + +  V  +F +Q  ELFF+ P   L
Sbjct  437   LVGKNNVVSQFDRQAKELSFNVPASE--VESIFNNQKDELFFEGPNDQL  483



>gb|KDP21423.1| hypothetical protein JCGZ_21894 [Jatropha curcas]
Length=514

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/391 (37%), Positives = 225/391 (58%), Gaps = 26/391 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ E F +   +     R+L +F+ RS+L  GIK+YR+  L    QTFV   H DA+
Sbjct  125   PYVFEEEHFTSIIKTEHGRARVLQKFTKRSELLRGIKNYRVGILEANPQTFVSQGHWDAD  184

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG++++I ++ ++SFN+  GDVLRI  GT  Y++N D  +K  L    ++  
Sbjct  185   GVLYVARGRGTISMIIEEKRQSFNVQRGDVLRIRAGTPLYLINRDEKEK--LYVVSVMVP  242

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG F+ FS +  +   SF+  FS E LEAAL T+   ++ +     Q++G  +K + 
Sbjct  243   VNIPGEFEIFSASGTEDSESFYEAFSWELLEAALKTERRRLEHIF---RQKQGAIVKASR  299

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFK-PLDEVD  642
             EQ++++S   + GG+ PF G E+     I++  +    N YG ++EVG+  FK  L ++D
Sbjct  300   EQIQAMSHREEGGGVWPF-GTESIG--PISILKNPVFRNNYGQLFEVGSRDFKQQLRDLD  356

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-------------KNNYQTV  501
             ++ +  NI+ G M GP++NSR T+++VVL+GEG+ EM CP             +  YQ V
Sbjct  357   LSVSVANISRGAMSGPYYNSRVTKISVVLDGEGYFEMACPHLSGSRGDTTGESQKTYQKV  416

Query  500   RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNA  321
              S+LK G  VV+P G+P   VA+ N   +L+   F+IN  GN R  LAG NN+  K+   
Sbjct  417   SSRLKRGTAVVVPAGHPAAFVASRN--NNLEVVCFEINEEGNTRHLLAGKNNIVNKMEKQ  474

Query  320   AKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             AK+L+F  G  +  V+  FG Q  E FF  P
Sbjct  475   AKELAF--GVSEREVDQAFGRQNEEWFFPGP  503



>ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis]
Length=560

 Score =   253 bits (647),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 146/393 (37%), Positives = 225/393 (57%), Gaps = 27/393 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  ++F  +  +      +LPRF+ +S L  GI++YR+  L    QTFV P+H DA+
Sbjct  168   PYVFDTDQFTEKVRTEHGSISVLPRFTKKSKLLRGIENYRVGILKANPQTFVAPSHWDAD  227

Query  1178  FICTVVLGRGSVAVIRQDG-KESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
              +  V  GRG+V +I ++G K SFNI  GDV+R+  GT  Y++N D+ +K  L     I+
Sbjct  228   AVLVVAKGRGTVTLIHEEGEKRSFNIEVGDVMRVRAGTPVYVINRDDNEK--LYIINFIQ  285

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              ++ PG F+ F  A G++  SF+N FS E LEAA  T    I++++    Q++   +K +
Sbjct  286   PVNLPGEFEAFRAAGGREDESFYNAFSWELLEAAFKTDRRRIEQLI---TQKQEAIVKAS  342

Query  821   EEQLRSLSQEGDEGG-IRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVG-TTHFKPLD  651
             +EQ+++++    EGG I PF G+  S     N+   + V SN +G ++E     H + L 
Sbjct  343   KEQIQAMTHRDQEGGTIWPFGGE--SSGAPFNLLHKRPVQSNNHGQLFEARPNDHKEQLQ  400

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------NNYQ  507
             ++D+  +F NIT G M GP +NSRAT++A+V +GEG++EM CP               Y 
Sbjct  401   DLDLMISFANITRGSMAGPLYNSRATKIAIVTQGEGYMEMACPHLSGGSEHQGRKGQTYG  460

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              VRS+L+ G V ++P G+P   VA+  P+ +L    F++N +GN R TLAG NN+  +  
Sbjct  461   RVRSRLRPGTVFIVPAGHPVATVAS--PNNNLAVLCFEVNAQGNIRYTLAGRNNIVRRWE  518

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               AK+L+F  G     V+ VF SQ    FF  P
Sbjct  519   REAKELAF--GVRAREVDEVFESQNEVFFFPGP  549



>ref|XP_004292578.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Fragaria 
vesca subsp. vesca]
Length=512

 Score =   252 bits (644),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/406 (34%), Positives = 233/406 (57%), Gaps = 38/406 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ ++F+T   + +   ++L +F+++SDL  GI ++R+  L+ +  +FV P+H DA+
Sbjct  104   PYLFEDQDFDTIVETDQGRVQILQKFTEKSDLLRGIANFRIGALITKPHSFVAPHHFDAD  163

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI-LIR  1002
              +  V  GR +++++R D +ES N+  GD+LR+P GT  YI+N D  +K+   F + L+ 
Sbjct  164   CVFFVFHGRPTISMVRGDKRESHNLERGDILRVPAGTPVYIINRDENEKL---FVVKLLH  220

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              ++ P +F+ F    G+ P SFF  FS E LEAA  T+ + ++R LFG+ Q +G  +K +
Sbjct  221   PVNLPDQFEAFYEGGGENPQSFFKAFSPEVLEAAFKTERDELRR-LFGQ-QRQGSIMKAS  278

Query  821   EEQLRSLSQEGDEG-GIRPFRGDE-------TSKNRSINVFPHK-TVSNQYGVIYEVGTT  669
              EQ+  +S       G+ PF GD+       +SK+   N+   + + SN++G ++E  ++
Sbjct  279   REQIEKMSHSSRSSEGLWPFHGDQPSTPFSTSSKSGPFNLLRKRPSQSNRHGRLFEADSS  338

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----------  522
              +K L+E+D+  +F NIT G M+ PFFNSRAT+++ VL+GEG+ EM CP           
Sbjct  339   DYKQLEELDLQISFANITRGSMIAPFFNSRATKISFVLDGEGFFEMACPHLASQESSQGG  398

Query  521   --------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERV  366
                       +YQ VR  L+ G V ++P G+P   +A+ N   +LQ   F++N + N R+
Sbjct  399   SQRQQRSSSPSYQNVRGDLRRGTVFIVPAGHPATAIASRN--NNLQILCFEVNAKDNVRL  456

Query  365   TLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              L G  N+  +    AK+L+F  G     V+ +F  Q  E F + P
Sbjct  457   PLTGKKNVVSQFEREAKELAF--GVPGREVDRIFNKQDGEFFLEGP  500



>ref|XP_010086607.1| Sucrose-binding protein [Morus notabilis]
 gb|EXB22118.1| Sucrose-binding protein [Morus notabilis]
Length=501

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 225/404 (56%), Gaps = 39/404 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ E F+T   + E    +L +F++RS L +GI++YR+ FL      FV P H DA+
Sbjct  98    PYLFEAEHFDTSVRTEEGRVHILKKFTERSKLLKGIENYRVGFLEANPHAFVAPVHFDAD  157

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI-LIR  1002
              I  V  GR +V ++R++ +E+FN+  GDV+ IP GT  YIVN D  +K+   F + LI 
Sbjct  158   VIFFVASGRPTVTLLREEKRETFNLERGDVVHIPAGTPAYIVNRDEREKL---FIVNLIN  214

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              +  PG F+ F G  G+ P SF+  FS + L+AA     + I+R LFG+ Q+ G   K +
Sbjct  215   PVYLPGEFESFHGPGGEDPESFYKAFSWKVLKAAFKRDRDEIER-LFGQ-QKRGGITKAS  272

Query  821   EEQLRSLSQEGDEGG----IRPFRGDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFKP  657
              EQ+  LS+  + GG    I PF+G+        N+F  H   SN+YG ++E  T   K 
Sbjct  273   REQVEELSRHAEGGGGGGPIWPFKGETKG---PFNLFRKHPVSSNRYGSLFEANTEDCKD  329

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------  519
             L+++++  +F NIT+G M+ P +NS+AT+++ V++GEGW EM CP               
Sbjct  330   LEDLNLMISFANITKGAMIAPNYNSKATKMSFVVDGEGWFEMACPHTPSEQGRQRGGGSA  389

Query  518   -------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTL  360
                      ++ +  +L+ GMV V+P G+P   +A+ N   +LQ   F++N +GN R  L
Sbjct  390   WQGEKSGKKFKRITGRLRRGMVFVVPAGHPVTAIASQN--TNLQILCFEVNAKGNTRYPL  447

Query  359   AGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             AG  N+   + N AK+L+F  G     V  +F SQ  E FF  P
Sbjct  448   AGRKNIVNNMDNVAKELAF--GVPAREVERIFKSQNEEFFFPGP  489



>ref|XP_009413881.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=433

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/397 (34%), Positives = 220/397 (55%), Gaps = 37/397 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  ++  + +      +L RF+  SD   G+ +YRLA L  E QTF++P H DAE
Sbjct  34    PYYFGRRSYQQWSRTEHGSLEVLERFARTSDQLLGVDNYRLAVLEAEPQTFIMPCHWDAE  93

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V+ GRG++ ++ ++ +ES +I  GD++R+P G   Y +N  + ++  L   +L+  
Sbjct  94    QVVYVMQGRGTITLLHEERRESHDIKRGDIMRVPAGVIVYAINKASNER--LRVAMLLHP  151

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG  + + GAAG+ P +F+  FS E LEAA NT W+ ++RV     Q +G  +K+TE
Sbjct  152   ISTPGHIEEYHGAAGRNPQTFYTSFSNEVLEAAFNTPWDKLERVF--RSQRKGGIIKITE  209

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             +Q+R+LS+   E G+          N   N+  +  + SN++G ++E      + L +++
Sbjct  210   DQIRALSESNTESGL---------SNEPYNLLENSPSHSNEHGQLHEATGNECEMLQDLN  260

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----------------  513
             V+ +  NI+E  M+ P +++R+T++A+V+EG G++EM CP  +                 
Sbjct  261   VDVSIANISERSMMAPNYDTRSTKLAMVVEGRGYIEMACPHRSAERRRTQVETGSQGEQR  320

Query  512   --YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLF  339
               Y+TVRS++  G V VIP G+P   VA +N  ++LQ   F      N R  LAG NN+ 
Sbjct  321   VRYRTVRSRVSRGSVFVIPAGHPAAVVAAAN--ENLQVLCFGTRSENNRRYYLAGRNNVL  378

Query  338   LKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              +L  AAK ++F  G   E V  V  +QP  +F   P
Sbjct  379   NRLDRAAKAMAF--GVPAEEVEEVLNAQPESVFMPGP  413



>ref|XP_008350065.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=524

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/379 (37%), Positives = 211/379 (56%), Gaps = 34/379 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ + FET+  + E   ++L +F++RSDL  GI+++R+ FL+ E   FV P H DA+
Sbjct  96    PYFFEDQHFETRIQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDAD  155

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GR ++  +R + KES N+  GD+ RIP GT  Y++N D  +K  L    L ++
Sbjct  156   SILFVFQGRPTIXTVRGEKKESXNLERGDLFRIPAGTPFYVLNRDENEK--LHIVELFKT  213

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG +  F  A G+ P SFF  FS E L+AA  T    + R LFG+ +  G  ++ ++
Sbjct  214   VSTPGEYAAFHSAGGQDPESFFRAFSPEVLQAAFKTDRNKLDR-LFGQXR-RGSIIRASK  271

Query  818   EQLRSLSQEGDEGGIR-----PFR-GDETSKNRSINVF-PHKTVSNQYGVIYEVGTTHFK  660
             EQ++ +SQ+   GG       PF  GDE+S   S N+F  H +  N++G ++E     FK
Sbjct  272   EQVQRMSQQHGHGGGXGIWPLPFHGGDESSSKDSFNLFKKHPSHENKFGRLFEADFNDFK  331

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----------  513
              L E ++  +F NIT GGM GP+FNSRAT+++VVL+GEG+ EM CP  +           
Sbjct  332   QLQEFNLVVSFANITRGGMAGPYFNSRATKISVVLDGEGYFEMACPHIDSRGRQRQSSGR  391

Query  512   ----------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
                       YQ +   L+ G V V P G+P   +A+ N    LQ   F++N   N R  
Sbjct  392   SQQRQKSSPTYQKMSGDLRRGAVFVAPAGHPVTTIASRN--NHLQVLCFEVNAHDNIRFP  449

Query  362   LAGTNNLFLKLGNAAKDLS  306
             L G NN+  +    AK+LS
Sbjct  450   LVGKNNVVSQFDRQAKELS  468



>emb|CBI28722.3| unnamed protein product [Vitis vinifera]
Length=1361

 Score =   252 bits (644),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 153/393 (39%), Positives = 223/393 (57%), Gaps = 27/393 (7%)
 Frame = -2

Query  1358  PFVFQREEFE-TQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+VF+ + F   +   GE   ++L  F  RS L  G+K+YR   L    QTFVVP H DA
Sbjct  179   PYVFRDQHFAFLRTNQGE--VKILEMFDRRSRLLRGLKNYRFICLEANPQTFVVPTHYDA  236

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E +  V  G+G++ ++ Q  + SF I  GD++RIP G T +++N+   +K+ + +F+L  
Sbjct  237   EIVGFVCSGQGTITMVCQGKRISFRIRIGDIVRIPAGITLHLINSHKNQKLRIAYFLL--  294

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              +  PGRF+ F GAAG+ P SF+  FS + L +A   +  T++RV   + Q +G F+K +
Sbjct  295   PVGIPGRFEPFHGAAGENPQSFYRAFSPKLLSSAFKVEEGTLERVF--QQQTKGHFIKAS  352

Query  821   EEQLRSLS--QEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLD  651
              EQ+++LS  Q G+  GI PF   E SK    N+     +V N YG ++E     F+ L 
Sbjct  353   GEQIQALSGGQHGEAAGIWPFTSGE-SKRPVFNLLNKDPSVCNNYGRLHEADAEDFRQLK  411

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN------------YQ  507
             ++D+  ++ NIT+ GM+GPFFNSR+T VA VLEGEG+LEM CP  +            YQ
Sbjct  412   DMDIEISYANITQEGMMGPFFNSRSTMVAAVLEGEGYLEMVCPHLSGEKQQQQGASPIYQ  471

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              V S L+ G + V+P G+P   VA +  S +L+   F IN   N R  LAG  N+   L 
Sbjct  472   KVSSSLRRGTLFVVPAGHPIAIVAGT--SWNLEIVCFGINAENNRREPLAGKGNVVNGLE  529

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               AK+L+FA  +    V+ VF  Q  ELFF  P
Sbjct  530   KEAKELAFALPA--REVDKVFRKQKEELFFPGP  560



>gb|EYU41459.1| hypothetical protein MIMGU_mgv1a003361mg [Erythranthe guttata]
Length=590

 Score =   243 bits (620),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 139/403 (34%), Positives = 229/403 (57%), Gaps = 33/403 (8%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q P+ F  + F+++  + +   ++L RFS  SDL +GI++YRLA L     TFV+P+H D
Sbjct  178   QNPYFFDSQRFDSKYRTEQGHIKILERFSKNSDLLQGIENYRLAILEANPNTFVLPHHCD  237

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             AE +  VV GRG+++ + +  ++S+N+  G VL +P G+  Y+ N D+ ++  L    L+
Sbjct  238   AESVFLVVGGRGTISYVWEKQRKSYNLKSGGVLWVPAGSIVYLTNNDDNER--LYILKLL  295

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
             + ++TPG+F+ + G  G+ P SF++ FS E LEAA NT+ E +QR LFG+ Q +G  +K 
Sbjct  296   QPVNTPGKFKEYFGVGGENPESFYSSFSNEILEAAFNTQSEKLQR-LFGQ-QSKGVIIKA  353

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDE  648
             ++EQ+R+LSQE  E   R  R  E+S    I++   + V SN++G  +E    H++ L +
Sbjct  354   SKEQIRALSQE-SESSPRGRREKESSSWGPIDLLNERPVFSNEFGQYFEASPNHYQQLRD  412

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----------------  519
             +DV+   VNIT+G M+ P++NS++T++  V+ G G+ EM CP                  
Sbjct  413   LDVSVLLVNITKGAMVAPYYNSKSTRLVFVVGGSGYFEMACPHLANAKGKHGSQGRKERQ  472

Query  518   ------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                    +YQ V ++L  G   V+P G+P   VA+ +   +LQ   F I    N++  LA
Sbjct  473   GEIITDVHYQKVSARLSVGDAFVVPAGHPIAIVASQDS--NLQLAGFGIKASHNQKYFLA  530

Query  356   GTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             G  N++ ++ + AK+L+F   +    V  +F SQ    F   P
Sbjct  531   GQENIWNEVQSEAKELAFRVPA--REVEEIFRSQEQSYFMPGP  571



>ref|XP_006650381.1| PREDICTED: globulin-1 S allele-like [Oryza brachyantha]
Length=549

 Score =   241 bits (614),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/422 (34%), Positives = 215/422 (51%), Gaps = 53/422 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F    +S +   R+LP F   S L  GIK+YR+A L    ++FVVP+H DA 
Sbjct  108   PYVFGRRSFRQVVSSDQGSVRLLPPFHQASRLLRGIKNYRVAVLEANPRSFVVPSHTDAH  167

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +C V  G G VA+I    + S+ I +GD+   P GT  Y+ NTD  +K  L    ++ +
Sbjct  168   CVCYVAQGEGVVAMIENGERRSYAIRQGDIFVAPAGTINYLANTDGRRK--LIVTKILHT  225

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG+ QFF GA G+ P SF + FS+    AA     E ++++L    Q++G  ++ +E
Sbjct  226   ISVPGKIQFFFGAGGRNPESFLSSFSKRVQRAAFKISDERLEKLLG--KQDKGVIIRASE  283

Query  818   EQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFK  660
             EQ+R L +   EGG      + PF   E+S+    N+   +   +N++G +YE     F 
Sbjct  284   EQVRELRRHASEGGHGSHWPLPPF--GESSRG-PFNILEQRPRFANRHGRLYEADARSFH  340

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L E D+  A VNIT G M  PF+N+R+ +VA VL+GEG  E+ CP              
Sbjct  341   DLAEHDIRVALVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGEESEGRRG  400

Query  518   ----------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
                                     Y+T+R +L  G V+V P G+P   V +S+   +LQ 
Sbjct  401   KGKWREEEEEEGQQQEEEEQVGKGYETIRGRLSRGWVIVAPAGHPI--VVSSSRDSTLQI  458

Query  404   GWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               FD++   NER+ LAGTN++  KL   AK+L+FA  +    V+ +  +Q    F   P 
Sbjct  459   VCFDVHAENNERMYLAGTNSVLKKLDAQAKELAFA--TSAREVDELLNAQQESAFVAGPE  516

Query  224   SS  219
              S
Sbjct  517   ES  518



>gb|KGN44776.1| hypothetical protein Csa_7G380130 [Cucumis sativus]
Length=485

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/400 (37%), Positives = 215/400 (54%), Gaps = 34/400 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  E F  Q  +GE   ++L +F+ RS L  GI+++R++ +     TFVVP H DAE
Sbjct  87    PYVFDDEHFVGQIETGEGKIKVLQKFTQRSHLLRGIENFRVSIVEANPSTFVVPTHFDAE  146

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++ VI++  + SF +  GDV RIP G   Y +N D  +K  L+   L++S
Sbjct  147   IILFVAQGRGTITVIKEK-RGSFELKCGDVFRIPSGAPFYFINKDEHRK--LKIVKLLQS  203

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
              S PG FQ F  A G+ P SF+  FS + LEAA     + ++R  F + Q+ G  +K + 
Sbjct  204   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLER--FFKQQKPGTIIKASR  261

Query  818   EQLRSLSQ-EGDEGGIRPFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHFKPLDEV  645
             EQ+RSLS+ E     I PF   ET   R  N+   H   SN++G ++E     F  L ++
Sbjct  262   EQIRSLSRHEEIIPKIWPFSEGET--ERPFNLLKQHPCQSNKFGRLFEAYPDEFSQLRDL  319

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
              V  AF NITEG M+ P +NS++ ++AVVL+G+G  +M CP                   
Sbjct  320   GVAIAFANITEGSMVAPHYNSKSMKIAVVLDGQGGFQMACPHLSSSSRRSGRWSEREEER  379

Query  518   ---NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTN  348
                  YQ +R +L  G+V V+P G+P+   A+  P+ SLQ   F++N  GN +  LAG  
Sbjct  380   KGERTYQKIRGRLSRGVVFVVPAGHPFSVFAS--PNHSLQIVCFEVNAYGNTKYFLAGKE  437

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             N+  K+ + A++L F   +    V  +F  Q  E FF  P
Sbjct  438   NIVNKMESIARELGF--NTPGREVERMFKQQEEEFFFPGP  475



>ref|XP_010695493.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Beta vulgaris 
subsp. vulgaris]
Length=607

 Score =   240 bits (612),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 222/396 (56%), Gaps = 29/396 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  + FE++ ++ E   R+L RFS++SDL  G+  +R+       +TF++P+H DA+
Sbjct  216   PYYFDSQSFESRYSTQEGQMRVLQRFSEKSDLLLGMDKFRVGIYEANPKTFMLPHHWDAD  275

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V+ G   V +++Q+ +++ N+  GDVL IP GTTTY++N+ N +K  LE   L+R 
Sbjct  276   SVVFVMKGNAVVTLLKQENRKTLNLERGDVLMIPAGTTTYLINSHNDEK--LEIAELLRP  333

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPGR+Q F G  G++  SFF  FS E L+AALN   E +Q++L    Q+EG  +K + 
Sbjct  334   VNTPGRYQQFFGVGGEQSKSFFTSFSTEILQAALNIPREQLQKLL--AQQKEGAIIKASH  391

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R+L+ +         RG        IN+   +  +SN++G  +EV    ++ L+++D
Sbjct  392   EQVRALAHKTSRRQFGDSRG-------QINLLDGRPQLSNKHGEFFEVTPNEYQQLEDLD  444

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------NNYQTV  501
             ++ A+++I +G M+ P +NSR + V +V EG G+ E+ CP               +Y+ V
Sbjct  445   ISVAYLDIKQGSMMAPHYNSRTSYVVLVEEGSGYFEIACPHLASERNKKQRGGSQSYEKV  504

Query  500   RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNA  321
             RS L  G V V+P G+P   VA+ N  K+L+   F IN   N+R  LAG +N+  +L   
Sbjct  505   RSHLSKGDVFVVPAGHPVAIVASEN--KNLRAIGFGINALNNQRNFLAGQDNIVNQLDEE  562

Query  320   AKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSSLN  213
             A ++SF   +    V  +F  Q    F   P    N
Sbjct  563   AMEMSFNLPA--REVEEMFQKQRRSYFMAGPQRQRN  596



>ref|XP_008451293.1| PREDICTED: sucrose-binding protein-like [Cucumis melo]
Length=515

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/400 (36%), Positives = 216/400 (54%), Gaps = 34/400 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  E F  +  +GE   ++L +F+ RS L  GI+++R++ +     TFVVP H DAE
Sbjct  117   PYVFDDEHFVGKVETGEGKIKVLQKFTQRSQLLRGIENFRVSIVEANPSTFVVPTHFDAE  176

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++ VI++  + SF++  GDV RIP G   Y +N D  +K  L+   L++S
Sbjct  177   IIMFVAQGRGTITVIKEK-RGSFDLKCGDVFRIPSGAPFYFINKDEHQK--LKIVKLLQS  233

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
              S PG FQ F  A G+ P SF+  FS + LEAA     + ++R  F + Q  G  +K + 
Sbjct  234   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLER--FFKQQRPGTIIKASR  291

Query  818   EQLRSLSQEGD-EGGIRPFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHFKPLDEV  645
             EQ+RSLSQ  +    I PF   ET   R  N+   H   SN++G ++E     F  L ++
Sbjct  292   EQIRSLSQHEEIIPKIWPFSEGET--ERPFNLLKQHPWQSNKFGRLFEAYPDEFSQLRDL  349

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-------------------  522
              V  AF NIT+G M+ P +NS++ ++AVVL+GEG  +M CP                   
Sbjct  350   GVAIAFANITKGSMMTPHYNSKSMKIAVVLDGEGGFQMACPHLSSSSGRSGRWSEREEGR  409

Query  521   --KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTN  348
               +  YQ +R +L  G+V V+P G+P+   A+  P+ SLQ   F++N  GN +  LAG  
Sbjct  410   KGERTYQKIRGRLSRGVVFVVPAGHPFSVFAS--PNHSLQIVCFEVNAYGNTKYFLAGKE  467

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             N+  K+ + A++L F   +    V  +F  Q  E FF  P
Sbjct  468   NIVNKMESIARELGF--NTPGREVERMFKQQEEEFFFPGP  505



>ref|XP_011090693.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Sesamum indicum]
Length=626

 Score =   239 bits (611),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 133/396 (34%), Positives = 228/396 (58%), Gaps = 31/396 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ + F+++  + E   ++L RFS +S+L +G+ +YRLA L     TFV+P+H DAE
Sbjct  222   PYFFESQRFDSKYRTEEGNVKVLERFSKKSELLQGVDNYRLAVLEANPNTFVLPHHFDAE  281

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G+G+++ + Q+ ++S+N+  GDV+R+P G+  Y+VN D+ +K  L    L++ 
Sbjct  282   SVLVVAGGKGTISYVWQNRRKSYNVKLGDVMRVPAGSIVYLVNRDDNEK--LYVLKLLQP  339

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPGRF+ + G  G+ P SF+  FS E LEAA N   + ++R LFG+ Q++G  ++ ++
Sbjct  340   VNTPGRFKEYFGVGGENPESFYRTFSNEILEAAFNVPSDRLKR-LFGQ-QKKGVIIRASK  397

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R+LSQE +E      RG         N+   + + SN+YG  +E     ++ L ++D
Sbjct  398   EQIRALSQESEESS----RGRREESWGPFNLLEGRPLFSNRYGQYFEASPNDYQQLKDLD  453

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-----------------  513
             V+  F+NI +GGM+ P++NSR+T++ +V+ G G  EM CP  +                 
Sbjct  454   VSVGFMNINKGGMVAPYYNSRSTKLVLVVGGNGRFEMACPHRSARSKQGRKERQGETTDV  513

Query  512   -YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFL  336
              YQ V ++L  G   ++P G+P   +A+ +   +LQ   F I G  N++  LAG +N++ 
Sbjct  514   RYQRVSARLSIGDAFIVPAGHPIAMIASQD--SNLQLVSFGIKGSYNQKYFLAGQDNIWN  571

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             ++ + AK+LSF   +    V  +F  Q    F   P
Sbjct  572   QVESEAKELSFKMPA--REVEEIFRRQEQSYFLPGP  605



>ref|XP_009771136.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=796

 Score =   238 bits (606),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/378 (34%), Positives = 219/378 (58%), Gaps = 34/378 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ + F ++  +    FR+L +F++RS+L  GI++YR+A +  E  +F++P+H DAE
Sbjct  376   PYLFESQRFRSRFRATHGDFRVLQKFTERSELLRGIENYRVAVIEFEPLSFMLPHHCDAE  435

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV GRG++++  QD K SFN+  GDV+R+  G+T Y++N DN ++  +  ++L ++
Sbjct  436   AIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTIYMLNRDNNERFFV--YVLAQA  493

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG+FQ F  A G+ P SF+  FS + LE A NT  + ++R LFG+ Q++G  +K +E
Sbjct  494   VNTPGQFQEFFSAGGQNPESFYRAFSSDILETAFNTPRDRLER-LFGQ-QKQGIVIKASE  551

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             EQ+R++S+       +  +G  T     +   P   +SN++G  +E     F+ L ++D 
Sbjct  552   EQIRAISEHASRSTKQQTKGQTTGPFNPLKERP--LISNKFGKFFEASPDRFEQLRDLDA  609

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------------  519
               AF+NI  GGM+ P++N+R+T++A+V+EG G  EM CP                     
Sbjct  610   AVAFMNINHGGMVLPYYNTRSTRLAMVVEGTGRFEMACPHLGTQSQRQGSRGGRREQESE  669

Query  518   ------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                    +YQ VR  L  G V+V+P G+P   +AT     +L+   F +N   N +  LA
Sbjct  670   EQEGGDVHYQKVRGTLSAGDVLVVPAGHPITFIATG--GSNLRIVGFGVNAHNNRKNFLA  727

Query  356   GTNNLFLKLGNAAKDLSF  303
             G  N++  +   AK++SF
Sbjct  728   GQQNIWRNVDREAKEISF  745



>gb|ACN34339.1| unknown [Zea mays]
 tpg|DAA50577.1| TPA: LOW QUALITY PROTEIN: globulin1 [Zea mays]
Length=572

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 146/419 (35%), Positives = 210/419 (50%), Gaps = 48/419 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R+L  F + S L  GI+DYR+A L    ++FVVP+H DA 
Sbjct  100   PYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTDAH  159

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              IC V  G G V  I    + S+ I +G V   P G  TY+ NTD  KK  L    ++ +
Sbjct  160   CICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKK--LVIAKILHT  217

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG FQFF G  G+ P SF + FS+    AA  T  + ++R+     Q++G  ++ TE
Sbjct  218   ISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGRHGQDKGIIVRATE  277

Query  818   EQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKP  657
             EQ R L +   EGG      + PF G+       ++  P  +++NQ+G +YE     F  
Sbjct  278   EQTRELRRHASEGGHGPHWPLPPF-GESRGPYSLLDQRP--SIANQHGQLYEADARSFHD  334

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN------------  513
             L E DV+ +F NIT G M  P FN+R+ ++A V  G+G+ E+ CP               
Sbjct  335   LAEHDVSVSFANITAGSMSAPLFNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERERDK  394

Query  512   ---------------------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
                                  Y T+R++L  G   V+P G+P+V VA+ +   +LQ   F
Sbjct  395   GRRSEEEEEESSEEQEEAGQGYHTIRARLSPGTAFVVPAGHPFVAVASRD--SNLQIVCF  452

Query  395   DINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSS  219
             +++   NE+V LAG +N+  KL   AK LSFA  S  E V+ V GS+  + F   P  S
Sbjct  453   EVHADRNEKVFLAGADNVLQKLDRVAKALSFA--SKAEEVDEVLGSRREKGFLPGPKES  509



>sp|Q9SPL3.1|AMP23_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-3; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor, 
partial [Macadamia integrifolia]
 gb|AAD54246.1| vicilin precursor [Macadamia integrifolia]
Length=625

 Score =   234 bits (597),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 145/401 (36%), Positives = 228/401 (57%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F      T+  + E    +L  F  RS L   +K+YRL  L      FV+P H DA+
Sbjct  210   PYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDAD  269

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GRG++ +I +D +ES+N+  GDV+RIP GTT Y++N DN +++ +  F  +++
Sbjct  270   AILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKF--LQT  327

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG+++ F  A G+ P  + + FS+E LEAALNT+ E ++ VL G+ Q EG  ++ ++
Sbjct  328   ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL-GQ-QREGVIIRASQ  385

Query  818   EQLRSLSQEGDEG---GIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
             EQ+R L+++  E     IR  RG E+S+    N+F  + + SN+YG  YEV    ++ L 
Sbjct  386   EQIRELTRDDSESRRWHIR--RGGESSRG-PYNLFNKRPLYSNKYGQAYEVKPEDYRQLQ  442

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------------  519
             ++DV+    NIT+G M+GPFFN+R+T+V VV  GE  +EM CP                 
Sbjct  443   DMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEE  502

Query  518   ---NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-  351
                 +Y+ VR++L     +V+  G+P V V++ N  ++L    F IN + N    LAG  
Sbjct  503   EEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGN--ENLLLFAFGINAQNNHENFLAGRE  560

Query  350   NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              N+  ++   A +L+FAA   ++ V  +F SQ   +FF  P
Sbjct  561   RNVLQQIEPQAMELAFAAS--RKEVEELFNSQDESIFFPGP  599



>emb|CAA41809.1| vicilin-like embryo storage protein [Zea mays]
Length=582

 Score =   233 bits (594),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 146/419 (35%), Positives = 210/419 (50%), Gaps = 48/419 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R+L  F + S L  GI+DYR+A L    ++FVVP+H DA 
Sbjct  100   PYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTDAH  159

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              IC V  G G V  I    + S+ I +G V   P G  TY+ NTD  KK  L    ++ +
Sbjct  160   CICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKK--LVITKILHT  217

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG FQFF G  G+ P SF + FS+    AA  T  + ++R+     Q++G  ++ TE
Sbjct  218   ISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGRHGQDKGIIVRATE  277

Query  818   EQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKP  657
             EQ R L +   EGG      + PF G+       ++  P  +++NQ+G +YE     F  
Sbjct  278   EQTRELRRHASEGGHGPHWPLPPF-GESRGPYSLLDQRP--SIANQHGQLYEADARSFHD  334

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN------------  513
             L E DV+ +F NIT G M  P FN+R+ ++A V  G+G+ E+ CP               
Sbjct  335   LAEHDVSVSFANITAGSMSAPLFNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERERDK  394

Query  512   ---------------------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
                                  Y T+R++L  G   V+P G+P+V VA+ +   +LQ   F
Sbjct  395   GRRSEEEEEESSEEQEEAGQGYHTIRARLSPGTAFVVPAGHPFVAVASRD--SNLQIVCF  452

Query  395   DINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSS  219
             +++   NE+V LAG +N+  KL   AK LSFA  S  E V+ V GS+  + F   P  S
Sbjct  453   EVHADRNEKVFLAGADNVLQKLDRVAKALSFA--SKAEEVDEVLGSRREKGFLPGPEES  509



>gb|AAS07324.1| putative globulin (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|ABF98039.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
Length=562

 Score =   232 bits (591),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 146/432 (34%), Positives = 212/432 (49%), Gaps = 63/432 (15%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R+LP F   S L  GIK+YR+A L    ++FV+P H DA 
Sbjct  105   PYVFGRRSFRQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAH  164

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              IC V  G G VA+I    K S+ I +GDV   P GT  Y+ NTD  +K  L    ++ +
Sbjct  165   CICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANTDGRRK--LIVTKILHT  222

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG+ QFF    G+ P SF + FS+    AA     E ++++L    Q++G  ++ +E
Sbjct  223   ISVPGQIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLL--GKQDKGVIIRASE  280

Query  818   EQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFK  660
             EQ+R L +   EGG      + PF   E+S+    N+   +   +N++G +YE     F 
Sbjct  281   EQVRELRRHASEGGHGPHWPLPPF--GESSRG-PFNILEQRPRFANRHGRLYEADARSFH  337

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L E D+  A VNIT G M  PF+N+R+ +VA VL+GEG  E+ CP              
Sbjct  338   DLAEHDIRVAVVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGRGGESEER  397

Query  518   --------------------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVA  435
                                               Y+T+R++L  G V V+P G+P   V 
Sbjct  398   RRERGKGKWREEEEEEEEQQKGQEEEEEEQVGQGYETIRARLSRGTVFVVPSGHPI--VV  455

Query  434   TSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQ  255
             TS+   +LQ   FD++   NER+ LAG N++  KL   AK+L+FAA +    V+ +  +Q
Sbjct  456   TSSRDSTLQIVCFDVHANNNERMYLAGMNSVLKKLDPQAKELAFAASA--REVDELLNAQ  513

Query  254   PLELFFKAPPSS  219
                 F   P  S
Sbjct  514   QESAFLAGPEKS  525



>sp|Q9SPL4.1|AMP22_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-2; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor 
[Macadamia integrifolia]
 gb|AAD54245.1|AF161884_1 vicilin precursor [Macadamia integrifolia]
Length=666

 Score =   233 bits (593),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/401 (36%), Positives = 227/401 (57%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F      T+  + E    +L  F  RS L   +K+YRL  L      FV+P H DA+
Sbjct  251   PYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDAD  310

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++ +I +D +ES+N+  GDV+RIP GTT Y++N DN +++ +  F  +++
Sbjct  311   AILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKF--LQT  368

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG+++ F  A G+ P  + + FS+E LEAALNT+ E ++ VL G+ Q EG  +  ++
Sbjct  369   ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-GQ-QREGVIISASQ  426

Query  818   EQLRSLSQEGDEG---GIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
             EQ+R L+++  E     IR  RG E+S+    N+F  + + SN+YG  YEV    ++ L 
Sbjct  427   EQIRELTRDDSESRRWHIR--RGGESSRG-PYNLFNKRPLYSNKYGQAYEVKPEDYRQLQ  483

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----------------  522
             ++DV+    NIT+G M+GPFFN+R+T+V VV  GE  +EM CP                 
Sbjct  484   DMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEE  543

Query  521   --KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-T  351
                 +Y+ V+++L     +V+P G+P V V++ N  ++L    F IN + N    LAG  
Sbjct  544   EEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGN--ENLLLFAFGINAQNNHENFLAGRE  601

Query  350   NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              N+  ++   A +L+FAA   ++ V  +F SQ   +FF  P
Sbjct  602   RNVLQQIEPQAMELAFAAP--RKEVEELFNSQDESIFFPGP  640



>sp|Q9SPL5.1|AMP21_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-1; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor 
[Macadamia integrifolia]
 gb|AAD54244.1|AF161883_1 vicilin precursor [Macadamia integrifolia]
Length=666

 Score =   232 bits (592),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 143/401 (36%), Positives = 226/401 (56%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F      T+  + E    +L  F  RS L   +K+YRL  L      FV+P H DA+
Sbjct  251   PYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDAD  310

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GRG++ +I  D +ES+N+  GDV+RIP GTT Y++N DN +++ +  F  +++
Sbjct  311   AILLVIGGRGALKMIHHDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKF--LQT  368

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG+++ F  A G+ P  + + FS+E LEAALNT+ E + R +FG+ Q EG  ++ ++
Sbjct  369   ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTEKL-RGVFGQ-QREGVIIRASQ  426

Query  818   EQLRSLSQEGDEG---GIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
             EQ+R L+++  E     IR  RG E+S+    N+F  + + SN+YG  YEV    ++ L 
Sbjct  427   EQIRELTRDDSESRHWHIR--RGGESSRG-PYNLFNKRPLYSNKYGQAYEVKPEDYRQLQ  483

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------------  519
             ++D++    N+T+G M+GPFFN+R+T+V VV  GE  +EM CP                 
Sbjct  484   DMDLSVFIANVTQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEE  543

Query  518   ---NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-T  351
                 +Y+ VR++L     +V+  G+P V V++ N  ++L    F IN + N    LAG  
Sbjct  544   EEDVHYEQVRARLSKREAIVVLAGHPVVFVSSGN--ENLLLFAFGINAQNNHENFLAGRE  601

Query  350   NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              N+  ++   A +L+FAA   ++ V   F SQ   +FF  P
Sbjct  602   RNVLQQIEPQAMELAFAAP--RKEVEESFNSQDQSIFFPGP  640



>ref|XP_009595711.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 isoform X1 
[Nicotiana tomentosiformis]
Length=798

 Score =   234 bits (597),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 220/378 (58%), Gaps = 35/378 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ + F ++  +    FR+L +F++RS+L  GI++YR+A +  E  +F++P+H DAE
Sbjct  379   PYLFESQRFRSRFRATHGDFRVLEKFTERSELLRGIENYRVAVVEFEPLSFMLPHHCDAE  438

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV GRG++++  QD K SFN+  GDV+R+  G+T Y++N DN ++  +  ++L ++
Sbjct  439   AIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTVYMLNRDNNERFFV--YVLAQA  496

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG+FQ +  A G+ P SF+  FS + LE A NT  + ++R LFG+ Q++G  +K +E
Sbjct  497   VNTPGQFQEYFSAGGQNPESFYRAFSSDILETAFNTPRDRLER-LFGQ-QKQGIVIKASE  554

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S+       +  +G  T      N+   H   S+++G  +E     F+ L ++D
Sbjct  555   EQIRAISEHASRSTKQQTKGRTTG---PFNLLKEHPLFSSRFGQFFEASPDRFEQLRDMD  611

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
                AF+NI +GGM+ P++N+R+T++A+V+EG G  EM CP                    
Sbjct  612   AAVAFMNINQGGMVLPYYNTRSTRLAMVVEGNGRFEMACPHLGSQSQRQGSRGGRREQER  671

Query  518   ------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                    +YQ VR  L  G V+V+P G+P   +AT     +L+   F +N   + +  LA
Sbjct  672   EQEGGDVHYQKVRGTLSVGDVLVVPAGHPITFIATG--GSNLRIVGFGVNAHNSRKNFLA  729

Query  356   GTNNLFLKLGNAAKDLSF  303
             G  N++  +   AK+LSF
Sbjct  730   GQQNIWRNVDREAKELSF  747



>ref|XP_009595712.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 isoform X2 
[Nicotiana tomentosiformis]
Length=797

 Score =   234 bits (596),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 220/378 (58%), Gaps = 35/378 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ + F ++  +    FR+L +F++RS+L  GI++YR+A +  E  +F++P+H DAE
Sbjct  378   PYLFESQRFRSRFRATHGDFRVLEKFTERSELLRGIENYRVAVVEFEPLSFMLPHHCDAE  437

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV GRG++++  QD K SFN+  GDV+R+  G+T Y++N DN ++  +  ++L ++
Sbjct  438   AIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTVYMLNRDNNERFFV--YVLAQA  495

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG+FQ +  A G+ P SF+  FS + LE A NT  + ++R LFG+ Q++G  +K +E
Sbjct  496   VNTPGQFQEYFSAGGQNPESFYRAFSSDILETAFNTPRDRLER-LFGQ-QKQGIVIKASE  553

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S+       +  +G  T      N+   H   S+++G  +E     F+ L ++D
Sbjct  554   EQIRAISEHASRSTKQQTKGRTTG---PFNLLKEHPLFSSRFGQFFEASPDRFEQLRDMD  610

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
                AF+NI +GGM+ P++N+R+T++A+V+EG G  EM CP                    
Sbjct  611   AAVAFMNINQGGMVLPYYNTRSTRLAMVVEGNGRFEMACPHLGSQSQRQGSRGGRREQER  670

Query  518   ------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                    +YQ VR  L  G V+V+P G+P   +AT     +L+   F +N   + +  LA
Sbjct  671   EQEGGDVHYQKVRGTLSVGDVLVVPAGHPITFIATG--GSNLRIVGFGVNAHNSRKNFLA  728

Query  356   GTNNLFLKLGNAAKDLSF  303
             G  N++  +   AK+LSF
Sbjct  729   GQQNIWRNVDREAKELSF  746



>gb|AAF18269.1|AF066055_1 vicilin-like protein precursor [Juglans regia]
Length=593

 Score =   229 bits (584),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 133/395 (34%), Positives = 213/395 (54%), Gaps = 29/395 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  +   ++  S E   + L RF++R++L  GI++YR+  L     T ++P+H+DAE
Sbjct  181   PYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAE  240

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GR ++ ++ Q+ +ESFN+  GDV+R+P G T Y++N D+ ++  LE   L++ 
Sbjct  241   SVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNER--LEMVKLLQP  298

Query  998   ISTPGRFQFFSGAAGKKP-VSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             ++ PG+F+ +  A  K P  S+   FS + L AALNT  + ++R    + Q EG  ++ +
Sbjct  299   VNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS  358

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVD  642
             +E+LR+LSQ     G RP+ G  +S           + SNQ+G  +E      + L E+D
Sbjct  359   QEKLRALSQHAMSAGQRPW-GRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMD  417

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
             V   +  I  G M+ P +NS+AT V  V+EG G  EM CP                    
Sbjct  418   VLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEES  477

Query  518   -NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNL  342
                +Q V ++L  G + VIP G+P    A+ N  ++L+   FDING  N+R  LAG NN+
Sbjct  478   TGRFQKVTARLARGDIFVIPAGHPIAITASQN--ENLRLLGFDINGENNQRDFLAGQNNI  535

Query  341   FLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
               +L   AK+LSF     +E +  +F SQ +E +F
Sbjct  536   INQLEREAKELSF--NMPREEIEEIFESQ-MESYF  567



>ref|NP_001105887.1| globulin-1 S allele precursor [Zea mays]
 sp|P15590.2|GLB1_MAIZE RecName: Full=Globulin-1 S allele; Short=GLB1-S; AltName: Full=7S-like; 
Flags: Precursor [Zea mays]
 gb|AAA33467.1| globulin precursor [Zea mays]
Length=573

 Score =   227 bits (578),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 144/418 (34%), Positives = 209/418 (50%), Gaps = 47/418 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R+L  F + S L  GI+DYR+A L    ++FVVP+H DA 
Sbjct  103   PYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTDAH  162

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  G G V  I    + S+ I +G V   P G  TY+ NTD  KK  L    ++ +
Sbjct  163   CIGYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKK--LVITKILHT  220

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG FQFF G  G+ P SF + FS+    AA  T  + ++R+     Q++G  ++ TE
Sbjct  221   ISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGRHGQDKGIIVRATE  280

Query  818   EQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKP  657
             EQ R L +   EGG      + PF G+       ++  P  +++NQ+G +YE     F  
Sbjct  281   EQTRELRRHASEGGHGPHWPLPPF-GESRGPYSLLDQRP--SIANQHGQLYEADARSFHD  337

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN------------  513
             L E DV+ +F NIT G M  P +N+R+ ++A V  G+G+ E+ CP               
Sbjct  338   LAEHDVSVSFANITAGSMSAPLYNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERERGK  397

Query  512   --------------------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFD  393
                                 Y T+R++L  G   V+P G+P+V VA+ +   +LQ   F+
Sbjct  398   GRRSEEEEESSEEQEEVGQGYHTIRARLSPGTAFVVPAGHPFVAVASRD--SNLQIVCFE  455

Query  392   INGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSS  219
             ++   NE+V LAG +N+  KL   AK LSFA  S  E V+ V GS+  + F   P  S
Sbjct  456   VHADRNEKVFLAGADNVLQKLDRVAKALSFA--SKAEEVDEVLGSRREKGFLPGPKES  511



>gb|AAM54366.1| vicilin seed storage protein [Juglans nigra]
Length=481

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 212/395 (54%), Gaps = 29/395 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  +   ++  S E   + L RF++R++L  GI++YR+  L     TF++P+H+DAE
Sbjct  69    PYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHHKDAE  128

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GR ++ ++ Q+ +ESFN+  GDV+R+P G T Y++N D+ ++  LE   L++ 
Sbjct  129   SVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNER--LEMVKLLQP  186

Query  998   ISTPGRFQFFSGAAGKKP-VSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             ++ PG+ + +  A  K P  S+   FS + L AALNT  + ++R    + Q EG  ++ +
Sbjct  187   VNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS  246

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVD  642
             +E+LR+LSQ     G RP+ G  +S           + SNQ+G  +E      + L E+D
Sbjct  247   QEKLRALSQHAMSAGQRPW-GRRSSGGPISLKSERPSYSNQFGQFFEACPEEHRQLQEMD  305

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
             V   +  I  G M+ P +NS+AT V  V+EG G  EM CP                    
Sbjct  306   VLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEES  365

Query  518   -NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNL  342
                +Q V ++L  G + VIP G+P    A+ N  ++L+   F ING  N+R  LAG N++
Sbjct  366   TGRFQKVTARLARGDIFVIPAGHPIAITASQN--ENLRLLGFGINGENNQRNFLAGQNSI  423

Query  341   FLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
               +L   AK+LSF     +E +  +F SQ +E +F
Sbjct  424   INQLEREAKELSF--NMPREEIEEIFESQ-MESYF  455



>ref|XP_004247580.1| PREDICTED: vicilin GC72-A [Solanum lycopersicum]
 emb|CAP69670.1| vicilin [Solanum lycopersicum]
Length=569

 Score =   226 bits (575),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/410 (32%), Positives = 221/410 (54%), Gaps = 48/410 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ + F ++  +    FR+L RF+ RS L +GI+ YR+A L +E Q+FV+P+H D E
Sbjct  147   PYLFESQRFRSRFRASHGDFRILERFNQRSQLLKGIEKYRVAILELEPQSFVLPHHCDGE  206

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV G+G + +  QD K SFN+ +GDV+R+  G+  Y++N DN +K  L  ++L +S
Sbjct  207   AIYVVVKGQGVINIAEQDNKNSFNLQKGDVIRLFAGSNVYLLNKDNNEK--LFVYVLAKS  264

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG  Q +  A G+ P SF+  FS + LE+A N   + ++R LFG+  +EG  +K +E
Sbjct  265   VNAPGNLQEYFSAGGQNPESFYRAFSSDILESAFNNPRDKLER-LFGQ-HKEGIIIKASE  322

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRS---INVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
             EQ+R++S+          R  + ++ R+    N+   + V  +++G  +E     ++ L 
Sbjct  323   EQIRAISEHAS-------RSTQQTRGRTQGPFNLMKERPVFESRFGQFFEARPERYEQLR  375

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------------  519
             ++D    F+NI +GGM+ P++N+++T++ +V+EG    EM CP                 
Sbjct  376   DLDAAVGFMNINQGGMVLPYYNTKSTKLVMVIEGNARFEMACPHLGRQSQSPWSRGQGRE  435

Query  518   -------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRG  378
                           +YQ +R  L  G V+VIP G+P   VAT N   +L+   F ++   
Sbjct  436   QEREQEQEQEEGDVHYQKIRGNLNVGDVLVIPAGHPITFVATGN--SNLRIVGFGVDAEN  493

Query  377   NERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             N++  LAG  N++  +   AK+LSF+       V  +F  Q    F   P
Sbjct  494   NKKNFLAGKQNIWRNIDREAKELSFSMPG--REVEEIFQRQDQSYFVAGP  541



>ref|XP_010911186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2, partial [Elaeis 
guineensis]
Length=555

 Score =   224 bits (572),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 219/401 (55%), Gaps = 32/401 (8%)
 Frame = -2

Query  1361  YPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             +P+ F +E F  Q  +     R+   F ++S L  G+ +YR+A +     TFV+P+H DA
Sbjct  148   HPYFFDKESFMRQVRTEHGQIRVFRNFFEKSKLLLGVANYRVAIIETNPNTFVLPSHFDA  207

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E +  V  G G + ++ QD KE+  +  GD++R+  G    ++N D  +K  L    L++
Sbjct  208   EALLFVARGNGILTLMCQDNKEAHELRRGDIMRVRAGAIASLMNKDRNEK--LVIVCLLQ  265

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              ++TPG F+ F GA G+ P SF+  FS++ L AA NT+ + ++R+   E Q++GP ++ +
Sbjct  266   PVATPGMFEAFVGAGGQNPESFYRSFSKQVLRAAFNTREDKLKRLF--EKQQKGPIIQAS  323

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEV  645
             +EQ+R +S++  EG  RP  G      R  N+   + + SN++G + E   T +  L ++
Sbjct  324   QEQIREMSRQISEGRSRPLGGS----RRPFNLLEKRPSHSNRHGELREADRTDYPELMDL  379

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
             ++  +  NI+ G M+ P +N+ AT++A+V+ G+G +++ CP                   
Sbjct  380   NIQVSLANISRGSMIAPNYNTEATKIAIVVGGKGDVQIVCPHLSRQQEEGRGREEEEQQR  439

Query  518   -NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNL  342
               +YQ V+S++  G V ++P G+P V V++ N  ++L+   F IN + N R  LAG NN+
Sbjct  440   GRHYQRVQSEVSRGTVFIVPAGHPSVAVSSRN--ENLEVLCFGINAKNNHRTWLAGRNNV  497

Query  341   FLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSS  219
               ++    K+LSF   +    V+ V  +   E+F + P  S
Sbjct  498   LKQMDRVTKELSFDQPA--REVDEVLNAPREEVFMEGPKES  536



>ref|XP_010938562.1| PREDICTED: globulin-1 S allele [Elaeis guineensis]
Length=477

 Score =   222 bits (565),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 216/387 (56%), Gaps = 17/387 (4%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q  + +  E FE    S    F++L RF++R  L +GI ++RLA L    +TFV+P+H D
Sbjct  84    QNRYCYGEENFEYWMKSELGHFKVLERFTERFKLLQGIGNFRLAILEANPRTFVLPSHMD  143

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             AE +  V+ GRG + V+   G+ S++I +G +     G+  Y++N D+ KK  L   +L+
Sbjct  144   AEELFYVMEGRGVLNVLEISGRNSYDIEQGQIFSFDAGSQAYLINKDDNKK--LRIAMLL  201

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
               +S+PGRF+ F  A G+ P SF+  FS + LEAA NT  + +++ LFG  Q+ G  +  
Sbjct  202   HPVSSPGRFKEFFDAGGRAPESFYRSFSTKVLEAAFNTTKDRLEK-LFG--QQRGETINA  258

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKT---VSNQYGVIYEVGTTHFKPL  654
             TEEQ+++L++     G       +  +   +++   +     SN++G +Y++    +  L
Sbjct  259   TEEQIKALTEPPTAPGGWFIGPSKQCRRSGVSLTSRQNRVWYSNEHGELYKIYACDYSDL  318

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----NNYQTVRSKL  489
              ++ V  +F NI+ G M+ P +NS AT  A+V+EGEG+ EM CP       +YQ VRS++
Sbjct  319   CDLGVEISFANISRGSMMAPHYNSMATLAALVVEGEGYFEMACPHIEQGGTHYQAVRSQV  378

Query  488   KTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDL  309
               G V +IP G+P V VA+ +  ++LQ  +  +N + N    LAG NN+   +   AK+L
Sbjct  379   SPGSVFMIPAGHPVVAVASRD--ENLQVLFLGMNAKHNRVHFLAGGNNVLNHMERVAKEL  436

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAP  228
             SF A +    V+ VF +Q    F   P
Sbjct  437   SFNAPA--RVVDEVFNAQKRAGFLPGP  461



>ref|XP_006839012.1| hypothetical protein AMTR_s00002p00272040 [Amborella trichopoda]
 gb|ERN01581.1| hypothetical protein AMTR_s00002p00272040 [Amborella trichopoda]
Length=523

 Score =   223 bits (567),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 131/399 (33%), Positives = 210/399 (53%), Gaps = 54/399 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+R+ F    ++    FR LP F++RS+LF GI++ R+  + ++   FV+P+H+DA+
Sbjct  94    PYAFERDRFVRDISTEHGSFRTLPPFTERSELFRGIENNRICIMELKPNAFVLPHHKDAD  153

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  G   +  I ++ ++S N+ +GD   IP G TTYI+N D+ ++  L+   L+++
Sbjct  154   IIYYVANGDARLVTIGEERQDSHNLKKGDTATIPAGKTTYIINKDSQRE--LKIVALLQT  211

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG+++ F GA G+ P S+   FS E LEA+ N     + R+L  E + +GP ++ + 
Sbjct  212   ISTPGQYEIFFGATGQNPPSYLRAFSDEILEASFNVDRSRLSRLL--EQKGQGPIVRPSS  269

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQL+ L   G  GG  PF G+     R  N+F  +  +SN +G +YE+  T + PL E D
Sbjct  270   EQLQGLIHGGSGGGKWPF-GESEESERPFNLFSRRPRISNDHGELYELDETEYSPLREFD  328

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP--------------------  522
             +  +F NI+ G +  PF+NSRAT++ V+LEG   +EM CP                    
Sbjct  329   IAISFANISRGSLEVPFYNSRATEIYVILEGRARIEMACPHVSGGREQEGSRRGQGEQEG  388

Query  521   --------------------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPS  420
                                       +  Y  +RS L    + V PP +P    A+    
Sbjct  389   SRRGQREQEGSRREQEQEERGKGQGQEIKYHKIRSDLNPEDLFVAPPSHPIAIRASQ--E  446

Query  419   KSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSF  303
             ++LQ   F+IN R N +  LAG N++  ++  AAK++SF
Sbjct  447   ENLQIICFEINARRNRKYFLAGKNSILNQIERAAKEVSF  485



>gb|ABV49593.1| 7S vicilin [Carya illinoinensis]
Length=784

 Score =   227 bits (579),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 127/374 (34%), Positives = 202/374 (54%), Gaps = 27/374 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  +   ++  SGE   + L RF++R++L  GI++YR+  L     TFV+P H+DAE
Sbjct  370   PYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAE  429

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GR ++  + Q+ +ESFN+  GDV+R+P G T Y++N D+ ++  LE   L++ 
Sbjct  430   SVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNER--LEMVKLLQP  487

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG+F+ +  A  +   S+   FS + L AALNT  + ++R    + Q EG  ++ ++
Sbjct  488   VNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRASQ  547

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             E+LR+LSQ     G RP+ G  +S           + SNQ+G  +E      + L E+DV
Sbjct  548   EKLRALSQHAMSAGQRPW-GRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDV  606

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------------------  516
                +  I  G M+ P +NS+AT V  V+EG G  EM CP +                   
Sbjct  607   LVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEES  666

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                 +Q V ++L  G + VIP G+P    A+ N  ++L+   F ING+ N+R  LAG NN
Sbjct  667   STGQFQKVTARLARGDIFVIPAGHPIAITASQN--ENLRLVGFGINGKNNQRNFLAGQNN  724

Query  344   LFLKLGNAAKDLSF  303
             +  +L   AK+LSF
Sbjct  725   IINQLEREAKELSF  738



>gb|ABV49590.1| 7S vicilin [Carya illinoinensis]
 gb|ABV49591.1| 7S vicilin [Carya illinoinensis]
 gb|ABV49592.1| 7S vicilin [Carya illinoinensis]
Length=792

 Score =   227 bits (578),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/374 (34%), Positives = 202/374 (54%), Gaps = 27/374 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  +   ++  SGE   + L RF++R++L  GI++YR+  L     TFV+P H+DAE
Sbjct  378   PYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAE  437

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GR ++  + Q+ +ESFN+  GDV+R+P G T Y++N D+ ++  LE   L++ 
Sbjct  438   SVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNER--LEMVKLLQP  495

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG+F+ +  A  +   S+   FS + L AALNT  + ++R    + Q EG  ++ ++
Sbjct  496   VNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRASQ  555

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             E+LR+LSQ     G RP+ G  +S           + SNQ+G  +E      + L E+DV
Sbjct  556   EKLRALSQHAMSAGQRPW-GRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDV  614

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------------------  516
                +  I  G M+ P +NS+AT V  V+EG G  EM CP +                   
Sbjct  615   LVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEES  674

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                 +Q V ++L  G + VIP G+P    A+ N  ++L+   F ING+ N+R  LAG NN
Sbjct  675   STGQFQKVTARLARGDIFVIPAGHPIAITASQN--ENLRLVGFGINGKNNQRNFLAGQNN  732

Query  344   LFLKLGNAAKDLSF  303
             +  +L   AK+LSF
Sbjct  733   IINQLEREAKELSF  746



>ref|XP_002464118.1| hypothetical protein SORBIDRAFT_01g012640 [Sorghum bicolor]
 gb|EER91116.1| hypothetical protein SORBIDRAFT_01g012640 [Sorghum bicolor]
Length=615

 Score =   223 bits (569),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 144/417 (35%), Positives = 209/417 (50%), Gaps = 49/417 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R L  F + S L  GI++YR+A L    ++FVVP+H DA 
Sbjct  129   PYVFDRRSFRRVVRSEQGSVRALRPFHEASKLLRGIRNYRVAVLEANPRSFVVPSHTDAH  188

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV G G V  I    + S+ I EG +   P G  TY+ NTD  KK  L    ++ +
Sbjct  189   CIGYVVQGEGVVTTIENGERRSYTIKEGHIFVAPAGAITYLANTDGRKK--LVIAKILHT  246

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG FQFF G  G+ P SF + FS+    AA  T  + ++R+     Q++G  ++ TE
Sbjct  247   ISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGKRGQDKGVIVRATE  306

Query  818   EQLRSL-SQEGDEGG------IRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFK  660
             EQ+R L  Q   EGG      + PF G+       ++  P  ++ NQ+G +YE     F+
Sbjct  307   EQIRELRHQASSEGGHGPHWPLPPF-GESHGPYSLLDQRP--SIGNQHGQLYEADARSFR  363

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L + DV+ +F NIT G M  P FN+RA ++A V  G+G  E+ CP              
Sbjct  364   DLADHDVSVSFANITAGSMSAPLFNTRAFKIAYVARGQGNAEIVCPHQQQQSQSQRGGKG  423

Query  518   --------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGW  399
                                   Y+T+R++L  G V V+P G+P+V VA  +   +L+   
Sbjct  424   RRRSEEEEEEGGSSEEEEAGQGYRTIRARLSQGTVFVVPVGHPFVAVAARD--SNLEIVC  481

Query  398   FDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             F++    NE+V LAG +N+  KL   AK LSFAA +  E V+ V G++  + F   P
Sbjct  482   FELRAEKNEKVFLAGADNVLKKLDRVAKALSFAAKA--EEVDEVLGARREKGFLPGP  536



>ref|XP_010256228.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=523

 Score =   220 bits (560),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 136/397 (34%), Positives = 225/397 (57%), Gaps = 28/397 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  + F ++  S +   ++L RFS RSDL  G+ +YRLA L VE  TF++P+H DA+
Sbjct  109   PYFFDEQRFSSRFKSEKGHLKILERFSTRSDLLSGLDNYRLAILKVEPNTFLIPHHWDAD  168

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  VV G+ ++ ++  D +ES+N+  GDV RIP GT  Y++N D+ +   L+   L R+
Sbjct  169   AVVVVVKGKATINLVHNDNRESYNLECGDVARIPAGTMVYLMNRDDNEN--LQIVTLFRT  226

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ISTPG    F  A+ +   SF+  FS E LEAALNT  + ++R+L  E + +G   + ++
Sbjct  227   ISTPGYVSEFFSASSEDGESFYTAFSNEILEAALNTPKDKLKRML--EEKRKGVMREASK  284

Query  818   EQLRSLSQEG---DEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
             EQ++++S++     EGG R +   ++      N+F  + + SN YG IYE     ++ L 
Sbjct  285   EQIKAMSEQASSSSEGG-RRWSIHKSETRGPFNLFKKRPIYSNSYGQIYEAQPNDYQQLK  343

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVRSKLKTGMVV  471
             ++DV+  F NI++G ML P +N+R+T++A V++G GW EM CP  + Q+ R +   G  V
Sbjct  344   DLDVSVIFSNISQGAMLAPLYNTRSTRIAFVVKGNGWWEMACPHISSQSQRGREGEGDGV  403

Query  470   ---------------VIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-NNLF  339
                            +IP G+ +  VA+    ++LQ   F IN + N+R  +AG  +N+ 
Sbjct  404   QYEKASSPVSPNTGFIIPLGHVFTVVASE--KENLQIIVFGINAQDNKRNFVAGKEHNVM  461

Query  338   LKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              ++   AK+L+F   S++E   ++  +Q    F   P
Sbjct  462   KQMDKEAKELAFDM-SEEEVDEILLNNQEESFFVPGP  497



>ref|XP_006383667.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 ref|XP_002306784.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
Length=544

 Score =   220 bits (560),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 132/404 (33%), Positives = 217/404 (54%), Gaps = 40/404 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+    +++  +     R+L +F+ +S L  G+++ R+A +    QTF+ P H DA 
Sbjct  143   PYVFEDRHLKSEVETEHGRVRVLQKFTKKSKLLRGLENIRVAIIEANPQTFIAPTHLDAG  202

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             F+  V  GRG++ +I ++ K++FN+  GDV  +P GTT Y+VN D  +K  L    ++  
Sbjct  203   FVLFVAKGRGAITLIHEEDKQTFNLERGDVFGVPAGTTFYMVNKDENEK--LRVAKILWP  260

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG F+ F GA G+   SFF  FS E LEAAL  +   ++R+     Q++G  +K ++
Sbjct  261   VNLPGNFKAFHGAGGEDAESFFRAFSWELLEAALKVR--RLERIF---KQQQGGIVKASK  315

Query  818   EQLRSL----SQEGDEGGIRPFRGDETSKNRSINVFPHKTVS-NQYGVIYEVGTTHFKPL  654
             EQ+++L          GG+ PF    +S     N+F    V  N YG ++E      + L
Sbjct  316   EQIQALGHGEEGGHGGGGLWPFPTGGSSG--PFNIFDKDPVKRNNYGQLFEAKPKDSEQL  373

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-------------  513
              ++D+  +  NIT G M GP++NS+AT +++VLEGEG+ EM CP+++             
Sbjct  374   RDLDLIVSLANITRGSMAGPYYNSKATMISIVLEGEGYFEMACPRDSSSGSSMGYIESEG  433

Query  512   ---------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTL  360
                      YQ   S+L    V ++P G+P   VA+ N   +L+   F++  +GN R  L
Sbjct  434   SRRGKGGQTYQKTSSRLSRNSVFIVPAGHPVATVASEN--SNLEVLCFEVYAKGNVRYPL  491

Query  359   AGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             AG  N+  ++   AK+L++  G   + V+ +FG Q  E FF  P
Sbjct  492   AGKWNVIGEMDREAKELAY--GVPAKEVDQIFGKQQEEFFFPGP  533



>ref|XP_006360765.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Solanum 
tuberosum]
Length=567

 Score =   219 bits (557),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 121/384 (32%), Positives = 217/384 (57%), Gaps = 44/384 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ + F ++  +    FR+L +F+ RS L +GI+ YR++ L +E Q+FV+P+H D E
Sbjct  147   PYLFESQRFRSRYRASHGDFRILEKFNQRSQLLKGIEKYRVSVLELEPQSFVLPHHCDGE  206

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV G+G +++  QD K SFN+ +GDV+R+  G+  Y++N DN +K  L  ++L +S
Sbjct  207   AIFVVVKGQGIISIAEQDNKNSFNLQKGDVIRVFAGSNVYMLNKDNNEK--LFVYVLAKS  264

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG  Q +  A G+ P +F+  FS + LE+A N   + ++R LFG+  +EG  +K +E
Sbjct  265   VNAPGNLQQYFSAGGQNPETFYKAFSSDILESAFNNPRDKLER-LFGQ-HKEGIIIKASE  322

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRS---INVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
             EQ+R++S+          R  + +K R+    N+   + +  +++G  +E     F+ L 
Sbjct  323   EQIRAISEHAS-------RSTQQTKGRTQGPFNLLKERPLFESKFGQFFEACPERFEQLR  375

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------------  519
             ++D    F+NI +GGM+ P++N+++T++ +V+EG    EM CP                 
Sbjct  376   DLDAAVGFMNINQGGMVLPYYNTKSTKLVMVVEGNARFEMACPHLGRQGQSPWSRGQGRE  435

Query  518   -----------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                         +YQ +R  L  G V+VIP G+P   VAT N   +++   F ++ + ++
Sbjct  436   HEQEQEQEEGEVHYQKIRGNLNVGDVLVIPAGHPITFVATGN--SNVRIVGFGVDAQNSK  493

Query  371   RVTLAGTNNLFLKLGNAAKDLSFA  300
             +  LAG  +++  +   AK+LSF+
Sbjct  494   KNFLAGKQSIWRNVDREAKELSFS  517



>gb|AEO27685.1| seed storage protein vicilin A, partial [Gossypium hirsutum]
Length=534

 Score =   218 bits (554),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 210/406 (52%), Gaps = 43/406 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+D+  L  GI ++R+A L     TFV+P+H DAE
Sbjct  127   PYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  186

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG+V  +  + KES+N+  G V+RIP G+T Y+ N DN +K  L   +L R 
Sbjct  187   KIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREK--LTIAVLHRP  244

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  A  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQ    G   P RG + S+  + N+       SNQ G  YE    +F +
Sbjct  305   RKASQEQIRALSQ----GATSP-RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  358

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V EG G +EM CP              
Sbjct  359   QLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSHWSSREE  418

Query  518   ------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                           Y+ VR++L TG + V+P G+P   VA+ N    L  G+   NG+ N
Sbjct  419   EEQEEQEVERRSGQYKRVRAQLSTGDLFVVPAGHPVTFVASQNEDLGL-LGFGLYNGQDN  477

Query  374   ERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             +R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  478   KRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  521



>gb|AEO27686.1| seed storage protein vicilin A, partial [Gossypium raimondii]
Length=534

 Score =   217 bits (552),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 142/406 (35%), Positives = 211/406 (52%), Gaps = 43/406 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+D+  L  GI ++R+A L     TFV+P+H DAE
Sbjct  127   PYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  186

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+RIP G+T Y+ N DN +K+ +   +L R 
Sbjct  187   KIYVVTNGRGTITFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIA--VLHRP  244

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  A  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSELLDELFGGRQSHRRQQGQGMF  304

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQ    G   P RG + S+  + N+       SNQ G  YE    +F +
Sbjct  305   RKASQEQIRALSQ----GATSP-RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  358

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V EG G +EM CP              
Sbjct  359   QLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSHWSSREE  418

Query  518   ------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                           Y+ VR++L TG + V+P G+P   VA+ N    L  G+   NG+ N
Sbjct  419   EEQEEQEDERRSGQYKRVRAQLSTGDLFVVPAGHPVTFVASQNEDLGL-LGFGLYNGQDN  477

Query  374   ERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             +R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  478   KRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  521



>gb|AEO27683.1| seed storage protein vicilin A, partial [Gossypium arboreum]
Length=537

 Score =   216 bits (550),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 141/409 (34%), Positives = 210/409 (51%), Gaps = 46/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+D+  L  GI ++R+A L     TFV+P+H DAE
Sbjct  127   PYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  186

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+RIP G+T Y+ N DN +K  L   +L R 
Sbjct  187   KIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREK--LTIAVLHRP  244

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  A  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQE         RG + S+  + N+       SNQ G  YE    +F +
Sbjct  305   RKASQEQIRALSQEATSP-----RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  358

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V +G G +EM CP              
Sbjct  359   QLQEVDSSVVAFEINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREE  418

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                              Y+ VR++L TG + V+P G+P   VA+ N +  L  G+   NG
Sbjct  419   EEQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGL-LGFGLYNG  477

Query  383   RGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             + N+R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  478   QDNKRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  524



>ref|XP_009771135.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
sylvestris]
Length=431

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/364 (34%), Positives = 204/364 (56%), Gaps = 25/364 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+   F ++  S    FR+L +F++RS+L  G++ YR+A L  E  +F++P+H DAE
Sbjct  32    PYLFKSHRFRSRFTSKHGEFRVLEKFTERSELLGGLEKYRVAVLEFEPLSFMLPHHCDAE  91

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV GRG++++  QD + SFN+  GDV+R+  G+T Y++N DN ++  +  ++L ++
Sbjct  92    VIFFVVRGRGTISIAEQDEQNSFNLEHGDVIRVNAGSTIYMINRDNNERFFV--YVLAKT  149

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG+FQ +    G+ P SF+  FS E LE A NT  +TI+ +L G+ Q +G F+K +E
Sbjct  150   VNIPGQFQEYFSGGGENPESFYRAFSSEILETAFNTSIDTIEGLL-GQ-QRKGIFVKASE  207

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S+       +  RG         N+   +  + N++G  +E     F+ L ++D
Sbjct  208   EQIRAISEHASLSTKQQTRG-------PFNLLNERPLLGNKFGHYFEATPERFEQLRDLD  260

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----------NNYQTVRS  495
               A  +NI +GGML P + +R T   +V+EG G  EM CP             +YQ V+ 
Sbjct  261   AAAGIMNINQGGMLLPVYCTRTTWFVMVVEGNGRFEMACPHLSSQSQSQRQGRHYQKVQG  320

Query  494   KLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAK  315
              L  G V++I  G+P   +AT +    L+      N   N    LAG  +++  +   AK
Sbjct  321   SLSVGDVMIIRAGHPITVIATGD--SELRMVGIGFNAHNNRMNFLAGRQSIWRNVDREAK  378

Query  314   DLSF  303
             ++SF
Sbjct  379   EVSF  382



>gb|AEO27682.1| seed storage protein vicilin A, partial [Gossypium herbaceum]
Length=537

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 141/409 (34%), Positives = 210/409 (51%), Gaps = 46/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+D+  L  GI ++R+A L     TFV+P+H DAE
Sbjct  127   PYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  186

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+RIP G+T Y+ N DN +K  L   +L R 
Sbjct  187   KIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREK--LTIAVLHRP  244

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  A  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQE         RG + S+  + N+       SNQ G  YE    +F +
Sbjct  305   RKASQEQIRALSQEATSP-----RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  358

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V +G G +EM CP              
Sbjct  359   QLQEVDSSVVAFEINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREE  418

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                              Y+ VR++L TG + V+P G+P   VA+ N +  L  G+   NG
Sbjct  419   EEQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGL-LGFGLYNG  477

Query  383   RGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             + N+R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  478   QDNKRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  524



>gb|KHN18868.1| Sucrose-binding protein [Glycine soja]
Length=423

 Score =   212 bits (539),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 136/390 (35%), Positives = 219/390 (56%), Gaps = 29/390 (7%)
 Frame = -2

Query  1358  PFVFQRE-EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+VF+ + +F T+  +     R+L +F+++S L +GI+++RLA L   + TFV P H D+
Sbjct  32    PYVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDS  91

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E +   + GR  + ++R+   E   +  GD++ IP GT  YIVN D  +K+ L   +L  
Sbjct  92    EVVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKLLLA--MLHI  149

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              +STPG+F+ F G  G+ P S  + FS   L+AAL T    ++R LF + Q EG   K++
Sbjct  150   PVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLER-LFNQ-QNEGSIFKIS  207

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-LDE  648
              E++R+L+    +    PF G+  ++    N+F  + T SN YG + EVG    K  L  
Sbjct  208   RERVRALAPT-KKSSWWPFGGESKAQ---FNIFSKRPTFSNGYGRLTEVGPDDEKSWLQR  263

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------------NYQ  507
             +++   F NIT+  M    +NS AT++A+V++G G L++ CP               +Y 
Sbjct  264   LNLMLTFTNITQRSMSTIHYNSHATKIALVMDGRGHLQISCPHMSSRSHSKHDKSSPSYH  323

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              + + LK GMV V+PPG+P+V +A++   ++L    F++N R N++ T AG +N+   L 
Sbjct  324   RISADLKPGMVFVVPPGHPFVTIASNK--ENLLIICFEVNVRDNKKFTFAGKDNIVSSLD  381

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             N AK+L+F   S  E VN VF  +   LFF
Sbjct  382   NVAKELAFNYPS--EMVNGVFERKE-SLFF  408



>ref|XP_009407076.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   216 bits (551),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/407 (32%), Positives = 213/407 (52%), Gaps = 67/407 (16%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R+ F  Q  +      +L  F ++S+   GI +YR+A + +  + F+VP+H DA+
Sbjct  196   PYFFDRDSFYEQVRTEHGHVMVLENFLEKSEFLLGIANYRIAIVGLNPRAFLVPHHLDAD  255

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI--LI  1005
              I  V  G G + ++ ++ KE+  +  GD+L  P G   Y++N D+ +    EF +  L+
Sbjct  256   AIYYVARGCGVLTLVCEEKKETHELRRGDILEAPAGAIIYMINKDSNE----EFLLIKLL  311

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
               +STPGRF+ F GA G+ P SFF  FS E LEAA NT+ + + R+ FG+ Q +G  ++ 
Sbjct  312   HPVSTPGRFEVFYGAGGQNPKSFFPSFSDEILEAAFNTRRDRLSRI-FGQ-QRKGGIVEA  369

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDE  648
             +EEQ+R+LS+   EGG  PF G+        N+   + + S++ G ++E     ++PL +
Sbjct  370   SEEQVRALSRHASEGGQWPF-GESKG---PFNLLEKRPIYSSRRGQMHEADGDDYRPLKQ  425

Query  647   VDVNAAFVNITE-------------------------------GGMLGPFFNSRATQVAV  561
             +D+  +  N+TE                               G M+ PF++SR+T++AV
Sbjct  426   LDLRVSHFNLTEVYMSYADPVPRAYHGHSFSPWWGMMLGSLLQGSMVAPFYDSRSTKIAV  485

Query  560   VLEGEGWLEMGCPK---------------------NNYQTVRSKLKTGMVVVIPPGYPYV  444
             +LEG G++E  CP                        YQ VRS++  G V +IPPG+P V
Sbjct  486   ILEGSGYVETICPHLSERGRSREEGGERHEGREGGQRYQKVRSQVSRGTVAIIPPGHPSV  545

Query  443   NVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSF  303
              VA+    ++L+   F+I    N R  LAG NN+  +L   AK+L+F
Sbjct  546   TVASRG--RNLEVVCFEIRAERNVRNFLAGRNNVLKQLDREAKELAF  590



>gb|KHG06468.1| hypothetical protein F383_32629 [Gossypium arboreum]
Length=608

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/409 (34%), Positives = 211/409 (52%), Gaps = 46/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+D+  L  GI ++R+A L     TFV+P+H DAE
Sbjct  182   PYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  241

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+RIP G+T Y+ N DN +K+ +   +L R 
Sbjct  242   KIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREKLTIA--VLHRP  299

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  A  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  300   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  359

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQE         RG + S+  + N+       SNQ G  YE    +F +
Sbjct  360   RKASQEQIRALSQEATSP-----RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  413

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V +G G +EM CP              
Sbjct  414   QLQEVDSSVVAFEINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREE  473

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                              Y+ VR++L TG + V+P G+P   VA+ N +  L  G+   NG
Sbjct  474   EEQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGL-LGFGLYNG  532

Query  383   RGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             + N+R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  533   QDNKRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  579



>ref|XP_003536630.1| PREDICTED: sucrose-binding protein-like [Glycine max]
 gb|KHN03813.1| Sucrose-binding protein [Glycine soja]
Length=504

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/392 (34%), Positives = 216/392 (55%), Gaps = 30/392 (8%)
 Frame = -2

Query  1358  PFVFQRE-EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P++F+ + +FET+  +     R+L +F+++S L +GI+++RLA L   + TFV P H D+
Sbjct  109   PYIFEEDKDFETRVETEGGRIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDS  168

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E +   + GR  + ++ +   E   +  GD++ IP GT  YIVN D   K+ L    +  
Sbjct  169   EVVFFNIKGRAVLGLVSESETEKITLEPGDMIHIPAGTPLYIVNRDENDKLFLAMLHIPV  228

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             S+STPG+F+ F G  G+ P S  + FS   L+AAL T    ++++   + Q EG    ++
Sbjct  229   SVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLEKLF--DQQNEGSIFAIS  286

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP--LD  651
              EQ+R+L+    +    PF G+   +    N+F  + T+SN YG + EVG    +   L 
Sbjct  287   REQVRALA-PTKKSSWWPFGGESKPQ---FNIFSKRPTISNGYGRLTEVGPDDDEKSWLQ  342

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN--------------N  513
              +++   F NIT+  M    +NS AT++A+V++G G L++ CP                +
Sbjct  343   RLNLMLTFTNITQRSMSTIHYNSHATKIALVIDGRGHLQISCPHMSSRSSHSKHDKSSPS  402

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLK  333
             Y  + S LK GMV V+PPG+P+V +A++   ++L    F++N R N++ T AG +N+   
Sbjct  403   YHRISSDLKPGMVFVVPPGHPFVTIASNK--ENLLMICFEVNARDNKKFTFAGKDNIVSS  460

Query  332   LGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             L N AK+L+F   S  E VN VF  +  E FF
Sbjct  461   LDNVAKELAFNYPS--EMVNGVFDRK--ESFF  488



>sp|P09799.1|VCLA_GOSHI RecName: Full=Vicilin GC72-A; AltName: Full=Alpha-globulin A; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA33069.1| vicilin precursor [Gossypium hirsutum]
 gb|AAA72623.1| alpha globulin A [synthetic construct]
 prf||1410330A vicilin gene A
Length=605

 Score =   215 bits (548),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 210/406 (52%), Gaps = 43/406 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+D+  L  GI ++R+A L     TFV+P+H DAE
Sbjct  182   PYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  241

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG+V  +  + KES+N+  G V+RIP G+T Y+ N DN +K  L   +L R 
Sbjct  242   KIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREK--LTIAVLHRP  299

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  A  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  300   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMF  359

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQ    G   P RG + S+  + N+       SNQ G  YE    +F +
Sbjct  360   RKASQEQIRALSQ----GATSP-RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  413

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V EG G +EM CP              
Sbjct  414   QLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREE  473

Query  518   ------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                           Y+ VR++L TG + V+P G+P   VA+ N    L  G+   NG+ N
Sbjct  474   EEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL-LGFGLYNGQDN  532

Query  374   ERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             +R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  533   KRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  576



>dbj|BAA34056.1| PV100 [Cucurbita maxima]
Length=810

 Score =   217 bits (553),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 140/413 (34%), Positives = 214/413 (52%), Gaps = 51/413 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ FQ + F+++  S E  +R+L RFS+RS+L +GIK+ RLA L     TF+VP+H DAE
Sbjct  390   PYYFQEQRFQSRYRSDEGHWRVLERFSERSELLKGIKNQRLALLEARPHTFIVPHHLDAE  449

Query  1178  FICTVVLGRGSVAVI----RQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI  1011
              +  VV GR ++  +    R+  KES+N+  GDV+ IP GTT Y+ N +N     L+   
Sbjct  450   CVLLVVRGRATITTVVQEKRETRKESYNVESGDVMTIPAGTTLYLANQENED---LQIVK  506

Query  1010  LIRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFL  831
             L++ ++ PG F+ +  A G+   ++++ FS + LEAALN   + ++R+     +  G  +
Sbjct  507   LVQPVNNPGEFKDYLSAGGESQ-AYYSVFSNDVLEAALNIPRDKLERIFKQRRERGGKIV  565

Query  830   KVTEEQLRSLSQEGD--EGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFK  660
             + ++EQLR+LSQ       G R  R         I +     V +NQYG ++E     F 
Sbjct  566   RASQEQLRALSQRATSVRKGSRGVRA-------PIKLESQTPVYNNQYGQMFEACPDEFP  618

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---KNNYQ------  507
              L   DV  + V+I +GGM+ P FNSRAT V  V EG G  EM CP    + +Q      
Sbjct  619   QLRRTDVATSVVDIKQGGMMVPHFNSRATWVVFVSEGAGSFEMACPHIQSSQWQRGRREE  678

Query  506   --------------------TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                                  V  +L  G V+VIP G+P   +A+  P+++L+   F IN
Sbjct  679   ERHWRREEEEEREERSGRFERVAGRLSEGGVLVIPAGHPIAIMAS--PNENLRLVGFGIN  736

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                N R  LAG  N+  +L   AK+L+F    + +  + +F SQ    F + P
Sbjct  737   AENNHRNFLAGRENIMNELDREAKELAFNV--EGKQADEIFRSQRESFFTEGP  787



>gb|AAA32936.1| embryo globulin [Hordeum vulgare subsp. vulgare]
 gb|AAA34269.1| storage protein [Triticum aestivum]
 prf||1916404A barley embryo globulin 1
Length=637

 Score =   214 bits (546),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/432 (33%), Positives = 209/432 (48%), Gaps = 68/432 (16%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF    F     S     R L  F   S L  GI+DYR+A + V  + FVVP   DA+
Sbjct  182   PYVFGPRSFRRIIQSDHGFVRALRPFDQVSRLLRGIRDYRVAIMEVNPRAFVVPGFTDAD  241

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + VI    K S+ + EGDV+  P G+  ++ NTD  +K  L    ++ +
Sbjct  242   GVGYVAQGEGVLTVIENGEKRSYTVKEGDVIVAPAGSIMHLANTDGRRK--LVIAKILHT  299

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEG-----PF  834
             IS PG+FQF S     KP       S+  L AA  T  E ++R LF + Q +        
Sbjct  300   ISVPGKFQFLS----VKP--LLASLSKRVLRAAFKTSDERLER-LFNQRQGQEKTRSVSI  352

Query  833   LKVTEEQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVG  675
             ++ +EEQLR L +E  EGG      + PFRGD      + N+   +  ++N++G +YE  
Sbjct  353   VRASEEQLRELRREAAEGGQGHRWPLPPFRGDSRD---TFNLLEQRPKIANRHGRLYEAD  409

Query  674   TTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------  522
                F  L   DV  A  NIT G M  P+ N+++ ++AVVLEGEG +++ CP         
Sbjct  410   ARSFHALANQDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVQIVCPHLGRESESE  469

Query  521   ---------------------------------KNNYQTVRSKLKTGMVVVIPPGYPYVN  441
                                              +  Y+TVR+++  G   V+PPG+P V 
Sbjct  470   REHGKGRRREEEEDDQRQQRRRGSESESEEEEEQQRYETVRARVSRGSAFVVPPGHPVVE  529

Query  440   VATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFG  261
             +++S  S +LQ   F+IN   NERV LAG NN+  KLG+ A++L+F  G     V  VF 
Sbjct  530   ISSSQGSSNLQVVCFEINAERNERVWLAGRNNVIGKLGSPAQELTF--GRPAREVQEVFR  587

Query  260   SQPLELFFKAPP  225
             +Q  +  F A P
Sbjct  588   AQDQDEGFVAGP  599



>ref|XP_009605859.1| PREDICTED: vicilin-like antimicrobial peptides 2-1 [Nicotiana 
tomentosiformis]
Length=440

 Score =   210 bits (535),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 202/362 (56%), Gaps = 23/362 (6%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+ + F ++  S    FR+L +F++RS+L  G++ Y +A L  E  +F+ P+H DAE
Sbjct  43    PYLFESQRFRSRFKSKHGEFRVLEKFTERSELLGGLEKYGVAVLEFEPLSFMFPHHCDAE  102

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  VV GRG++++  Q+ K SFN+  GDV+R+  G+T Y++N +N ++  +  ++L ++
Sbjct  103   IILFVVRGRGTISIAEQEEKNSFNLENGDVIRVNAGSTIYMINRNNNERFFV--YVLAKT  160

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG+FQ +    G+ P SF+  FS E LE A N   +TI+  LFG+ Q +G F+K +E
Sbjct  161   VNIPGQFQEYFSGGGENPESFYRAFSSEILETAFNIPRDTIEG-LFGQ-QRKGIFVKASE  218

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEVD  642
             EQ+R++S+       +  RG         N+   +  + N++G  +E     F+ L ++D
Sbjct  219   EQIRAISEHASRSTKQQTRG-------PFNLLNERPLLGNRFGQYFEATPERFEQLRDLD  271

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------NNYQTVRSKL  489
               A  +NI +GGML P + +R T   +V+EG G  EM CP           +YQ V+  L
Sbjct  272   AAAGIMNINQGGMLLPVYCTRTTWFVMVVEGNGRFEMACPHLGSQSQRQGRHYQKVQGSL  331

Query  488   KTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDL  309
               G V++I  G+P   VAT +    L+      N   N    LAG  +++  +   AK++
Sbjct  332   SVGDVLIIRAGHPITVVATGD--SDLRMVGIGFNAHNNRMNFLAGRQSIWRNIDREAKEV  389

Query  308   SF  303
             SF
Sbjct  390   SF  391



>ref|NP_001276308.1| sucrose-binding protein precursor [Glycine max]
 sp|Q04672.1|SBP_SOYBN RecName: Full=Sucrose-binding protein; Short=SBP; Flags: Precursor 
[Glycine max]
 gb|AAB03894.1| glucose binding protein [Glycine max]
Length=524

 Score =   212 bits (539),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 129/383 (34%), Positives = 211/383 (55%), Gaps = 28/383 (7%)
 Frame = -2

Query  1358  PFVFQRE-EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P++F+ + +FET+  +     R+L +F+++S L +GI+++RLA L   + TFV P H D+
Sbjct  109   PYIFEEDKDFETRVETEGGRIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDS  168

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E +   + GR  + ++ +   E   +  GD++ IP GT  YIVN D   K+ L    +  
Sbjct  169   EVVFFNIKGRAVLGLVSESETEKITLEPGDMIHIPAGTPLYIVNRDENDKLFLAMLHIPV  228

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             S+STPG+F+ F    G+ P S  + FS   L+AAL T    ++ V   + Q EG   +++
Sbjct  229   SVSTPGKFEEFFAPGGRDPESVLSAFSWNVLQAALQTPKGKLENVF--DQQNEGSIFRIS  286

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP--LD  651
              EQ+R+L+    +    PF G+   +    N+F  + T+SN YG + EVG    +   L 
Sbjct  287   REQVRALA-PTKKSSWWPFGGESKPQ---FNIFSKRPTISNGYGRLTEVGPDDDEKSWLQ  342

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN--------------N  513
              +++   F NIT+  M    +NS AT++A+V++G G L++ CP                +
Sbjct  343   RLNLMLTFTNITQRSMSTIHYNSHATKIALVIDGRGHLQISCPHMSSRSSHSKHDKSSPS  402

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLK  333
             Y  + S LK GMV V+PPG+P+V +A++   ++L    F++N R N++ T AG +N+   
Sbjct  403   YHRISSDLKPGMVFVVPPGHPFVTIASNK--ENLLMICFEVNARDNKKFTFAGKDNIVSS  460

Query  332   LGNAAKDLSFAAGSDKESVNVVF  264
             L N AK+L+F   S  E VN VF
Sbjct  461   LDNVAKELAFNYPS--EMVNGVF  481



>gb|AAF05723.1|AF191299_1 sucrose binding protein homolog S-64 [Glycine max]
Length=489

 Score =   211 bits (536),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 135/392 (34%), Positives = 218/392 (56%), Gaps = 29/392 (7%)
 Frame = -2

Query  1364  QYPFVFQRE-EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHE  1188
             Q P+VF+ + +F T+  +     R+L +F+++S L +G +++RLA L   + TFV P H 
Sbjct  96    QNPYVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGNENFRLAILEARAHTFVSPRHF  155

Query  1187  DAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL  1008
             D+E +   + GR  + ++R+   E   +  GD++ IP GT  YIVN D  +K+ L    +
Sbjct  156   DSEVVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKLLLAMLHI  215

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLK  828
                +STPG+F+ F G  G+ P S  + FS   L+AAL T    ++R LF + Q EG   K
Sbjct  216   --PVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLER-LFNQ-QNEGSIFK  271

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-L  654
             ++ E++R+L+    +    PF G+  ++    N+F  + T SN YG + EVG    K  L
Sbjct  272   ISRERVRALA-PTKKSSWWPFGGESKAQ---FNIFSKRPTFSNGYGRLTEVGPDDEKSWL  327

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------------N  513
               +++   F NIT+  M    +NS AT++A+V++G G L++ CP               +
Sbjct  328   QRLNLMLTFTNITQRSMSTIHYNSHATKIALVMDGRGHLQISCPHMSSRSDSKHDKSSPS  387

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLK  333
             Y  + + LK GMV V+PPG+P+V +A++   ++L    F++N R N++ T AG +N+   
Sbjct  388   YHRISADLKPGMVFVVPPGHPFVTIASNK--ENLLIICFEVNVRDNKKFTFAGKDNIVSS  445

Query  332   LGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             L N AK+L+F   S  E VN VF  +   LFF
Sbjct  446   LDNVAKELAFNYPS--EMVNGVFERKE-SLFF  474



>gb|AEO27684.1| seed storage protein vicilin A, partial [Gossypium hirsutum]
Length=537

 Score =   211 bits (538),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 139/409 (34%), Positives = 209/409 (51%), Gaps = 46/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F R  F+ +       FR+L RF+ +  L  GI ++R+A L     TFV+P+H DAE
Sbjct  127   PYYFHRRSFQERFREEHGNFRVLQRFAAKHHLLRGINEFRIAILEANPNTFVLPHHCDAE  186

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+RIP G+T Y+ N DN +K  L   +L R 
Sbjct  187   KIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREK--LTIAVLHRP  244

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+FQ F  +  + P S+   FSRE LEA  NT+ E +  +  G       Q +G F
Sbjct  245   VNNPGQFQKFFPSGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF-K  660
              K ++EQ+R+LSQE         RG + S+  + N+       SNQ G  YE    +F +
Sbjct  305   RKASQEQIRALSQEATSP-----RG-KGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQ  358

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L EVD +     I +G +  P +NS+AT V +V +G G +EM CP              
Sbjct  359   QLQEVDSSVVAFEINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREQ  418

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                              Y+ VR++L TG + V+P G+P   VA+ N +  L  G+   NG
Sbjct  419   EEQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGL-LGFGLYNG  477

Query  383   RGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             + N+R+ +AG  N   +    AK+L+F  G +   V+ VF + P E +F
Sbjct  478   QDNKRIFVAGKTNNVRQWDRQAKELAF--GVESRLVDEVFNNNPQESYF  524



>ref|NP_001237244.1| sucrose-binding protein 2 precursor [Glycine max]
 gb|AAO48716.1| sucrose-binding protein 2 [Glycine max]
Length=489

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 126/368 (34%), Positives = 208/368 (57%), Gaps = 26/368 (7%)
 Frame = -2

Query  1358  PFVFQRE-EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+VF+ + +F T+  +     R+L +F+++S L +GI+++RLA L   + TFV P H D+
Sbjct  98    PYVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDS  157

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E +   + GR  + ++R+   E   +  GD++ IP GT  YIVN D  +K+ L    +  
Sbjct  158   EVVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKLLLAMLHI--  215

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              +STPG+F+ F G  G+ P S  + FS   L+AAL T    ++R LF + Q EG   K++
Sbjct  216   PVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLER-LFNQ-QNEGSIFKIS  273

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-LDE  648
              E++R+L+    +    PF G+  ++    N+F  + T SN YG + EVG    K  L  
Sbjct  274   RERVRALA-PTKKSSWWPFGGESKAQ---FNIFSKRPTFSNGYGRLTEVGPDDEKSWLQR  329

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------------NYQ  507
             +++   F NIT+  M    +NS AT++A+V++G G L++ CP               +Y 
Sbjct  330   LNLMLTFTNITQRSMSTIHYNSHATKIALVMDGRGHLQISCPHMSSRSDSKHDKSSPSYH  389

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              + + LK GMV V+PPG+P+V +A++   ++L    F++N R N++ T AG +N+   L 
Sbjct  390   RISADLKPGMVFVVPPGHPFVTIASNK--ENLLIICFEVNVRDNKKFTFAGKDNIVSSLD  447

Query  326   NAAKDLSF  303
             N AK+L+F
Sbjct  448   NVAKELAF  455



>ref|XP_011032788.1| PREDICTED: vicilin-like antimicrobial peptides 2-1 [Populus euphratica]
Length=546

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/404 (32%), Positives = 215/404 (53%), Gaps = 38/404 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+    +T+  +     R+L +F+ +S L  G+++ R+A +    Q F+ P H DA 
Sbjct  143   PYVFEDRHLKTEVETEHGRVRVLQKFTKKSKLLRGLENIRVAIIEANPQAFIAPTHLDAG  202

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             F+  V  GRG++ +I ++ K+++++  GDV R+P GTT Y+VN D  +K  L    ++  
Sbjct  203   FVLFVAKGRGAITLIHEEDKQTYSLERGDVFRVPAGTTFYMVNKDENEK--LRVAKILWP  260

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ P  F  F GA G+   SFF  FS E LEAAL T    ++R+     Q++G  +K ++
Sbjct  261   VNLPDNFNAFHGAGGEDAESFFKAFSWELLEAALKTDRGRLERIF---KQQQGGIVKASK  317

Query  818   EQLRSL----SQEGDEGGIRPFRGDETSKNRSINVFPHKTVS-NQYGVIYEVGTTHFKPL  654
             EQ+++L          GG+ PF    +S     N+F    V  N YG ++E      + L
Sbjct  318   EQIQALGQGEEGGHGGGGLWPFPTGGSSG--PFNIFDKGPVKRNNYGQLFEARPKDSEQL  375

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN-------------  513
              ++D+  +  NIT G M GP++NS+AT +++V+EGEG+ EM CP+++             
Sbjct  376   RDLDLIVSSANITRGSMAGPYYNSKATMISIVMEGEGYFEMACPRDSSSGSSMGYIESEG  435

Query  512   ---------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTL  360
                      YQ   S+L    V ++P G+P   +A+ N   +L+   F++  +GN R  L
Sbjct  436   SRRGKGGQTYQRTSSRLSRSSVFIVPAGHPVATMASEN--SNLEVLSFEVYAKGNVRYPL  493

Query  359   AGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             AG  N+  ++   AK+L++  G   + V+ +FG Q  E FF  P
Sbjct  494   AGKWNVIGEMDREAKELAY--GVPAKEVDQIFGKQQEEFFFPGP  535



>ref|XP_008439368.1| PREDICTED: vicilin [Cucumis melo]
Length=735

 Score =   214 bits (544),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 140/417 (34%), Positives = 217/417 (52%), Gaps = 58/417 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ FQ  +F+++  S +  +R+L RFS+RS+L  G+K+ RLA L    QTF++P+H DAE
Sbjct  312   PYYFQERQFQSRFRSDQGQWRVLERFSERSELLRGLKNQRLAILEARPQTFIIPHHIDAE  371

Query  1178  FICTVVLGRGSVAVIRQD----GKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI  1011
              +  VV GR ++  I Q+     KES+N+  GDV+ IP GTT Y+ N +N     L+   
Sbjct  372   SVLFVVKGRATITTIVQERKETRKESYNVERGDVVTIPAGTTVYLANQENED---LQIVK  428

Query  1010  LIRSISTPGRFQ-FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPF  834
             LI+ ++ PG F+ + SG  G +  S+++ FS + LEAALN   + ++R+     +  G  
Sbjct  429   LIQPVNNPGEFKDYLSG--GGEAQSYYSVFSNDVLEAALNIPRDRLERIFKQRGERRGKI  486

Query  833   LKVTEEQLRSLSQEG---DEGGIRPFRGDETSKNRSINVFPHKT--VSNQYGVIYEVGTT  669
             ++ ++EQL++LSQ      +GG    RG      RS+     ++   +NQYG +YE    
Sbjct  487   IRASQEQLKALSQRATSVKKGG----RG-----ARSLIKLESQSPVYNNQYGQMYEACPD  537

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----------  522
              F  L   DV  + ++I +GGM+ P FNSRAT V  V EG G  EMGCP           
Sbjct  538   EFPQLRRTDVATSVLDIKQGGMMVPHFNSRATWVVFVSEGTGSFEMGCPHVQGSQWQRGR  597

Query  521   -------------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGW  399
                                    + +  +L  G V+VIP G+P   +A+  P+++L+   
Sbjct  598   REEERQWRREEEKELSDERSGRIERIAGRLSQGGVLVIPAGHPIAIMAS--PNENLRLVG  655

Query  398   FDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             F IN   N+R  LAG  N+  ++   AK+L+F    + +     F SQ    F + P
Sbjct  656   FGINAENNKRNFLAGRENIMNEVDREAKELTFNV--EGKQAEETFKSQKESFFTEGP  710



>emb|CAA72090.1| P54 protein [Pisum sativum]
Length=483

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/393 (33%), Positives = 225/393 (57%), Gaps = 30/393 (8%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             + P+VF+  +FET+  + +    +L +F+++S L + I++Y LA L +++  F+ P+H D
Sbjct  88    ENPYVFEDNDFETKIDTKDGRVLILNKFNEKSKLLKNIENYGLAVLEIKANAFLSPHHYD  147

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             +E I   + GRG + ++ +D  E FN+ EGD++R+P GT  Y+VN D  +K+ +  F + 
Sbjct  148   SEAILFNIKGRGIIGLVAEDRTERFNLEEGDIMRVPAGTPMYLVNRDENEKLYIAAFHMP  207

Query  1004  RSI-STPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLK  828
              S  S P   + F  +AG+KP S  N FS + L+AAL +    ++ VL  + Q++G   K
Sbjct  208   PSSGSAPVNLEPFFESAGRKPESVLNTFSSKVLQAALKSSKGELETVL--DEQKKGRIFK  265

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP-L  654
             + +E +R L+    +  + PF G   S     N+F +    SN++G ++EVG +  K  L
Sbjct  266   IEKEDVRGLAP---KKSLWPFGGPFKS---PFNIFSNNPAFSNKFGSLFEVGPSQEKSGL  319

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN--------------  516
             + +++     NIT+G M    +N+ A ++A+V++GEG LEM CP                
Sbjct  320   EGLNLMLTLANITKGSMSTIHYNTNANKIALVIDGEGELEMACPHMPSSSSNSRQKKSSI  379

Query  515   NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFL  336
             +Y  + +KL+ G++ V+P G+P+VN+A+    K+L    F++N + N+++ LAG  N+  
Sbjct  380   SYHNINAKLRPGVMFVVPAGHPFVNIASK--KKNLIVVCFEVNAQRNKKLALAGKKNIVS  437

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
              L  AAK+++F   ++K  V+ VF  +  E FF
Sbjct  438   ALDKAAKEVAFDIAAEK--VDEVFERKE-EFFF  467



>ref|XP_010108323.1| Vicilin-like antimicrobial peptides 2-1 [Morus notabilis]
 gb|EXC18944.1| Vicilin-like antimicrobial peptides 2-1 [Morus notabilis]
Length=914

 Score =   212 bits (539),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 128/382 (34%), Positives = 205/382 (54%), Gaps = 39/382 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+    +++  + E   ++L   S RS+L +G+K+YR+  L     TFVVP+H DA+
Sbjct  497   PYHFRSHRLQSRYRTEEGHLKVLEMLSRRSELLKGLKNYRIVVLEANPNTFVVPHHCDAD  556

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G+G+++++RQ+ KES+NI   DV+ +  G+T Y+VN  N    PL+   L+  
Sbjct  557   SVLVVTRGKGTISIVRQNNKESYNIERADVITVLAGSTVYLVNDQN---EPLQITKLVTP  613

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-------EG  840
             ++ PG+F+ +    G+ P S+F  FS   L++ L+   E I+R L GE +E        G
Sbjct  614   VNIPGQFEEYYPGGGENPQSYFKAFSTNILKSTLSATEEQIER-LIGEQREGRRQLQRPG  672

Query  839   PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFK  660
                + ++EQL++L+Q       R   G +T+   S++     T SN YG  YE      K
Sbjct  673   FIKRASQEQLQALTQHA--SSPRRKGGRQTTGPISLHSLS-PTYSNNYGKFYEATPEDNK  729

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN------------  516
              L+E+DV  A+ ++ +G +  P FNS+ T + +V+EGEG +EM CP              
Sbjct  730   QLEEMDVLVAWTDLKQGSIFVPHFNSKTTVLVMVVEGEGRMEMACPHLARQKRQQWGGRE  789

Query  515   -----------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                         YQ V S L  G V +IP G+P   VA+SN  ++L+   F +N R NER
Sbjct  790   EEEKERQTSTWQYQKVTSHLSAGDVFIIPAGHPISVVASSN--QNLRMVGFGVNARNNER  847

Query  368   VTLAGTNNLFLKLGNAAKDLSF  303
               +AG +N+  +L   AK+L+F
Sbjct  848   TFIAGKDNVIKQLEREAKELAF  869



>ref|XP_004134437.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=863

 Score =   211 bits (537),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 217/419 (52%), Gaps = 61/419 (15%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ FQ  +F+++  S +  +R+L RFS+RS+L +G+K+ RLA L    QTF++P+H DAE
Sbjct  258   PYYFQERQFQSRFRSDQGEWRVLERFSERSELLKGLKNQRLAILEARPQTFIIPHHIDAE  317

Query  1178  FICTVVLGRGSVAVIRQDG----KESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI  1011
              +  VV GR ++  I Q+     KES+N+  GDV+ IP GTT Y+ N +N +   L+   
Sbjct  318   SVLLVVKGRATITTIVQEKKETRKESYNVECGDVITIPAGTTVYLANQENEE---LQIVK  374

Query  1010  LIRSISTPGRFQ-FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPF  834
             LI+ I+ PG F+ + SG  G +  ++++ FS + LEAALN   + ++R+   + +  G  
Sbjct  375   LIQPINNPGEFKDYLSG--GGESQAYYSVFSNDVLEAALNIPRDRLERIFKQKSERRGKI  432

Query  833   LKVTEEQLRSLSQ------EGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGT  672
             ++ + EQL++LSQ      +G +G     + +  S             +NQYG +YE   
Sbjct  433   IRASREQLKALSQRATSVKKGGQGARAVIKLESQS----------PVYNNQYGQMYEACP  482

Query  671   THFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------  519
               F  L   DV  + ++I +GGM+ P FNSRAT V  V +G G  EMGCP          
Sbjct  483   DEFPQLRRTDVATSVLDIKQGGMMVPHFNSRATWVVFVSKGTGSYEMGCPHIQGSQWQRG  542

Query  518   ----------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
                                   +  + +  +L  G V+VIP G+P   +A+  P+++L+ 
Sbjct  543   RREEERQWRREEERERSDERSSSRIERIAGRLSQGGVLVIPAGHPIAIMAS--PNENLRL  600

Query  404   GWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               F IN   N+R  LAG  N+  ++   AK+L+F    + +     F SQ    F + P
Sbjct  601   VGFGINAENNKRNFLAGRENIMNEVDREAKELAFNV--EGKQAEETFKSQKESFFTEGP  657



>ref|XP_004162195.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=453

 Score =   205 bits (521),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 190/354 (54%), Gaps = 33/354 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  E F  Q  +GE   ++L +F+ RS L  GI+++R++ +     TFVVP H DAE
Sbjct  87    PYVFDDEHFVGQVETGEGKIKVLQKFTQRSQLLRGIENFRVSIVEANPSTFVVPTHFDAE  146

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++ VI++  + SF +  GDV RIP G   Y +N D  +K  L+   L++S
Sbjct  147   IILFVAQGRGTITVIKEK-RGSFELKCGDVFRIPSGAPFYFINKDEHRK--LKIVKLLQS  203

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
              S PG FQ F  A G+ P SF+  FS + LEAA     + ++R  F + Q+ G  +K + 
Sbjct  204   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLER--FFKQQKPGTIIKASR  261

Query  818   EQLRSLSQ-EGDEGGIRPFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHFKPLDEV  645
             EQ+RSLS+ E     I PF   ET  +R  N+   H   SN++G ++E     F  L ++
Sbjct  262   EQIRSLSRHEEIIPKIWPFSEGET--DRPFNLLKQHPCQSNKFGRLFEAYPDEFSQLRDL  319

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
              V  AF NITEG M+ P +NS++ ++AVVL+G+G  +M CP                   
Sbjct  320   GVAIAFANITEGSMVAPHYNSKSMKIAVVLDGQGGFQMACPHLSSSSRRSGRWSEREEER  379

Query  518   ---NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERV  366
                  YQ +R +L  G+V V+P G    N+     S + + G F+  GR  ER+
Sbjct  380   KGERTYQKIRGRLSRGVVFVVPAGKE--NIVNKMESIARELG-FNTPGREVERM  430



>gb|AGU37285.1| 7S globulin precursor isoform 2, partial [Ficus pumila var. awkeotsang]
Length=676

 Score =   209 bits (532),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 211/384 (55%), Gaps = 41/384 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+  + +  +++  + E   ++L + S RS+L +G+++YR+  L     TFVVP+H DA+
Sbjct  255   PYHIRSQRLQSRYRTDEGHLKVLEKLSSRSELLKGLENYRIVVLEANPNTFVVPHHCDAD  314

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  GRG+++++RQ+ KES+NI   DV+ +  G+T Y+VN D+ ++  L+   L+ S
Sbjct  315   SVLVVTRGRGTISIVRQNNKESYNIECADVITVRAGSTVYLVNDDDNER--LQITKLVTS  372

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL----FGEPQEEGP-F  834
             ++ PG+F+ +  A G  P S+F  FS   L+  L+   + I+R++     G  Q + P F
Sbjct  373   VNIPGQFEEYFAAGGDNPQSYFKAFSTNILKRTLSATEDQIERLIGQQSQGRRQLQRPGF  432

Query  833   LK-VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSI-NVFPHKTVSNQYGVIYEVGTTHFK  660
             +K  ++EQLR+L+Q          RG E++   S+ N  P    SN YG  YE      K
Sbjct  433   IKRASQEQLRALTQHASSP---RRRGRESTGPISLRNQSP--LYSNNYGKFYEASPEDNK  487

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L ++DV+ ++ ++ +G +  P +NSR T + +V+EGEG +EM CP              
Sbjct  488   QLHDMDVHVSWTDLEQGSIFVPHYNSRTTVLCMVVEGEGEMEMACPHLSRQRRQREWGQE  547

Query  518   ------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                         + YQ V ++L  G V +IP G+P   VA+ N  ++L+   F +N + N
Sbjct  548   EEEEEEMQTSTGSRYQKVTARLSQGDVFIIPAGHPISVVASGN--RNLKMVGFGVNAKNN  605

Query  374   ERVTLAGTNNLFLKLGNAAKDLSF  303
             ER  +AG +N+  +L   AK+L+F
Sbjct  606   ERYFIAGKDNMIKQLEREAKELAF  629



>gb|AFM30909.1| globulin-3A [Triticum aestivum]
Length=588

 Score =   207 bits (528),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 143/435 (33%), Positives = 212/435 (49%), Gaps = 71/435 (16%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF    F     S     + L  F + S L  GI++YR+A + V  + FVVP   DA+
Sbjct  133   PYVFGPRSFRRIIRSDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDAD  192

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + VI    K S+ + +GDV+  P G+  ++ NTD  +K  L    ++ +
Sbjct  193   GVGYVAQGEGVLTVIENGEKRSYTVRQGDVIVAPAGSIMHLANTDGRRK--LVIAKILHT  250

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL---FGEPQEEG--PF  834
             IS PG+FQ+FS     KP       S+  L AAL T  E +  +L    G+ +EE     
Sbjct  251   ISVPGKFQYFSA----KP--LLASLSKRVLTAALKTSDERLGSLLGSRQGKEEEEKSISI  304

Query  833   LKVTEEQLRSL---SQEGDEGG---IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVG  675
             ++ +EEQLR L   + EGD+G    + PFRGD      + N+   +  ++N++G +YE  
Sbjct  305   VRASEEQLRELRRQASEGDQGHHWPLPPFRGDSRD---TFNLLEQRPKIANRHGRLYEAD  361

Query  674   TTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------  522
                F  L + DV  A  NIT G M  P+ N+++ ++AVVLEGEG +E+ CP         
Sbjct  362   ARSFHALAQHDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVEIVCPHLGRDSERR  421

Query  521   -----------------------------------KNNYQTVRSKLKTGMVVVIPPGYPY  447
                                                +  Y+TVR+++  G   V+PPG+P 
Sbjct  422   EQEHGKGRWRSEEEEDDRRQQRRRGSGSESEEEQDQQRYETVRARVSRGSAFVVPPGHPV  481

Query  446   VNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVV  267
             V +A+S  S +LQ   F+IN   NERV LAG NN+  KL + A++L+F  G     V  V
Sbjct  482   VEIASSRGSSNLQVVCFEINAERNERVWLAGRNNVIAKLDDPAQELAF--GRPAREVQEV  539

Query  266   FGS--QPLELFFKAP  228
             F +  Q  E F   P
Sbjct  540   FRAKDQQDEGFVAGP  554



>gb|ACJ65514.1| globulin 3 [Triticum aestivum]
Length=588

 Score =   207 bits (528),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 143/435 (33%), Positives = 212/435 (49%), Gaps = 71/435 (16%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF    F     S     + L  F + S L  GI++YR+A + V  + FVVP   DA+
Sbjct  133   PYVFGPRSFRRIIRSDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDAD  192

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + VI    K S+ + +GDV+  P G+  ++ NTD  +K  L    ++ +
Sbjct  193   GVGYVAQGEGVLTVIENGEKRSYTVRQGDVIVAPAGSIMHLANTDGRRK--LVIAKILHT  250

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL---FGEPQEEG--PF  834
             IS PG+FQ+FS     KP       S+  L AAL T  E +  +L    G+ +EE     
Sbjct  251   ISVPGKFQYFSA----KP--LLASLSKRVLTAALKTSDERLGSLLGSRQGKEEEEKSISI  304

Query  833   LKVTEEQLRSL---SQEGDEGG---IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVG  675
             ++ +EEQLR L   + EGD+G    + PFRGD      + N+   +  ++N++G +YE  
Sbjct  305   VRASEEQLRELRRQASEGDQGHHWPLPPFRGDSRD---TFNLLEQRPKIANRHGRLYEAD  361

Query  674   TTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------  522
                F  L + DV  A  NIT G M  P+ N+++ ++AVVLEGEG +E+ CP         
Sbjct  362   ARSFHALAQHDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVEIVCPHLGRDSERR  421

Query  521   -----------------------------------KNNYQTVRSKLKTGMVVVIPPGYPY  447
                                                +  Y+TVR+++  G   V+PPG+P 
Sbjct  422   EQEHGKGRWRSEEEEDDRRQQRRRGSGSESEEEQDQQRYETVRARVSRGSAFVVPPGHPV  481

Query  446   VNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVV  267
             V +A+S  S +LQ   F+IN   NERV LAG NN+  KL + A++L+F  G     V  V
Sbjct  482   VEIASSRGSSNLQVVCFEINAERNERVWLAGRNNVIAKLDDPAQELTF--GRPAREVQEV  539

Query  266   FGS--QPLELFFKAP  228
             F +  Q  E F   P
Sbjct  540   FRAKDQQDEGFVAGP  554



>ref|XP_004146991.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=453

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 189/354 (53%), Gaps = 33/354 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  E F  Q  +GE   ++L +F+ RS L  GI+++R++ +     TFVVP H DAE
Sbjct  87    PYVFDDEHFVGQIETGEGKIKVLQKFTQRSHLLRGIENFRVSIVEANPSTFVVPTHFDAE  146

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++ VI++  + SF +  GDV RIP G   Y +N D  +K  L+   L++S
Sbjct  147   IILFVAQGRGTITVIKEK-RGSFELKCGDVFRIPSGAPFYFINKDEHRK--LKIVKLLQS  203

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
              S PG FQ F  A G+ P SF+  FS + LEAA     + ++R  F + Q+ G  +K + 
Sbjct  204   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLER--FFKQQKPGTIIKASR  261

Query  818   EQLRSLSQ-EGDEGGIRPFRGDETSKNRSINVFP-HKTVSNQYGVIYEVGTTHFKPLDEV  645
             EQ+RSLS+ E     I PF   ET   R  N+   H   SN++G ++E     F  L ++
Sbjct  262   EQIRSLSRHEEIIPKIWPFSEGET--ERPFNLLKQHPCQSNKFGRLFEAYPDEFSQLRDL  319

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
              V  AF NITEG M+ P +NS++ ++AVVL+G+G  +M CP                   
Sbjct  320   GVAIAFANITEGSMVAPHYNSKSMKIAVVLDGQGGFQMACPHLSSSSRRSGRWSEREEER  379

Query  518   ---NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERV  366
                  YQ +R +L  G+V V+P G    N+     S + + G F+  GR  ER+
Sbjct  380   KGERTYQKIRGRLSRGVVFVVPAGKE--NIVNKMESIARELG-FNTPGREVERM  430



>emb|CAC27161.1| putative sucrose binding protein [Vicia faba var. minor]
Length=482

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/390 (33%), Positives = 216/390 (55%), Gaps = 28/390 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ ++FET+  + +    +L +F ++S L + I++Y LA L +++  F+ P+H D+E
Sbjct  90    PYVFENKDFETKIDTKDGRILILNKFHEKSKLLKNIENYGLAVLEIKANAFLSPHHYDSE  149

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I   + G+G + ++ +D  E FN+ EGD++R+P GT TY+VN D  +K+ +  F L  S
Sbjct  150   AILFNIKGKGIIGLVAEDQTERFNLEEGDLIRVPAGTPTYLVNRDENEKLLIAAFHLPPS  209

Query  998   I-STPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
               S P   + F  + G++P S  + FS + L+AAL +    ++ VL  + Q++G   K+ 
Sbjct  210   SGSAPVNLEPFFESGGRRPESVLSTFSSKVLQAALKSSERELETVL--DEQQKGRIFKIA  267

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKP-LDEV  645
             +E + SL+    +  + PF G         N  P    SNQ+G ++EVG +  K  L+ +
Sbjct  268   KEDVLSLAP---KRSLWPFGGTFKGPFNIRNNNP--AFSNQFGTLFEVGPSLEKTGLEGL  322

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------NNYQ  507
             ++   F NIT+G M    +N+ A ++A V+ GEG  EM CP                +Y 
Sbjct  323   NLMLTFANITKGSMSTIHYNTNANKIAFVVNGEGDFEMACPHMPSSSSNSKQKKSSISYH  382

Query  506   TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLG  327
              + +KLK GMV V+P G+PYVN+A+     +L    F++N + N+++  AG  N+   L 
Sbjct  383   NINAKLKPGMVFVVPAGHPYVNIASK--KNNLLILCFEVNAQRNKKLAFAGKKNIMSALD  440

Query  326   NAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
               AK+L+F   + K  V+ +F  +  ELFF
Sbjct  441   KTAKELAFDLAAQK--VDKIFERKE-ELFF  467



>gb|KDP40207.1| hypothetical protein JCGZ_02205 [Jatropha curcas]
Length=572

 Score =   206 bits (523),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/397 (33%), Positives = 207/397 (52%), Gaps = 50/397 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  +  +++  + E    +L +FSDRS+L  GI++YRL+ L     TFVVP+H DAE
Sbjct  188   PYYFHAQRLQSRHKTQEGHISVLEKFSDRSELLRGIENYRLSTLEANPNTFVVPHHCDAE  247

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+G++  + +D + S+N+ +GDV+RIP G T Y++N DN +K  L    L++ 
Sbjct  248   SIIVVLRGKGTITCVLRDERRSYNLEKGDVIRIPAGATLYLINRDNNEK--LNMVKLMQP  305

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +++PG F+                F  + LEAAL+T  + + R LFG+ Q +G  LK ++
Sbjct  306   VNSPGNFRTV--------------FINDVLEAALDTPRDQLDR-LFGQ-QRQGVILKASQ  349

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVD  642
             E L++LSQ      I   +       R  N+   + + SN++G   E        L +VD
Sbjct  350   EHLKALSQH-----ISSTKQKGHESERPFNLLNRQPLYSNRFGNFIEAS------LQDVD  398

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----------------NNY  510
             ++ ++  I  G ++ P +NS+AT +A+V+EG G  EM CP                   Y
Sbjct  399   ISVSYAEIKRGALMVPHYNSKATMIALVVEGAGRFEMACPHLASQRMEPREEPPEGTRQY  458

Query  509   QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKL  330
             Q + S L  G V + P G+P   +A+ N  ++L    F IN R N+R  LAG +N+  ++
Sbjct  459   QKISSDLSPGDVFITPAGHPVAVLASQN--QNLILIGFAINARDNQRNFLAGRDNIMNQI  516

Query  329   GNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSS  219
                AK+LSF   S  E +  +F +Q    F  A   S
Sbjct  517   EREAKELSF--NSPAELIEKIFRNQKESHFVAARQQS  551



>emb|CAA44873.1| vicilin-like storage protein [Picea glauca]
Length=448

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 127/398 (32%), Positives = 199/398 (50%), Gaps = 34/398 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  + F T+A+S     R LP F + S+L EGI+ +R+  + ++  T ++P++ DA 
Sbjct  52    PYVFHSDSFRTRASSEAGEIRALPNFGEVSELLEGIRKFRVTCIEMKPNTVMLPHYIDAT  111

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V  GRG +A + Q+      + EGDV  +P G T Y+VN D+     L    L+R 
Sbjct  112   WILYVTRGRGYIAYVHQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNT--LRIASLVRP  169

Query  998   IST-PGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             +ST  G +Q F  A G+ P + ++ FS + LEAA NT  + ++R+  G   + G  +   
Sbjct  170   VSTVRGEYQPFYVAGGRNPQTVYSAFSDDVLEAAFNTNVQQLERIFGG--HKSGVIIHAN  227

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKT----VSNQYGVIYEVGTTHFKPL  654
             EEQ+R + ++      R F     S       F  +       N+ G     G  ++  L
Sbjct  228   EEQIREMMRK------RGFSAGSMSAPEHPKPFNLRNQKPDFENENGRFTIAGPKNYPFL  281

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
             D +DV+    ++  G M  P  NS++T + +V  GEG +EM CP                
Sbjct  282   DALDVSVGLADLNPGSMTAPSLNSKSTSIGIVTNGEGRIEMACPHLGQHGWSSPRERGDQ  341

Query  518   -NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNL  342
                YQ V +KL+TG V ++P G+P   +A++N    LQ  WFD+N RGNER  LAG NN+
Sbjct  342   DITYQRVWAKLRTGSVYIVPAGHPITEIASTN--SRLQILWFDLNTRGNERQFLAGKNNV  399

Query  341   FLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                L    + LSF     +E +  V  +Q  ++  + P
Sbjct  400   LNTLEREIRQLSFNVPRGEE-IEEVLQAQKDQVILRGP  436



>gb|KGN56960.1| hypothetical protein Csa_3G146460 [Cucumis sativus]
Length=927

 Score =   209 bits (531),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/419 (33%), Positives = 218/419 (52%), Gaps = 61/419 (15%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ FQ  +F+++  S +  +R+L RFS+RS+L +G+K+ RLA L    QTF++P+H DAE
Sbjct  505   PYYFQERQFQSRFRSDQGEWRVLERFSERSELLKGLKNQRLAILEARPQTFIIPHHIDAE  564

Query  1178  FICTVVLGRGSVAVIRQDG----KESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFI  1011
              +  VV GR ++  I Q+     KES+N+  GDV+ IP GTT Y+ N +N +   L+   
Sbjct  565   SVLLVVKGRATITTIVQEKKETRKESYNVECGDVITIPAGTTVYLANQENEE---LQIVK  621

Query  1010  LIRSISTPGRFQ-FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPF  834
             LI+ I+ PG F+ + SG  G +  ++++ FS + LEAALN   + ++R+   + +  G  
Sbjct  622   LIQPINNPGEFKDYLSG--GGESQAYYSVFSNDVLEAALNIPRDRLERIFKQKSERRGKI  679

Query  833   LKVTEEQLRSLSQ------EGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGT  672
             ++ + EQL++LSQ      +G +G     + +  S             +NQYG +YE   
Sbjct  680   IRASREQLKALSQRATSVKKGGQGARAVIKLESQS----------PVYNNQYGQMYEACP  729

Query  671   THFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---NNYQT-  504
               F  L   DV  + ++I +GGM+ P FNSRAT V  V +G G  EMGCP    + +Q  
Sbjct  730   DEFPQLRRTDVATSVLDIKQGGMMVPHFNSRATWVVFVSKGTGSYEMGCPHIQGSQWQRG  789

Query  503   ---------------------------VRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
                                        +  +L  G V+VIP G+P   +A+  P+++L+ 
Sbjct  790   RREEERQWRREEERERSDERSSSRIERIAGRLSQGGVLVIPAGHPIAIMAS--PNENLRL  847

Query  404   GWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               F IN   N+R  LAG  N+  ++   AK+L+F    + +     F SQ    F + P
Sbjct  848   VGFGINAENNKRNFLAGRENIMNEVDREAKELAFNV--EGKQAEETFKSQKESFFTEGP  904



>gb|AAB01554.1| vicilin-like storage protein [Picea glauca]
Length=450

 Score =   202 bits (513),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 127/398 (32%), Positives = 200/398 (50%), Gaps = 34/398 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  + F T+A+S     R LP F + S+L  GI+ +R+ F+ ++ +T ++P++ DA 
Sbjct  54    PYVFHSDSFRTRASSEAGEIRALPNFGEVSELLGGIRKFRVTFIEMKPKTVMLPHYIDAT  113

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V  GRG +  + Q+      + EGDV  +P G T Y+VN+D+     L    L+R 
Sbjct  114   WILYVTRGRGYITYVHQNELVKRKLEEGDVFGVPSGHTFYLVNSDDHNT--LRIASLLRP  171

Query  998   IST-PGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             +ST  G +Q F  A G+ P + ++ FS + LEAA NT  + ++R+  G   + G  +   
Sbjct  172   VSTVRGEYQPFYVAGGRNPQTVYSAFSDDVLEAAFNTNVQQLERIFGG--HKSGVIIHPN  229

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKT----VSNQYGVIYEVGTTHFKPL  654
             EEQ+R + ++      R F     S       F  +       N+ G     G  ++  L
Sbjct  230   EEQIREMIRK------RGFSAGSMSAPEHPKPFNLRNQKPDFENENGRFTIAGPQNYPFL  283

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
             D +DV+    ++  G M  P  NS++T + +V  GEG +EM CP                
Sbjct  284   DALDVSVGLADLNPGSMTAPSLNSKSTSIGIVTNGEGRIEMACPHLGQHGWSSPRERGDQ  343

Query  518   -NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNL  342
                YQ V SKL+TG V ++P G+P   +A++N    LQ  WFD+N RGNER  LAG NN+
Sbjct  344   DITYQRVWSKLRTGSVYIVPAGHPITEIASTN--SRLQILWFDLNTRGNERQFLAGKNNV  401

Query  341   FLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                L    + LSF     +E +  V  +Q  ++  + P
Sbjct  402   LNTLEREIRQLSFNVPRGEE-IEEVLQAQKDQVILRGP  438



>pdb|4LEJ|A Chain A, Crystal Structure Of The Korean Pine (pinus Koraiensis) 
Vicilin
Length=407

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/399 (33%), Positives = 199/399 (50%), Gaps = 35/399 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  + F  +A+S     R LP F + S+L EGI  YR+  + ++  T ++P++ DA+
Sbjct  10    PYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAK  69

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V  GRG +A ++Q+      + EGDV  +P G T Y+VN D+     L    L+R+
Sbjct  70    WILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNS--LRIASLLRT  127

Query  998   IST-PGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              ST  G ++ F  A G+ P + ++ FS + LEAA NT  + ++ + FG     G      
Sbjct  128   ESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FG-AHRRGVIFYAN  185

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKT----VSNQYGVIYEVGTTHFKPL  654
             EEQ+R + + G       F  + TS +     F  +       N  G     G      L
Sbjct  186   EEQIREMMRRGG------FSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFL  239

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
             D VDV   F  +  G M  P  N++AT +A+V+EGEG +EM CP                
Sbjct  240   DSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGH  299

Query  518   --NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                NY+ VR++L+TG V V+P G+P   +A++N    L+  WFDIN  GNER  LAG NN
Sbjct  300   QDINYERVRARLRTGTVYVVPAGHPITEIASTN--GRLEILWFDINTSGNEREFLAGKNN  357

Query  344   LFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             +   L    + LSF     +E +  V  +Q  ++  + P
Sbjct  358   VLQTLEKEVRHLSFNIPRGEE-IEEVLQAQKDQVILRGP  395



>ref|XP_004981475.1| PREDICTED: globulin-1 S allele-like [Setaria italica]
Length=455

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 134/417 (32%), Positives = 206/417 (49%), Gaps = 48/417 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F   A S +  FR+L RF+    L + + +YR+A L    + F+ P+H DA+
Sbjct  43    PYHFGEERFRQWAQSRQGRFRVLERFTHEL-LEDAVGNYRVAELEAAPRAFLQPSHYDAD  101

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G VA++ +  +ESF + EGDVL IP G   Y  NT   K       +L+  
Sbjct  102   EVMFVKEGEGVVALLARGKRESFCVKEGDVLVIPAGAVVYSANTHGSKW--FRVVMLLNP  159

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +ST GRF+ F    G+ P SFF+ FS + L+AA NT+ E  ++V   E Q +G     +E
Sbjct  160   VSTKGRFEEFFPIGGESPESFFSVFSDDVLQAAFNTRREEWEQVF--EKQSKGEITTASE  217

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKT--VSNQYGVIYEVGTTHFKPLDEV  645
             EQ+R LS+     G R   G E+  +  +     K    SN +G  YE+       L  +
Sbjct  218   EQIRELSRSCSRTG-RSHGGGESMWDIKLCSLTSKRPLHSNNHGRHYEITGDDCPQLRAL  276

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-------------------  522
             D+     N++ G M  P +++ A ++ VVL+G G+ EM CP                   
Sbjct  277   DIEVGLTNLSRGSMTAPSYSTHADKLFVVLDGSGYFEMACPHLSSGRSSSPRRERGHGSR  336

Query  521   -----------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFD  393
                                 Y+ V+S+++ G V+VIP G+P   VA  +   +L   +F 
Sbjct  337   EWGKEEEEEAEQEGGQKSRGYKQVKSRIREGSVIVIPAGHPMTLVAGED--NNLAVLYFS  394

Query  392   INGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPS  222
             +N R +E+V L G+N L  ++  AAK L+F  G++KE V+ V G+Q   +F + P S
Sbjct  395   VNARHDEKVFLVGSNGLLRQMDEAAKALAF--GAEKEKVDRVIGAQSDAVFLRGPNS  449



>ref|XP_004247670.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=424

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/382 (32%), Positives = 208/382 (54%), Gaps = 22/382 (6%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P++F+   F+++  S    FR+L +F+    L  GI++YR+  L  E ++F++P+H DA+
Sbjct  40    PYLFESHMFKSRFESKHGEFRVLDKFTQ---LLLGIENYRIGVLEFEPRSFLLPHHFDAQ  96

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  +V GRGS+++  +D K SFN+  GDVL +  G+T Y  NTDN +K  +  ++L ++
Sbjct  97    LLLLIVRGRGSISIAEEDEKNSFNLEYGDVLSVSAGSTIYFTNTDNKEKFSV--YVLAKA  154

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             I+ PG+FQ F  A  + P +F+  FS + LE A NT    ++R LFG  Q++G  +K +E
Sbjct  155   INVPGQFQEFFSAGSENPETFYRAFSSDILETAFNTPRSRLER-LFG-LQKQGIIIKASE  212

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             E++R++SQ       R  RG+       +N  P   + N++G  +E     F+ L ++DV
Sbjct  213   EKIRAISQHAS----RSTRGETRGPFNVLNQRP--LIGNRFGQYFEAAPESFQHLMDLDV  266

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-----NYQTVRSKLKTGMV  474
                 +NI +GGM+ P +++R T + +V +G G  EM   ++     + + VR  L  G  
Sbjct  267   AVGIMNINQGGMILPVYSTRTTWLVMVAQGNGRFEMVSSQSQERRGHRKAVRDCLSVGDF  326

Query  473   VVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAG  294
              VIP G+P   +A  N   +L    F ING  +    LAG  +++  +    K+LSF   
Sbjct  327   FVIPAGHPITVIA--NADSNLSMVGFGINGHNSMLNFLAGQESIWRNVNRETKELSFNMP  384

Query  293   SDKESVNVVFGSQPLELFFKAP  228
             + +  V  +  +Q    F  AP
Sbjct  385   ARE--VEEILQNQNESYFVAAP  404



>gb|AHC94918.1| vicilin [Pinus koraiensis]
Length=463

 Score =   200 bits (509),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 131/399 (33%), Positives = 199/399 (50%), Gaps = 35/399 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF  + F  +A+S     R LP F + S+L EGI  YR+  + ++  T ++P++ DA+
Sbjct  66    PYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAK  125

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V  GRG +A ++Q+      + EGDV  +P G T Y+VN D+     L    L+R+
Sbjct  126   WILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNS--LRIASLLRT  183

Query  998   IST-PGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
              ST  G ++ F  A G+ P + ++ FS + LEAA NT  + ++ + FG     G      
Sbjct  184   ESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FG-AHRRGVIFYAN  241

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKT----VSNQYGVIYEVGTTHFKPL  654
             EEQ+R + + G       F  + TS +     F  +       N  G     G      L
Sbjct  242   EEQIREMMRRGG------FSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFL  295

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
             D VDV   F  +  G M  P  N++AT +A+V+EGEG +EM CP                
Sbjct  296   DSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGH  355

Query  518   --NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                NY+ VR++L+TG V V+P G+P   +A++N    L+  WFDIN  GNER  LAG NN
Sbjct  356   QDINYERVRARLRTGTVYVVPAGHPITEIASTN--GRLEILWFDINTSGNEREFLAGKNN  413

Query  344   LFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             +   L    + LSF     +E +  V  +Q  ++  + P
Sbjct  414   VLQTLEKEVRHLSFNIPRGEE-IEEVLQAQKDQVILRGP  451



>ref|XP_002517098.1| Vicilin GC72-A precursor, putative [Ricinus communis]
 gb|EEF45261.1| Vicilin GC72-A precursor, putative [Ricinus communis]
Length=613

 Score =   203 bits (516),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 207/397 (52%), Gaps = 35/397 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  +   +   + E   R+L +FS+ S+L  GI++YRL  L     TF+VPNH DAE
Sbjct  206   PYYFHAQRLRSPFKTDEGHIRVLEKFSESSELLRGIENYRLLLLDAVPNTFIVPNHFDAE  265

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V+ G+ +++ + ++ + S+N+  GDV++IP G T Y+ N DN +   L    LI+ 
Sbjct  266   SLVVVLNGKCTISYVLREKRVSYNLETGDVIKIPAGATVYMSNHDNNEM--LRLATLIQP  323

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG F  FS A G    SF+  FS + LEAAL+T  + + + LFG+ Q +G  +K  +
Sbjct  324   VNIPGEFSSFSAAGGGNLESFYTVFSNDVLEAALDTPRDQLDK-LFGQ-QRQGVIVKAPQ  381

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             +QL++LSQ      +   R    +     N  P    SN+YG ++E      K L ++DV
Sbjct  382   KQLKALSQR-----VSSTRQKGQAPLNLRNQQP--LYSNRYGNLWEASPNDHKQLQDMDV  434

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------N  516
             + ++  I  G ++ P +NSR T + +VLEG G +EM CP                     
Sbjct  435   SVSYAEIKRGSLMVPHYNSRTTTIGLVLEGSGRVEMACPHVASQKQKESQQEQETKGGAE  494

Query  515   NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-NNLF  339
             +Y+ + S L  G V ++P G+P   +A+ N  ++L   WF IN   N R  LAG  +N+ 
Sbjct  495   HYRKISSNLSPGGVFIMPAGHPTALLASQN--ENLLTLWFGINASNNHRNFLAGQRDNVM  552

Query  338   LKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              ++   AK+LSF   +  E +  +F +Q    F   P
Sbjct  553   NQIEIEAKELSFNVPA--ELIEKIFRNQKESHFVAGP  587



>gb|EMS66832.1| Globulin-1 S allele [Triticum urartu]
Length=509

 Score =   198 bits (503),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 136/423 (32%), Positives = 201/423 (48%), Gaps = 72/423 (17%)
 Frame = -2

Query  1316  SGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLGRGSVAV  1137
             S     + L  F + S L  GI++YR+A + V  + FVVP   DA+ +  V  G G + V
Sbjct  66    SDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDADGVGYVAQGEGVLTV  125

Query  1136  IRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQFFSGAA  957
             I    K S+ + +GDV+  P G+  ++ NTD  +K  L    ++ +IS PG+FQ+FS   
Sbjct  126   IENGEKRSYTVRQGDVIVAPAGSIMHLANTDGRRK--LVIAKILHTISLPGKFQYFSA--  181

Query  956   GKKPVSFFNGFSRETLEAALNTKWETIQRVL---FGEPQEEG--PFLKVTEEQLRSLSQE  792
               KP       S+  L AAL T  E +  +L    G+ +EE     ++ +EEQ+R L +E
Sbjct  182   --KP--LLASLSKRVLRAALKTSDERLGSLLGSRQGKEEEEKSISIVRASEEQVRELRRE  237

Query  791   GDEGG------IRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDVNAA  630
               E G      + P RGD       +   P   ++N++G +YE     F  L + DV  A
Sbjct  238   ASESGQGHHWPLPPVRGDSRDTYNLLEQRP--KIANRHGRLYEADARSFHALAQHDVRVA  295

Query  629   FVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----------------------  519
               NIT G M  P+ N+++ ++AVVLEGEG +E+ CP                        
Sbjct  296   VANITPGSMTAPYLNTQSFKLAVVLEGEGEVEIVCPHLGRDSERREQEHGKGRWGEEEED  355

Query  518   ------------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSL  411
                                       Y+TVR+++  G   V+PPG+P V +A+S  S +L
Sbjct  356   DRRQQRRRGSGSGSESESEEQQDQQRYETVRARVSRGSAFVVPPGHPVVEIASSRGSSNL  415

Query  410   QFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGS--QPLELFF  237
             Q   F+IN   NERV LAG NN+  KL + A++L+F  G     V  VF +  Q  E F 
Sbjct  416   QVVCFEINAERNERVWLAGRNNVIAKLDDPAQELTF--GRPAREVQEVFRAKDQQDEGFV  473

Query  236   KAP  228
               P
Sbjct  474   AGP  476



>gb|EMT20973.1| Globulin-1 S allele [Aegilops tauschii]
Length=569

 Score =   199 bits (506),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 132/385 (34%), Positives = 193/385 (50%), Gaps = 52/385 (14%)
 Frame = -2

Query  1298  RMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLGRGSVAVIRQDGK  1119
             + L  F + S L  GI++YR+A + V  + FVVP   DA+ +  V  G G + VI    K
Sbjct  156   KALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDADGVGYVAQGEGVLTVIENGEK  215

Query  1118  ESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQFFSGAAGKKPVS  939
              S+ + EGDV+  P G+  ++ NTD  +K  L    ++ +IS PG FQ+FS     KP  
Sbjct  216   RSYTVREGDVIVAPAGSIMHLANTDGRRK--LIIAKILHTISVPGMFQYFSA----KP--  267

Query  938   FFNGFSRETLEAALNTKWETIQRVL---FGEPQEEGPF--LKVTEEQLRSLSQEGDEGG-  777
                  S+  L AAL T  E ++R+L    G+ +  G    ++ +EEQL  LS++  EG  
Sbjct  268   LLASLSKRVLRAALKTSDERLERLLDPRQGQEKTGGSMSIVRASEEQLHELSRQASEGSQ  327

Query  776   -----IRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDVNAAFVNITE  612
                  + PFRGD       +   P   ++N++G +YE     F  L + DV  A  NIT 
Sbjct  328   GHHWPLPPFRGDSRDTYNLLEQRP--KIANRHGRLYEADARSFHALAQHDVRVAVANITP  385

Query  611   GGMLGPFFNSRATQVAVVLEGEGWLEMG-----------------------------CPK  519
             G M  P+ N+++ ++AVVLEGEG    G                               +
Sbjct  386   GSMTAPYLNTQSFKLAVVLEGEGEQGKGRWSEEEDDDQRQQRRRGSGSESESESEEQQDQ  445

Query  518   NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLF  339
               YQT+R+++  G   V+PPG+P V +A+S  S +LQ   F+IN   NERV LAG NN+ 
Sbjct  446   QRYQTIRARVSRGSAFVVPPGHPVVEIASSQGSSNLQVVCFEINAERNERVWLAGRNNVI  505

Query  338   LKLGNAAKDLSFAAGSDKESVNVVF  264
              KL N A++L+F  G     V  VF
Sbjct  506   GKLDNPAQELTF--GRPAREVQEVF  528


 Score = 74.7 bits (182),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 113/266 (42%), Gaps = 47/266 (18%)
 Frame = -2

Query  1223  VESQTFVVPNHEDAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTD  1044
             V  + FVVP   DA+ +  V  G G + VI    K S+ + +GDV+  P G+  ++ NTD
Sbjct  3     VNPRAFVVPGFTDADGVGYVAQGEGVLTVIESGEKRSYTVRQGDVIVAPAGSIMHLANTD  62

Query  1043  NVKKVPLEFFILIRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL  864
               +K  L    ++ +IS PGRFQ+FS     KP       S+  L AAL  K  T    +
Sbjct  63    ARRK--LVIAKILHTISVPGRFQYFSA----KP--LLASLSKRVLRAALKKKLGTY---I  111

Query  863   FGEPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIY  684
              G  +E     +   E  R   ++G  GG++            +++F    +   +G + 
Sbjct  112   HGHGRERADLRRAAGEAARQAPRQG--GGVQ------------VHLF-GSIIRTDHGFV-  155

Query  683   EVGTTHFKPLDEV--------DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-  531
                    +P DEV        +   A + +     + P     A  V  V +GEG L + 
Sbjct  156   ----KALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTD-ADGVGYVAQGEGVLTVI  210

Query  530   -GCPKNNYQTVRSKLKTGMVVVIPPG  456
                 K +Y TVR     G V+V P G
Sbjct  211   ENGEKRSY-TVRE----GDVIVAPAG  231



>ref|XP_004495184.1| PREDICTED: sucrose-binding protein-like [Cicer arietinum]
Length=470

 Score =   197 bits (500),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 200/369 (54%), Gaps = 21/369 (6%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+ ++F+T+  + +    +L +F+D+S L   I++Y LA L V+   FV P+H D+E
Sbjct  86    PYVFKSKDFDTRIDTEDGRVLVLNKFNDKSKLLRNIENYGLAVLEVKGHAFVSPHHFDSE  145

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL-IR  1002
              I   V G+  + ++ +D  E FN+  GD++R+P GT  Y+VN D  +K+ +    +   
Sbjct  146   VIIFNVKGKAIIGLVMEDKTERFNLESGDIMRVPAGTPMYLVNRDENEKLFIAALHMPPL  205

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             S S P   + F    G+ P S    FS + L+AAL T  E ++R  F + Q      K++
Sbjct  206   SASAPVNLEAFFEPGGRNPESVLTAFSSKVLQAALKTPKEKLER--FFDYQRRERIFKIS  263

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-LDE  648
             +E +  L+    +  I PF G         N+F ++ + SNQYG ++EVG +  K  LDE
Sbjct  264   KEDVHGLAP---KRSIWPFGGQFKG---PFNIFTNRPSFSNQYGSLFEVGPSEEKSGLDE  317

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP--------KNNYQTVRSK  492
             +++     NIT+G M   ++N+ A ++A V EGEG  EM CP          +Y  +  +
Sbjct  318   LNLMLTLANITKGCMSTIYYNTNANKIAFVTEGEGDFEMACPHLKEKKSSSTSYHKISGR  377

Query  491   LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKD  312
             LK GMV V+P G+P+V +A+     +L    F++N   N+++  AG  N+   L   AK+
Sbjct  378   LKAGMVFVVPAGHPFVTMASK--KNNLVIVCFEVNAERNKKLAFAGKRNIVSALDKRAKE  435

Query  311   LSFAAGSDK  285
             +++   ++K
Sbjct  436   VAYEYPAEK  444



>ref|XP_010938152.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Elaeis guineensis]
Length=574

 Score =   199 bits (505),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 119/416 (29%), Positives = 211/416 (51%), Gaps = 51/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F  +  +     R+L  F ++S L  G+ +YR+A L     TFV+P+H DAE
Sbjct  145   PYFFDEESFLHRVRTEHGHVRVLRNFLEKSKLLLGVANYRVAILETNPNTFVLPSHWDAE  204

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + +  QD K +  +  GD++R+  GT     N+  V    L   IL+  
Sbjct  205   ALLFVARGHGHITLQCQDNKATHELRRGDIMRVRAGTIVSFANS-GVGNEKLVIVILLHP  263

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG F+ F GA G+ P SF+  FS+  L AA NT+ + ++R+   + Q +G  ++ ++
Sbjct  264   VATPGMFEAFVGAGGQNPESFYRSFSKRVLSAAFNTREDKLERLF--QKQNKGAIIQASQ  321

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVD  642
             EQ++ +S+ G EG   PF        R  N+F  +   SN++G + E  +  +  L +++
Sbjct  322   EQIKEMSR-GSEGRSWPF----GESRRPFNLFHKRPAHSNRHGELREADSDDYPELRDLN  376

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
             ++ ++ NI++G M+ P +N+ AT+++VV+ G G +++ CP                    
Sbjct  377   IHVSYANISKGSMIAPNYNTEATKISVVVGGNGDVQIVCPHISRQQEEGRRGREEEEGRG  436

Query  518   -------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
                                 +Y+ V SK+  G   ++P G+P V+V++ N  ++L+   F
Sbjct  437   RQEGREEEEEEEEEQQQRGQHYRRVESKVSCGTTFIVPAGHPSVSVSSRN--ENLEVLCF  494

Query  395   DINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
             +IN + N+R  LAG NN+  ++    K+L+F     +  V+ V  +   E+F   P
Sbjct  495   EINAKNNQRTWLAGRNNVLKQMDRVTKELAFDL--PEREVDEVLNAPREEVFMAGP  548



>ref|XP_003590610.1| Vicilin-like antimicrobial peptides 2-2 [Medicago truncatula]
 gb|AES60861.1| sucrose-binding protein-like protein [Medicago truncatula]
Length=494

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/392 (32%), Positives = 204/392 (52%), Gaps = 31/392 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF+  +FET+  + +     L  F  +S L    ++Y L  L  +   FV P+H D+E
Sbjct  99    PYVFEDRDFETKIDTDDGRVMALNMFDQKSKLLRNFENYGLTILEAKGHAFVSPHHFDSE  158

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTD-NVKKVPLEFFILIR  1002
              I   V GRG + ++ +D  E FN+  GD++R+P GT  Y+VN D N K       +   
Sbjct  159   VIFFNVKGRGIIGLVMEDKTERFNLEAGDIMRVPAGTPMYLVNRDENEKLFVAALHMPPS  218

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVT  822
             S S P   + F G AG+ P S    FS + L+AA  +    ++  L  + Q +G   K+ 
Sbjct  219   SASAPVNLEAFFGPAGRDPESVLTAFSSKVLQAAFKSPKGKLESFL--DEQNKGRIFKIQ  276

Query  821   EEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-LDE  648
             +E L  L+    +  I PF G    KN   N+F +    SNQ+G ++EVG +     LD 
Sbjct  277   KEDLSGLAP---KKSIWPFGG--QFKN-PFNIFSNNPAFSNQFGSLFEVGPSEITSGLDG  330

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------NN  513
             +++   F NIT+G M   ++N+ A ++A+V++GEG  EM CP                 +
Sbjct  331   LNLMLTFANITKGSMSTIYYNTNANKIALVIDGEGEFEMACPHMSSSSSHSKQRRSSSTS  390

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLK  333
             YQ + ++L+ G V V+P G+P+V +A+ N   +L+   F++N + N+++  AG NN+   
Sbjct  391   YQKINARLRPGTVFVVPAGHPFVTIASKN--NNLKIVCFEVNAQRNKKLAFAGKNNIVSA  448

Query  332   LGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             L   AK L+F   ++K  V+ +F  +  E FF
Sbjct  449   LDKTAKKLAFDKSAEK--VDEIF-KRDEEFFF  477



>gb|AAK28402.1|AF250228_1 7S globulin [Elaeis guineensis]
Length=572

 Score =   198 bits (503),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 201/389 (52%), Gaps = 47/389 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F  +  +     R+L  F ++S L  G+ +YR+A L     TFV+P+H DAE
Sbjct  145   PYFFDEESFLHRVRTEHGHVRVLRNFLEKSKLLLGVANYRVAILETNPNTFVLPSHWDAE  204

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + +  QD K +  +  GD++R+  GT     N   V    L   IL+  
Sbjct  205   ALLFVARGHGHITLQCQDNKATHELRRGDIMRVRAGTIVSFANR-GVGNEKLVIVILLHP  263

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG F+ F GA G+ P SF+  FS+  L AA NT+ + ++R+   + Q +G  ++ ++
Sbjct  264   VATPGMFEAFVGAGGQNPESFYRSFSKRVLSAAFNTREDKLERLF--QKQNKGAIIQASQ  321

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVD  642
             EQ++ +S+ G EG   PF        R  N+F  +   SN++G + E  +  +  L +++
Sbjct  322   EQIKEMSR-GSEGRSWPF----GESRRPFNLFHKRPAHSNRHGELREADSDDYPELRDLN  376

Query  641   VNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------------  519
             ++ ++ NI++G M+ P +N+ AT+++VV+ G G +++ CP                    
Sbjct  377   IHVSYANISKGSMIAPNYNTEATKISVVVGGNGDVQIVCPHISRQQEEGRRGREEEEGRG  436

Query  518   -----------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                               +Y+ V SK+  G   ++P G+P V+V++ N  ++L+   F+I
Sbjct  437   RQEGREEEEEEEQQQRGQHYRRVESKVSCGTTFIVPAGHPSVSVSSRN--ENLEVLCFEI  494

Query  389   NGRGNERVTLAGTNNLFLKLGNAAKDLSF  303
             N + N+R  LAG NN+  ++    K+L+F
Sbjct  495   NAKNNQRTWLAGRNNVLKQMDRVTKELAF  523



>gb|AAA72622.1| alpha globulin B [synthetic construct]
Length=590

 Score =   198 bits (503),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 127/410 (31%), Positives = 207/410 (50%), Gaps = 46/410 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  181   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  240

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+NI  G V+++P G+T Y+ N DN +K+ +   +L R 
Sbjct  241   KIYLVTNGRGTLTFLTHENKESYNIVPGVVVKVPAGSTVYLANQDNKEKLIIA--VLHRP  298

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP-----F  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G            F
Sbjct  299   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMF  358

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP  657
              K ++EQ+R+LSQE           +++ +  + N+       SNQ G  +E     F+ 
Sbjct  359   RKASQEQIRALSQEATSP------REKSGERFAFNLLSQTPRYSNQNGRFFEACPPEFRQ  412

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------  519
             L +++V  + + + +G +  P +NS+AT V +V EG G+ EM  P               
Sbjct  413   LRDINVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEED  472

Query  518   -------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DIN  387
                            Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN
Sbjct  473   EEEEQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNIN  532

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
                N+R+ +AG  N   +  + AK+L+F   S    V+ +F S P E +F
Sbjct  533   PDHNQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNSNPQESYF  580



>ref|XP_006650713.1| PREDICTED: globulin-1 S allele-like [Oryza brachyantha]
Length=475

 Score =   195 bits (495),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 130/425 (31%), Positives = 203/425 (48%), Gaps = 64/425 (15%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F     +    F +L RFSD   L   + DYR+A L    + F+ P+H DA+
Sbjct  58    PYHFGEESFRHWTRTRHGRFSVLERFSDEP-LVGAVWDYRVAVLEAAPRAFLQPSHYDAD  116

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + ++R+  +ESF + EGD + IP G   Y  NT + K       +L+  
Sbjct  117   EVFYVKEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKW--FRVVMLLNP  174

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPGRF+ +    G +P SFF+ FS + L+AA NT+ E +++V F   +E G      E
Sbjct  175   VSTPGRFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKV-FERQREGGEITTAPE  233

Query  818   EQLRSLSQEGD-------EGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFK  660
             EQ+R LS+          E  I+P     T K          T SN +G ++E+     +
Sbjct  234   EQVRELSKSCSRGGGSGSEWEIKP--SSLTGKR--------PTYSNNHGKMFEIDGDECR  283

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L ++D+     NIT G M+ P +++RAT+VA+VL G G+ EM CP              
Sbjct  284   HLRKLDMLVGLANITRGSMMAPSYSTRATKVAMVLHGSGYFEMACPHVSGGRSSERRERE  343

Query  518   ----------------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNP  423
                                           Y  VR++++ G V+VIP  +P   VA  + 
Sbjct  344   REQGRREEWGREEEEQEEEQHGGRQQKARRYHKVRAQVREGSVIVIPAAHPATFVAGDD-  402

Query  422   SKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLEL  243
              ++L    F +    +++V LAG N+L  +L + AK L F   + +E V+ V  +QP ++
Sbjct  403   -ENLSVLCFGVGANYDDKVFLAGRNSLLRQLDDPAKALVFGGSAAREMVDRVLAAQPEQI  461

Query  242   FFKAP  228
             F + P
Sbjct  462   FLRGP  466



>gb|AEB33715.1| conglutin beta 4 [Lupinus angustifolius]
Length=590

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 129/404 (32%), Positives = 209/404 (52%), Gaps = 38/404 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T   +     R+L RF  R+D  E +++YR+     +  T ++P H DA+
Sbjct  173   PYYFSSERFQTLYRNRNGQIRVLERFDQRTDRLENLQNYRIVEFQSKPNTLILPKHSDAD  232

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ G  ++ ++  D ++S+N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  233   YILVVLNGSATITIVNPDKRQSYNLENGDALRLPAGTTSYILNPDDNQN--LRVVKLAIP  290

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG F  F  ++ K   S+F+GFSR TLEA  NT++E IQR+L G             
Sbjct  291   INNPGNFYDFYPSSSKDQQSYFSGFSRNTLEATFNTRYEEIQRILLGNEDEQEDDEQRHG  350

Query  851   -----QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  ++V++EQ++ L +          R  + SK+   N+  +K + SN++G 
Sbjct  351   QEQSHQDEGVIVRVSKEQVQELRKYAQSSS----RKGKPSKSGPFNLRSNKPIYSNKFGN  406

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-----GC  525
              YE+         ++D++  F+ I EG +L P +NS+A  V +V EGEG  E+       
Sbjct  407   FYEITPNRNPQAQDLDISLTFIEINEGALLLPHYNSKAIFVVLVDEGEGNYELVGIRDQQ  466

Query  524   PKNNYQTVR---SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
              + + Q VR   ++L  G + VIP G+P     + N S +L+   F IN   N+R  LAG
Sbjct  467   RQQDEQEVRRYSARLSEGDIFVIPAGHP----ISINASSNLRLLGFGINADENQRNFLAG  522

Query  353   T-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             + +N+  +L    K L+F   +  E V  +  +Q    F  A P
Sbjct  523   SEDNVIRQLDTEVKGLTFPGST--EDVERLIKNQQQSYFANAQP  564



>gb|AEO27690.1| seed storage protein vicilin B, partial [Gossypium hirsutum]
Length=540

 Score =   196 bits (498),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 126/407 (31%), Positives = 205/407 (50%), Gaps = 46/407 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  144   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  203

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+NI  G V+++P G+T Y+ N DN +K+ +   +L R 
Sbjct  204   KIYLVTNGRGTLTFLTHENKESYNIVPGVVVKVPAGSTVYLANQDNKEKLIIA--VLHRP  261

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP-----F  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G            F
Sbjct  262   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMF  321

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP  657
              K ++EQ+R+LSQE           +++ +  + N+       SNQ G  +E     F+ 
Sbjct  322   RKASQEQIRALSQEATSP------REKSGERFAFNLLSQTPRYSNQNGRFFEACPREFRQ  375

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------  519
             L +++V  + + + +G +  P +NS+AT V +V EG G+ EM  P               
Sbjct  376   LRDINVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEED  435

Query  518   -------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DIN  387
                            Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN
Sbjct  436   EEEEQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNIN  495

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLE  246
                N+R+ +AG  N   +  + AK+L+F   S    V+ +F S P E
Sbjct  496   PDHNQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNSNPQE  540



>gb|KFK40533.1| hypothetical protein AALP_AA2G008100 [Arabis alpina]
Length=486

 Score =   195 bits (495),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 130/411 (32%), Positives = 204/411 (50%), Gaps = 33/411 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSD-LFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F +  FE    S E   ++LP+F+ RS  LF GI++YR +F+ +E  TF+VP+H DA
Sbjct  68    PFHFAKRSFENVFKSNEGFVKLLPKFTKRSSTLFRGIENYRFSFMEMEPSTFLVPHHWDA  127

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             + +  V+ G+G +A +    KESF+I  GDVLR+P G T ++ NT++   VPL    ++ 
Sbjct  128   DSVFLVLQGKGVIAFVTDSTKESFHIRRGDVLRVPSGVTHFLTNTNDT--VPLRIAKILV  185

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFLKV  825
              ++ PGRFQ F  A  +   S+F GFS++ L A+ N   E ++R++    Q  +G   +V
Sbjct  186   PVNIPGRFQDFFPARSQFHQSYFTGFSKQVLSASFNIPEELLERLISRSQQMGQGIIRRV  245

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDE  648
             + +Q++ L+++      +    D +      ++F    V SN +G  +EV  T F  L +
Sbjct  246   SPDQIKELAEQATSPSNKHKDSDMSKFWTPFSIFKQDPVYSNDFGHFHEVDPTSFSQLQD  305

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN----------------  516
             + +  A+VN+T+G +  P FNS+ T V  V  G    EM  P                  
Sbjct  306   LHIAVAWVNMTQGSLFLPQFNSKTTFVTFVENGCAHFEMASPYKFQSKQQQWFGPREEEE  365

Query  515   -------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                      Q + S++  G   VIP G+P+  ++       + FG F  N   N R  LA
Sbjct  366   EEEEIGGQVQKIVSRVCKGDAFVIPAGHPFTILSQDQNFVGIGFGIFASN---NIRTFLA  422

Query  356   GTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPSSLNPDQ  204
             G  N+   L   A  LSF  GS  +    +F SQ    F  + PS   P++
Sbjct  423   GQENMLNNLDTVATRLSFGVGS--KMAEKLFTSQNYSYFAPSNPSRQFPEE  471



>ref|XP_007225266.1| hypothetical protein PRUPE_ppa001515mg [Prunus persica]
 gb|EMJ26465.1| hypothetical protein PRUPE_ppa001515mg [Prunus persica]
Length=810

 Score =   198 bits (503),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 128/377 (34%), Positives = 200/377 (53%), Gaps = 34/377 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDR-SDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F    F+ +  S E    +L RF+ R S++  GIK+YRLA    +  TFV+P+H DA
Sbjct  406   PYYFPSHRFQPRFQSNEGGLYVLERFTQRQSEVLRGIKNYRLAIFEAKPNTFVLPHHCDA  465

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E I  V+ G+ +  ++ QD KESFN+  GDV+R+P G TTY+VN ++ +   L    L++
Sbjct  466   EAIYVVLSGQCTCTLLMQDRKESFNMEHGDVIRVPAGATTYLVNNNSDET--LRIAKLLQ  523

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP--FLK  828
              ++ PGRF+ F  A  + P S+F+ FS + LE+A NT  E ++       Q++G    ++
Sbjct  524   PVNNPGRFEEFFPAGSRNPESYFSVFSNDILESAFNTPREQLEHGFKQGQQQQGQGIVMR  583

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
                EQL++LSQ          RGD  S+    N+   + V SN YG  +E     F  L 
Sbjct  584   APREQLQALSQ----AASSRRRGDRQSQG-PFNLRQQRPVHSNNYGQFFEARPEEFNQLQ  638

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGC------------------  525
             ++D + + + I +  M+ P FNS+AT + +V+EG G +EM C                  
Sbjct  639   DMDASVSCIEINQQAMMVPHFNSKATHLIMVVEGNGLVEMACPYLASQSQEIMGQQEQQG  698

Query  524   -PKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-  351
              P   Y  V ++L  G V VIP G+P   VA    ++SL+   F +N + N+R  LAG  
Sbjct  699   EPSGRYMKVTAQLSRGDVFVIPAGHPVALVAQ---NQSLRILGFGLNAQNNKRNFLAGQE  755

Query  350   NNLFLKLGNAAKDLSFA  300
             +N+ + +   A+ L+F 
Sbjct  756   DNIIMHMDREARQLAFG  772



>ref|NP_001173574.1| Os03g0663800 [Oryza sativa Japonica Group]
 dbj|BAH92302.1| Os03g0663800 [Oryza sativa Japonica Group]
Length=406

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 125/380 (33%), Positives = 185/380 (49%), Gaps = 63/380 (17%)
 Frame = -2

Query  1202  VPNHEDAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPL  1023
             +P H DA  IC V  G G VA+I    K S+ I +GDV   P GT  Y+ NTD  +K  L
Sbjct  1     MPTHTDAHCICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANTDGRRK--L  58

Query  1022  EFFILIRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEE  843
                 ++ +IS PG+ QFF    G+ P SF + FS+    AA     E ++++L    Q++
Sbjct  59    IVTKILHTISVPGQIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLL--GKQDK  116

Query  842   GPFLKVTEEQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHK-TVSNQYGVIY  684
             G  ++ +EEQ+R L +   EGG      + PF   E+S+    N+   +   +N++G +Y
Sbjct  117   GVIIRASEEQVRELRRHASEGGHGPHWPLPPF--GESSRG-PFNILEQRPRFANRHGRLY  173

Query  683   EVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----  519
             E     F  L E D+  A VNIT G M  PF+N+R+ +VA VL+GEG  E+ CP      
Sbjct  174   EADARSFHDLAEHDIRVAVVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGG  233

Query  518   ----------------------------------------NNYQTVRSKLKTGMVVVIPP  459
                                                       Y+T+R++L  G V V+P 
Sbjct  234   RGGESEERRRERGKGKWREEEEEEEEQQKGQEEEEEEQVGQGYETIRARLSRGTVFVVPS  293

Query  458   GYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKES  279
             G+P   V TS+   +LQ   FD++   NER+ LAG N++  KL   AK+L+FAA + +  
Sbjct  294   GHPI--VVTSSRDSTLQIVCFDVHANNNERMYLAGMNSVLKKLDPQAKELAFAASARE--  349

Query  278   VNVVFGSQPLELFFKAPPSS  219
             V+ +  +Q    F   P  S
Sbjct  350   VDELLNAQQESAFLAGPEKS  369



>gb|AEO27691.1| seed storage protein vicilin B, partial [Gossypium raimondii]
Length=540

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 126/407 (31%), Positives = 204/407 (50%), Gaps = 46/407 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  144   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  203

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+NI  G V+ +P G+T Y+ N DN +K+ +   +L R 
Sbjct  204   KIYLVTNGRGTLTFLTHENKESYNIVPGVVVSVPAGSTVYLANQDNKEKLIIA--VLHRP  261

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP-----F  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G            F
Sbjct  262   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMF  321

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP  657
              K ++EQ+R+LSQE           +++ +  + N+       SNQ G  +E     F+ 
Sbjct  322   RKASQEQIRALSQEATSP------REKSGERFAFNLLSQTPRYSNQNGRFFEACPREFRQ  375

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------  519
             L +++V  + + + +G +  P +NS+AT V +V EG G+ EM  P               
Sbjct  376   LRDINVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEQE  435

Query  518   -------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DIN  387
                            Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN
Sbjct  436   EEQEQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNIN  495

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLE  246
                N+R+ +AG  N   +  + AK+L+F   S    V+ +F S P E
Sbjct  496   PDHNQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNSNPQE  540



>gb|AEO27687.1| seed storage protein vicilin B, partial [Gossypium herbaceum]
 gb|AEO27689.1| seed storage protein vicilin B, partial [Gossypium hirsutum]
Length=538

 Score =   193 bits (491),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 131/404 (32%), Positives = 209/404 (52%), Gaps = 42/404 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  144   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  203

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+R+P G+T Y+ N DN +K+ +   +L R 
Sbjct  204   KIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA--VLHRP  261

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G       Q +G F
Sbjct  262   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMF  321

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPL  654
              K ++EQ+R+LSQE      R   G+  + N    ++     SNQ G  YE     F+ L
Sbjct  322   RKASQEQIRALSQEAT--SPREKSGERFAFNL---LYQTPRYSNQNGRFYEACPREFRQL  376

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
              +++V  + + + +G +  P +NS+AT V +V EG G++EM  P                
Sbjct  377   RDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSYEEEEEQQQ  436

Query  518   ----------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DINGRG  378
                         Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN   
Sbjct  437   EQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  496

Query  377   NERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLE  246
             N+R+ +AG  N   +  + AK+L+F   S    V+ +F S P E
Sbjct  497   NQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNSNPQE  538



>ref|XP_003536525.1| PREDICTED: beta-conglycinin, alpha chain-like [Glycine max]
Length=584

 Score =   194 bits (493),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 130/386 (34%), Positives = 198/386 (51%), Gaps = 41/386 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F    F+T   +     R+L RF  RS   E ++DYR+  L+ +  T  +P+H DA+
Sbjct  192   PFHFSSNRFQTLFKNQHGHLRVLQRFDQRSPQLENLRDYRVVELMAKPNTLFLPHHADAD  251

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             F+  V+ GR  + +++ D ++ + +  G   RIP GTT Y+VN D  KK  L    L   
Sbjct  252   FLLLVLSGRALINLVKPDDRDPYYLDRGYAQRIPAGTTVYLVNPD--KKKDLRVIKLAIP  309

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPFL  831
             ++ PG F+ F  ++ +   S+  GFS   LEA+ NTK+E I RVLFG      Q+EG  L
Sbjct  310   VNKPGNFEDFFLSSTQDQQSYLQGFSENILEASFNTKFEEINRVLFGGEGRRHQQEGVIL  369

Query  830   KVTEEQLRSLSQEG-------DEGGIRPF--RGDETSKNRSINVFPHKTVSNQYGVIYEV  678
             ++++EQ+R LS+         +     PF  RG + S             SN +G  YE+
Sbjct  370   ELSKEQIRELSKRAKSSSRSTNSFDYEPFYLRGSQIS-------------SNNFGKFYEI  416

Query  677   GTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQ---  507
                    L + D+    V+I EGG+L P +NS+A  + +V EGE  +E+   K   Q   
Sbjct  417   TPEKNPQLRDFDILLNTVDINEGGLLLPHYNSKAIVILMVTEGEANIELVGLKEQQQGEE  476

Query  506   -----TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-NN  345
                    R++L    + VIP  YP+V  ATSN    L F  F IN   N+R  LAG+ +N
Sbjct  477   TREVRKYRAELSEDDIFVIPAAYPFVVNATSN----LNFVAFGINAENNQRNFLAGSKDN  532

Query  344   LFLKLGNAAKDLSFAAGSDKESVNVV  267
             +  ++    K+L+F AGS ++  N++
Sbjct  533   VIRQIQKQVKELAFPAGSAQDIENLI  558



>gb|AEB33716.1| conglutin beta 5 [Lupinus angustifolius]
Length=637

 Score =   195 bits (495),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 210/405 (52%), Gaps = 41/405 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T+  +     R+L RF  R++  E +++YR+        T ++P H DA+
Sbjct  216   PYYFSSERFQTRYKNKNGQIRVLERFDQRTNRLENLQNYRIVEFQSRPNTLILPKHSDAD  275

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ GR ++ ++  D ++++N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  276   YILVVLNGRATITIVNPDKRQAYNLEYGDALRLPAGTTSYILNPDDNQD--LRVVKLAIP  333

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-------------  858
             I+ PG+F  F  +  K   S+F+GFS+ TLEA  NT +E IQR+L G             
Sbjct  334   INNPGKFYDFYPSRTKDQQSYFSGFSKNTLEATFNTHYEEIQRILLGYEDEQEDEEQRRE  393

Query  857   ---EPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  ++V++EQ++ L +          R  + S++   N+  ++ + SN++G 
Sbjct  394   QEQSHQDEGVIVRVSKEQIQELRKHAQSSS----RKGKPSESGPFNLRSNEPIYSNKFGN  449

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNY  510
              YE+       + ++D++  F  I+EG +L P +NS+A  V VV EGEG  E+   +N  
Sbjct  450   FYEITPDRNPQVQDLDISLIFTEISEGALLLPHYNSKAIFVIVVDEGEGNYELVGIRNQQ  509

Query  509   --------QTVRS---KLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
                     + VRS   +L  G ++VIP G+P    A+SN    L+   F IN   N+R  
Sbjct  510   RQQDEQEVEEVRSYNARLSEGDILVIPAGHPLSINASSN----LRLLGFGINADENQRNF  565

Query  362   LAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKA  231
             LAG+ +N+  +L    K+L F   +  E V  +  +Q    F  A
Sbjct  566   LAGSEDNVIRQLDREVKELIFPGSA--EDVERLIRNQQQSYFANA  608



>prf||1410330B vicilin gene B
Length=592

 Score =   193 bits (491),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 127/411 (31%), Positives = 207/411 (50%), Gaps = 47/411 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  182   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  241

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+NI  G V+++P G+T Y+ N DN +K+ +   +L R 
Sbjct  242   KIYLVTNGRGTLTFLTHENKESYNIVPGVVVKVPAGSTVYLANQDNKEKLIIA--VLHRP  299

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP-----F  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G            F
Sbjct  300   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMF  359

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFK-  660
              K ++EQ+R+LSQE           +++ +  + N+       SNQ G  +E     F+ 
Sbjct  360   RKASQEQIRALSQEATSP------REKSGERFAFNLLSQTPRYSNQNGRFFEACPPEFRQ  413

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L +++V  + + + +G +  P +NS+AT V +V EG G+ EM  P              
Sbjct  414   QLRDINVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEE  473

Query  518   --------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DI  390
                             Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +I
Sbjct  474   DEEEEQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNI  533

Query  389   NGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             N   N+R+ +AG  N   +  + AK+L+F   S    V+ +F S P E +F
Sbjct  534   NPDHNQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNSNPQESYF  582



>emb|CAI84850.2| vicilin-like protein [Lupinus albus]
Length=531

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/409 (30%), Positives = 208/409 (51%), Gaps = 43/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  + F+T   +     R+L RF  R++  E +++YR+     +  T ++P H DA+
Sbjct  114   PYHFNSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDAD  173

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  V+ GR ++ ++  D ++++N+  GD LRIP G+T+YI+N D+ +K  L    L   
Sbjct  174   YVLVVLNGRATITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQK--LRVVKLAIP  231

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG F  F  ++ K   S+F+GFSR TLEA  NT++E IQR+L G             
Sbjct  232   INNPGYFYDFYPSSTKDQQSYFSGFSRNTLEATFNTRYEEIQRILLGNEDEQEYEEQRRG  291

Query  851   -----QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  ++V+ EQ++ L++       +    D+ S++   N+  ++ + SN+YG 
Sbjct  292   QEQSHQDEGVIVRVSREQIQELTKYAQSSSGK----DKPSQSGPFNLRSNEPIYSNKYGN  347

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-------  531
              YE+       + ++D++  F  I EG +L P +NS+A  + VV EG G  E+       
Sbjct  348   FYEITPDRNPQVQDLDISLTFTEINEGALLLPHYNSKAIFIVVVGEGNGKYELVGIRDQQ  407

Query  530   ------GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                          +   ++L  G + VIP GYP     + N S +L+   F IN   N+R
Sbjct  408   RQQDEQEEEPEEVRRYSARLSEGDIFVIPAGYP----ISVNASSNLRLLGFGINAYENQR  463

Query  368   VTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               LAG+ +N+  +L    K+L+F   +  E +  +  +Q    F  A P
Sbjct  464   NFLAGSEDNVIRQLDREVKELTFPGSA--EDIERLIKNQQQSYFANALP  510



>gb|KHG06467.1| Vicilin C72 [Gossypium arboreum]
Length=590

 Score =   193 bits (490),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 131/409 (32%), Positives = 211/409 (52%), Gaps = 44/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  181   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  240

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+R+P G+T Y+ N DN +K+ +   +L R 
Sbjct  241   KIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA--VLHRP  298

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G       Q +G F
Sbjct  299   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMF  358

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPL  654
              K ++EQ+R+LSQE      R   G+  + N    ++     SNQ G  YE     F+ L
Sbjct  359   RKASQEQIRALSQEAT--SPREKSGERFAFNL---LYQTPRYSNQNGRFYEACPREFRQL  413

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
              +++V  + + + +G +  P +NS+AT V +V EG G++EM  P                
Sbjct  414   RDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSYEEEEEQEQ  473

Query  518   ------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DING  384
                           Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN 
Sbjct  474   EQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINP  533

Query  383   RGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
               N+R+ +AG  N   +  + AK+L+F   S    V+ +F + P E +F
Sbjct  534   DHNQRIFVAGKINHVRQWDSQAKELAFGLSS--RLVDEIFNNNPQESYF  580



>gb|AEO27688.1| seed storage protein vicilin B, partial [Gossypium arboreum]
Length=540

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 131/406 (32%), Positives = 209/406 (51%), Gaps = 44/406 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  144   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  203

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+R+P G+T Y+ N DN +K+ +   +L R 
Sbjct  204   KIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA--VLHRP  261

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ PG+F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G       Q +G F
Sbjct  262   VNNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMF  321

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPL  654
              K ++EQ+R+LSQE      R   G+  + N    ++     SNQ G  YE     F+ L
Sbjct  322   RKASQEQIRALSQEAT--SPREKSGERFAFNL---LYQTPRYSNQNGRFYEACPREFRQL  376

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
              +++V  + + + +G +  P +NS+AT V +V EG G++EM  P                
Sbjct  377   RDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSYEEEEEQEQ  436

Query  518   ------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DING  384
                           Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN 
Sbjct  437   EQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINP  496

Query  383   RGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLE  246
               N+R+ +AG  N   +  + AK+L+F   S    V+ +F S P E
Sbjct  497   DHNQRIFVAGKINHVRQWDSQAKELAFGLSS--RLVDEIFNSNPQE  540



>gb|ABR21771.1| conglutin beta [Lupinus angustifolius]
Length=521

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/409 (30%), Positives = 210/409 (51%), Gaps = 43/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T+  +     R+L RF  R++  E +++YR+        T ++P H DA+
Sbjct  99    PYHFSSERFQTRYRNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSNPNTLILPKHSDAD  158

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ GR ++ ++  D ++++N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  159   YILVVLNGRATITIVNPDKRQAYNLEYGDALRLPAGTTSYILNPDDNQN--LRVVKLAIP  216

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ P  F  F  ++ K   S+F+GFS+ TLEA  NT++E IQR+L G             
Sbjct  217   INNPSNFYDFYPSSTKDQQSYFSGFSKNTLEATFNTRYEEIQRILLGNEDEQEDEEQRRG  276

Query  851   -----QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  ++V++EQ++ L +          R  + S++   N+  ++++ SN++G 
Sbjct  277   QEQSYQDEGVIVRVSKEQIQELRKHAQSSS----RKGKPSESGPFNLRSNESIYSNKFGN  332

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-------  531
              YE+       + ++D++  F  I EG +L P +NS+A  + VV EGEG  E+       
Sbjct  333   FYEITPERNPQVQDLDISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQ  392

Query  530   ---GCPKNNYQTVR---SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                   +   + VR   ++L  G + VIP GYP     + N S +L+   F IN   N+R
Sbjct  393   RQQDEQEEEEEEVRRYSARLSEGDIFVIPAGYP----ISVNASSNLRLLGFGINANENQR  448

Query  368   VTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               LAG+ +N+  +L    K+L+F   +  + V  +  +Q    F  A P
Sbjct  449   NFLAGSEDNVISQLDREVKELTFPGSA--QDVERLIKNQQQSYFANAQP  495



>ref|XP_004496703.1| PREDICTED: convicilin-like [Cicer arietinum]
Length=558

 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 131/386 (34%), Positives = 191/386 (49%), Gaps = 44/386 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F   +F+T   +     R+L RF  RS+LFE +++YRL        T  +P H DA+
Sbjct  155   PFFFNSNKFQTIFENEHGHIRLLQRFDKRSNLFENLQNYRLLEYKARPHTLFLPQHTDAD  214

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  215   FILVVLSGKAILTVLNSNDRNSFNLECGDTIKLPAGTIAYLANRDSNED--LRIVDLAIP  272

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+TP +FQ F   A     S+FNGFS+  LEA+ N K+E I+R+L  EP           
Sbjct  273   INTPAKFQAFFPFANNNQQSYFNGFSKNILEASFNAKYEDIERILLEEPQQRRGHRGRQQ  332

Query  851   -QEEGPFLKVTEEQLRSLSQEG-------DEGGIRPFRGDETSKNRSINVFPHKTVSNQY  696
              QE    +KV+ EQ+  LS+               PF      K RS         SN++
Sbjct  333   SQEAEVIVKVSREQIEELSKHAESSSRKSISSESEPF----NLKRRS------PIYSNKF  382

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
             G  +E+       L ++D+   +  I EGG++ P FNSRAT V VV EG+G  E+   +N
Sbjct  383   GKFFEITPKKSSQLQDLDILVDYAEINEGGLMLPHFNSRATMVVVVNEGKGNFELVGLRN  442

Query  515   -------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                      Q  R+ L  G V VIP G+P    A+SN    L    F IN + N+R  LA
Sbjct  443   EEEEKSKQVQRYRANLSPGDVFVIPAGHPVAVNASSN----LSLLGFGINAQNNQRNFLA  498

Query  356   G-TNNLFLKLGNAAKDLSFAAGSDKE  282
             G  +N+  ++    K+L+F  GS +E
Sbjct  499   GEDDNVISQIERPVKELAF-PGSAQE  523



>gb|AEB33718.1| conglutin beta 7 [Lupinus angustifolius]
Length=605

 Score =   192 bits (488),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 210/409 (51%), Gaps = 43/409 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T+  +     R+L RF  R++  E +++YR+        T ++P H DA+
Sbjct  183   PYHFSSERFQTRYRNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSNPNTLILPKHSDAD  242

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ GR ++ ++  D ++++N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  243   YILVVLNGRATITIVNPDKRQAYNLEYGDALRVPAGTTSYILNPDDNQN--LRVVKLAIP  300

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ P  F  F  ++ K   S+F+GFS+ TLEA  NT++E IQR+L G             
Sbjct  301   INNPSNFYDFYPSSTKDQQSYFSGFSKNTLEATFNTRYEEIQRILLGNEDEQEDEEQRRG  360

Query  851   -----QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  ++V++EQ++ L +          R  + S++   N+  ++++ SN++G 
Sbjct  361   QEQSYQDEGVIVRVSKEQIQELRKHAQSSS----RKGKPSESGPFNLRSNESIYSNKFGN  416

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-------  531
              YE+       + ++D++  F  I EG +L P +NS+A  + VV EGEG  E+       
Sbjct  417   FYEITPERNPQVQDLDISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQ  476

Query  530   ---GCPKNNYQTVR---SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                   +   + VR   ++L  G + VIP GYP    A+SN    L+   F IN   N+R
Sbjct  477   RQQDEQEEEEEEVRRYSARLSEGDIFVIPAGYPISVNASSN----LRLLGFGINANENQR  532

Query  368   VTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               LAG+ +N+  +L    K+L+F   +  + V  +  +Q    F  A P
Sbjct  533   NFLAGSEDNVISQLDREVKELTFPGSA--QDVERLIKNQQQSYFANAQP  579



>gb|AEB33713.1| conglutin beta 2 [Lupinus angustifolius]
Length=603

 Score =   192 bits (488),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 121/389 (31%), Positives = 194/389 (50%), Gaps = 55/389 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T   +     R+L RF  R++  E +++YR+     +  T ++P H DA+
Sbjct  176   PYYFSYERFQTLYKNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDAD  235

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ GR ++ ++  D ++++N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  236   YILVVLNGRATITIVNPDKRQAYNLEHGDALRLPAGTTSYILNPDDNQN--LRVVKLAIP  293

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG F  F  ++ K   S+FNGFSR TLEA  NT++E IQR++ G             
Sbjct  294   INNPGNFYDFYPSSTKDQQSYFNGFSRNTLEATFNTRYEEIQRIILGNEDGQEDEEQSRG  353

Query  851   -----QEEGPFLKVTEEQLRSLSQEGD---------EGGIRPFRGDETSKNRSINVFPHK  714
                  Q++G  ++V++EQ++ L +            E G    R DE             
Sbjct  354   QEQSHQDQGVIVRVSKEQIQELRKHAQSSSGKGKPSESGPFNLRSDEP------------  401

Query  713   TVSNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLE  534
               SN++G  YE+         ++D++  F+ I EGG+L P +NS+A  V VV EGEG  E
Sbjct  402   IYSNKFGNFYEITPDRNPQAQDLDISLTFIEINEGGLLLPHYNSKAIFVVVVDEGEGNYE  461

Query  533   M-----------GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
             +              +   +   +KL  G + VIP G+P     + N S +L+   F IN
Sbjct  462   LVGIRDQERQQDEQEQEEVRRYNAKLSEGDIFVIPAGHP----ISINASSNLRLLGFGIN  517

Query  386   GRGNERVTLAGT-NNLFLKLGNAAKDLSF  303
                N+R  LAG+ +N+  +L    K L+F
Sbjct  518   ADENQRNFLAGSEDNVIRQLDKEVKQLTF  546



>prf||1713472A convicilin
Length=607

 Score =   192 bits (488),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 130/398 (33%), Positives = 205/398 (52%), Gaps = 34/398 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R+L RF  RSDLFE +++YRL        T  +P H DA+
Sbjct  202   PFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRARPHTIFLPQHIDAD  261

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  262   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRLVDLVIP  319

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQEEGPFL  831
             ++ PG+F+ F  A  K    +  GFS+  LEA+ NTK+ETI++VL      EPQ+    +
Sbjct  320   VNGPGKFEAFDLAKNKN--QYLRGFSKNILEASYNTKYETIEKVLLEEQEKEPQQRRAIV  377

Query  830   KVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-  657
             KV+ EQ+  L +               S+   IN+  HK   SN++G ++E+      P 
Sbjct  378   KVSREQIEELRKLAKSSSK----KSLPSEFEPINLRSHKPEYSNKFGKLFEITPEKKYPQ  433

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------N  516
             L ++D+  + V I EG ++ P +NSRA  V +V EG+G LE+   K             N
Sbjct  434   LQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNLELLGLKDEQQEREDRKERNN  493

Query  515   NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-NNLF  339
               Q   ++L  G VV+IP G+P    A+SN    L    F IN   NER  L+G+ +N+ 
Sbjct  494   EVQRYEARLSPGDVVIIPAGHPVAITASSN----LNLLAFGINAENNERNFLSGSDDNVI  549

Query  338   LKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              ++ N  K+L+F      + +N +  +Q    F  A P
Sbjct  550   SQIENPVKELTFPRSV--QEINRLIKNQKQSHFANAEP  585



>sp|P09801.1|VCLB_GOSHI RecName: Full=Vicilin C72; AltName: Full=Alpha-globulin B; Flags: 
Precursor [Gossypium hirsutum]
 gb|AAA33071.1| vicilin precursor [Gossypium hirsutum]
Length=588

 Score =   191 bits (486),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 130/407 (32%), Positives = 210/407 (52%), Gaps = 42/407 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  181   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  240

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+R+P G+T Y+ N DN +K+ +   +L R 
Sbjct  241   KIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA--VLHRP  298

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ P +F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G       Q +G F
Sbjct  299   VNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMF  358

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPL  654
              K ++EQ+R+LSQE      R   G+  + N    ++     SNQ G  YE     F+ L
Sbjct  359   RKASQEQIRALSQEAT--SPREKSGERFAFNL---LYRTPRYSNQNGRFYEACPREFRQL  413

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
              +++V  + + + +G +  P +NS+AT V +V EG G++EM  P                
Sbjct  414   SDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQ  473

Query  518   ----------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DINGRG  378
                         Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN   
Sbjct  474   EQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  533

Query  377   NERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             N+R+ +AG  N   +  + AK+L+F   S    V+ +F + P E +F
Sbjct  534   NQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNNNPQESYF  578



>gb|EAY91281.1| hypothetical protein OsI_12896 [Oryza sativa Indica Group]
Length=520

 Score =   190 bits (483),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 133/432 (31%), Positives = 190/432 (44%), Gaps = 105/432 (24%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R+LP F   S L  GIK+YR+A L    ++FV+P H DA 
Sbjct  105   PYVFGRRSFRQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAH  164

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              IC V  G G VA+I    K S+ I +GDV   P GT  Y+ NTD  +K+ +        
Sbjct  165   CICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANTDGRRKLII--------  216

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
                                      S E LE  L               Q++G  ++ +E
Sbjct  217   -------------------------SEEKLEKLLGK-------------QDKGVIIRASE  238

Query  818   EQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFK  660
             EQ+R L +   EGG      + PF   E+S+    N+   +   +N++G +YE     F 
Sbjct  239   EQVRELRRHASEGGHGPHWPLPPF--GESSRG-PFNILEQRPRFANRHGRLYEADARSFH  295

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
              L E D+  A VNIT G M  PF+N+R+ +VA VL+GEG  E+ CP              
Sbjct  296   DLAEHDIRVAVVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGRGGESEER  355

Query  518   --------------------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVA  435
                                               Y+T+R++L  G V V+P G+P   V 
Sbjct  356   RRERGKGKWREEEEEEEEQQKGQEEEEEEQVGQGYETIRARLSRGTVFVVPSGHPI--VV  413

Query  434   TSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQ  255
             TS+   +LQ   FD++   NER+ LAG N++  KL   AK+L+FAA +    V+ +  +Q
Sbjct  414   TSSRDSTLQIVCFDVHANNNERMYLAGMNSVLKKLDPQAKELAFAASA--REVDELLNAQ  471

Query  254   PLELFFKAPPSS  219
                 F   P  S
Sbjct  472   QESAFLAGPEKS  483



>prf||1306412A storage protein C72
Length=586

 Score =   191 bits (486),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 130/407 (32%), Positives = 210/407 (52%), Gaps = 42/407 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F R  F+++       FR+L RF+ R  +  GI ++RL+ L     TFV+P+H DAE
Sbjct  179   PFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAE  238

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  GRG++  +  + KES+N+  G V+R+P G+T Y+ N DN +K+ +   +L R 
Sbjct  239   KIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA--VLHRP  296

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-----EPQEEGPF  834
             ++ P +F+ F  A  ++P S+   FSRE LE A NT+ E +  +  G       Q +G F
Sbjct  297   VNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMF  356

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPL  654
              K ++EQ+R+LSQE      R   G+  + N    ++     SNQ G  YE     F+ L
Sbjct  357   RKASQEQIRALSQEAT--SPREKSGERFAFNL---LYRTPRYSNQNGRFYEACPREFRQL  411

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---------------  519
              +++V  + + + +G +  P +NS+AT V +V EG G++EM  P                
Sbjct  412   SDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQ  471

Query  518   ----------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ-FGWF--DINGRG  378
                         Y+ +RS+L  G + V+P  +P   VA+ N +  +  FG +  +IN   
Sbjct  472   EQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  531

Query  377   NERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
             N+R+ +AG  N   +  + AK+L+F   S    V+ +F + P E +F
Sbjct  532   NQRIFVAGKINHVRQWDSQAKELAFGVSS--RLVDEIFNNNPQESYF  576



>ref|XP_008665579.1| PREDICTED: globulin-1 S allele-like [Zea mays]
 tpg|DAA51858.1| TPA: globulin2 [Zea mays]
 prf||1802402A globulin 2
Length=450

 Score =   188 bits (477),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 130/421 (31%), Positives = 209/421 (50%), Gaps = 49/421 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ +  E F     S +  FR+L RF+    L + + +YR+A L    + F+ P+H DA+
Sbjct  31    PYHYGEESFRHWTRSRQGRFRVLERFTHEL-LEDAVGNYRVAELEAAPRAFLQPSHYDAD  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + ++R   +ESF + EGDV+ IP G   Y  NT   +   +   +L   
Sbjct  90    EVMFVKEGEGVIVLLRGGKRESFCVREGDVMVIPAGAVVYSANTHQSEWFRV-VMLLSPV  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +ST GRF+ F    G+ P SF + FS + ++A+ NT+ E  ++V   E Q +G     +E
Sbjct  149   VSTSGRFEEFFPIGGESPESFLSVFSDDVIQASFNTRREEWEKVF--EKQSKGEITTASE  206

Query  818   EQLRSLSQEGDEGG--IRPFRGDETSKNRSINVFPHK------TVSNQYGVIYEVGTTHF  663
             EQ+R LS+    GG   R   GD  S +    + P        T SN +G  YE+     
Sbjct  207   EQIRELSRSCSRGGRSSRSEGGDSGSSSSKWEIKPSSLTDKKPTHSNSHGRHYEITGDEC  266

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-------------  522
               L  +D++    NI  G M+ P +N+RA ++A+VL+G+G+ EM CP             
Sbjct  267   PHLRLLDMDVGLANIARGSMMAPSYNTRANKIAIVLKGQGYFEMACPHVSGGRSSPRRER  326

Query  521   ---------------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
                                    +Y+ V+S+++ G V+VIP G+P   VA  +  K+L  
Sbjct  327   GHGREEEEEREEEQGGGGGQKSRSYRQVKSRIREGSVIVIPAGHPTALVAGED--KNLAV  384

Query  404   GWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               F++N   +++V LAGTN+   K+   AK L+F A  +++ V+ V G+Q   +F + P 
Sbjct  385   LCFEVNASFDDKVFLAGTNSALQKMDRPAKLLAFGA-DEEQQVDRVIGAQKDAVFLRGPQ  443

Query  224   S  222
             S
Sbjct  444   S  444



>gb|AEB33717.1| conglutin beta 6 [Lupinus angustifolius]
Length=593

 Score =   191 bits (484),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 195/378 (52%), Gaps = 36/378 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T   +     R+L RF  R+D  E +++YR+     +  T ++P H DA+
Sbjct  176   PYYFSSERFQTLYRNRNGQIRVLERFDKRTDRLENLQNYRIVEFQSKPNTLILPKHSDAD  235

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ G  ++ ++  D ++S+N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  236   YILVVLNGSATITIVNPDKRQSYNLENGDALRLPAGTTSYILNPDDNQN--LRVVKLAIP  293

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG F  F  ++ K   S+F+GFSR TLEA  NT++E IQR+L G             
Sbjct  294   INNPGNFYDFYPSSSKDQQSYFSGFSRNTLEATFNTRYEEIQRILLGNEDEQEDDEQRHG  353

Query  851   -----QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  ++V++EQ++ L +          R  + SK+   N+  +K + SN++G 
Sbjct  354   QEQSHQDEGVIVRVSKEQVQELRKYAQSSS----RKGKPSKSGPFNLRSNKPIYSNKFGN  409

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-------  531
              YE+         ++D++  F+ I EG +L P +NS+A  V +V EGEG  E+       
Sbjct  410   FYEITPNRNPQAQDLDISLTFIEINEGALLLPHYNSKAIFVVLVDEGEGNYELVGIRDQQ  469

Query  530   -GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
                 +   +   ++L  G + VIP G+P     + N S + +   F IN   N+R  LAG
Sbjct  470   RQQDEQEVRRYSARLSEGDIFVIPAGHP----ISINASSNFRLLGFGINADENQRNFLAG  525

Query  353   -TNNLFLKLGNAAKDLSF  303
               +N+  +L    K L+F
Sbjct  526   FEDNVIRQLDREVKGLTF  543



>emb|CAA96513.1| convicilin precursor [Vicia narbonensis]
Length=545

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 137/405 (34%), Positives = 211/405 (52%), Gaps = 41/405 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  133   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  192

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I TV+ GR  + V+  + + S+N+  GD +++P GTT+Y++N D+ +   L    L  S
Sbjct  193   LILTVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLLNQDDEED--LRVVDLSIS  250

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+ + F G +G K   +  GFS+  LEA+LNTK+ETI++VL  EP           
Sbjct  251   VNRPGKVESF-GLSGSKN-QYLRGFSKNILEASLNTKYETIEKVLLEEPQQSIGQKRRSQ  308

Query  851   -QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEV  678
              QE    +KV+ EQ+  L +       +    + E    RS N       SN++G ++E+
Sbjct  309   RQETNALVKVSREQVEELKRLAKSSSKKGVSSEFEPFNLRSQN----PKYSNKFGKLFEI  364

Query  677   GTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTV  501
                   P L ++D+  + V I EGG++ P +NSRA  + +V EG+G LE+   KN  Q  
Sbjct  365   TPEKKYPQLQDLDIFVSSVEINEGGLMLPHYNSRAIVILLVNEGKGNLELVGLKNEQQEQ  424

Query  500   R------------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
             R            ++L  G VV+IP G+P    A+SN    L    F IN   N+R  L 
Sbjct  425   REREDEQQVQRYEARLSPGDVVIIPAGHPVAVSASSN----LNLLGFGINAENNQRNFLT  480

Query  356   GT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             G+ +N+  ++ N  K+L+F  GS +E VN +  +Q    F  A P
Sbjct  481   GSDDNVISQIENPVKELTF-PGSAQE-VNRLLKNQEHSHFANAEP  523



>emb|CAP06316.1| cvc [Pisum fulvum]
Length=543

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/353 (33%), Positives = 189/353 (54%), Gaps = 27/353 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F+T   +     R+L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  202   PFLFKSNKFQTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  261

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  262   LILVVLSGKAILTVLSPNARNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRLVDLVIP  319

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG+F+ F  +  K    +  GFS+  LEA+ NTK+ETI++VL  E ++    +KV+ 
Sbjct  320   VNGPGKFEAFDLSKNKN--QYLRGFSKNILEASYNTKYETIEKVLLEEQEKTDAIVKVSR  377

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-LDEV  645
             EQ+  L +       + F     S+   IN+  HK   SN++G ++E+      P L ++
Sbjct  378   EQIEELRKHAKSSSKKIF----PSEFEPINLRNHKPEYSNKFGKLFEITPEKKYPQLQDL  433

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-------------GCPKNNYQT  504
             D+  + V I EG ++ P +NSRA  V +V EG+G LE+                 N  Q 
Sbjct  434   DIFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNLELLGLENEQQEREDRKERNNEVQR  493

Query  503   VRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
               ++L  G VV+IP G+P    A+SN    L    F IN   N+R  L+G+++
Sbjct  494   YEARLSPGDVVIIPAGHPVAITASSN----LNLLAFGINAENNQRNFLSGSDD  542



>ref|XP_008775109.1| PREDICTED: globulin-1 S allele [Phoenix dactylifera]
Length=564

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/411 (30%), Positives = 207/411 (50%), Gaps = 46/411 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F+ E F  +  +     R+L  F +RS L  G+ +YR+A L     TFV+P+H DAE
Sbjct  140   PYFFEEESFLHRVRTEHGNVRVLRNFLERSKLLLGVANYRVAILEANPNTFVLPSHWDAE  199

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G +    QD KE+  +  G ++R+  GT    VN D  +K  L   +L ++
Sbjct  200   ALLFVARGNGLITRQCQDNKETQELRRGHIIRVRAGTIVSFVNKDRNEK--LVIVMLFQT  257

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG  + F GA G+ P SF+  FS+  L AA NT  + ++R LFG  Q++G  ++ ++
Sbjct  258   VATPGMLEAFVGAGGRNPESFYRSFSKPVLRAAFNTGVDKLER-LFGR-QKKGAMIEASQ  315

Query  818   EQLRSLSQE-GDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKPLDEV  645
             EQ+R LS+  G EG   PF        R  N+   + + SN++G + E     +  L ++
Sbjct  316   EQIRELSRRAGSEGLPWPF----GESRRPFNLLDKRPSHSNRHGELREADRDDYPELRDL  371

Query  644   DVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------------  519
             ++  A   I +G M+ P +N+ AT +++V+ G G +++ CP                   
Sbjct  372   NIQVALARINKGSMMSPNYNTEATTISIVVGGNGQVQIVCPHVSRQQEEGRGREGEEGRG  431

Query  518   --------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGR  381
                             YQ V S++  G   ++P G+P V V++ N  +SL+   F+IN  
Sbjct  432   QQEGKEEEEQQQRGQRYQRVESEVSRGTTYIVPAGHPSVAVSSRN--ESLEVLCFEINAM  489

Query  380   GNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
              N+R  LAG+NN+  ++    K+L+F   + +  V+ V  +   E+F   P
Sbjct  490   NNQRTWLAGSNNILKQMDRMTKELAFDQPARE--VDEVLNAPREEVFMAGP  538



>gb|EEC76319.1| hypothetical protein OsI_13867 [Oryza sativa Indica Group]
Length=470

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 198/413 (48%), Gaps = 43/413 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F     +    F +L RF D   +   +  YR+A L    + F+ P+H DA+
Sbjct  56    PYHFGEESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDAD  115

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + ++R+  KESF + EGD + IP G   Y  NT + K       +L+  
Sbjct  116   EVFYVKEGEGVIVLLREGRKESFCVREGDAMVIPAGAIVYSANTHSSKW--FRVVMLLNP  173

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG F+ +    G +P SFF+ FS + L+AA NT+ E +++V F   +E G      E
Sbjct  174   VSTPGHFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKV-FERQREGGEITTAPE  232

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             EQ+R LS+    GG      +   K  S+        SN +G ++E+     + L ++D+
Sbjct  233   EQIRELSKSCSRGGGGGSGSEWEIKPSSLT-GKSPYFSNNHGKLFELTGDECRHLKKLDL  291

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------------  519
                  NIT G M+ P +N+RAT++AVVL+G G+ EM CP                     
Sbjct  292   QIGLANITRGSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRR  351

Query  518   ----------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                               Y  VR++++ G V+VIP  +P   VA+    +SL    F + 
Sbjct  352   EEEQGEEEHGERGEKARRYHKVRAQVREGSVIVIPASHPATIVASEG--ESLAVVCFFVG  409

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                +E+V LAG N+   +L + AK L F   + +E+ + V  +QP ++  + P
Sbjct  410   ANHDEKVFLAGRNSPLRQLDDPAKKLVFGGSAAREA-DRVLAAQPEQILLRGP  461



>ref|XP_002466310.1| hypothetical protein SORBIDRAFT_01g005440 [Sorghum bicolor]
 gb|EER93308.1| hypothetical protein SORBIDRAFT_01g005440 [Sorghum bicolor]
Length=466

 Score =   187 bits (475),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/426 (31%), Positives = 210/426 (49%), Gaps = 55/426 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F     S +  FR+L +F+    L + + +YR+A L    + F+ P+H DA+
Sbjct  43    PYHFGEESFRHWTRSRQGRFRVLEQFTHEL-LEDAVGNYRVAELEAAPRAFLQPSHYDAD  101

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G V ++R + KESF + EGDVL IP G   Y  NT + +       +L+  
Sbjct  102   EVMFVKEGEGVVVLLRGERKESFCVREGDVLVIPAGAVVYSANTHHSEW--FRVVMLLSP  159

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +ST G F+ F    G+ P SF + FS + ++A+ NT+ E  ++V   E Q +G     +E
Sbjct  160   VSTSGHFEEFYPIGGESPESFLSVFSDDVIQASFNTRREEWEKVF--EKQSKGEITTASE  217

Query  818   EQLRSLSQEGDEGGIRPFR---GDETSKNRS-INVFPHK------TVSNQYGVIYEVGTT  669
             EQ+R LS+    GG R  R   GD  S++ S   + P        T SN +G  YE+   
Sbjct  218   EQIRELSRSCSRGGGRSSREEGGDTGSRSSSKWEIKPSSLTGKRPTHSNSHGKHYEITGD  277

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLE-GEGWLEMGCP----------  522
                 L  +D+     NI+ G M+   +++RA ++A+V++ GEG+ EM CP          
Sbjct  278   ECPHLRVLDMKVGLANISRGSMMALSYSTRAHKIAIVVDGGEGYFEMACPHVSGGRSSSQ  337

Query  521   --------------------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPS  420
                                         +Y+ V+S+++ G V+VIP G+P   VA  N  
Sbjct  338   RREREHGRREWGGREEEEEEGGRGHKSRSYRQVKSRVREGSVIVIPAGHPTALVAGEN--  395

Query  419   KSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELF  240
              +L    F++N   +E+V LAG N+   ++   AK L+F A  ++E V+ V G+Q   +F
Sbjct  396   SNLAVLCFEVNANFDEKVFLAGRNSALKQMDGPAKLLAFGA-DEEEVVDRVIGAQKDAVF  454

Query  239   FKAPPS  222
              + P S
Sbjct  455   LRGPQS  460



>gb|AAS97865.1| beta-conglutin precursor [Lupinus albus]
Length=533

 Score =   188 bits (477),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/388 (30%), Positives = 205/388 (53%), Gaps = 41/388 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  + F+T   +     R+L RF  R++  E +++YR+     +  T ++P H DA+
Sbjct  114   PYHFSSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDAD  173

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  V+ GR ++ ++  D ++++N+  GD LRIP G+T+YI+N D+ +K  L    L   
Sbjct  174   YVLVVLNGRATITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQK--LRVVKLAIP  231

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-------------  858
             I+ PG F  F  ++ K   S+F+GFSR TLEA  NT++E IQR++ G             
Sbjct  232   INNPGYFYDFYPSSTKDQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRG  291

Query  857   ---EPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGV  690
                  Q+EG  + V+++Q++ L++       +    D+ S +   N+  ++ + SN+YG 
Sbjct  292   QEQSDQDEGVIVIVSKKQIQKLTKHAQSSSGK----DKPSDSGPFNLRSNEPIYSNKYGN  347

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-------  531
              YE+       + +++++  ++ I EG +L P +NS+A  V VV EGEG  E+       
Sbjct  348   FYEITPDRNPQVQDLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYELVGIRDQQ  407

Query  530   ----GCPKNNYQTVR--SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                    +   + +R  ++L  G + VIP GYP     + N S +L+   F IN   N+R
Sbjct  408   RQQDEQEEKEEEVIRYSARLSEGDIFVIPAGYP----ISINASSNLRLLGFGINADENQR  463

Query  368   VTLAGT-NNLFLKLGNAAKDLSFAAGSD  288
               LAG+ +N+  +L  A  +L+F   ++
Sbjct  464   NFLAGSKDNVIRQLDRAVNELTFPGSAE  491



>ref|XP_009369870.1| PREDICTED: LOW QUALITY PROTEIN: vicilin-like [Pyrus x bretschneideri]
Length=595

 Score =   189 bits (480),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 136/402 (34%), Positives = 207/402 (51%), Gaps = 38/402 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+++  S E   ++L RF  +S+L  GIK+YRLA       TFV+P+H DAE
Sbjct  187   PFYFPSQMFQSRFQSNEGGLQVLERFG-KSELLRGIKNYRLAIFEAMPNTFVLPHHCDAE  245

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+ +  ++ +D +ESFN+  GDV+R+  GTT Y+ N +N +  PL    LIRS
Sbjct  246   AIFVVLNGQCTCTLLLKDRRESFNMEHGDVIRVRAGTTIYLTNNNNDE--PLHIAKLIRS  303

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNT---KWETIQRVLFGEPQEEGPFLK  828
             +++PGRF+ F  A    P S+F+ FS + LE+A NT   + E   R   G+   +G  ++
Sbjct  304   VNSPGRFEEFFPAGSGNPESYFSVFSNDILESAFNTPRKELEQGFRQQRGQQGGQGIVMR  363

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
               +EQL +LSQ          R  E       N+   K V SN YG ++E     F    
Sbjct  364   APKEQLEALSQRASSARREGRRQSEG----PFNLRQLKPVHSNNYGQLFEARPEEFNQFQ  419

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----------------  522
             ++DV+ + + + +  M+ P FNS+AT +  V+EG   +EMGCP                 
Sbjct  420   DMDVSVSCIEMNQQTMMVPHFNSKATFLIYVVEGNVRVEMGCPHLASQMHGQETMEQQEQ  479

Query  521   ---KNNYQTVRSKLKTGMVVVIPPGYPYVNVATS-NPSKSLQFGWFDINGRGNERVTLAG  354
                   +  V ++L  G   VIP G+P   V  S N +++++   F +N + N R  LAG
Sbjct  480   GEQSGRFMKVNAQLSPGDAFVIPAGHPVAFVTQSGNQNQNIRILGFGLNAQYNTRNFLAG  539

Query  353   -TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKA  231
               +N+ L++   AK L+F  G D E    +FG Q    F  A
Sbjct  540   QKDNIMLQMDREAKQLAF--GQDMEK---IFGKQQESYFVPA  576



>dbj|BAF47690.1| beta-conglycinin alpha' subunit [Glycine soja]
Length=541

 Score =   188 bits (477),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 213/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  131   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  190

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  191   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  248

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  249   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  308

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+  H  + SN+ G ++E+   
Sbjct  309   ESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLRSHDPIYSNKLGKLFEITPE  364

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  365   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  424

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  425   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  480

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  481   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  519



>ref|XP_008224279.1| PREDICTED: vicilin GC72-A-like [Prunus mume]
Length=809

 Score =   191 bits (484),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 197/379 (52%), Gaps = 38/379 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDR-SDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F    F+ +  S E    +L RF+ R S++  GIK+YRLA       TFV+P+H DA
Sbjct  405   PFYFPSHRFQPRFQSNEGGLYVLERFTQRQSEVLRGIKNYRLAIFEARPNTFVLPHHCDA  464

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIV--NTDNVKKVPLEFFIL  1008
             E I  V+ G+ +  ++ QD KESFN+  GDV+R+P G TTY+V  N+DN     L    L
Sbjct  465   EAIYVVLSGQCTCTLLMQDRKESFNMEHGDVIRVPAGATTYLVNNNSDNT----LRIAKL  520

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP--F  834
             +++++ PGRF+ F  A    P S+F+ FS + LE+A NT  E ++       Q++G    
Sbjct  521   LQTVNNPGRFEEFFPAGSGNPESYFSVFSNDILESAFNTPREQLEHGFKQGQQQQGQGIV  580

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP  657
             ++   EQL++LSQ          RGD  S+    N+   + V SN YG + E     +  
Sbjct  581   MRAPREQLQALSQ----AASSRRRGDRQSQG-PFNLRQQRPVHSNNYGQLCEARPEEYNQ  635

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------------  522
             L ++D + + + I +  M+ P FNS+AT + +V+EG G +EM  P               
Sbjct  636   LQDMDASVSCIEINQQAMMVPHFNSKATHLIMVVEGNGLVEMAYPYLASQSQEIMGQQEQ  695

Query  521   ----KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
                    Y  V ++L  G V VIP G+P   VA +   + L FG   +N + N R  LAG
Sbjct  696   QGEQSGRYMKVTAQLSPGDVFVIPAGHPVALVAQNQNLRILGFG---LNAQNNTRNFLAG  752

Query  353   T-NNLFLKLGNAAKDLSFA  300
               +N+ +++   A+ L+F 
Sbjct  753   QEDNIIMQMDREARQLAFG  771



>pdb|1UIK|A Chain A, Crystal Structure Of Soybean Beta-Conglycinin Alpha 
Prime Homotrimer
 pdb|1UIK|B Chain B, Crystal Structure Of Soybean Beta-Conglycinin Alpha 
Prime Homotrimer
 pdb|1UIK|C Chain C, Crystal Structure Of Soybean Beta-Conglycinin Alpha 
Prime Homotrimer
Length=418

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 212/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  8     PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  67

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  68    YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  125

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  126   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  185

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+     + SN+ G ++E+   
Sbjct  186   ESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPE  241

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  242   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  301

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  302   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  357

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  358   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  396



>ref|XP_004496705.1| PREDICTED: convicilin-like isoform X2 [Cicer arietinum]
Length=563

 Score =   187 bits (476),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 133/414 (32%), Positives = 205/414 (50%), Gaps = 48/414 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+  +F+T   +     R+L  F  RS+LF+ +++YR         T ++P H DA+
Sbjct  140   PFFFRSNKFQTIFENQHGHIRLLQNFDKRSNLFQNLQNYRFLEYKARPHTLLLPQHIDAD  199

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+  GD +++P GTT Y+ N D+ +   L    L   
Sbjct  200   FILVVLSGKAILTVLNPNDRNSFNLERGDTIKLPAGTTAYLANHDDEED--LRVVELAIP  257

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQ----------  849
             ++ PG+FQ F  ++ +   S+FNGFS+  LEA+ NTK+ETI+RVL  E +          
Sbjct  258   VNRPGKFQSFFPSSNQNQQSYFNGFSKSILEASFNTKYETIERVLLEEQEPEQSRGRRGS  317

Query  848   ---EEG-PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYGVIY  684
                EEG   +KV+ EQ+  LS+       +    +    N RS N       SN++G  +
Sbjct  318   EESEEGDAIVKVSREQIEELSKHAKSSSRKSISSESEPFNLRSRN----PIYSNKFGKFF  373

Query  683   EVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM---------  531
             E+       L ++++  + V I EGG++ P FNSRA  V  + EG+G LE+         
Sbjct  374   EITPEKSPQLQDLNIFVSCVEINEGGLMLPHFNSRAIVVLFINEGKGHLELVGLRNEQQE  433

Query  530   -----------GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                            N  Q  R++L  G V +IP G+P       N S  L F  F IN 
Sbjct  434   QQQEEDEEQEEEERNNQVQRFRARLSPGDVFIIPAGHP----VAVNASSDLNFVGFGINA  489

Query  383   RGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               N+R  LAG  +N+  ++ N  K+L+F  GS +E VN +  +Q    F  A P
Sbjct  490   ENNQRNFLAGEDDNVISQIQNPVKELTF-PGSAQE-VNRLIKNQRQSYFANAQP  541



>ref|XP_006419988.1| hypothetical protein CICLE_v10006494mg, partial [Citrus clementina]
 gb|ESR33228.1| hypothetical protein CICLE_v10006494mg, partial [Citrus clementina]
Length=610

 Score =   188 bits (477),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 192/385 (50%), Gaps = 30/385 (8%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  + F  +  S     R+L RFS +S L  GI +YRLA L     T VVP+H DAE
Sbjct  224   PYYFHSQRFRYRVRSDSGHMRVLQRFSQKSHLLRGIDNYRLAILEANPSTLVVPHHSDAE  283

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  ++ G+G + ++  + +ESFN+  GDV+R+P GTT Y+ N DNV +  L    L++ 
Sbjct  284   TILVLLKGKGVITLVSHERRESFNMEHGDVIRVPAGTTYYLSNQDNVDR--LHVAKLLQP  341

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++TPG+F+ +  A G  P S++  FS + LE ALNT  E +  +   + +++G   + ++
Sbjct  342   VNTPGQFREYYAAGGGFPESYYKVFSYDILERALNTPREQLHSLFEVQQRQQGTIKRASQ  401

Query  818   EQLRSLSQEGD------EGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFK  660
             EQL++LS           G   PF           N+   K + +N +G  +E     ++
Sbjct  402   EQLKALSHHASSRRRHGRGSTAPF-----------NLLSRKPIYNNNFGRFFEATPKDYQ  450

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVRSKLKTG  480
              L E+D    +V I +G +   +      +     E E            Q + + L  G
Sbjct  451   QLQEIDAGVTYVEINQGPLSSRWSQESQREQEEEEEEEE------SSRELQKISANLSPG  504

Query  479   MVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFA  300
             +V +IPPG+P   VA+ N  K L  G F +N R N+R  LAG  N+  ++     +++F 
Sbjct  505   VVFIIPPGHPIALVASPN-EKLLTVG-FSLNARNNQRNFLAGKINIMNQVERETMEVAFN  562

Query  299   AGSDKESVNVVFGSQPLELFFKAPP  225
               +    +  VFG+ P E +F A P
Sbjct  563   VPA--RLIERVFGTNPKESYFVAGP  585



>ref|XP_007144650.1| hypothetical protein PHAVU_007G173600g [Phaseolus vulgaris]
 gb|ESW16644.1| hypothetical protein PHAVU_007G173600g [Phaseolus vulgaris]
Length=502

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 120/382 (31%), Positives = 216/382 (57%), Gaps = 30/382 (8%)
 Frame = -2

Query  1337  EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVL  1158
             +F+T+  + +   R+L +F+++S+L +GI++ RL  +  +  TFV P H D++ +   + 
Sbjct  122   DFDTKFETEDGRIRLLKKFTEKSELLKGIENIRLTIVEAKPHTFVAPRHFDSDVVLFNIK  181

Query  1157  GRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRF  978
             GR  +  +++   E F +  GD+L IP GT  YIVN D  +K+ L   +L   +STPG+F
Sbjct  182   GRAVLGWVKESETEKFILESGDMLAIPAGTPLYIVNRDENEKLFLA--MLHVPVSTPGKF  239

Query  977   QFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTEEQLRSLS  798
             Q F G  G+ P SF + F    L+AAL +    +++ LF + Q  G   +++ ++++ ++
Sbjct  240   QEFFGPGGRDPESFLSAFGWNVLQAALQSPKGQLEK-LFNQ-QNGGSIFEISRKKVQEMA  297

Query  797   QEGDEGGIRPFRGDETSKNRSINVFPH-KTVSNQYGVIYEVGTTHFKP-LDEVDVNAAFV  624
              +  +    PF G  T++    N+F    T SN++G + EVG    +  L+++++  +F 
Sbjct  298   PK--KTSWWPFGGPSTAE---FNLFTKPPTFSNRHGRLTEVGPPDSRSLLEKLNIMLSFT  352

Query  623   NITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQT-------------VRSKLKT  483
             NIT   M    +NS AT++A+V++G+G L++ CP  + ++             + + LK 
Sbjct  353   NITMKSMSTIHYNSHATKIALVIDGKGHLQIVCPHISSRSNSKHEKSSPSNHRISADLKP  412

Query  482   GMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSF  303
             GM+ V+PPG+P+V  ++    ++LQ   F+IN R N++ T AG +N+   + + AK+L+F
Sbjct  413   GMLFVVPPGHPFVTFSSRK--ENLQIISFEINARDNKKFTFAGKDNIVSSMDDLAKELAF  470

Query  302   AAGSDKESVNVVFGSQPLELFF  237
                S  E VN +F  +  E FF
Sbjct  471   NYPS--EIVNKIFDRK--ESFF  488



>ref|XP_004496704.1| PREDICTED: convicilin-like isoform X1 [Cicer arietinum]
Length=593

 Score =   187 bits (475),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 133/414 (32%), Positives = 205/414 (50%), Gaps = 48/414 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+  +F+T   +     R+L  F  RS+LF+ +++YR         T ++P H DA+
Sbjct  170   PFFFRSNKFQTIFENQHGHIRLLQNFDKRSNLFQNLQNYRFLEYKARPHTLLLPQHIDAD  229

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+  GD +++P GTT Y+ N D+ +   L    L   
Sbjct  230   FILVVLSGKAILTVLNPNDRNSFNLERGDTIKLPAGTTAYLANHDDEED--LRVVELAIP  287

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQ----------  849
             ++ PG+FQ F  ++ +   S+FNGFS+  LEA+ NTK+ETI+RVL  E +          
Sbjct  288   VNRPGKFQSFFPSSNQNQQSYFNGFSKSILEASFNTKYETIERVLLEEQEPEQSRGRRGS  347

Query  848   ---EEG-PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYGVIY  684
                EEG   +KV+ EQ+  LS+       +    +    N RS N       SN++G  +
Sbjct  348   EESEEGDAIVKVSREQIEELSKHAKSSSRKSISSESEPFNLRSRN----PIYSNKFGKFF  403

Query  683   EVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM---------  531
             E+       L ++++  + V I EGG++ P FNSRA  V  + EG+G LE+         
Sbjct  404   EITPEKSPQLQDLNIFVSCVEINEGGLMLPHFNSRAIVVLFINEGKGHLELVGLRNEQQE  463

Query  530   -----------GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                            N  Q  R++L  G V +IP G+P       N S  L F  F IN 
Sbjct  464   QQQEEDEEQEEEERNNQVQRFRARLSPGDVFIIPAGHP----VAVNASSDLNFVGFGINA  519

Query  383   RGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               N+R  LAG  +N+  ++ N  K+L+F  GS +E VN +  +Q    F  A P
Sbjct  520   ENNQRNFLAGEDDNVISQIQNPVKELTF-PGSAQE-VNRLIKNQRQSYFANAQP  571



>prf||1905429A major storage protein
Length=566

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 126/410 (31%), Positives = 207/410 (50%), Gaps = 50/410 (12%)
 Frame = -2

Query  1358  PFVF-QREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F +R  F+T+    E  F++L RF++ S   +GI DYRLA       TF++P+H DA
Sbjct  143   PYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHCDA  202

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E I  V  G+G++  +  + KES+N+  G V+ +P G+T Y+V+ DN +K+ +   +L  
Sbjct  203   EAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIA--VLAL  260

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL------FGEPQEEG  840
              +++PG+++ F  A   KP S++  FS E LE   NT+ E ++ +L        +  ++G
Sbjct  261   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  320

Query  839   PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHF  663
              F K   EQ+R++SQ+         RG E     +IN+     V SNQ G  +E     F
Sbjct  321   MFRKAKPEQIRAISQQATSPR---HRGGE---RLAINLLSQSPVYSNQNGRFFEACPEDF  374

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------  519
                  +DV  +   + +G +  P +NS+AT V  V +G G+ +M CP             
Sbjct  375   SQFQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSGR  434

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSN-PSKSLQFGWFDIN  387
                              +Q V++ L  G V V P G+     A+ + P  ++ FG   +N
Sbjct  435   QDRREQEEESEEETFGEFQQVKAPLSPGDVFVAPAGHAVTFFASKDQPLNAVAFG---LN  491

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
              + N+R+ LAG  NL  ++ + AK+LSF  G   + V+ +F + P E +F
Sbjct  492   AQNNQRIFLAGKKNLVRQMDSEAKELSF--GVPSKLVDNIFNN-PDESYF  538



>ref|XP_010026941.1| PREDICTED: vicilin C72 [Eucalyptus grandis]
Length=730

 Score =   188 bits (478),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/414 (31%), Positives = 208/414 (50%), Gaps = 65/414 (16%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F      ++  + E   R+L RF  RS L  G+K+YRL        TFV+P+H DA+
Sbjct  288   PYYFHSRMLHSRFRAEEGQIRVLERFDKRSRLLRGLKNYRLEIFEANPNTFVLPHHVDAD  347

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G G+++++ QD K+S+++  GDV+R+P GTT Y +++    +V  +   LI+ 
Sbjct  348   CILIVLKGEGTISLVWQDKKQSYHLEGGDVMRVPAGTTVYFISSGRDGQV--QIAKLIQP  405

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG F+ F     + P S++  FS E LE++L T  + I+R LFG+ Q +G  ++ +E
Sbjct  406   VNIPGTFKEFYPVGTENPESYYKVFSSEILESSLKTSRDQIER-LFGQ-QRQGVMIRASE  463

Query  818   EQLRSLSQEG----DEG-GIR-PFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFK  660
             EQ ++LS+      ++G G+R PF           N+   + + SN++G  ++     FK
Sbjct  464   EQRQALSEHSGWLKNKGHGLRGPF-----------NLLGREPIYSNEFGRFFQASPGEFK  512

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP--------------  522
              L ++ V+        G  + P +NS++  V +V+EG GW EM CP              
Sbjct  513   QLLDLGVS--------GSTMVPHYNSKSMTVVLVVEGNGWFEMACPHLAQAQQRWGSGGE  564

Query  521   -----------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFD  393
                                 YQ V S+L  G + VIP G+P   VA  N  + L+   F 
Sbjct  565   REEEEEEEEEQETEQGGSARYQKVTSQLSPGDIFVIPAGHPIAIVAGQN--EDLRMVGFG  622

Query  392   INGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKA  231
             IN   NER+ LAG  N+  ++   AK+LSF   +    V+ VF +Q    F  +
Sbjct  623   INAHKNERIFLAGKENIINRMDTEAKELSFDLPA--REVDRVFRNQEKSYFVSS  674



>gb|KHN02730.1| Beta-conglycinin, alpha' chain [Glycine soja]
Length=627

 Score =   187 bits (476),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 213/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  217   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  276

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  277   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  334

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  335   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  394

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+  H  + SN+ G ++E+   
Sbjct  395   ESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLRSHDPIYSNKLGKLFEITPE  450

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  451   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  510

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  511   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  566

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  567   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  605



>ref|XP_007034812.1| Vicilin-A, putative [Theobroma cacao]
 pir||S22477 vicilin precursor - cacao
 gb|EOY05738.1| Vicilin-A, putative [Theobroma cacao]
Length=566

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 126/410 (31%), Positives = 207/410 (50%), Gaps = 50/410 (12%)
 Frame = -2

Query  1358  PFVF-QREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F +R  F+T+    E  F++L RF++ S   +GI DYRLA       TF++P+H DA
Sbjct  143   PYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHCDA  202

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E I  V  G+G++  +  + KES+N+  G V+ +P G+T Y+V+ DN +K+ +   +L  
Sbjct  203   EAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIA--VLAL  260

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL------FGEPQEEG  840
              +++PG+++ F  A   KP S++  FS E LE   NT+ E ++ +L        +  ++G
Sbjct  261   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  320

Query  839   PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHF  663
              F K   EQ+R++SQ+         RG E     +IN+     V SNQ G  +E     F
Sbjct  321   MFRKAKPEQIRAISQQATSPR---HRGGE---RLAINLLSQSPVYSNQNGRFFEACPEDF  374

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------  519
                  +DV  +   + +G +  P +NS+AT V  V +G G+ +M CP             
Sbjct  375   SQFQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSGR  434

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSN-PSKSLQFGWFDIN  387
                              +Q V++ L  G V V P G+     A+ + P  ++ FG   +N
Sbjct  435   QDRREQEEESEEETFGEFQQVKAPLSPGDVFVAPAGHAVTFFASKDQPLNAVAFG---LN  491

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFF  237
              + N+R+ LAG  NL  ++ + AK+LSF  G   + V+ +F + P E +F
Sbjct  492   AQNNQRIFLAGKKNLVRQMDSEAKELSF--GVPSKLVDNIFNN-PDESYF  538



>gb|AAM33459.2| globulin-like protein [Oryza sativa Japonica Group]
Length=470

 Score =   184 bits (467),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/413 (30%), Positives = 198/413 (48%), Gaps = 43/413 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+    E F     +    F +L RF D   +   +  YR+A L    + F+ P+H DA+
Sbjct  56    PYHLGEESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDAD  115

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + ++R+  +ESF + EGD + IP G   Y  NT + K       +L+  
Sbjct  116   EVFYVKEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKW--FRVVMLLNP  173

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG F+ +    G +P SFF+ FS + L+AA NT+ E +++V F   +E G      E
Sbjct  174   VSTPGHFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKV-FERQREGGEITTAPE  232

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             EQ+R LS+    GG      +   K  S+        SN +G ++E+     + L ++D+
Sbjct  233   EQIRELSKSCSRGGGGGSGSEWEIKPPSLT-GKSPYFSNNHGKLFELTGDECRHLKKLDL  291

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------------  519
                  NIT G M+ P +N+RAT++AVVL+G G+ EM CP                     
Sbjct  292   QIGLANITRGSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRR  351

Query  518   ----------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                               Y  VR++++ G V+VIP  +P   VA+    +SL    F + 
Sbjct  352   EEEQGEEEHGERGEKARRYHKVRAQVREGSVIVIPASHPATIVASEG--ESLAVVCFFVG  409

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                +E+V LAG N+   +L + AK L F   + +E+ + V  +QP ++  ++P
Sbjct  410   ANHDEKVFLAGRNSPLRQLDDPAKKLVFGGSAAREA-DRVLAAQPEQILLRSP  461



>sp|P13915.1|CVCA_PEA RecName: Full=Convicilin; Flags: Precursor [Pisum sativum]
 emb|CAA29695.1| unnamed protein product [Pisum sativum]
Length=571

 Score =   186 bits (471),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 130/410 (32%), Positives = 209/410 (51%), Gaps = 46/410 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  154   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  213

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD ++IP GTT+Y+VN D+ + + +  F++   
Sbjct  214   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEEDLRVVDFVI--P  271

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE----PQ------  849
             ++ PG+F+ F  +  K    +  GFS+  LEA+LNTK+ETI++VL  E    PQ      
Sbjct  272   VNRPGKFEAFGLSENKN--QYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRK  329

Query  848   ------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGV  690
                   E    +KV+ EQ+  L +               S+    N+  HK   SN++G 
Sbjct  330   RTQQGEERDAIIKVSREQIEELRKLAKSSSK----KSLPSEFEPFNLRSHKPEYSNKFGK  385

Query  689   IYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN  513
             ++E+      P L ++D+  + V I +G ++ P +NSRA  V +V EG+G LE+   KN 
Sbjct  386   LFEITPEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNE  445

Query  512   Y-------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                           Q   ++L  G VV+IP G+P    A+SN    L    F IN + N+
Sbjct  446   QQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAISASSN----LNLLGFGINAKNNQ  501

Query  371   RVTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             R  L+G+ +N+  ++ N  K+L+F   S  + VN +  +Q    F  A P
Sbjct  502   RNFLSGSDDNVISQIENPVKELTFPGSS--QEVNRLIKNQKQSHFASAEP  549



>emb|CAP06309.1| convicilin [Lens nigricans]
Length=515

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/368 (34%), Positives = 192/368 (52%), Gaps = 42/368 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  +  +P H DA+
Sbjct  159   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHSIFLPQHIDAD  218

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  +AV+  + + S+N+  GD ++IP GTT+Y+VN D+ + + +  F++  S
Sbjct  219   FIVVVLNGKAILAVLSPNDRNSYNLERGDAIKIPAGTTSYLVNQDDEEDLRVVDFVI--S  276

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG F+ F  +A ++   +  GFS+  LEA+LNTK++TI++VL  E            
Sbjct  277   LNRPGEFEAFDLSANRR--QYLRGFSKSVLEASLNTKYDTIEKVLLEEQEREPHQRRDRK  334

Query  851   ----QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVI  687
                 QE    +KV+ EQ+  L +       +    + E S  RS N       SN++G  
Sbjct  335   GRQGQEPHAIVKVSREQIEELRRLAKSSSKKSLPSEFEPSNLRSQN----PKYSNKFGKF  390

Query  686   YEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK---  519
             +EV      P L ++D+  + V I EGG+L P +NSR T V +V EG+G LE+   K   
Sbjct  391   FEVTPEKKYPQLQDLDLLVSSVEINEGGLLLPHYNSRTTVVLLVTEGKGNLELAGFKNEQ  450

Query  518   ----------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                       N  Q   ++L  G VV+IP G+P    ATSN    L    F IN   N+R
Sbjct  451   EEREDNKERNNQVQRCEARLSAGDVVIIPAGHPVSISATSN----LNLLGFGINAENNQR  506

Query  368   VTLAGTNN  345
               L G+++
Sbjct  507   NFLTGSDD  514



>gb|ACG48473.1| globulin-1 S allele precursor [Zea mays]
Length=451

 Score =   182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 129/422 (31%), Positives = 209/422 (50%), Gaps = 50/422 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ +  E F     S +  FR+L RF+    L + + +YR+A L    +TF+ P+H DA+
Sbjct  31    PYHYGEESFRHWTRSRQGRFRVLERFTHEL-LEDAVGNYRVAELEAAPRTFLQPSHYDAD  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + ++R   +ESF + EGDV+ IP G   Y  NT   +   +   +L   
Sbjct  90    EVMFVKEGEGVIVLLRGGKRESFCVREGDVMVIPAGAVVYSANTHQSEWFRV-VMLLSPV  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +ST GRF+ F    G+ P SF + FS + ++A+ NT+ E  ++V   E Q +G     +E
Sbjct  149   VSTSGRFEEFFPIGGESPESFLSVFSDDVIQASFNTRREEWEKVF--EKQSKGEITTASE  206

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK---------TVSNQYGVIYEVGTTH  666
             EQ+R LS+    GG         S + S + +  K         T SN +G  YE+    
Sbjct  207   EQIRELSRSCSRGGRGSRGEGGDSGSSSSSKWEIKPSSLTDKKPTHSNSHGRHYEITGDE  266

Query  665   FKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-----------  519
                L  +D++    NI  G M+ P +N+RA ++A+VL+G+G+ EM CP            
Sbjct  267   CPHLRLLDMDVGLANIARGSMMAPSYNTRANKIAIVLKGQGYFEMACPHVSGGRSSPRRE  326

Query  518   -----------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ  408
                                     +Y+ V+S+++ G V+VIP G+P   VA  +  K+L 
Sbjct  327   RGHGREEEEEREEEQGGGGGQKARSYRQVKSRIREGSVIVIPAGHPTALVAGED--KNLA  384

Query  407   FGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                F++N   +++V LAGTN+   K+   AK L+F A  +++ V+ V G+Q   +F + P
Sbjct  385   VLCFEVNASFDDKVFLAGTNSALQKMDRPAKLLAFGA-DEEQQVDRVIGAQKDAVFLRGP  443

Query  227   PS  222
              S
Sbjct  444   QS  445



>gb|AEB33714.1| conglutin beta 3 [Lupinus angustifolius]
Length=580

 Score =   184 bits (467),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 124/405 (31%), Positives = 202/405 (50%), Gaps = 44/405 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E F+T   +     R+L RF  R++  E +++YR+     +  T ++P H DA+
Sbjct  163   PYYFSSERFQTLYRNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDAD  222

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             +I  V+ G  ++ ++  D ++S+N+  GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  223   YILVVLNGSATITIVNPDKRQSYNLENGDALRLPAGTTSYILNPDDNQN--LRVVKLAIP  280

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG F  F  ++ K   S+F+GFS+ TLEA  NT++E IQ +L G             
Sbjct  281   INNPGNFYDFYPSSSKDQQSYFSGFSKNTLEATFNTRYEEIQSILLGNEDEQEDDEQWHG  340

Query  851   -----QEEGPFLKVTEEQ---LRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQ  699
                  Q+EG  ++V++EQ   LR  +Q     G +P+           N+  +K + SN+
Sbjct  341   QEQSHQDEGVIVRVSKEQVQELRKYAQSSSRKG-KPYESG------PFNLRSNKPIYSNK  393

Query  698   YGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM----  531
             +G  YE+         ++D++  F+ I EG +L P +NS+A  V VV EGEG  E+    
Sbjct  394   FGNFYEITPDRNPQAQDLDISLTFIEINEGALLLPHYNSKAIFVVVVDEGEGNYELVGIR  453

Query  530   ----GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
                    +   +   ++L  G + VIP G+P     + N S +L+   F IN   N+R  
Sbjct  454   DQQRQQDEQEVRRYSARLSEGDIFVIPAGHP----ISINASSNLRLLGFGINADENQRNF  509

Query  362   LAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKA  231
             LAG+ +N+  +L    K L F   +  E V  +  +Q    F  A
Sbjct  510   LAGSEDNVIRQLDREVKGLIFPGSA--EDVERLIKNQQQSYFANA  552



>ref|XP_009335336.1| PREDICTED: LOW QUALITY PROTEIN: vicilin C72 [Pyrus x bretschneideri]
Length=711

 Score =   185 bits (470),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 203/399 (51%), Gaps = 46/399 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+++  S E    +L RF  R +L  GIK+YRLA L     TFV+P+H DAE
Sbjct  301   PFYFPSQMFQSRFQSNEGSLHVLERFGKR-ELLRGIKNYRLAILEAMPNTFVLPHHCDAE  359

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+    ++ +D KESFN+  GDV+R+P G TTY++N +N +  PL+   LIRS
Sbjct  360   AIFVVLNGQCICTLLMKDRKESFNMEHGDVIRVPAGATTYLINNNNDE--PLQIAKLIRS  417

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP---FLK  828
             +++PGRF+ F  A    P S+F+ FS + LE+A NT  E +++    +  ++G     ++
Sbjct  418   VNSPGRFEEFFPAGSGNPESYFSVFSNDILESAFNTPREQLKQGFRQQRGQQGGQGIVMR  477

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV----SNQYGVIYEVGTTHFK  660
               +EQL +LSQ       RP       + +S   F  +      SN YG  +E     F 
Sbjct  478   APKEQLEALSQ-------RPSSARREGRRQSQGPFNLRQQTPVHSNNYGQFFEARPEEFN  530

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK-------------  519
                ++DV+ + + + +  M+ P FNS AT +  V+EG   +EM CP              
Sbjct  531   QFQDMDVSVSCIEMNQQTMMVPHFNSEATLLMYVVEGHVRVEMACPHLASQMQGQEMMEQ  590

Query  518   -------NNYQTVRSKLKTGMVVVIPPGYPYVNVA---TSNPSKSLQFGWFDINGRGNER  369
                      +  V ++L  G   V+P G+P   VA     N +++++   F +N + N R
Sbjct  591   QEQGEHSGRFTKVAAQLSPGDAFVVPAGHPVAFVAQNNNGNQNQNIRILGFGLNAQNNMR  650

Query  368   VTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQ  255
               LAG  +N+  ++   AK L+F      + +  +FG Q
Sbjct  651   NFLAGQKDNIMQQMDREAKQLAFG-----QEMERIFGEQ  684



>dbj|BAA74452.2| alpha' subunit of beta-conglycinin [Glycine max]
Length=559

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 212/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  149   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  208

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  209   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  266

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  267   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  326

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+     + SN+ G ++E+   
Sbjct  327   ESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPE  382

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  383   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  442

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  443   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  498

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  499   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  537



>emb|CAB82855.1| convicilin [Pisum sativum]
Length=613

 Score =   184 bits (467),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 131/404 (32%), Positives = 210/404 (52%), Gaps = 40/404 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  202   PFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  261

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  262   LILVVLSGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRLVDLVIP  319

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP----------Q  849
             ++ PG+F+ F  A  K    +  GFS+  LEA+ NT++ETI++VL  E           +
Sbjct  320   VNGPGKFEAFDLAKNKN--QYLRGFSKNILEASYNTRYETIEKVLLEEQEKDRKRRQQGE  377

Query  848   EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGT  672
             E    +KV+ EQ+    +E  +      +    S+   IN+  HK   SN++G ++E+  
Sbjct  378   ETDAIVKVSREQI----EELKKLAKSSSKKSLPSEFEPINLRSHKPEYSNKFGKLFEITP  433

Query  671   THFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNY-----  510
                 P L ++D+  + V I EG ++ P +NSRA  V +V EG+G LE+   KN       
Sbjct  434   EKKYPQLQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNEQQERED  493

Query  509   --------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
                     Q   ++L  G VV+IP G+P    A+SN    L    F IN   NER  L+G
Sbjct  494   RKERNNEVQRYEARLSPGDVVIIPAGHPVAITASSN----LNLLGFGINAENNERNFLSG  549

Query  353   T-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             + +N+  ++ N  K+L+F  GS +E +N +  +Q    F  A P
Sbjct  550   SDDNVISQIENPVKELTF-PGSVQE-INRLIKNQKQSHFANAEP  591



>dbj|BAE02726.1| beta-conglycinin alpha prime subunit [Glycine max]
 dbj|BAE44298.1| beta-conglycinin alpha prime subunit [Glycine max]
 gb|ADD38965.1| beta-conglycinin alpha prime subunit [Glycine max]
 dbj|BAK53445.1| beta-conglycinin alpha' subunit [Glycine max]
Length=621

 Score =   184 bits (467),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 212/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  211   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  270

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  271   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  328

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  329   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  388

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+     + SN+ G ++E+   
Sbjct  389   ESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPE  444

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  445   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  504

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  505   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  560

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  561   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  599



>dbj|BAC78524.1| prepro beta-conglycinin alpha prime subunit [Glycine max]
Length=621

 Score =   184 bits (467),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 212/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  211   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  270

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  271   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  328

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  329   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  388

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+     + SN+ G ++E+   
Sbjct  389   ESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPE  444

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  445   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  504

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  505   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  560

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  561   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  599



>gb|KEH43849.1| vicilin 47 kDa protein [Medicago truncatula]
Length=667

 Score =   184 bits (468),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 129/414 (31%), Positives = 208/414 (50%), Gaps = 50/414 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R++ RF  RS+LF+ +K+YRL     +  T  +P+H DA+
Sbjct  246   PFLFRSNRFQTLFENENGHIRLIQRFDKRSNLFQNLKNYRLLEYRAKPHTIFLPHHTDAD  305

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+ +GD +++P G+T Y+VN DN +   L    L+  
Sbjct  306   FILVVLSGKAILTVLNSNNRNSFNLEQGDTIKLPAGSTAYLVNQDNDED--LRVVDLVIP  363

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE------------  855
             ++ PG+FQ F  +  +   S+F GFS+  LEA+ NT +ETI+RVL  E            
Sbjct  364   VNRPGKFQSFDLSGNQNNPSYFRGFSKSILEASFNTDYETIERVLLEEHEHEQQQRRGRK  423

Query  854   ----PQEEGPFLKVTEEQ---LRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQY  696
                  QE    +KV+ EQ   LR  ++   +  I    G    +NR+         SN++
Sbjct  424   GRQQSQEANAIVKVSREQIEELRRHAKSSSKRSISSESGPFNLRNRN------PLYSNKF  477

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
             G  +E+       L ++D+  + V I EG ++ P +NSR+T V V+ EG+G LE+   K+
Sbjct  478   GKFFEITPEKNPQLQDLDIFVSSVEINEGALILPHYNSRSTVVLVMNEGKGHLELVGHKS  537

Query  515   ----------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDING  384
                               Q   ++L  G VV+IP G+P    A+SN    L F  F IN 
Sbjct  538   EQQEQREQDEKELRNPEVQRYNARLSPGDVVIIPAGHPVAINASSN----LNFLGFGINA  593

Query  383   RGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               N+R  LAG  +N+  ++    K+++F   +  E V+ +  +Q    F  A P
Sbjct  594   ENNQRNFLAGEDDNVISQIERPVKEVAFPGSA--EEVDRLIKNQRQSYFANAQP  645



>tpg|DAA37931.1| TPA: hypothetical protein ZEAMMB73_015593 [Zea mays]
Length=562

 Score =   183 bits (465),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/385 (33%), Positives = 185/385 (48%), Gaps = 43/385 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+VF R  F     S +   R+L  F + S L  GI+DYR+A L    ++FVVP+H +  
Sbjct  154   PYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTNVH  213

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              IC V  G G V  I    + S+ I +G +     G  TY+ NTD  KK  L    ++ +
Sbjct  214   CICYVAEGEGVVTTIENGERRSYTIKQGHIFVASAGAVTYLANTDGQKK--LVIAKILHT  271

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             IS PG FQFF G  G+ P SF + FS+            +IQR  +   +++G  ++ TE
Sbjct  272   ISVPGEFQFFFGPGGRNPESFLSSFSK------------SIQRAAY---KDKGIIVRATE  316

Query  818   EQLRSLSQEGDEGGIRPFR-----GDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPL  654
             EQ   L +   EGG  P       G+       ++  P  +++NQ+G +YE     F  L
Sbjct  317   EQTHELRRHASEGGHGPHWPLPSFGESRGPYSLLDQRP--SIANQHGQLYEADARSFHDL  374

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVRSKLKTGMV  474
              E DV+ +F NIT G M  P FN+R+ ++A V  G+G+ E+ CP    Q   S+ +    
Sbjct  375   AEYDVSVSFANITTGSMSAPLFNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERE----  430

Query  473   VVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAG  294
                               +S +    +    GNE+V LAG +N+  KL   AK LSFAA 
Sbjct  431   -------------RDKGRRSEEESSEEQEEAGNEKVFLAGADNVLQKLDRVAKALSFAAK  477

Query  293   SDKESVNVVFGSQPLELFFKAPPSS  219
             +  E V+ V GS+  + F   P  S
Sbjct  478   A--EEVDEVLGSRHEKGFLPGPEES  500



>ref|NP_001051533.1| Os03g0793700 [Oryza sativa Japonica Group]
 gb|AAO37963.2| putative globulin [Oryza sativa Japonica Group]
 gb|ABF99314.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF13447.1| Os03g0793700 [Oryza sativa Japonica Group]
 dbj|BAH00598.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66992.1| globulin protein [Oryza sativa Japonica Group]
Length=470

 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 122/413 (30%), Positives = 196/413 (47%), Gaps = 43/413 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+    E F     +    F +L RF D   +   +  YR+A L    + F+ P+H DA+
Sbjct  56    PYHLGEESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDAD  115

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              +  V  G G + ++R+  +ESF + EGD + IP G   Y  NT + K       +L+  
Sbjct  116   EVFYVKEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKW--FRVVMLLNP  173

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +STPG F+ +    G +P SFF+ FS + L+AA NT+ E +++V F   +E G      E
Sbjct  174   VSTPGHFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKV-FERQREGGEITTAPE  232

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKPLDEVDV  639
             EQ+R LS+    GG      +   K  S+        SN +G ++E+     + L ++D+
Sbjct  233   EQIRELSKSCSRGGGGGSGSEWEIKPSSLT-GKSPYFSNNHGKLFELTGDECRHLKKLDL  291

Query  638   NAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK--------------------  519
                  NIT G M+ P +N+RAT++AVVL+G G+ EM CP                     
Sbjct  292   QIGLANITRGSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRR  351

Query  518   ----------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                               Y  VR++++   V+VIP  +P   VA+    +SL    F + 
Sbjct  352   EEEQGEEEHGERGEKARRYHKVRAQVREESVIVIPASHPATIVASEG--ESLAVVCFFVG  409

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
                +E+V LAG N+   +L + AK L F   + +E+ + V  +QP ++  + P
Sbjct  410   ANHDEKVFLAGRNSPLRQLDDPAKKLVFGGSAAREA-DRVLAAQPEQILLRGP  461



>gb|ABH09130.1| beta-conglycinin alpha'-subunit [Glycine max]
Length=600

 Score =   183 bits (465),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 211/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T + PNH DA+
Sbjct  190   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLSPNHADAD  249

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  250   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  307

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  308   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  367

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+     + SN+ G ++E+   
Sbjct  368   ESVIVEISKKQIRELSKHAKPSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPE  423

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  424   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  483

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  484   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  539

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  540   NVISQIPSQVQELAF-PGSAKDIENLI-KSQSESYFVDAQP  578



>gb|AAO45103.1| beta-conglycinin alpha' subunit [Glycine max]
Length=396

 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 119/381 (31%), Positives = 204/381 (54%), Gaps = 35/381 (9%)
 Frame = -2

Query  1298  RMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLGRGSVAVIRQDGK  1119
             R+L RF+ RS   + ++DYR+     +  T ++P+H DA+++  ++ G   + ++  D +
Sbjct  6     RVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDR  65

Query  1118  ESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQFFSGAAGKKPVS  939
             +S+N+  GD LR+P GTT Y+VN DN +   L    L   ++ PGRF+ F  ++ +   S
Sbjct  66    DSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIPVNKPGRFESFFLSSTQAQQS  123

Query  938   FFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP-------FLKVTEEQLRSLSQEGD  786
             +  GFS+  LEA+ +TK+E I +VLFG  E Q++G         ++++++Q+R LS+   
Sbjct  124   YLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAK  183

Query  785   EGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEG  609
                    R   +S+++  N+     + SN+ G ++E+       L ++DV  + V++ EG
Sbjct  184   SSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEG  239

Query  608   GMLGPFFNSRATQVAVVLEGEGWLEMGCPKN------------NYQTVRSKLKTGMVVVI  465
              +  P FNS+A  V V+ EGE  +E+   K               +  R++L    + VI
Sbjct  240   ALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVI  299

Query  464   PPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-NNLFLKLGNAAKDLSFAAGSD  288
             P GYP V  ATS+    L F  F IN   N+R  LAG+ +N+  ++ +  ++L+F  GS 
Sbjct  300   PAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAF-PGSA  354

Query  287   KESVNVVFGSQPLELFFKAPP  225
             K+  N++  SQ    F  A P
Sbjct  355   KDIENLI-KSQSESYFVDAQP  374



>ref|NP_001237316.1| beta-conglycinin alpha prime subunit precursor [Glycine max]
 dbj|BAB64303.1| beta-conglycinin alpha prime subunit [Glycine max]
Length=621

 Score =   183 bits (465),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 212/401 (53%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  211   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  270

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  271   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN--LRMITLAIP  328

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +VLFG  E Q++G     
Sbjct  329   VNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ  388

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 ++++++Q+R LS+          R   +S+++  N+     + SN+ G ++E+   
Sbjct  389   ESVIVEISKKQIRELSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPE  444

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++DV  + V++ EG +  P FNS+A  V V+ EGE  +E+   K          
Sbjct  445   KNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEE  504

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATS+    L F  F IN   N+R  LAG+ +
Sbjct  505   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD----LNFFAFGINAENNQRNFLAGSKD  560

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F  GS K+  N++  SQ    F  A P
Sbjct  561   NVISQIPSQVQELAF-LGSAKDIENLI-KSQSESYFVDAQP  599



>dbj|BAA23360.2| alpha subunit of beta conglycinin [Glycine max]
Length=543

 Score =   182 bits (462),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  133   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  192

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  193   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  250

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  251   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  310

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  311   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  366

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  367   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  426

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  427   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  482

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  483   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  521



>ref|XP_004493035.1| PREDICTED: vicilin-like [Cicer arietinum]
Length=455

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 132/418 (32%), Positives = 204/418 (49%), Gaps = 53/418 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+   F+T   +     R+L RF  RS LFE +++YRL     +  T  +P H DA+
Sbjct  30    PFFFKSNNFQTLFKNENGHVRLLQRFDKRSQLFENLQNYRLVEYNSKPHTLFLPQHNDAD  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ GR  + V+  + + +F +  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  90    FILVVLSGRAILTVLNPNDRNTFKLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  147

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP------  837
             ++ PG+FQ FS +  +   S+F GFS++ LEA+ N+ +E I+RVL  E QE+ P      
Sbjct  148   VNRPGQFQSFSLSGSENQQSYFQGFSKKILEASFNSDYEEIERVLL-EEQEQKPKQRRGH  206

Query  836   -------------FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQ  699
                           +K++ EQ+  LS+       R    +    N RS N       SN+
Sbjct  207   KDRQQSQRQEADVIVKISREQIEELSKNAKSSSKRSVSSESEPFNLRSRN----PIYSNK  262

Query  698   YGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK  519
             YG  +E+       L ++D++   V I EG +L P FNSRAT + VV EG+G +E+   +
Sbjct  263   YGNFFEITPEKNPQLQDLDISLNSVEINEGSLLLPHFNSRATVILVVNEGKGEVELVGLR  322

Query  518   N-----------------NYQTVR--SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
             N                 N Q  R  SKL +G VVVIP  +P+    + N S  L    F
Sbjct  323   NENEQENKKEDEEEEEDRNVQVQRFQSKLSSGDVVVIPASHPF----SINASSDLFLLGF  378

Query  395   DINGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              IN + N+R  LAG  +N+  ++    K+++F   +  E V+ +  +Q    F  A P
Sbjct  379   GINAQNNQRNFLAGEEDNVISQIQRPVKEVAFPGSA--EEVDRLLKNQRQSHFANAQP  434



>dbj|BAE44299.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAK39721.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAK39722.1| beta-conglycinin alpha subunit [Glycine max]
Length=605

 Score =   182 bits (463),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  195   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  255   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  313   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  372

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  373   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  428

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  429   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  488

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  489   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  544

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  545   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  583



>sp|P13916.2|GLCA_SOYBN RecName: Full=Beta-conglycinin, alpha chain; Flags: Precursor 
[Glycine max]
 emb|CAA35691.1| unnamed protein product [Glycine max]
Length=605

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  195   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  255   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  313   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  372

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  373   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  428

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  429   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  488

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  489   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  544

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  545   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  583



>ref|XP_003556051.1| PREDICTED: beta-conglycinin, alpha chain [Glycine max]
 dbj|BAB56161.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAE46788.1| beta-conglycinin alpha subunit [Glycine max]
Length=605

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  195   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  255   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  313   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  372

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  373   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  428

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  429   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  488

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  489   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  544

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  545   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  583



>dbj|BAE02727.1| beta-conglycinin alpha subunit [Glycine max]
Length=604

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  194   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  253

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  254   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  311

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  312   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  371

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  372   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  427

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  428   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  487

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  488   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  543

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  544   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  582



>gb|KHN15747.1| Beta-conglycinin, alpha chain [Glycine soja]
 gb|KHN15748.1| Beta-conglycinin, alpha chain [Glycine soja]
Length=605

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  195   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  255   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  313   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  372

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  373   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  428

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  429   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  488

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  489   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  544

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  545   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  583



>dbj|BAK39718.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAK39719.1| beta-conglycinin alpha subunit [Glycine max]
Length=605

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 209/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  195   PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  255   YLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ-----E  846
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF    G+ Q     +
Sbjct  313   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  372

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             E   +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  373   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  428

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  429   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEE  488

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  489   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  544

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  545   NVISQIPSQVQELAFPGSA--QAVEKLLKNQRESYFVDAQP  583



>ref|XP_003624145.1| Convicilin [Medicago truncatula]
 gb|ABD28361.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80363.1| vicilin 47 kDa protein [Medicago truncatula]
Length=464

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/415 (31%), Positives = 203/415 (49%), Gaps = 45/415 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    F+T   +     R+L RF  RS +FE +++YRL     +  T  +P H DA+
Sbjct  34    PFIFNSNRFQTLFENENGHIRLLQRFDKRSKIFENLQNYRLLEYHSKPHTLFLPQHNDAD  93

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  VV G+  + V+  + + SFN+  GD +++P GT  Y+ N D+ K   L    L   
Sbjct  94    FILVVVSGKAILTVLNPNNRNSFNLERGDTIKLPAGTLGYLANRDDNKD--LRVLDLAIP  151

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLK-VT  822
             ++ PG+FQ FS +  +   SF +GFS+  LEAA N+ +E I+RVL  E ++E    + + 
Sbjct  152   VNRPGQFQSFSLSESENQQSFLSGFSKNILEAAFNSNYEEIERVLIEENEQEPQHRRGLR  211

Query  821   EEQLRSLSQEGDE-GGIRPFRGDETSKNRS-------------INVFPHKTV-SNQYGVI  687
             +++ R  SQE +    +   + +E SKN               IN+   K + SN++G  
Sbjct  212   KDERRQQSQEANVIVKVSREQIEELSKNAKSSSRRSESSESEPINLRNQKPIYSNKFGNF  271

Query  686   YEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQ  507
             +E+       L ++D+   +  I EG +L P FNSRAT +  V EG+G  E+   +N  Q
Sbjct  272   FEITPEKNPQLKDLDILVNYAEIREGSLLLPHFNSRATVIVAVEEGKGEFELVGQRNENQ  331

Query  506   TV--------------------RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                                   R++L  G V VIP G+P V  A+S+    L    F IN
Sbjct  332   QEQREYEEDEQQQERSQQVQRYRARLSPGDVYVIPAGHPIVVTASSD----LSLLGFGIN  387

Query  386   GRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
                N+R  LAG  +N+  ++    K+++F   +  + V  +  +Q    F  A P
Sbjct  388   AENNQRNFLAGEEDNVISQIERPVKEVAFPGSA--QDVESLLKNQRQSYFANAQP  440



>emb|CAP06332.1| convicilin [Vicia ervilia]
Length=540

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/368 (34%), Positives = 188/368 (51%), Gaps = 42/368 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H DAE
Sbjct  184   PFLFKSNNFLTVFENENGYMRLLQRFDKRSDLFENLQNYRLTEYRSKPHTIFLPQHIDAE  243

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + S+N+  GD +++P GTT YIVN D+ +   L    L+  
Sbjct  244   FILVVLSGKAILTVLSPNNRNSYNLERGDTIKLPAGTTAYIVNGDDEED--LRVIDLVIP  301

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEE-----GPF  834
             ++ PG F+ F  +  KK      GFS+  LEA+LNTK+ETI++VL  +PQ+       P 
Sbjct  302   VNRPGEFEAFDLSGSKK--QSLRGFSKNILEASLNTKYETIEKVLLEDPQQHRRGQAKPI  359

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKP  657
             +KV+ +Q+  L         +    + E    RS N       SN++G ++E+      P
Sbjct  360   VKVSRKQIEELRNHAKSSSRKSLSSEFEPINLRSQN----PEYSNEFGKLFEITPQKKYP  415

Query  656   -LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVRSK----  492
              + ++D++ + V+I EG +L P +NSRA  V +V EG+G LE+   KN  Q  R K    
Sbjct  416   QVQDLDISVSSVDIKEGALLLPHYNSRAITVLLVNEGKGNLELVGFKNEEQEQREKEGEQ  475

Query  491   -------------------LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNER  369
                                L  G VVVIP G+P    A+SN    L    F IN   N+R
Sbjct  476   QEREDEKERNKQVQRYEANLSPGDVVVIPAGHPVAISASSN----LNLLGFGINAGNNQR  531

Query  368   VTLAGTNN  345
               L+G+++
Sbjct  532   NFLSGSDD  539



>emb|CAP06333.1| convicilin [Vicia narbonensis]
Length=485

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/364 (34%), Positives = 190/364 (52%), Gaps = 38/364 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  133   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  192

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I TV+ GR  + V+  + + S+N+  GD +++P GTT+Y++N D+ +   L    L  S
Sbjct  193   LILTVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLLNQDDEED--LRVVDLSIS  250

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+ + F G +G K   +  GFS+  LEA+LNTK+ETI++VL  EP           
Sbjct  251   VNRPGKVESF-GLSGSKN-QYLRGFSKNILEASLNTKYETIEKVLLEEPQQSIGQKRRSQ  308

Query  851   -QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEV  678
              QE    +KV+ EQ+  L +       +    + E    RS N       SN++G ++E+
Sbjct  309   RQETNALVKVSREQVEELKRLAKSSSKKGVSSEFEPFNLRSQN----PKYSNKFGKLFEI  364

Query  677   GTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTV  501
                   P L ++D+  + V I EGG++ P +NSRA  + +V EG+G LE+   KN  Q  
Sbjct  365   TPEKKYPQLQDLDIFVSSVEINEGGLMLPHYNSRAIVILLVNEGKGNLELVGLKNEQQEQ  424

Query  500   R------------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
             R            ++L  G VV+IP G+P    A+SN    L    F IN   N+R  L 
Sbjct  425   REREDEQQVQRYEARLSPGDVVIIPAGHPVAVSASSN----LNLLGFGINAENNQRNFLT  480

Query  356   GTNN  345
             G+++
Sbjct  481   GSDD  484



>ref|XP_004492829.1| PREDICTED: vicilin-like isoform X1 [Cicer arietinum]
Length=446

 Score =   178 bits (452),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 127/416 (31%), Positives = 204/416 (49%), Gaps = 51/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+    +T   +     R+L RF  RS LFE +++YRL     +  T  +P H DA+
Sbjct  30    PFFFKSNNCQTLFENENGHVRLLQRFDKRSQLFENLQNYRLMEYNSKPHTLFLPQHNDAD  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ GR  + V+  + + +F +  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  90    FILVVLRGRAILTVLNPNDRNTFKLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  147

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP------  837
             ++ PG+FQ FS +  +   S+F GFS++ LEA+ N+ +E I+RVL  E QE+ P      
Sbjct  148   VNRPGQFQSFSLSGNENQQSYFQGFSKKILEASFNSDYEEIERVLL-EEQEQKPEQRRGH  206

Query  836   -----------FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYG  693
                         +K++ EQ+  LS+       +      +S++   N+     + SN++G
Sbjct  207   KGRQQSQETDVIVKISREQIEELSKNAKSNCKKSV----SSESEPFNLRSRSPIYSNRFG  262

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+       L ++D+    V I EG +L P FNSRAT + VV EG+G +E+   +N 
Sbjct  263   NFFEITPEKNPQLKDLDIFVNSVEIKEGSLLLPHFNSRATVILVVNEGKGEVELVGLRNE  322

Query  515   ----------------NYQTVR--SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                             N Q  R  SKL +G VVVIP  +P+    + N S  L    F I
Sbjct  323   NEQENKKEDEEEEEDRNVQVQRFQSKLSSGDVVVIPASHPF----SINASSDLFLLGFGI  378

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N + N+R  LAG  +N+  ++    K+++F   +  E V+ +  +Q    F  A P
Sbjct  379   NAQNNQRNFLAGEEDNVISQIQRPVKEVAFPGSA--EEVDRLLKNQRQSHFANAQP  432



>emb|CAP06331.1| convicilin [Vicia articulata]
Length=547

 Score =   180 bits (457),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 190/361 (53%), Gaps = 35/361 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+  +F+T   +     R+L RF  RSDLFE +++YRL     +  T  +P H +A+
Sbjct  198   PFFFKSNKFQTVFENENGHIRLLQRFDKRSDLFENLQNYRLTEYRSKPHTIFLPQHVNAD  257

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + S+N+  GD +++P GTT Y+VN D+ +   L    L+  
Sbjct  258   FILVVLSGKAILTVLSPNERNSYNLERGDTIKLPAGTTAYLVNQDDEED--LRVVDLVIP  315

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP---------QE  846
             ++ PG+F+ F+ +  K    +  GFS+  LEA+LNT++ETI++VL  EP         QE
Sbjct  316   VNRPGKFEAFNLSGNKN--QYLRGFSKNILEASLNTRYETIEKVLLEEPQQYRRRQQRQE  373

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEVGTT  669
                 +KV+ EQ+  L         +    + E    RS N       SN++G ++E+   
Sbjct  374   TEAIVKVSREQIEELRNHAKSSSKKRLSSEFEPFNLRSQN----PKYSNKFGKLFEITPE  429

Query  668   HFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVR--  498
                P L ++D+  + V I EG ++ P++NSRAT V +V EG G LE+   KN  Q  R  
Sbjct  430   KKHPQLQDLDIFLSHVEIKEGALMLPYYNSRATVVLLVNEGRGKLELVGLKNEQQEQRKE  489

Query  497   ----------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTN  348
                       ++L  G +VVIP G+P    A+SN    L    F IN   N+R  L+G++
Sbjct  490   ERNKQVQRFEARLSPGDIVVIPAGHPVAIRASSN----LNLLGFGINAENNQRNFLSGSD  545

Query  347   N  345
             +
Sbjct  546   D  546



>ref|NP_001236856.1| beta-conglycinin alpha-subunit precursor [Glycine max]
 dbj|BAB64304.1| beta-conglycinin alpha-subunit [Glycine max]
Length=623

 Score =   181 bits (459),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 208/401 (52%), Gaps = 35/401 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F    FET   +     R+L RF+ RS   + ++DYR+     +  T ++PNH DA+
Sbjct  213   PFHFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADAD  272

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             ++  ++ G   ++++  D ++S+ +  GD LR+P GTT Y+VN DN +   L    L   
Sbjct  273   YLIAILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN--LRLITLAIP  330

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG--EPQEEGP----  837
             ++ PGRF+ F  ++ +   S+  GFSR  LEA+ +TK+E I +VLF   E Q++G     
Sbjct  331   VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQ  390

Query  836   ---FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
                 +++++EQ+R+LS+          R   +S+++  N+     + SN+ G  +E+   
Sbjct  391   ESVIVEISKEQIRALSKRAKSSS----RKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE  446

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN---------  516
                 L ++D+  + V++ EG +L P FNS+A  + V+ EG+  +E+   K          
Sbjct  447   KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEEQQEE  506

Query  515   ---NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT-N  348
                  +  R++L    + VIP GYP V  ATSN    L F    IN   N+R  LAG+ +
Sbjct  507   QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN----LNFFAIGINAENNQRNFLAGSQD  562

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++ +  ++L+F   +  ++V  +  +Q    F  A P
Sbjct  563   NVISQIPSQVQELAFLGSA--QAVEKLLKNQRESYFVDAQP  601



>ref|XP_010466550.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=494

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 116/393 (30%), Positives = 192/393 (49%), Gaps = 40/393 (10%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHE  1188
             ++P+ F +  F+    S E   +MLP+F+ R+ +LF GI++YR A   +E  TF+VP+H 
Sbjct  65    EFPYHFGKRSFKNWFQSNEGFVKMLPKFTKRAPNLFRGIENYRFALFEMEPNTFLVPHHL  124

Query  1187  DAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL  1008
             DA+ +  V+ G G V  +    KESF++ +GDV+R+P G T Y  NT+  + VPL F  +
Sbjct  125   DADSVVLVLQGHGVVEFVTDKTKESFHVTKGDVVRLPSGVTHYATNTN--QTVPLRFVKI  182

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFL  831
             I  ++ PG+F+ +  A  +   S+F GFS+E L A+ N   E + R+  G  Q  +G   
Sbjct  183   IVPVNNPGQFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRLFSGSQQTGQGIMR  242

Query  830   KVTEEQLRSLSQEGDEGG-----IRPFRGDETSKNRSINVFPHKTVS---NQYGVIYEVG  675
             +V+ +Q++ L++            +    D ++K R  N+F   +VS   N +G  +E  
Sbjct  243   RVSPDQIKELTKHATSPSNKHKETKSKHKDTSTKLRPFNLFTQDSVSTYTNDFGHFHEAR  302

Query  674   TTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------  516
                F  L ++ +  A+ N+++G +  P +NS+ T V  V  G    EM  P +       
Sbjct  303   PESFDQLQDLRIAVAWTNMSQGSLFLPHYNSKTTFVTFVENGCARYEMASPYSFQGEQQQ  362

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                   + S++  G V +IP G+P   V+ +    S+ FG   I
Sbjct  363   QQWWPEQGGEEEEEDMSGQVHKIVSRVCKGDVFIIPAGHPVTLVSHNENFVSVGFG---I  419

Query  389   NGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGS  291
             +     R  LAG  N+   L   A  ++F  GS
Sbjct  420   HASNCTRTFLAGQENVLSNLDTVATRVTFGVGS  452



>ref|XP_010511540.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=491

 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/394 (29%), Positives = 192/394 (49%), Gaps = 41/394 (10%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHE  1188
             ++P+ F++  F+    S E   +MLP+F+ R+ +LF GI++YR A   +E  TF+VP+H 
Sbjct  61    EFPYHFRKRSFKNWFQSNEGFVKMLPKFTKRARNLFRGIENYRFALFEMEPNTFLVPHHL  120

Query  1187  DAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL  1008
             DA+ +  V+ G G V  +    KESF++ +GDV+R+P G T +  NT+  + VPL F  +
Sbjct  121   DADSVVLVLQGHGVVEFVTDKTKESFHVTKGDVVRLPSGVTHFATNTN--QTVPLRFVKI  178

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFL  831
             I  ++ PG+F+ +  A  +   S+F GFS+E L A+ N   E + R+  G  Q  +G   
Sbjct  179   IVPVNNPGQFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRLFSGSQQTGQGIMR  238

Query  830   KVTEEQLRSLSQEGDEGG-----IRPFRGDETSKNRSINVFPHKTVS---NQYGVIYEVG  675
             +V+ +Q++ L++            +    D ++K R  N+F   +VS   N +G  +E  
Sbjct  239   RVSPDQIKELTKHATSPSNKHKETKSKHKDISTKLRPFNLFTQDSVSSYTNDFGHFHEAH  298

Query  674   TTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------  522
                F  L ++ +  A+ N+++G +  P +NS+ T +  V  G    EM  P         
Sbjct  299   PESFDQLQDLRIAVAWTNMSQGSLFLPHYNSKTTFITFVENGCARYEMASPYSFQGEQQQ  358

Query  521   -----------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFD  393
                                    + S++  G V +IP G+P+  V+      S+ FG   
Sbjct  359   QEQQWWPQQGGEEEEDMSGQVHKIVSRVCKGDVFIIPAGHPFTLVSHDENFVSVGFG---  415

Query  392   INGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGS  291
             I+     R  LAG  N+   L   A  ++F  GS
Sbjct  416   IHASNCTRTFLAGQENVLSNLDTVATRVTFGVGS  449



>ref|XP_010551719.1| PREDICTED: vicilin [Tarenaya hassleriana]
Length=469

 Score =   177 bits (450),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 123/412 (30%), Positives = 192/412 (47%), Gaps = 53/412 (13%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             ++PF F +  F+T   S E   ++LP F+ RS LF GI++YR AFL +  +TFV P+H D
Sbjct  52    EHPFYFGQRSFQTLLRSKEGFMKLLPSFTSRSWLFRGIENYRFAFLKMAPRTFVQPHHPD  111

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A+ +  V+ G+G    + Q+ KE+F+I +G V+R+P GTT Y+ NT + +  PL    + 
Sbjct  112   ADVVFVVLQGKGVAMFLTQEEKETFHIEKGHVVRMPAGTTHYVANTGDDE--PLRLAAIF  169

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
               ++ PG FQ F  AA +   S+F+GFS + L A+ N   E + R L G          +
Sbjct  170   VPVNIPGSFQVFFPAAAEFQQSYFDGFSSKVLSASFNVSEELLGRFLRGPQTGRKAIQTI  229

Query  824   TEEQLRSLSQEGDEGGIRPFRGDETSKNRS-----INVFPHKTV-SNQYGVIYEVGTTHF  663
             + E+++ L         R     E  K++       ++   + V SN++G  YE     F
Sbjct  230   SPEEIKEL---------RKHVSSEKHKHQGRLWSPFDIHSQEPVYSNEFGRFYEAHPERF  280

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------  519
             + L ++ ++   +N+T+G +  P F+S+AT +  V  G    EM  P             
Sbjct  281   RQLRDLGISVTCINMTQGSIFVPHFSSKATFIVFVESGCARFEMAKPHIGSGQWQQQQQE  340

Query  518   -------------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
                                     V S++  G + VIP  +P   +       ++ FG  
Sbjct  341   GPQWGGQGQEQQWGEQEMTGKIHRVVSQVCKGELFVIPASHPVAIITQDQNFTAVGFG--  398

Query  395   DINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELF  240
              IN   + R  LAG  N+  KL  A K L+F  G  KE    VF SQ    F
Sbjct  399   -INAHNSSRTFLAGQGNILSKLDTAEKRLTFGVG--KEVSERVFTSQDYSYF  447



>ref|XP_008382112.1| PREDICTED: vicilin-like [Malus domestica]
 ref|XP_008382113.1| PREDICTED: vicilin-like [Malus domestica]
Length=612

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/404 (33%), Positives = 205/404 (51%), Gaps = 40/404 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+++  S E   ++L RF  +S+L  GIK+YRLA       TFV+P+H DAE
Sbjct  202   PFYFPSQMFQSRFQSDEGSLQVLVRFG-KSELLRGIKNYRLAIFEAMPNTFVLPHHCDAE  260

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+ +  ++ +D KESFN   GDV+R+  GTT Y+ N +N +  PL    LIRS
Sbjct  261   AIFVVLNGQCTCTLLLKDRKESFNXEHGDVIRVRAGTTIYLTNNNNDE--PLHIAKLIRS  318

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNT---KWETIQRVLFGEPQEEGPFLK  828
             +++PGRF+ F  A    P S+F+ FS + LE+A +T   + E   R   G+   +G  ++
Sbjct  319   VNSPGRFEEFFPAGSGNPESYFSVFSNDILESAFSTPRKELEQGFRQQRGQQGGQGIVMR  378

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLD  651
               +EQL +LSQ          R  E       N+   K V SN YG ++E     F    
Sbjct  379   APKEQLEALSQRASSARREGRRQSEG----PFNLRQLKPVHSNNYGQLFEARPEEFSQFQ  434

Query  650   EVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----------------  522
             ++DV+ + + + +  M+ P FNS+AT +  V+EG   +EM CP                 
Sbjct  435   DMDVSVSCIEMNQQTMMVPHFNSKATFLIYVVEGNVRVEMVCPHLASQMQGQETTEQQEQ  494

Query  521   ---KNNYQTVRSKLKTGMVVVIPPGYPYVNVATS---NPSKSLQFGWFDINGRGNERVTL  360
                   +  V ++L  G   VIP G+P   V  S   N +++++   F +N + + R  L
Sbjct  495   GEHSGRFMKVNAQLSPGDAFVIPAGHPVAFVTHSNNGNQNQNIRILGFGLNAQYSMRNFL  554

Query  359   AG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKA  231
             AG  +N+ L++   AK L+F  G D E    +FG Q    F  A
Sbjct  555   AGQKDNIMLQMNREAKQLAF--GQDMEK---IFGKQQESYFVPA  593



>emb|CAP06329.1| convicilin [Vicia peregrina]
Length=499

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 122/374 (33%), Positives = 189/374 (51%), Gaps = 51/374 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +G    R+L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  140   PFLFKSNKFLTLFQNGNGHIRLLQRFDKRSDLFENLQNYRLLEYRAKPHTIFLPQHIDAD  199

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GR  + V+  D + S+N+  GD +++P GTT+Y +N D+ +   L    L  S
Sbjct  200   LILVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYPLNQDDEED--LRVVDLAIS  257

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+ + F+ +  K    +  GFS   LEA+ NTK+ETI++VL  E            
Sbjct  258   VNRPGKVESFNLSGNKN--QYLRGFSENILEASFNTKYETIEKVLLEEQDKESQQPRGQR  315

Query  851   ---QEEGPFLKVTEEQ---LRSLSQEGDEGGIRPFRGDETSKNRSINVFPH-KTVSNQYG  693
                QE    +KV+ EQ   L+ L++   + G+       +S+    N+  H    SN++G
Sbjct  316   LQRQETNALVKVSREQVEELKRLARTSSKKGV-------SSEFEPFNLRSHGPKYSNKFG  368

Query  692   VIYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
               +E+      P L ++D++ + V I EG +  P +NSRA  V +V EG+G LE+   KN
Sbjct  369   KFFEITPEKKYPQLQDLDISVSSVEINEGALFLPHYNSRAIVVVLVDEGKGNLELVGFKN  428

Query  515   NYQTVR-----------------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
               Q  R                 +KL  G VV+IP G+P    A+SN    L    F IN
Sbjct  429   EQQEQREKEDEQEERNKQVQRYEAKLSPGDVVIIPAGHPVAVSASSN----LNLLGFGIN  484

Query  386   GRGNERVTLAGTNN  345
                N+R  L G+++
Sbjct  485   AENNQRNFLTGSDD  498



>gb|ACB05815.1| conglutin beta [Lupinus angustifolius]
Length=611

 Score =   179 bits (454),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/389 (30%), Positives = 200/389 (51%), Gaps = 49/389 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F    F+T   +     R+L RF+ R++  E +++YR+     +  T ++P H DA+
Sbjct  185   PYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDAD  244

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ GR ++ ++  D ++ +N+ +GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  245   FILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQN--LRVAKLAIP  302

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG+   F  +  K   S+F+GFS+ TLEA  NT++E I+RVL G+            
Sbjct  303   INNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRRG  362

Query  851   -----QEEGPFLKVTEEQLRSLSQ--EGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQY  696
                  Q+EG  ++V+++Q++ L +  +   G  +P      S++   N+  +K + SN++
Sbjct  363   QEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKP------SESGPFNLRSNKPIYSNKF  416

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
             G  YE+         +++++  F  I EG +L P +NS+A  + VV EGEG  E+   ++
Sbjct  417   GNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRD  476

Query  515   NY-----------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                                +    KL  G V +IP G+P     + N S +L+   F IN
Sbjct  477   QQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPL----SINASSNLRLLGFGIN  532

Query  386   GRGNERVTLAGT-NNLFLKLGNAAKDLSF  303
                N+R  LAG+ +N+  +L    K+L+F
Sbjct  533   ANENQRNFLAGSEDNVIKQLDREVKELTF  561



>gb|AEB33712.1| conglutin beta 1 [Lupinus angustifolius]
Length=611

 Score =   179 bits (454),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/389 (30%), Positives = 200/389 (51%), Gaps = 49/389 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F    F+T   +     R+L RF+ R++  E +++YR+     +  T ++P H DA+
Sbjct  185   PYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDAD  244

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ GR ++ ++  D ++ +N+ +GD LR+P GTT+YI+N D+ +   L    L   
Sbjct  245   FILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQN--LRVAKLAIP  302

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             I+ PG+   F  +  K   S+F+GFS+ TLEA  NT++E I+RVL G+            
Sbjct  303   INNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRRG  362

Query  851   -----QEEGPFLKVTEEQLRSLSQ--EGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQY  696
                  Q+EG  ++V+++Q++ L +  +   G  +P      S++   N+  +K + SN++
Sbjct  363   QEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKP------SESGPFNLRSNKPIYSNKF  416

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
             G  YE+         +++++  F  I EG +L P +NS+A  + VV EGEG  E+   ++
Sbjct  417   GNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRD  476

Query  515   NY-----------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                                +    KL  G V +IP G+P     + N S +L+   F IN
Sbjct  477   QQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPL----SINASSNLRLLGFGIN  532

Query  386   GRGNERVTLAGT-NNLFLKLGNAAKDLSF  303
                N+R  LAG+ +N+  +L    K+L+F
Sbjct  533   ANENQRNFLAGSEDNVIKQLDREVKELTF  561



>ref|XP_004493034.1| PREDICTED: vicilin-like [Cicer arietinum]
Length=462

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 131/421 (31%), Positives = 205/421 (49%), Gaps = 56/421 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+   F+T   +     R+L RF  RS LFE +++YRL     +  T  +P H DA+
Sbjct  30    PFFFKSNNFQTLFKNENGHVRLLQRFDKRSQLFENLQNYRLVEYNSKPHTLFLPQHNDAD  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ GR  + V+  + + +FN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  90    FILVVLSGRAILTVLNPNDRNTFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  147

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP------  837
             ++ PG+FQ FS +  +   S+F GFS++ LEA+ N+ +E I+RVL  E QE+ P      
Sbjct  148   VNRPGQFQSFSLSGSENQQSYFQGFSKKILEASFNSDYEEIERVLL-EEQEQKPKQRRGH  206

Query  836   ----------------FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTV  708
                              +K++ EQ+  LS+       +    +    N RS N       
Sbjct  207   KDRQQSQSQSQQEADVIVKISREQIEELSKNAKSSSKKSVSSESEPFNLRSRN----PIY  262

Query  707   SNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMG  528
             SN+YG  +E+       L ++D++   V I EG +L P FNSRAT + VV EG+G +E+ 
Sbjct  263   SNKYGNFFEITPEKNPQLQDLDISLNSVEINEGSLLLPHFNSRATVILVVNEGKGEVELV  322

Query  527   CPKN-----------------NYQTVR--SKLKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
               +N                 N Q  R  S+L +G VVVIP  +P+    + N S  L  
Sbjct  323   GLRNENEQENKKEDEEEEEDRNVQVQRFQSRLSSGDVVVIPASHPF----SINASSDLFL  378

Query  404   GWFDINGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAP  228
               F IN + N+R  LAG  +N+  ++    K+++F   +  E V+ +  +Q    F  A 
Sbjct  379   LGFGINAQNNQRNFLAGEEDNVISQIQRPVKEVAFPGSA--EEVDRLLKNQRQSHFANAQ  436

Query  227   P  225
             P
Sbjct  437   P  437



>ref|XP_003624149.1| Provicilin [Medicago truncatula]
 gb|ABD28364.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80367.1| vicilin 47 kDa protein [Medicago truncatula]
Length=463

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/417 (30%), Positives = 194/417 (47%), Gaps = 51/417 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F    F+T   +     R+L RF  RS +FE +++YRL     +  T  +P H DA+
Sbjct  35    PFFFNANHFQTLFENENGHIRLLQRFDKRSKIFENLQNYRLLEYHSKPHTLFLPQHNDAD  94

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  D + SFN+  GD +++P G+  Y+ N D+ +   L    L   
Sbjct  95    FILAVLSGKAILTVLNPDNRNSFNLERGDTIKLPAGSIAYLANRDDNED--LRVLDLAIP  152

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEE--------  843
             ++ PG+FQ FS +  +   SFF+GFS+  LEAA N  +E I+RVL  E ++E        
Sbjct  153   VNRPGKFQSFSLSGSQNQQSFFSGFSKNILEAAFNANYEEIERVLIEEHEQEPQHRRGLR  212

Query  842   ----------GPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQY  696
                          +KV+ EQ+  LS+       R    +    N RS         SN++
Sbjct  213   KDRRQQSQDSNVIVKVSREQIEELSRHAKSSSRRSGSSESAPFNLRS----REPIYSNEF  268

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-----  531
             G  +E+       L ++D+   +  I EG +L P FNSRAT + VV EG+G  E+     
Sbjct  269   GNFFEITPEKNPQLKDLDILVNYAEIREGSLLLPHFNSRATVIVVVDEGKGEFELVGQRN  328

Query  530   --------------GCPKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFD  393
                                  Q  R++L  G V VIP G+P V  A+S+    L    F 
Sbjct  329   ENQQEQREEDEQQEEERSQQVQRYRARLSPGDVYVIPAGHPTVVSASSD----LSLLGFG  384

Query  392   INGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             IN   NER  LAG  +N+  ++    K+++F   +  + V  +  +Q    F  A P
Sbjct  385   INAENNERNFLAGEEDNVISQIERPVKEVAFPGSA--QDVESLLKNQRQSYFANAQP  439



>ref|XP_006299670.1| hypothetical protein CARUB_v10015858mg [Capsella rubella]
 gb|EOA32568.1| hypothetical protein CARUB_v10015858mg [Capsella rubella]
Length=495

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/388 (30%), Positives = 188/388 (48%), Gaps = 49/388 (13%)
 Frame = -2

Query  1334  FETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVL  1158
             F+    S E   ++LP+F+ R+ +LF GI +YR A   +E  TF+VP+H DA+F+  ++ 
Sbjct  75    FKNWFQSNEGFVKILPKFTKRAPNLFRGIGNYRFALFEMEPNTFLVPHHLDADFVVIILQ  134

Query  1157  GRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRF  978
             G+G V  +    KESF + +GDV+R+P G T +  NT+  + VPL F  ++  ++ PG+F
Sbjct  135   GQGVVEYVTDKTKESFQVTKGDVVRLPSGVTHFATNTN--QTVPLRFAKIMVPVNNPGQF  192

Query  977   QFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFLKVTEEQLRSL  801
             + +  A  +   S+F GFS+E L A+ N   E + RV FG  Q  +G   +++ +Q++ L
Sbjct  193   KDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRVFFGSQQMGQGIMRRISPDQIKEL  252

Query  800   SQEGDEGGIRP---------FRGDETSKNRSINVFPHKTV---SNQYGVIYEVGTTHFKP  657
             +    EG   P            D  +K    N+F H +V   +N +G  +E     F  
Sbjct  253   T----EGATSPSNKHKEKKSKHKDTNTKWNPFNIFKHDSVETYTNDFGHFHEAHPESFDQ  308

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN------------  513
             L ++ ++ A+VN+ +G +  P +NSR T V  V  G    EM  P  +            
Sbjct  309   LQDLHISVAWVNMKQGSLFLPHYNSRTTFVTFVENGCARYEMASPYTSQGEKQQQQQLWP  368

Query  512   --------------YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                              + S++  G V +IP G+P   V+      S+ FG   I+    
Sbjct  369   EQGGEEQEEDMSGQVHKIVSRVCKGDVFIIPAGHPVTLVSHDENFVSVGFG---IHASNC  425

Query  374   ERVTLAGTNNLFLKLGNAAKDLSFAAGS  291
              R  LAG  N+   L   A  ++F+ GS
Sbjct  426   TRTFLAGEENMLSNLDTVATKVTFSVGS  453



>emb|CAR78997.1| convicilin storage protein 1 [Lotus japonicus]
Length=528

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 204/404 (50%), Gaps = 38/404 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+   F+T   +     R+L RF +RS LFE +++YR+     + QT V+P+H DA+
Sbjct  114   PFHFRSSRFQTHFENEHGHVRVLQRFDERSKLFENLQNYRILEFKAKPQTLVLPHHNDAD  173

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  ++ GR  + ++  + ++S+N+  GD L IP G T Y+ N DN +   L    L+  
Sbjct  174   SIIVILSGRAILTIVNPNDRDSYNLESGDALVIPAGATAYLANRDNDEN--LRVVKLLIP  231

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-------EPQEEG  840
             I+ PG++Q F  ++ +   S+ NGFSR  LEA+ N  ++ I+RVL         + QE+G
Sbjct  232   INRPGQYQPFFPSSSETQESYLNGFSRNILEASFNAGYDEIERVLLQREEQRGEQSQEQG  291

Query  839   PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHF  663
               +K +++Q++ LS+              +SK+   N+   K + SN++G ++E+     
Sbjct  292   VIVKASQDQIQQLSRHAKSSSR----KRSSSKSEPFNLRSSKPISSNKFGKLFEITPEKN  347

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNY---------  510
             + L ++D+  +   I EG +  P ++S +T + VV EG G LE+   +            
Sbjct  348   QQLRDLDILLSEAQIKEGSIFLPHYHSTSTLILVVNEGRGELELVAQRRQQQRGQEEEQE  407

Query  509   --------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
                     Q  R++L  G V+VIP  +P+   A+S+    L    F IN   N+R  LAG
Sbjct  408   EEQPRIEAQRFRARLSPGDVIVIPASHPFAVTASSD----LNLLAFGINAENNQRNFLAG  463

Query  353   -TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               +N+  ++    K+L+F   +  E +  +  +Q    F  A P
Sbjct  464   RDDNVISQIERPVKELAFPGSA--EEIESLIKNQRNSCFASAQP  505



>ref|XP_004492830.1| PREDICTED: vicilin-like isoform X2 [Cicer arietinum]
Length=434

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 124/403 (31%), Positives = 203/403 (50%), Gaps = 37/403 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+    +T   +     R+L RF  RS LFE +++YRL     +  T  +P H DA+
Sbjct  30    PFFFKSNNCQTLFENENGHVRLLQRFDKRSQLFENLQNYRLMEYNSKPHTLFLPQHNDAD  89

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ GR  + V+  + + +F +  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  90    FILVVLRGRAILTVLNPNDRNTFKLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  147

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP----FL  831
             ++ PG+FQ FS +  +   S+F GFS++ LEA+ N+ +E I+RVL  E +++       +
Sbjct  148   VNRPGQFQSFSLSGNENQQSYFQGFSKKILEASFNSDYEEIERVLLEEQEQQSQETDVIV  207

Query  830   KVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPL  654
             K++ EQ+  LS+          +   +S++   N+     + SN++G  +E+       L
Sbjct  208   KISREQIEELSKNAKSNC----KKSVSSESEPFNLRSRSPIYSNRFGNFFEITPEKNPQL  263

Query  653   DEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN--------------  516
              ++D+    V I EG +L P FNSRAT + VV EG+G +E+   +N              
Sbjct  264   KDLDIFVNSVEIKEGSLLLPHFNSRATVILVVNEGKGEVELVGLRNENEQENKKEDEEEE  323

Query  515   ---NYQTVR--SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-  354
                N Q  R  SKL +G VVVIP  +P+    + N S  L    F IN + N+R  LAG 
Sbjct  324   EDRNVQVQRFQSKLSSGDVVVIPASHPF----SINASSDLFLLGFGINAQNNQRNFLAGE  379

Query  353   TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              +N+  ++    K+++F   +  E V+ +  +Q    F  A P
Sbjct  380   EDNVISQIQRPVKEVAFPGSA--EEVDRLLKNQRQSHFANAQP  420



>ref|XP_010466552.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=462

 Score =   176 bits (445),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 111/387 (29%), Positives = 193/387 (50%), Gaps = 36/387 (9%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHE  1188
             ++P+ F+++ F+    S E   +MLP+F+ R+ +LF GI++YR +   +E  TF+VP H 
Sbjct  58    EFPYHFKKQSFKNWFQSKEGFVKMLPKFTKRAPNLFRGIENYRFSLYEMEPNTFLVPLHL  117

Query  1187  DAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL  1008
             DA+ +  ++ G+G    +    KE F++ +GDV+R+P G T + +NT+  + VPL F  +
Sbjct  118   DADSVVIILQGQGVAEFVTAKTKELFHLTKGDVVRLPSGITHFAINTN--QTVPLRFAKI  175

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFL  831
                ++ PG+FQ +  A  +   S+F GFS+E L A+ N   E + R+ FG  Q  +G   
Sbjct  176   TIPVNIPGQFQNYFSAPSQFQQSYFTGFSKEVLSASFNIPEELVGRIFFGSQQMGQGILR  235

Query  830   KVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVS---NQYGVIYEVGTTHFK  660
             ++T EQ++ +++       +    D+++K    N+F H +VS   N +G  +E     F 
Sbjct  236   RITPEQIKEITENSTSRSNK--DKDKSTKFSPFNLFTHDSVSSYTNDFGHFHEAQPDSFD  293

Query  659   PLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP--------------  522
              + ++ +   + N+T+G +  P +NS+AT V  V  G    EM  P              
Sbjct  294   QIQDLQIAVTWTNMTQGSVFLPQYNSKATFVTFVENGCARYEMASPYSFQREQQQQQWWP  353

Query  521   ----------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                             + S++  G V +IP G+P+  V+      S+ FG +  N   + 
Sbjct  354   EQGGEEEEDMSGQVHKIVSRVCKGDVFIIPAGHPFTIVSHDENFVSVGFGIYASN---SI  410

Query  371   RVTLAGTNNLFLKLGNAAKDLSFAAGS  291
             R  LAG  N+   L   A  ++F   S
Sbjct  411   RTFLAGQGNVLSNLDTVATRVAFGVRS  437



>ref|XP_003624154.1| Convicilin [Medicago truncatula]
 gb|ABD28367.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80372.1| vicilin 47 kDa protein [Medicago truncatula]
Length=471

 Score =   176 bits (445),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/422 (30%), Positives = 200/422 (47%), Gaps = 52/422 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F    F+T   +     R+L RF  RS +FE +++YRL     +  T  +P H DA+
Sbjct  34    PFIFNSNRFQTLFENENGHIRLLQRFDKRSKIFENLQNYRLLEYHSKPHTLFLPQHNDAD  93

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+  GD +++P G+  Y+ N D+ +   L    L   
Sbjct  94    FILAVLSGKAILTVLNPNNRNSFNLERGDTIKLPAGSIAYLANRDDNQD--LRVLDLAIP  151

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE------------  855
             ++ PG+FQ FS +  +   SFF+GFS+  LEAA N  +E I+RVL  E            
Sbjct  152   VNRPGQFQSFSLSGNQNQQSFFSGFSKNILEAAFNANYEEIERVLIEEQEPQHRRGLRDR  211

Query  854   ----PQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRS------INVFPHKTV-  708
                  QE    +KV+ EQ+  LS+       R    +  S+  +       N+  H+ + 
Sbjct  212   RHKQSQEADVIVKVSREQIEELSRHAKSSSRRSASSESASRRSASSESAPFNLRSHEPIY  271

Query  707   SNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMG  528
             SN++G  +E+       L ++D+   +  I EG +L P FNSRAT +  V EG+G  E+ 
Sbjct  272   SNEFGNFFEITPEKNPQLQDLDILVNYAEIREGSLLLPHFNSRATVIVAVEEGKGEFELV  331

Query  527   CPKNNYQTV--------------------RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQ  408
               +N  Q                      R++L  G V VIP G+P V  A+S+    L 
Sbjct  332   GQRNENQQEQREYEEDEQQQERSQQVQRYRARLSPGDVYVIPAGHPIVVKASSD----LS  387

Query  407   FGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKA  231
                F IN   N+R  LAG  +N+  ++    K+++F   +  + V  +  +Q    F  A
Sbjct  388   LLGFGINAENNQRNFLAGEEDNVISQIERPVKEVAFPGSA--QDVESLLKNQRQSYFANA  445

Query  230   PP  225
              P
Sbjct  446   QP  447



>emb|CAR78993.1| convicilin storage protein 1 [Lotus japonicus]
Length=561

 Score =   177 bits (449),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 204/404 (50%), Gaps = 38/404 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+   F+T   +     R+L RF +RS LFE +++YR+     + QT V+P+H DA+
Sbjct  147   PFHFRSSRFQTHFENEHGHVRVLQRFDERSKLFENLQNYRILEFKAKPQTLVLPHHNDAD  206

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  ++ GR  + ++  + ++S+N+  GD L IP G T Y+ N DN +   L    L+  
Sbjct  207   SIIVILSGRAILTIVNPNDRDSYNLESGDALVIPAGATAYLANRDNDEN--LRVVKLLIP  264

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG-------EPQEEG  840
             I+ PG++Q F  ++ +   S+ NGFSR  LEA+ N  ++ I+RVL         + QE+G
Sbjct  265   INRPGQYQPFFPSSSETQESYLNGFSRNILEASFNAGYDEIERVLLQREEQRGEQSQEQG  324

Query  839   PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHF  663
               +K +++Q++ LS+              +SK+   N+   K + SN++G ++E+     
Sbjct  325   VIVKASQDQIQQLSRHAKSSSR----KRSSSKSEPFNLRSSKPISSNKFGKLFEITPEKN  380

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNY---------  510
             + L ++D+  +   I EG +  P ++S +T + VV EG G LE+   +            
Sbjct  381   QQLRDLDILLSEAQIKEGSIFLPHYHSTSTLILVVNEGRGELELVAQRRQQQRGQEEEQE  440

Query  509   --------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG  354
                     Q  R++L  G V+VIP  +P+   A+S+    L    F IN   N+R  LAG
Sbjct  441   EEQPRIEAQRFRARLSPGDVIVIPASHPFAVTASSD----LNLLAFGINAENNQRNFLAG  496

Query  353   -TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
               +N+  ++    K+L+F   +  E +  +  +Q    F  A P
Sbjct  497   RDDNVISQIERPVKELAFPGSA--EEIESLIKNQRNSCFASAQP  538



>emb|CAP06322.1| convicilin [Lathyrus clymenum var. clymenum]
Length=498

 Score =   176 bits (446),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 185/358 (52%), Gaps = 32/358 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RS+LFE +++YRL     +  T  +P H DA+
Sbjct  152   PFLFKSNKFRTLFENENGHIRRLQRFDKRSNLFENLQNYRLVEYRAKPHTIFLPQHIDAD  211

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  212   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRVVDLVIP  269

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP----------Q  849
             ++ PG+F+ F     K    +  GFS+  LEA+LN K+ETI++VL   P          Q
Sbjct  270   VNRPGKFEDFDLYENKN--QYLRGFSKNILEASLNAKYETIEKVLLEGPQKQLRDLKRRQ  327

Query  848   EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEVGT  672
             E    ++V+ EQ+  L +       +    + E    RS N       SN +G ++E+  
Sbjct  328   ETDAIVRVSREQIEELRKLAKSSSKKKLPSEFEPFNLRSQN----PKYSNNFGKLFEITP  383

Query  671   THFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVR-  498
                 P L ++D++ + V I EG ++ P +NSRA  V +V +G G LE+   KN  Q  R 
Sbjct  384   RKKYPQLQDLDISVSCVEINEGALMLPHYNSRAIIVVLVTQGNGNLELVGFKNEEQEQRE  443

Query  497   -------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                    ++L  G VVVIP G+P    A+SN    L    F IN   N+R+ L+G+++
Sbjct  444   NQVQRYEARLSPGDVVVIPAGHPVAITASSN----LNLLGFGINAENNQRIFLSGSDD  497



>ref|XP_010488296.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=489

 Score =   176 bits (445),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 116/392 (30%), Positives = 190/392 (48%), Gaps = 39/392 (10%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHE  1188
             ++P+ F +  F+    S E   +MLP+F+ R+ +LF GI++YR A   +E  TF+VP+H 
Sbjct  61    EFPYHFGKRSFKNWFQSNEGFVKMLPKFTKRAPNLFRGIENYRFAVFEMEPNTFLVPHHL  120

Query  1187  DAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL  1008
             DA+ +  V+ G G V  +    KESF + +GDV+R+P G T +  NT+  + VPL F  +
Sbjct  121   DADSVVLVLQGHGVVEFVTDKTKESFQVTKGDVVRLPSGITHFATNTN--QTVPLRFVKI  178

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFL  831
             I  ++ PGRF+ +  A  +   S+F GFS+E L A+ N   E + R+  G  Q  +G   
Sbjct  179   IVPVNNPGRFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRLFSGSQQTGQGIMR  238

Query  830   KVTEEQLRSLSQEGDEGG-----IRPFRGDETSKNRSINVFPHKTVS---NQYGVIYEVG  675
             +V+ +Q++ L++            +    D ++K R  N+F   +VS   N +G  +E  
Sbjct  239   RVSPDQIKKLTKHATSPSNKHKESKSKHKDISTKLRPFNLFTQDSVSTYTNDFGHFHEAH  298

Query  674   TTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP---------  522
                F  L ++ +  A+ N+++G +  P +NS+ T V  V  G    EM  P         
Sbjct  299   PESFDQLQDLRIAVAWTNMSQGSLFLPHYNSKTTFVTFVENGCARYEMASPYSFQGEQQQ  358

Query  521   ---------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                                  + S++  G V +IP G+P   V+ +    S+ FG   I+
Sbjct  359   KQWWPEQGGEEEEDMSGQVHKIVSRVCKGDVFIIPAGHPVTLVSHNENFVSVGFG---IH  415

Query  386   GRGNERVTLAGTNNLFLKLGNAAKDLSFAAGS  291
                  R  LAG  N+   L   A  ++F  GS
Sbjct  416   ASNCTRTFLAGQENVLSNLDTVATRVTFGVGS  447



>emb|CAP06324.1| convicilin [Lathyrus ochrus]
Length=499

 Score =   176 bits (445),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 117/358 (33%), Positives = 188/358 (53%), Gaps = 32/358 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F+T   +     R+L RF  RS+LFE +++YRL     +  T  +P H DA+
Sbjct  153   PFLFKSNKFQTLFENENGHIRLLQRFDKRSNLFEDLQNYRLVEYRAKPHTIFLPQHIDAD  212

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ + + +  F++   
Sbjct  213   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVNFVI--P  270

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP----------Q  849
             ++ PG+F+ F     K    +  GFS+  LEA+LNTK+ETI++VL   P          Q
Sbjct  271   VNRPGKFEDFDLYESKN--QYLRGFSKNILEASLNTKYETIEKVLLEGPEKQLRDLKRRQ  328

Query  848   EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEVGT  672
             E    ++V+ EQ+  L +       +    + E    RS N       SN++G ++E+  
Sbjct  329   ETDAIVRVSREQIEELRRLAKSSSKKKLSSEFEPFNLRSQN----PKYSNKFGKLFEITP  384

Query  671   THFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVR-  498
                 P L ++D++   V I EG +L P +NSRA  V +V +G G LE+   KN  Q  R 
Sbjct  385   QKKYPQLQDLDMSVGCVEINEGALLLPHYNSRAIVVLLVTQGIGNLELVGLKNEQQEQRE  444

Query  497   -------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                    + L  G VVVIP G+P    A+SN    L    F IN   N+R  L+G+++
Sbjct  445   NQVQRYEASLSPGDVVVIPAGHPVAITASSN----LNLLGFGINAENNQRNFLSGSDD  498



>ref|XP_003624150.1| Convicilin [Medicago truncatula]
 gb|ABD28365.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80368.1| vicilin 47 kDa protein [Medicago truncatula]
Length=464

 Score =   175 bits (443),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 201/418 (48%), Gaps = 52/418 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F    F+T   +     R+L RF  RS +FE +++YRL     +  T  +P H DA+
Sbjct  35    PFFFNANRFQTLFENENGHIRLLQRFDKRSKIFENLQNYRLLEYHSKPHTLFLPQHNDAD  94

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+  GD +++P G+  Y+ N D+ +   L    L   
Sbjct  95    FILAVLSGKAILTVLNPNNRNSFNLERGDTIKLPAGSIAYLANRDDNQD--LRVLDLAIP  152

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGP------  837
             ++ PG+FQ FS +  +   SFF+GFS+  LEAA N  +E I+RVL  E QE+ P      
Sbjct  153   VNRPGQFQSFSLSGSQNQQSFFSGFSKNILEAAFNANYEEIERVLI-EEQEQDPHRRGLR  211

Query  836   ------------FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQY  696
                          +KV+ EQ+  LS+          R   +S++   N+   K + SN++
Sbjct  212   DRRHKQSQEANVIVKVSREQIEELSRHAKSSSS---RRSASSESAPFNLRSRKPIYSNEF  268

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
             G  +E+     + L ++D+      I EG +L P FNSRAT + VV EG+G  E+   +N
Sbjct  269   GNFFEITPEKNQQLQDLDILVTNAEIREGSLLLPHFNSRATVIVVVDEGKGEFELVGQRN  328

Query  515   NYQTV--------------------RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
               Q                      R++L  G V VIP GYP V  A+S+    L    F
Sbjct  329   ENQQEQREYEEDEQEEERSQQVQRYRARLTPGDVYVIPAGYPNVVKASSD----LSLLGF  384

Query  395   DINGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              IN   N+R  LAG  +N+  ++    K+L+F   +  + V  +  +Q    F  A P
Sbjct  385   GINAENNQRSFLAGEEDNVISQIQRPVKELAFPGSA--QDVESLLKNQRQSYFANAQP  440



>emb|CAP06325.1| convicilin [Lathyrus aphaca]
Length=513

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 182/360 (51%), Gaps = 42/360 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF +RSDLFE +++YRL     +  T  +P H DA+
Sbjct  173   PFLFRSNKFLTLFKNENGHIRRLQRFDERSDLFENLQNYRLVEYRAKPHTMFLPQHIDAD  232

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  233   LILVVLNGKAILTVLSPNERNSYNLECGDTIKLPAGTTSYLVNHDDEED--LRVVDLVIP  290

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             ++ PG+F+ F  A  K    +  GFS+  LEA+LNTK+E I++VL G  QE    +KV+ 
Sbjct  291   VNRPGKFEAFDLAENKN--QYLRGFSKNILEASLNTKYEIIEKVLLG-GQETNAIVKVSR  347

Query  818   EQLRSLSQEGDEGG-------IRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHF  663
             EQ+  L +               PF           N+  H    SN++G ++E+     
Sbjct  348   EQIAELRKLAKSSSKKSLLSEFEPF-----------NLRSHNPKYSNKFGKLFEIAPQKK  396

Query  662   KP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVRSK--  492
              P L ++DV+   V I EG ++ P +NSRA  V +V EG G LE+   KN  Q    K  
Sbjct  397   YPQLQDLDVSIKCVEINEGALMLPHYNSRAIVVLLVNEGRGNLELVGFKNEQQEREDKKE  456

Query  491   -----------LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                        L  G VV+IP G+P    A+SN    L    F IN   N+R  L G+++
Sbjct  457   RNNGVQRYEARLSPGDVVIIPAGHPVAISASSN----LNLLGFGINAENNQRNFLTGSDD  512



>emb|CAP06330.1| convicilin [Vicia lutea]
Length=515

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 190/377 (50%), Gaps = 54/377 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  153   PFLFKSNNFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  212

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y++N+D+ +   L    L  S
Sbjct  213   LILVVLSGKAILTVLSPNNRNSYNLKRGDTIKLPAGTTSYLLNSDDEED--LRMVDLAIS  270

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+ + F+ +  K    +  GFS+  LEA+ NTK+ETI++VL  E            
Sbjct  271   VNRPGKVESFNLSGNKN--QYLRGFSKNILEASFNTKYETIEKVLLEEQDKESQQSIGQK  328

Query  851   -----QEEGPFLKVTEEQL---RSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQ  699
                  QE    +KV+ EQ+   + L++     G+       +S+   IN+   +   SN+
Sbjct  329   RISQRQETNALVKVSREQIEEPKRLARSSSRKGV-------SSEFEPINLRSQRPKYSNK  381

Query  698   YGVIYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP  522
             +G  YE+      P L ++DV+ + V I EG +L P +NSRA    +V EG+G LE+   
Sbjct  382   FGKFYEISPEKKYPQLQDLDVSVSSVEINEGALLLPHYNSRAIVTVLVNEGKGNLELIGF  441

Query  521   KNNYQTVRSK------------------LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
             +N  Q  R K                  L +G VV+IP G+P    A+SN    L    F
Sbjct  442   QNEQQGQREKEDEQQHERNKQVQRYDARLSSGDVVIIPAGHPVAVSASSN----LDLLGF  497

Query  395   DINGRGNERVTLAGTNN  345
              IN   ++R  L G+++
Sbjct  498   GINAENSQRNFLTGSDD  514



>ref|XP_010511547.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=487

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/411 (28%), Positives = 201/411 (49%), Gaps = 40/411 (10%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHE  1188
             ++P+ F++  F+    S E   +MLP+F+ R+ +LF GI++YR +   +E  +F+VP H 
Sbjct  83    EFPYHFRKRSFKNWFQSKEGFVKMLPKFTKRAPNLFRGIENYRFSLYDMEPNSFLVPLHL  142

Query  1187  DAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFIL  1008
             DA+ +  ++ G G    +    KE F++ +GDV+R+P G T + +NT+  + VPL F  +
Sbjct  143   DADSVVIILQGHGVAEFVTAKTKELFHLTKGDVVRLPSGITHFAINTN--QTVPLRFAKI  200

Query  1007  IRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE--EGPF  834
                ++ PG+FQ +  A  +   S+F GFS+E L A+ N   E + R+ FG PQ+  +G  
Sbjct  201   TIPVNNPGQFQNYFSAPSQFQQSYFTGFSKEVLSASFNIPEELVGRIFFG-PQQMGQGIM  259

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTVS---NQYGVIYEVGTTHF  663
              ++T +Q++ L++       +    D+++K    ++F H +VS   N +G  +E     F
Sbjct  260   RRITPDQIKELTENSTSPSNK--HKDKSTKFSPFSLFTHDSVSSYTNDFGHFHEAHPESF  317

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-----------  516
               L ++ +   + N+T+G +  P +NS+AT V  V  G    EM  P +           
Sbjct  318   DQLQDLQIAVTWTNMTQGSVFLPQYNSKATFVTFVENGCARYEMASPYSFQGEQQQQQWW  377

Query  515   -------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                              + S++    V +IP G+P+  V+      S+ FG +  N    
Sbjct  378   PEQGEEKEEDMSGQVHKIVSRVCKSDVFIIPAGHPFTIVSHDENFVSVGFGIYASNSI--  435

Query  374   ERVTLAGTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPPS  222
              R  LAG  N+   L   A  ++F  GS  +    +F SQ    F    PS
Sbjct  436   -RTFLAGQGNVLSNLDTVATRVAFGVGS--KVAEKLFTSQNYSHFAPTTPS  483



>gb|ABG02262.1| 8S globulin beta isoform precursor [Vigna radiata]
 gb|ABW23573.1| 8S globulin beta subunit [Vigna radiata]
Length=453

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 201/401 (50%), Gaps = 38/401 (9%)
 Frame = -2

Query  1358  PFVFQREE-FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F  +  F T   +     R++ RF  RS   + +++YR+     +  T ++P+H DA
Sbjct  44    PFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADA  103

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVN---TDNVKKVPLEFFI  1011
             +F+  V+ GR  + ++  DG++S+ + +G   +IP GTT ++VN    DN++ + L    
Sbjct  104   DFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAI--  161

Query  1010  LIRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG---------  858
                 ++ P RFQ F  ++ +   S+  GFS+  LEA+ ++ ++ I RVLFG         
Sbjct  162   ---PVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGE  218

Query  857   EPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYE  681
             E QEEG  +++  EQ+R L +          R + +S++   N+     + SN++G  YE
Sbjct  219   ESQEEGVIVELKREQIRELIKHAKSSS----RKELSSQDEPFNLRNSNPIYSNKFGRWYE  274

Query  680   VGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQT-  504
             +       L ++DV  + V++ EGG+L P +NS+A  + V+ EGE  +E+  P +  Q  
Sbjct  275   ITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQD  334

Query  503   -------VRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TN  348
                     R++L    V VIP  YP    ATSN    L F  F IN   N+R  LAG  +
Sbjct  335   ESLEVQRYRAELSEDDVFVIPAAYPVAINATSN----LNFFAFGINAENNQRNFLAGEKD  390

Query  347   NLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N+  ++     D+SF A  +K  V  +   Q    F  A P
Sbjct  391   NVMSEIPTEVLDVSFPASGNK--VEKLIKKQSESHFVDAQP  429



>gb|KDP42507.1| hypothetical protein JCGZ_00304 [Jatropha curcas]
Length=426

 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 191/387 (49%), Gaps = 45/387 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             P+ F  E FE    + E   R L +FS  S+   GI++YRL  L     TFVVP H +A+
Sbjct  55    PYYFSAERFEYLQKTQEGNIRALEKFS--SEHLRGIENYRLLTLEANPSTFVVPQHNNAK  112

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+ ++  +  + ++S+N+ +GDV+ IP G   Y++N D  +K  L   IL + 
Sbjct  113   SIVVVLRGKATITYVLGEKRQSYNLEKGDVIEIPAGAVIYLINPDKNEK--LNMIILTQP  170

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKVTE  819
             +++PG    +  A G   VSF+  FS + LEAALN   E + + LF E Q +G  LK  +
Sbjct  171   VTSPGNLANYFVAGG---VSFYEVFSNDVLEAALNITREKLDQ-LFAE-QRQGVILKAPQ  225

Query  818   EQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHF--KPLDE  648
             EQL +L+       I   +          N+     +  NQ+G        HF    L  
Sbjct  226   EQLMALN-----SNISATKQKGQKSAGPFNILDQLPLYYNQFG--------HFLQASLKG  272

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP----------------KN  516
              D++ ++  I  G ++ PF+NS+AT +  V+EG+G+ EM  P                  
Sbjct  273   EDISVSYAEIKSGALMVPFYNSKATAIIFVVEGDGYFEMVSPCVSSQAMEGKGEETEGNE  332

Query  515   NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNNLFL  336
              YQ + S +  G V+V+P G P+  +A+ N  ++L    F +N + N+R  LAG  N+  
Sbjct  333   PYQQINSNVSAGDVIVLPAGSPFAILASGN--QNLIAASFTVNDKHNQRNFLAGAGNVMT  390

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQ  255
             +L   A  L F   +  ES+  +F +Q
Sbjct  391   QLDREAIKLCFTGSA--ESIESLFRNQ  415



>emb|CAP06311.1| convicilin [Pisum sativum var. pumilio]
Length=511

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/369 (32%), Positives = 189/369 (51%), Gaps = 43/369 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  154   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  213

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD ++IP GTT+Y+VN D+ + + +  F++   
Sbjct  214   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEEDLRVVDFVI--P  271

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE----PQ------  849
             ++ PG+F+ F  +  K    +  GFS+  LEA+LNTK+ETI++VL  E    PQ      
Sbjct  272   VNRPGKFEAFGLSENKN--QYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRK  329

Query  848   ------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGV  690
                   E    +KV+ EQ+  L +               S+    N+  HK   SN++G 
Sbjct  330   RRQQGEERDAIIKVSREQIEELRKLAKSSSK----KSLPSEFEPFNLRSHKPEYSNKFGK  385

Query  689   IYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN  513
             ++E+      P L ++D+  + V I +G ++ P +NSRA  V +V EG+G LE+   KN 
Sbjct  386   LFEITPEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNE  445

Query  512   Y-------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                           Q   ++L  G VV+IP G+P    A+SN    L    F IN   N+
Sbjct  446   QQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAITASSN----LNLLAFGINAENNQ  501

Query  371   RVTLAGTNN  345
             R  L+G+++
Sbjct  502   RNFLSGSDD  510



>emb|CAP06319.1| convicilin [Lathyrus tingitanus]
Length=508

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 184/352 (52%), Gaps = 26/352 (7%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L  F +RSDLFE +++YRL     +  T  +P H DA+
Sbjct  168   PFLFKSNKFLTLFQNENGHIRRLQGFDERSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  227

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GR  + V+  + + S+N+  GD +++P GTT+Y++N D+ +   L    L+  
Sbjct  228   LILVVLNGRAILTVLSSNDRNSYNLECGDTIKLPAGTTSYLLNQDDEED--LRVVDLVVP  285

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-QEEGPFLKVT  822
             ++ PG+F+    +  K    +  GFS+  LEA+ NTK+ETI++VL  +  QE    LKV+
Sbjct  286   VNRPGKFEALGLSNNKN--QYLRGFSKNVLEASFNTKYETIEKVLLEQQGQETNAILKVS  343

Query  821   EEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEVGTTHFKP-LDE  648
              EQ+  L +       +    + E    RS N       SN++G  +E+      P L +
Sbjct  344   REQVEELRKHAKSSSKKSLPSECEPFNLRSQN----PKYSNKFGKFFEITPQKKYPQLQD  399

Query  647   VDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-----------NYQTV  501
             +DV+ + V I EG +L P +NSRA  V +V EGEG LE+   KN           N Q  
Sbjct  400   LDVSISSVEINEGALLLPHYNSRAIVVVLVNEGEGNLELVGFKNEQQRQGENEDKNVQRY  459

Query  500   RSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
              ++L +G V++IP G+P    A+SN    L    F IN   N+R    G+++
Sbjct  460   EARLSSGDVIIIPAGHPVAISASSN----LNLLGFGINAENNQRNFFTGSDD  507



>emb|CAP06323.1| convicilin [Lathyrus latifolius]
Length=498

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 184/358 (51%), Gaps = 32/358 (9%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +FET   +     R L RF  RS+LFE +++YRL     +  T  +P H DA+
Sbjct  152   PFLFKSNKFETLFENENGHIRRLQRFDKRSNLFENLQNYRLVEYRAKPHTIFLPQHIDAD  211

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  212   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRVVDLVIP  269

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP----------Q  849
             ++ PG+F+ F     K    +  GFS+  LEA+LN K+ETI++VL   P          Q
Sbjct  270   VNRPGKFEDFDLYENKN--QYLRGFSKNILEASLNAKYETIEKVLLEGPQKQLRDLRRTQ  327

Query  848   EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGVIYEVGT  672
             E    ++V+ EQ+  L +       +    + E    RS N       SN +G ++E+  
Sbjct  328   ETDAIVRVSREQIEELRKLAKSSSKKKLPSEFEPFNLRSQN----PKYSNNFGKLFEITP  383

Query  671   THFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVR-  498
                 P L ++D++ + V I EG ++ P +N RA  V +V +G G LE+   KN  Q  R 
Sbjct  384   QKKYPQLQDLDISVSCVEINEGALMLPHYNLRAIIVVLVTQGNGNLELVGFKNEQQEQRE  443

Query  497   -------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                    ++L  G VVVIP G+P    A+SN    L    F IN   N+R  L+G+++
Sbjct  444   NQVQRYEARLSPGDVVVIPAGHPVAITASSN----LNLLGFGINAENNQRNFLSGSDD  497



>emb|CAP06328.1| cvc [Vicia villosa]
Length=589

 Score =   175 bits (443),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 124/380 (33%), Positives = 184/380 (48%), Gaps = 61/380 (16%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F+T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  228   PFLFKSNKFQTLFQNENGYIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  287

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GR  + V+  D + S+N+  GD +++P GTT+Y+VN D+ +   L    L   
Sbjct  288   LIIVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRVVDLAIP  345

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+ + F  +  K    +  GFS+  LEA+ NT +ETI+RVL  E            
Sbjct  346   VNRPGKVESFLLSGNKN--QYLRGFSKNILEASFNTNYETIERVLLEEQDKESQQSIGQK  403

Query  851   -----QEEGPFLKVTEEQLRSL-------SQEGDEGGIRPFRGDETSKNRSINVFPHK-T  711
                  QE    +KV+ EQL  L       SQEG      P           IN+      
Sbjct  404   RRSQRQETNALVKVSREQLEDLKRLAKSSSQEGLSSQFEP-----------INLRSQNPK  452

Query  710   VSNQYGVIYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLE  534
              SN++G ++E+      P L ++D+  + V+I EG ++ P +NSRA  V +V EG G LE
Sbjct  453   YSNKFGKVFEITPEKKYPQLQDLDLFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLE  512

Query  533   MGCPKNNYQTVRSK-----------------LKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
             +   KN  Q  R K                 L  G VV+IP G+P    A+S+    L  
Sbjct  513   LVGLKNEQQEQREKEDEQQERNNQVQRYEARLSPGDVVIIPAGHPVAVRASSD----LNL  568

Query  404   GWFDINGRGNERVTLAGTNN  345
               F IN   N+R  LAG+++
Sbjct  569   LAFGINAENNQRNFLAGSDD  588



>emb|CAP06315.1| cvc [Pisum sativum subsp. elatius]
Length=527

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 187/369 (51%), Gaps = 43/369 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+ +  +F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  170   PFLLKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  229

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  230   LILVVLSGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRLVDLVIP  287

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEE--------  843
             ++ PG+F+ F  A  K    +  GFS+  LEA+ NTK+ETI++VL  E ++E        
Sbjct  288   VNGPGKFEAFDLAKNKN--QYLRGFSKNILEASYNTKYETIEKVLLEEQEKEPQQRRDRK  345

Query  842   --------GPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGV  690
                        +KV+ EQ+  L +               S+   IN+  HK   SN++G 
Sbjct  346   RRQQGQETDAIVKVSREQIEELRKLAKSSSK----KSLPSEFEPINLRSHKPEYSNKFGK  401

Query  689   IYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN  513
             ++E+      P L ++D+  + V I EG ++ P +NSRA  V +V EG+G +E+   KN 
Sbjct  402   LFEITPEKKYPQLQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNVELLGLKNE  461

Query  512   YQT-------------VRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
              Q                ++L  G VV+IP G+P    A+SN    L    F IN   NE
Sbjct  462   QQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAITASSN----LNLLGFGINAENNE  517

Query  371   RVTLAGTNN  345
             R  L+G+++
Sbjct  518   RNFLSGSDD  526



>pdb|1IPK|A Chain A, Crystal Structures Of Recombinant And Native Soybean 
Beta- Conglycinin Beta Homotrimers
 pdb|1IPK|B Chain B, Crystal Structures Of Recombinant And Native Soybean 
Beta- Conglycinin Beta Homotrimers
 pdb|1IPK|C Chain C, Crystal Structures Of Recombinant And Native Soybean 
Beta- Conglycinin Beta Homotrimers
 dbj|BAA23361.2| beta subunit of beta conglycinin [Glycine max]
Length=416

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 204/397 (51%), Gaps = 31/397 (8%)
 Frame = -2

Query  1358  PFVFQREE-FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F+    F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA
Sbjct  10    PFYFRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADA  69

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             +F+  V+ GR  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L  
Sbjct  70    DFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAI  127

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPF  834
              ++ PGR+  F  ++ +   S+  GFS   LE + ++++E I RVLFG    + Q+EG  
Sbjct  128   PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI  187

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP  657
             +++++EQ+R LS+          R   +S++   N+     + SN +G  +E+       
Sbjct  188   VELSKEQIRQLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQ  243

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------N  513
             L ++D+  + V+I EG +L P FNS+A  + V+ EG+  +E+ G  +             
Sbjct  244   LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLE  303

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFL  336
              Q  R++L    V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  
Sbjct  304   VQRYRAELSEDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVR  359

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             ++    ++L+F   +  + V  +   Q    F  A P
Sbjct  360   QIERQVQELAFPGSA--QDVERLLKKQRESYFVDAQP  394



>pdb|1UIJ|A Chain A, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer 
(I122mK124W)
 pdb|1UIJ|B Chain B, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer 
(I122mK124W)
 pdb|1UIJ|C Chain C, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer 
(I122mK124W)
 pdb|1UIJ|D Chain D, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer 
(I122mK124W)
 pdb|1UIJ|E Chain E, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer 
(I122mK124W)
 pdb|1UIJ|F Chain F, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer 
(I122mK124W)
Length=416

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 204/397 (51%), Gaps = 31/397 (8%)
 Frame = -2

Query  1358  PFVFQREE-FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F+    F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA
Sbjct  10    PFYFRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADA  69

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             +F+  V+ GR  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L  
Sbjct  70    DFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKMIWLAI  127

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPF  834
              ++ PGR+  F  ++ +   S+  GFS   LE + ++++E I RVLFG    + Q+EG  
Sbjct  128   PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI  187

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP  657
             +++++EQ+R LS+          R   +S++   N+     + SN +G  +E+       
Sbjct  188   VELSKEQIRQLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQ  243

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------N  513
             L ++D+  + V+I EG +L P FNS+A  + V+ EG+  +E+ G  +             
Sbjct  244   LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLE  303

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFL  336
              Q  R++L    V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  
Sbjct  304   VQRYRAELSEDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVR  359

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             ++    ++L+F   +  + V  +   Q    F  A P
Sbjct  360   QIERQVQELAFPGSA--QDVERLLKKQRESYFVDAQP  394



>emb|CAP06320.1| cvc [Lathyrus cicera]
Length=564

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 116/356 (33%), Positives = 188/356 (53%), Gaps = 34/356 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF +RSD+FE +++YRL     +  T  +P H DA+
Sbjct  224   PFLFKSNKFLTLFENENGYIRRLQRFDERSDIFENLQNYRLVEYRAKPHTIFLPQHIDAD  283

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  ++ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  284   LILVILNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNEDDEED--LRVVDLVIP  341

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEG----PFL  831
             ++ PG+F+ F          +  GFS+  LEA+LNTK+ETI++VL  E Q++G      +
Sbjct  342   VNRPGKFEAFDLN------QYLGGFSKSVLEASLNTKYETIEKVLLEEQQKQGQETNAIV  395

Query  830   KVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-  657
             KV+ EQ+  L +               S+   +N+  H    SN++G  +E+      P 
Sbjct  396   KVSREQIEELRKLAKSSSK----KSLLSELEPVNLRSHSPKYSNKFGKFFEITPEKKYPQ  451

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLE-MGCPKNNYQTVR------  498
             L ++DV+ + V I EG +L P +NSRA  V +V EG+G LE +G    + Q  R      
Sbjct  452   LQDLDVSISCVEINEGALLLPHYNSRAIVVVLVNEGKGNLELLGVQNEDEQQERKERNKE  511

Query  497   -----SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                  ++L  G VV+IP G+P    A+SN    L    F IN   N+R  L+G+++
Sbjct  512   VQRYEARLSPGDVVIIPSGHPVAVSASSN----LNLLGFGINAENNQRNFLSGSDD  563



>emb|CBK38917.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   172 bits (436),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/416 (29%), Positives = 198/416 (48%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     +  T  +P + DA+
Sbjct  31    PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD  90

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  91    FILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNED--LRVLDLAIP  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE------------  855
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL  E            
Sbjct  149   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTDYEEIEKVLLEEHEKETQHRRSLK  208

Query  854   -----PQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYG  693
                   QEE   +K++  Q+  LS+       +      +S++   N+     + SN++G
Sbjct  209   DKRQQSQEENVIVKLSRGQIEELSKNAKSTSKKGV----SSESEPFNLRSRGPIYSNEFG  264

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  265   KFFEITPGKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  324

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  R+KL  G V VIP G+P   VA  N S  L    F I
Sbjct  325   NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP---VAI-NASSDLNLIGFGI  380

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N   NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  381   NAENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  434



>emb|CAP06321.1| convicilin [Lathyrus sativus]
Length=527

 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 117/356 (33%), Positives = 186/356 (52%), Gaps = 34/356 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF +RSDLFE +++YRL     +  T  +P H DA+
Sbjct  187   PFLFKSNKFLTLFENENGYIRRLQRFDERSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  246

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  ++ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  247   LILVILNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNEDDEED--LRVVDLVIP  304

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEG----PFL  831
             ++ PG+F+ F          +  GFS+  L+A+LNTK+ETI++VL  E Q++G      +
Sbjct  305   VNRPGKFEAFDLN------QYLGGFSKSVLKASLNTKYETIEKVLLEEQQKQGQETNAIV  358

Query  830   KVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-  657
             KV+ EQ+  L +               S+   +N+  H    SN++G  +E+      P 
Sbjct  359   KVSREQIEELRKLAKSSSK----KSLLSELEPVNLRSHSPKYSNKFGKFFEITPEKKYPQ  414

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLE-MGCPKNNYQTVRSK----  492
             L ++DV+ + V I EG +L P +NSRA  V +V EG+G LE +G    + Q  R K    
Sbjct  415   LQDLDVSISCVEINEGALLLPHYNSRAIVVLLVNEGKGNLELLGVQDEDEQQERKKRNKE  474

Query  491   -------LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTNN  345
                    L    VV+IP G+P    A+SN    L    F IN   NER  L+G+++
Sbjct  475   VQRYEARLSPSDVVIIPAGHPVAVSASSN----LNLLGFGINAENNERNFLSGSDD  526



>sp|Q43358.1|VCL_THECC RecName: Full=Vicilin; Flags: Precursor [Theobroma cacao]
 emb|CAA44493.1| vicilin [Theobroma cacao]
Length=525

 Score =   173 bits (438),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 113/371 (30%), Positives = 185/371 (50%), Gaps = 47/371 (13%)
 Frame = -2

Query  1358  PFVF-QREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F +R  F+T+    E  F++L RF++ S   +GI DYRLA       TF++P+H DA
Sbjct  143   PYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHCDA  202

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E I  V  G+G++  +  + KES+N+  G V+ +P G+T Y+V+ DN +K+ +   +L  
Sbjct  203   EAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIA--VLAL  260

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVL------FGEPQEEG  840
              +++PG+++ F  A   KP S++  FS E LE   NT+ E ++ +L        +  ++G
Sbjct  261   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  320

Query  839   PFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHF  663
              F K   EQ+R++SQ+         RG E     +IN+     V SNQ G  +E     F
Sbjct  321   MFRKAKPEQIRAISQQATSPR---HRGGE---RLAINLLSQSPVYSNQNGRFFEACPEDF  374

Query  662   KPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK------------  519
                  +DV  +   + +G +  P +NS+AT V  V +G G+ +M CP             
Sbjct  375   SQFQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSGR  434

Query  518   ---------------NNYQTVRSKLKTGMVVVIPPGYPYVNVATSN-PSKSLQFGWFDIN  387
                              +Q V++ L  G V V P G+     A+ + P  ++ FG   +N
Sbjct  435   QDRREQEEESEEETFGEFQQVKAPLSPGDVFVAPAGHAVTFFASKDQPLNAVAFG---LN  491

Query  386   GRGNERVTLAG  354
              + N+R+ LAG
Sbjct  492   AQNNQRIFLAG  502



>emb|CAP06310.1| convicilin [Pisum sativum subsp. sativum]
Length=511

 Score =   172 bits (437),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 190/369 (51%), Gaps = 43/369 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  154   PFLFKSNKFLTLFENENGHTRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  213

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ + + +  F++   
Sbjct  214   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKVPAGTTSYLVNQDDEEALRVVDFVI--P  271

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE----PQ------  849
             ++ PG+F+ F  +  K    +  GFS+  LEA+LNTK+ETI++VL  E    PQ      
Sbjct  272   VNRPGKFEAFGLSENKN--QYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRK  329

Query  848   ------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGV  690
                   E    +KV+ EQ+  L +               S+    N+  HK   SN++G 
Sbjct  330   RTQQGEERDAIIKVSREQIEELRKLAKSSSK----KSLPSEFEPFNLRSHKPEYSNKFGK  385

Query  689   IYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN  513
             ++E+      P L ++D+  + V I +G ++ P +NSRA  V +V EG+G LE+   KN 
Sbjct  386   LFEITPEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNE  445

Query  512   Y-------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                           Q   ++L  G VV+IP G+P    A+SN    L    F IN + N+
Sbjct  446   QQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAISASSN----LNLLGFGINAKNNQ  501

Query  371   RVTLAGTNN  345
             R  L+G+++
Sbjct  502   RNFLSGSDD  510



>sp|P13918.2|VCLC_PEA RecName: Full=Vicilin; Flags: Precursor [Pisum sativum]
 emb|CAA32239.1| vicilin [Pisum sativum]
Length=459

 Score =   172 bits (435),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 125/420 (30%), Positives = 208/420 (50%), Gaps = 50/420 (12%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q PF+F+  +F+T   +     R+L +F  RS +FE +++YRL     +  T  +P H D
Sbjct  33    QNPFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYRLLEYKSKPHTIFLPQHTD  92

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A++I  V+ G+  + V++ D + SFN+  GD +++P GT  Y+VN D+ ++  L    L 
Sbjct  93    ADYILVVLSGKAILTVLKPDDRNSFNLERGDTIKLPAGTIAYLVNRDDNEE--LRVLDLA  150

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
               ++ PG+ Q F  +  +   ++ +GFS+  LEA+ NT +E I++VL  E ++E    + 
Sbjct  151   IPVNRPGQLQSFLLSGNQNQQNYLSGFSKNILEASFNTDYEEIEKVLLEEHEKETQHRRS  210

Query  824   TEEQLRSLSQEGDEGGIRPFRG--DETSKNRS-------------INVFPHKTV-SNQYG  693
              +++ R  SQE +   ++  RG  +E SKN                N+     + SN++G
Sbjct  211   LKDK-RQQSQE-ENVIVKLSRGQIEELSKNAKSTSKKSVSSESEPFNLRSRGPIYSNEFG  268

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+       L ++D+    V I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  269   KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPHYNSRAIVIVTVNEGKGDFELVGQRNE  328

Query  515   ----------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFG  402
                                     Q  ++KL +G V VIP G+P    A+SN    L   
Sbjct  329   NQQEQRKEDDEEEEQGEEEINKQVQNYKAKLSSGDVFVIPAGHPVAVKASSN----LDLL  384

Query  401   WFDINGRGNERVTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              F IN   N+R  LAG  +N+  ++    K+L+F  GS +E V+ +  +Q    F  A P
Sbjct  385   GFGINAENNQRNFLAGDEDNVISQIQRPVKELAF-PGSAQE-VDRILENQKQSHFADAQP  442



>emb|CAB89812.1| convicilin [Lens culinaris]
Length=518

 Score =   172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 190/369 (51%), Gaps = 43/369 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  +  +P H DAE
Sbjct  161   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHSIFLPQHIDAE  220

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + S+N+  GD ++ P G T Y+VN D+ + + +  F++  S
Sbjct  221   FIVVVLSGKAILTVLSPNDRNSYNLERGDAIKSPAGATYYLVNPDDEEDLRVVDFVI--S  278

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF--------------  861
             ++ PG+F+ F  +A ++   +  GFS+  LEA+LNTK++TI++VL               
Sbjct  279   LNRPGKFEAFDLSANRR--QYLRGFSKSVLEASLNTKYDTIEKVLLEEQENEPHQRRDRK  336

Query  860   GEP--QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGD-ETSKNRSINVFPHKTVSNQYGV  690
             G P  QE+   +KV+ EQ+  L +       +    + E    RS N       SN++G 
Sbjct  337   GRPQGQEKHAIVKVSREQIEELRRLAKSSSKKSLPSEFEPFNLRSQN----PKYSNKFGK  392

Query  689   IYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN  513
              +EV      P L ++D+  + V I EGG+L P +NSRA  V +V EG+G LE+   KN 
Sbjct  393   FFEVTPEKKYPQLQDLDLLVSSVEINEGGLLLPHYNSRAIVVLLVNEGKGNLELVGFKNE  452

Query  512   Y-------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                           Q   ++L  G VV+IP G+P    A+SN    L    F IN   NE
Sbjct  453   QQEREDNKERNNEVQRYEARLSPGDVVIIPAGHPVSISASSN----LNLLGFGINAENNE  508

Query  371   RVTLAGTNN  345
             R  L G+++
Sbjct  509   RNFLTGSDD  517



>sp|P25974.1|GLCB_SOYBN RecName: Full=Beta-conglycinin, beta chain; Flags: Precursor 
[Glycine max]
 gb|AAB23463.1| CG4 beta-conglycinin [Glycine max]
Length=439

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 204/397 (51%), Gaps = 31/397 (8%)
 Frame = -2

Query  1358  PFVFQREE-FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F+    F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA
Sbjct  33    PFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADA  92

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             +F+  V+ GR  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L  
Sbjct  93    DFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAI  150

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPF  834
              ++ PGR+  F  ++ +   S+  GFS   LE + ++++E I RVLFG    + Q+EG  
Sbjct  151   PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI  210

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP  657
             +++++EQ+R LS+          R   +S++   N+     + SN +G  +E+       
Sbjct  211   VELSKEQIRQLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQ  266

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------N  513
             L ++D+  + V+I EG +L P FNS+A  + V+ EG+  +E+ G  +             
Sbjct  267   LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLE  326

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFL  336
              Q  R++L    V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  
Sbjct  327   VQRYRAELSEDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVR  382

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             ++    ++L+F   +  + V  +   Q    F  A P
Sbjct  383   QIERQVQELAFPGSA--QDVERLLKKQRESYFVDAQP  417



>emb|CAA68708.1| vicilin precursor [Pisum sativum]
Length=433

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 125/420 (30%), Positives = 208/420 (50%), Gaps = 50/420 (12%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q PF+F+  +F+T   +     R+L +F  RS +FE +++YRL     +  T  +P H D
Sbjct  7     QNPFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYRLLEYKSKPHTIFLPQHTD  66

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A++I  V+ G+  + V++ D + SFN+  GD +++P GT  Y+VN D+ ++  L    L 
Sbjct  67    ADYILVVLSGKAILTVLKPDDRNSFNLERGDTIKLPAGTIAYLVNRDDNEE--LRVLDLA  124

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEGPFLKV  825
               ++ PG+ Q F  +  +   ++ +GFS+  LEA+ NT +E I++VL  E ++E    + 
Sbjct  125   IPVNRPGQLQSFLLSGNQNQQNYLSGFSKNILEASFNTDYEEIEKVLLEEHEKETQHRRS  184

Query  824   TEEQLRSLSQEGDEGGIRPFRG--DETSKNRS-------------INVFPHKTV-SNQYG  693
              +++ R  SQE +   ++  RG  +E SKN                N+     + SN++G
Sbjct  185   LKDK-RQQSQE-ENVIVKLSRGQIEELSKNAKSTSKKSVSSESEPFNLRSRGPIYSNEFG  242

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+       L ++D+    V I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  243   KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPHYNSRAIVIVTVNEGKGDFELVGQRNE  302

Query  515   ----------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFG  402
                                     Q  ++KL +G V VIP G+P    A+SN    L   
Sbjct  303   NQQEQRKEDDEEEEQGEEEINKQVQNYKAKLSSGDVFVIPAGHPVALKASSN----LDLL  358

Query  401   WFDINGRGNERVTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              F IN   N+R  LAG  +N+  ++    K+L+F  GS +E V+ +  +Q    F  A P
Sbjct  359   GFGINAENNQRNFLAGDEDNVISQVQRPVKELAF-PGSAQE-VDRILENQKQSHFADAQP  416



>emb|CBK38920.1| vicilin 47k [Pisum sativum]
Length=441

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 126/417 (30%), Positives = 199/417 (48%), Gaps = 49/417 (12%)
 Frame = -2

Query  1364  QYPFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             Q PF+F+  +F+T   +     R+L +F  RS +FE +++YRL     + +T  +P + D
Sbjct  33    QNPFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYRLLEYKSKPRTLFLPQYTD  92

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A+FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L 
Sbjct  93    ADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLA  150

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ----  849
               ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ    
Sbjct  151   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRSL  210

Query  848   --------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQY  696
                     EE   +KV+ EQ+  LS+       +    +    N RS N       SN++
Sbjct  211   KDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRN----PIYSNKF  266

Query  695   GVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN  516
             G  +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N
Sbjct  267   GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN  326

Query  515   -------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFD  393
                                  Q  R+KL  G V VIP G+P       N S  L    F 
Sbjct  327   ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP----VAINASSDLNLIGFG  382

Query  392   INGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             IN   NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  383   INAENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  437



>dbj|BAD98463.1| beta-conglycinin beta subunit [Glycine max]
 dbj|BAE02728.1| beta-conglycinin beta subunit [Glycine max]
Length=420

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 200/388 (52%), Gaps = 30/388 (8%)
 Frame = -2

Query  1334  FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLG  1155
             F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA+F+  V+ G
Sbjct  23    FQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSG  82

Query  1154  RGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQ  975
             R  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L   ++ PGR+ 
Sbjct  83    RAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAIPVNKPGRYD  140

Query  974   FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPFLKVTEEQLR  807
              F  ++ +   S+  GFS   LE + ++++E I RVLFG    + Q+EG  +++++EQ+R
Sbjct  141   DFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIR  200

Query  806   SLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVDVNAA  630
              LS+          R   +S++   N+     + SN +G  +E+       L ++D+  +
Sbjct  201   QLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLS  256

Query  629   FVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------NYQTVRSKLK  486
              V+I EG +L P FNS+A  + V+ EG+  +E+ G  +              Q  R++L 
Sbjct  257   SVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELS  316

Query  485   TGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDL  309
                V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  ++    ++L
Sbjct  317   EDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQEL  372

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAPP  225
             +F   +  + V  +   Q    F  A P
Sbjct  373   AFPGSA--QDVERLLKKQRESYFVDAQP  398



>emb|CAP06318.1| cvc [Lathyrus annuus]
Length=541

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 119/362 (33%), Positives = 188/362 (52%), Gaps = 36/362 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF +RSD+FE +++YRL     +  T  +P H DA+
Sbjct  191   PFLFKSNKFLTLFENENGHIRRLQRFDERSDIFENLQNYRLVEYRAKPHTMFLPQHIDAD  250

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L   
Sbjct  251   LILVVLNGKAILTVLSPNDRNSYNLERGDTVKLPAGTTSYLVNQDDEED--LRVVDLAIP  308

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP---------QE  846
             ++ PG+F+ F  +A K    +  GFS+  LEA+LNTK+ETI++VL  E          QE
Sbjct  309   VNRPGKFEAFGLSANKN--QYLRGFSKNILEASLNTKYETIEKVLLEERRDQKGRQQGQE  366

Query  845   EGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYGVIYEVGTT  669
                 +KV+ EQ+  L +       +    +    N RS N       SN++G  +E+   
Sbjct  367   TNAIVKVSREQIEELRKLAKSSSKKSLLSESEPLNLRSQNP----KYSNKFGKFFEITPQ  422

Query  668   HFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVR--  498
                P L ++DV+ + V I +G +L P +NSR+  + +V EG+G LE+   KN  Q  R  
Sbjct  423   KKYPQLQDLDVSISCVEINKGALLLPHYNSRSIGILLVNEGKGNLELVGFKNEQQRQREN  482

Query  497   -----------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGT  351
                        ++L +G VVVIP G+P    A+SN    L    F IN   N+R  L G+
Sbjct  483   EETNKKLQRYEARLSSGDVVVIPEGHPVAISASSN----LNLLGFGINAANNQRNFLTGS  538

Query  350   NN  345
             ++
Sbjct  539   DD  540



>emb|CAP06313.1| cvc [Pisum sativum subsp. sativum]
Length=572

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 187/380 (49%), Gaps = 52/380 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  202   PFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  261

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L+  
Sbjct  262   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRLVDLVIP  319

Query  998   ISTPGRFQFFSGAAGKKPV-----------------------SFFNGFSRETLEAALNTK  888
             ++ PG+F+ F  A  K                           +  GFS+  LEA+ NTK
Sbjct  320   VNGPGKFEAFDLAKNKNQYLRGFSKNILEASYNAFDLAKNKNQYLRGFSKNILEASYNTK  379

Query  887   WETIQRVLF----GEPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFP  720
             +ETI++VL      EPQ+    +KV+  Q+  L +               S+   IN+  
Sbjct  380   YETIEKVLLEEQEKEPQQRRAIVKVSRGQIEELRKLAKSSSK----KSLPSEFEPINLRS  435

Query  719   HK-TVSNQYGVIYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGE  546
             HK   SN++G ++E+      P L ++D+  + V I EG ++ P +NSRA  V +V EG+
Sbjct  436   HKPEYSNKFGKLFEITPEKKYPQLQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGK  495

Query  545   GWLEMGCPKNNY-------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQF  405
             G LE+   KN               Q   ++L  G VV+IP G+P    A+SN    L  
Sbjct  496   GNLELLGLKNEQQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAITASSN----LNL  551

Query  404   GWFDINGRGNERVTLAGTNN  345
               F IN   NER  L+G+++
Sbjct  552   LAFGINAENNERNFLSGSDD  571



>emb|CAP06326.1| cvc [Vicia disperma]
Length=549

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/369 (32%), Positives = 188/369 (51%), Gaps = 46/369 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+  +F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H +A+
Sbjct  195   PFYFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIEAD  254

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GR  + V+  + + S+N+  GD +++P GTT+Y++N D+ +   L    L  S
Sbjct  255   LILVVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLLNQDDEED--LRVVDLAIS  312

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+ + F  +  +    +  GFS+  LEA+ NT +E I+ VL  E            
Sbjct  313   VNRPGKVESFVLSGNRN--QYLRGFSKNHLEASFNTNYENIESVLLEEQDIESQQSIGQK  370

Query  851   -----QEEGPFLKVTEEQ---LRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQ  699
                  QE    +KV+ EQ   L+ L++   E G+       +S+   IN+  H    SN+
Sbjct  371   RRSQRQETNALVKVSREQIEELKRLAKSSSEKGL-------SSQFEPINLRSHNPKYSNK  423

Query  698   YGVIYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP  522
             +G ++E+      P L ++D+  + V+I EG ++ P +NSRA  V +V EG G LE+   
Sbjct  424   FGKLFEITPEKKYPQLQDLDLFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGF  483

Query  521   KNNYQTVR----------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
             KN  Q  R          ++L  G VV+IP G+P    A+SN    L    F IN   N+
Sbjct  484   KNEQQEQRERNNQVQRYEARLSPGDVVIIPAGHPVSVSASSN----LNLLAFGINAENNQ  539

Query  371   RVTLAGTNN  345
             R  LAG+++
Sbjct  540   RNFLAGSDD  548



>emb|CAP06334.1| convicilin [Vicia faba]
Length=477

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 182/361 (50%), Gaps = 50/361 (14%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  143   PFLFKSNKFLTLFQNKNGYIRRLQRFDTRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  202

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V  G+  + V+  + + S+N+  GD ++IP GTT+Y+VN D+ +   LE F L R+
Sbjct  203   LILVVFSGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEQD--LEAFDLSRN  260

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQEEG----PFL  831
              +                  +   FS+  LEA+LNTK+ETI++VL  E +++G      +
Sbjct  261   KN-----------------QYLRAFSKNILEASLNTKYETIEKVLLEERRQQGKETNAIV  303

Query  830   KVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVIYEVGTTHFKP-  657
             K++ EQ+  L +       R       SK   IN+       SN++G ++E+      P 
Sbjct  304   KLSREQIAELRKLAKSSSKRSL----PSKFEPINLRSQNPKYSNKFGRLFEITPEKKYPQ  359

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-------------  516
             L ++D+  +F  I+EG +L P +NSRA  V VV EG+G LE+   KN             
Sbjct  360   LQDLDIFVSFSEISEGALLLPHYNSRAIVVLVVNEGQGNLELVGFKNEQQEQSLKEDEQQ  419

Query  515   --NYQTVR--SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAGTN  348
               N Q  R  ++L  G VVVIP G+P+   A SN    L    F IN   NER  L G++
Sbjct  420   ERNKQVQRYEARLSPGDVVVIPSGHPFSVSALSN----LTLFGFGINAENNERNFLTGSD  475

Query  347   N  345
             +
Sbjct  476   D  476



>gb|KHN15750.1| Beta-conglycinin, beta chain [Glycine soja]
 gb|KHN15767.1| Beta-conglycinin, beta chain [Glycine soja]
Length=439

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 200/388 (52%), Gaps = 30/388 (8%)
 Frame = -2

Query  1334  FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLG  1155
             F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA+F+  V+ G
Sbjct  42    FQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSG  101

Query  1154  RGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQ  975
             R  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L   ++ PGR+ 
Sbjct  102   RAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAIPVNKPGRYD  159

Query  974   FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPFLKVTEEQLR  807
              F  ++ +   S+  GFS   LE + ++++E I RVLFG    + Q+EG  +++++EQ+R
Sbjct  160   DFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIR  219

Query  806   SLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVDVNAA  630
              LS+          R   +S++   N+     + SN +G  +E+       L ++D+  +
Sbjct  220   QLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLS  275

Query  629   FVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------NYQTVRSKLK  486
              V+I EG +L P FNS+A  + V+ EG+  +E+ G  +              Q  R++L 
Sbjct  276   SVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELS  335

Query  485   TGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDL  309
                V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  ++    ++L
Sbjct  336   EDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQEL  391

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAPP  225
             +F   +  + V  +   Q    F  A P
Sbjct  392   AFPGSA--QDVERLLKKQRESYFVDAQP  417



>emb|CBK38919.1| vicilin 47k [Pisum sativum]
Length=437

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/415 (30%), Positives = 197/415 (47%), Gaps = 49/415 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     + +T  +P + DA+
Sbjct  31    PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQYTDAD  90

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  91    FILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ      
Sbjct  149   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRSLKD  208

Query  848   ------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYGV  690
                   EE   +KV+ EQ+  LS+       +    +    N RS N       SN++G 
Sbjct  209   RRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRN----PIYSNKFGK  264

Query  689   IYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN--  516
              +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N  
Sbjct  265   FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN  324

Query  515   -----------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDIN  387
                                Q  R+KL  G V VIP G+P       N S  L    F IN
Sbjct  325   QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP----VAINASSDLNLIGFGIN  380

Query  386   GRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
                NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  381   AENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  433



>ref|XP_006406142.1| hypothetical protein EUTSA_v10021982mg [Eutrema salsugineum]
 gb|ESQ47595.1| hypothetical protein EUTSA_v10021982mg [Eutrema salsugineum]
Length=495

 Score =   171 bits (433),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/396 (29%), Positives = 190/396 (48%), Gaps = 45/396 (11%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGE-SIFRMLPRFSDRSD-LFEGIKDYRLAFLLVESQTFVVPNHED  1185
             P+ F+   F++   S E    +MLP+F+ RS  LF GI+++R  F+ +E  TF+VP+H D
Sbjct  64    PYHFKERSFKSWFQSKEVGYMKMLPKFTKRSSTLFRGIENHRFMFMEMEPNTFLVPHHVD  123

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A+F+  V+ G+G +  +    KESF I +GDV+R+P G T +  NT+  + VPL    + 
Sbjct  124   ADFVFIVLQGKGMIGFVTDKTKESFEIKKGDVVRVPSGVTHFFTNTN--ETVPLRLAKIA  181

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQE-EGPFLK  828
               ++TPG FQ    +  K   S+F+GFS + L A+ N   E +  ++ G  Q  +G   +
Sbjct  182   VPVNTPGHFQANFPSRSKFQQSYFSGFSNDVLSASFNIPEELVGSLIRGSQQMGQGIIRR  241

Query  827   VTEEQLRSLSQEGDEGG------IRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTT  669
             V+ EQ++ L++             +    D ++     N+F    + SN +G ++E    
Sbjct  242   VSPEQIKELTEHATSPSNKHKEKGKGKEKDTSTMWNPFNIFKEDPIYSNDFGHLHEAHPK  301

Query  668   HFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----------  522
              F  L ++D++ +++N+T+G +  P +NS+ T V  V  G    EM  P           
Sbjct  302   KFSQLQDLDISVSWINMTQGSLFLPHYNSKTTFVVFVENGCARFEMASPYTFQGEQQQQQ  361

Query  521   -------------------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGW  399
                                        S++  G V +IP G+P+  +A      ++ FG 
Sbjct  362   KPWFEQEQGEEQEQEEEEMSGQVHKFVSRVCKGEVFIIPAGHPFAVLAQDQNYVAVGFG-  420

Query  398   FDINGRGNERVTLAGTNNLFLKLGNAAKDLSFAAGS  291
               IN   ++R  LAG  N+   L   A  LSF  GS
Sbjct  421   --INAFNSKRTFLAGQENMLNNLDKVATRLSFGVGS  454



>emb|CAP06312.1| cvc [Pisum abyssinicum]
Length=526

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 188/369 (51%), Gaps = 43/369 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF  RSDLFE +++YRL     +  T  +P H DA+
Sbjct  169   PFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDAD  228

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD ++IP GTT+Y+VN D+ + + +  F++   
Sbjct  229   LILVVLNGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEEDLRVVDFVI--P  286

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE----PQ------  849
             ++ PG+F+ F  +  K    +  GFS+  LEA+LNTK+ETI++VL  E    PQ      
Sbjct  287   VNRPGKFEAFGLSENKN--QYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRK  344

Query  848   ------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGV  690
                   E    +KV+ EQ+  L +               S+    N+  HK   SN++G 
Sbjct  345   RRQQGGERDAIIKVSREQIEELRKLAKSSSK----KSLPSEFEPFNLRSHKPEYSNKFGK  400

Query  689   IYEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN  513
             ++E+      P L ++D+  + V I +G ++ P +NSRA  V +V EG+G LE+   KN 
Sbjct  401   LFEITPEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNE  460

Query  512   Y-------------QTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNE  372
                           Q   ++L  G VV+IP G+P    A+SN    L    F  N   N+
Sbjct  461   QQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAISASSN----LNLLGFGTNAENNQ  516

Query  371   RVTLAGTNN  345
             R  L+G+++
Sbjct  517   RNFLSGSDD  525



>ref|XP_003624146.1| Convicilin [Medicago truncatula]
 gb|ABD28362.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80364.1| vicilin 47 kDa protein [Medicago truncatula]
Length=473

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 199/425 (47%), Gaps = 56/425 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F    F+T   +     R+L RF  RS +FE +++YRL     +  T  +P H DA+
Sbjct  34    PFFFNANRFQTLFENENGHIRLLQRFDKRSKIFENLQNYRLLEYHSKPHTLFLPQHNDAD  93

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVN-TDNVKKVPLEFFILIR  1002
             FI  V+ G+  + V+  + + SFN+  GD +++P G+  Y+ N  DN     L+  I   
Sbjct  94    FILAVLSGKAILTVLNPNDRNSFNLERGDTIKLPAGSIAYLANRADNEDLRVLDLAI---  150

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGE-----------  855
              ++ PG+FQ FS +  +   SFF+GFS+  LEAA N+ +E I+RVL  E           
Sbjct  151   PVNRPGQFQSFSLSGNQNQQSFFSGFSKNILEAAFNSNYEEIERVLIEEQEQEPRHRRGL  210

Query  854   -------PQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRS------INVFPHK  714
                     QE    +KV+ EQ+  LS+       R    +  S+  +       N+   +
Sbjct  211   RDRRHKQSQEANVIVKVSREQIEELSRHAKSSSRRSASSESASRRSASSESAPFNLRSRE  270

Query  713   TV-SNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWL  537
              + SN++G  +E+       L ++D+   +  I EG +L P FNSRAT +  V EG+G  
Sbjct  271   PIYSNEFGNFFEITPEKNPQLQDLDILVNYAEIREGSLLLPHFNSRATVIVAVEEGKGEF  330

Query  536   EMGCPKNNYQTV--------------------RSKLKTGMVVVIPPGYPYVNVATSNPSK  417
             E+   +N  Q                      R++L  G V VIP GYP V  A+S+   
Sbjct  331   ELVGQRNENQQEQREYEEDEQEEERSQQVQRYRARLTPGDVYVIPAGYPNVVKASSD---  387

Query  416   SLQFGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELF  240
              L    F IN   N+R  LAG  +N+  ++    K+L+F   +  + V  +  +Q    F
Sbjct  388   -LSLLGFGINAENNQRSFLAGEEDNVISQIQRPVKELAFPGSA--QDVESLLKNQRQSYF  444

Query  239   FKAPP  225
               A P
Sbjct  445   ANAQP  449



>emb|CAF25232.1| Vicilin [Pisum sativum]
Length=415

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 196/416 (47%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     +  T  +P + DA+
Sbjct  8     PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD  67

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  68    FILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNED--LRVLDLAIP  125

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ      
Sbjct  126   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK  185

Query  848   -------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYG  693
                    EE   +KV+ EQ+  LS+       +    +    N RS N       SN++G
Sbjct  186   DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRN----PIYSNKFG  241

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  242   KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  301

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  R+KL  G V VIP G+P       N S  L    F I
Sbjct  302   NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP----VAINASSDLNLIGFGI  357

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N   NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  358   NAENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  411



>sp|P11827.1|GLCAP_SOYBN RecName: Full=Beta-conglycinin, alpha' chain; Flags: Precursor 
[Glycine max]
 gb|AAB01374.1| beta-conglycinin storage protein [Glycine max]
Length=639

 Score =   172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 120/418 (29%), Positives = 211/418 (50%), Gaps = 51/418 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F  + F+T   +     R+L RF+ RS   + ++DYR+     +  T ++P+H DA+
Sbjct  211   PFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADAD  270

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVP---------  1026
             ++  ++ G   + ++  D ++S+N+  GD LR+P GTT Y+VN DN + +          
Sbjct  271   YLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYV  330

Query  1025  --------LEFFILIRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQR  870
                     L    L   ++ PGRF+ F  ++ +   S+  GFS+  LEA+ +TK+E I +
Sbjct  331   VNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINK  390

Query  869   VLFG--EPQEEGP-------FLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPH  717
             VLFG  E Q++G         ++++++Q+R LS+          R   +S+++  N+   
Sbjct  391   VLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLGSR  446

Query  716   KTV-SNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGW  540
               + SN+ G ++E+ T     L ++DV  + V++ EG +  P FNS+A  V V+ EGE  
Sbjct  447   DPIYSNKLGKLFEI-TQRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEAN  505

Query  539   LEMGCPKN------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWF  396
             +E+   K               +  R++L    + VIP GYP +  ATS+    L F  F
Sbjct  506   IELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD----LNFFAF  561

Query  395   DINGRGNERVTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              IN   N+R  LAG+ +N+  ++ +  ++L+F   +  + +  +  SQ    F  A P
Sbjct  562   GINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSA--KDIENLIKSQSESYFVDAQP  617



>emb|CAP06327.1| cvc [Vicia bithynica]
Length=557

 Score =   171 bits (434),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 186/366 (51%), Gaps = 43/366 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF F+  +F T   +     R+L RF  RSDLFE +++YRL     +  T  +P H +A+
Sbjct  206   PFYFESNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIEAD  265

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ GR  + V+  + + S+N+  GD +++P GTT+++VN D+ +   L    L  S
Sbjct  266   LILVVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSHLVNQDDEED--LRVADLAIS  323

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             +  PG+ + F  +  K    +  GFS+  LEA+ NT +ETI++VL  E            
Sbjct  324   VDRPGKVESFLLSGNKN--QYLRGFSKNILEASFNTNYETIEKVLLEEQGKEPQQSRRSQ  381

Query  851   -QEEGPFLKVTEEQ---LRSLSQEGDEGGIRPFRGDETSKNRSINVFPHK-TVSNQYGVI  687
              QE    +K + EQ   L+ L++   + G+       +S+   IN+       SN++G +
Sbjct  382   RQETNALVKASREQIEELKRLAKSSSKEGL-------SSQFEPINLRSQNPKYSNKFGKL  434

Query  686   YEVGTTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNY  510
             +E+      P L ++D+  + V+I EG ++ P +NSRA  V +V EG G LE+   KN  
Sbjct  435   FEITPEKKYPQLQDLDIFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGLKNEQ  494

Query  509   QTVRSK-----------LKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVT  363
             Q  R K           L  G VV+IP G+P    A+SN    L    F ING  N+R  
Sbjct  495   QEQREKRNNQLQRYEARLSPGDVVIIPAGHPVAVSASSN----LNLLAFGINGENNQRNF  550

Query  362   LAGTNN  345
             L G+++
Sbjct  551   LTGSDD  556



>emb|CAA47814.1| vicilin 47kD protein [Pisum sativum]
 emb|CBK38918.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 196/416 (47%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     +  T  +P + DA+
Sbjct  31    PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD  90

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  91    FILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNED--LRVLDLAIP  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ      
Sbjct  149   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK  208

Query  848   -------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYG  693
                    EE   +KV+ EQ+  LS+       +    +    N RS N       SN++G
Sbjct  209   DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRN----PIYSNKFG  264

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  265   KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  324

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  R+KL  G V VIP G+P       N S  L    F I
Sbjct  325   NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP----VAINASSDLNLIGFGI  380

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N   NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  381   NAENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  434



>emb|CBK38921.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 197/416 (47%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     + +T  +P + DA+
Sbjct  31    PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQYTDAD  90

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  91    FILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLTIP  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ      
Sbjct  149   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK  208

Query  848   -------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYG  693
                    EE   +KV+ EQ+  LS+       +    +    N RS N       SN++G
Sbjct  209   DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRN----PIYSNKFG  264

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  265   KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  324

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  R+KL  G V VIP G+P       N S  L    F I
Sbjct  325   NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP----VAINASSDLNLIGFGI  380

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N   NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  381   NAENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  434



>pdb|1IPJ|A Chain A, Crystal Structures Of Recombinant And Native Soybean 
Beta-Conglycinin Beta Homotrimers Complexes With N-Acetyl-D-Glucosamine
 pdb|1IPJ|B Chain B, Crystal Structures Of Recombinant And Native Soybean 
Beta-Conglycinin Beta Homotrimers Complexes With N-Acetyl-D-Glucosamine
 pdb|1IPJ|C Chain C, Crystal Structures Of Recombinant And Native Soybean 
Beta-Conglycinin Beta Homotrimers Complexes With N-Acetyl-D-Glucosamine
Length=416

 Score =   168 bits (426),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 199/388 (51%), Gaps = 30/388 (8%)
 Frame = -2

Query  1334  FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLG  1155
             F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA+F+  V+ G
Sbjct  19    FQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSG  78

Query  1154  RGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQ  975
             R  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L   ++ PGR+ 
Sbjct  79    RAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAIPVNKPGRYD  136

Query  974   FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPFLKVTEEQLR  807
              F  ++ +   S+  GFS   LE + ++++E I RVL G    + Q+EG  +++++EQ+R
Sbjct  137   DFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLLGEEEEQRQQEGVIVELSKEQIR  196

Query  806   SLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVDVNAA  630
              LS+          R   +S++   N+     + SN +G  +E+       L ++D+  +
Sbjct  197   QLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLS  252

Query  629   FVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------NYQTVRSKLK  486
              V+I EG +L P FNS+A  + V+ EG+  +E+ G  +              Q  R++L 
Sbjct  253   SVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELS  312

Query  485   TGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDL  309
                V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  ++    ++L
Sbjct  313   EDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQEL  368

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAPP  225
             +F   +  + V  +   Q    F  A P
Sbjct  369   AFPGSA--QDVERLLKKQRESYFVDAQP  394



>emb|CAF25233.1| Vicilin [Pisum sativum]
Length=415

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 196/416 (47%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     + +T  +P   DA+
Sbjct  8     PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQCTDAD  67

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  68    FILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLTIP  125

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ      
Sbjct  126   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK  185

Query  848   -------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYG  693
                    EE   +KV+ EQ+  LS+       +    +    N RS N       SN++G
Sbjct  186   DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPI----YSNKFG  241

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  242   KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  301

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  R+KL  G V VIP G+P       N S  L    F I
Sbjct  302   NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHP----VAINASSDLNLIGFGI  357

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N   NER  LAG  +N+  ++    K+L+F   S    V+ +  +Q    F  A P
Sbjct  358   NAENNERNFLAGEEDNVISQVERPVKELAFPGSS--HEVDRLLKNQKQSYFANAQP  411



>ref|XP_003556052.1| PREDICTED: beta-conglycinin, beta chain-like [Glycine max]
 dbj|BAK39720.1| beta-conglycinin beta subunit [Glycine max]
Length=439

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 199/388 (51%), Gaps = 30/388 (8%)
 Frame = -2

Query  1334  FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLG  1155
             F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA+F+  V+ G
Sbjct  42    FQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSG  101

Query  1154  RGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQ  975
             R  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L   ++ PGR+ 
Sbjct  102   RAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAIPVNKPGRYD  159

Query  974   FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPFLKVTEEQLR  807
              F  ++ +   S+  GFS   LE + ++++E I RVL G    + Q+EG  +++++EQ+R
Sbjct  160   DFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLLGEEEEQRQQEGVIVELSKEQIR  219

Query  806   SLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVDVNAA  630
              LS+          R   +S++   N+     + SN +G  +E+       L ++D+  +
Sbjct  220   QLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLS  275

Query  629   FVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------NYQTVRSKLK  486
              V+I EG +L P FNS+A  + V+ EG+  +E+ G  +              Q  R++L 
Sbjct  276   SVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELS  335

Query  485   TGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDL  309
                V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  ++    ++L
Sbjct  336   EDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQEL  391

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAPP  225
             +F   +  + V  +   Q    F  A P
Sbjct  392   AFPGSA--QDVERLLKKQRESYFVDAQP  417



>emb|CBK38922.1| vicilin 47k [Pisum sativum]
 emb|CBK38923.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/416 (30%), Positives = 196/416 (47%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     +  T  +P + DA+
Sbjct  31    PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD  90

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+ ++ V++ + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  91    FILVVLNGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  148

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ Q F  +  +   S  +GFS+  LEAA NT +E I++VL      EPQ      
Sbjct  149   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK  208

Query  848   -------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYG  693
                    EE   +KV+ EQ+  LS+       +    +    N RS N       SN++G
Sbjct  209   DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRN----PIYSNKFG  264

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+     + L ++D+    V+I EG +L P +NSRA  +  V EG+G  E+   +N 
Sbjct  265   KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  324

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  ++KL  G V VIP G+P       N S  L    F I
Sbjct  325   NQGKENDKEEEQEEETSKQVQLYKAKLSPGDVFVIPAGHP----VAINASSDLNLIGFGI  380

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N   NER  LAG  +N+  ++    K+L+F   S    ++ +  +Q    F  A P
Sbjct  381   NAENNERNFLAGEEDNVISQVQRPVKELAFPGSS--HEIDRLLKNQKQSYFANAQP  434



>gb|KHN02728.1| Beta-conglycinin, beta chain [Glycine soja]
Length=349

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 176/342 (51%), Gaps = 41/342 (12%)
 Frame = -2

Query  1226  LVESQTFVVPNHEDAEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNT  1047
             + +  T  +P+H DA+F+  V+ GR  + +++ D ++ + +  G   RIP GTT Y+VN 
Sbjct  1     MAKPNTLFLPHHADADFLLLVLSGRALINLVKPDDRDPYYLDRGYAQRIPAGTTVYLVNP  60

Query  1046  DNVKKVPLEFFILIRSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRV  867
             D  KK  L    L   ++ PG F+ F  ++ +   S+  GFS   LEA+ NTK+E I RV
Sbjct  61    D--KKKDLRVIKLAIPVNKPGNFEDFFLSSTQDQQSYLQGFSENILEASFNTKFEEINRV  118

Query  866   LFG----EPQEEGPFLKVTEEQLRSLSQEG-------DEGGIRPF--RGDETSKNRSINV  726
             LFG      Q+EG  L++++EQ+R LS+         +     PF  RG + S       
Sbjct  119   LFGGEGRRHQQEGVILELSKEQIRELSKRAKSSSRSTNSFDYEPFYLRGSQIS-------  171

Query  725   FPHKTVSNQYGVIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGE  546
                   SN +G  YE+       L + D+    V+I EGG+L P +NS+A  + +V EGE
Sbjct  172   ------SNNFGKFYEITPEKNPQLRDFDILLNTVDINEGGLLLPHYNSKAIVILMVTEGE  225

Query  545   GWLEMGCPKNNYQ--------TVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
               +E+   K   Q          R++L    + VIP  YP+V  ATSN    L F  F I
Sbjct  226   ANIELVGLKEQQQGEETREVRKYRAELSEDDIFVIPAAYPFVVNATSN----LNFVAFGI  281

Query  389   NGRGNERVTLAGT-NNLFLKLGNAAKDLSFAAGSDKESVNVV  267
             N   N+R  LAG+ +N+  ++    K+L+F AGS ++  N++
Sbjct  282   NAENNQRNFLAGSKDNVIRQIQKQVKELAFPAGSAQDIENLI  323



>ref|XP_008224282.1| PREDICTED: vicilin C72 [Prunus mume]
Length=541

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 127/406 (31%), Positives = 200/406 (49%), Gaps = 53/406 (13%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEG-IKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F + E   +  + E  + +L  F+  S L  G I++YR A L     TFV+P H DA
Sbjct  122   PYYFPKFELRPRFLAEEGAYFVLESFARLSHLLRGRIQNYRTALLQTTPGTFVLPYHLDA  181

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E I  V  GRG++ ++ +D KESF I  GDV+R+P G TTY++N    +   L    L +
Sbjct  182   ESIFVVWNGRGTLTLVMKDTKESFKIENGDVIRVPAGATTYLINNHTTEN--LSLVQLFQ  239

Query  1001  SISTPGRFQFFSGAAGKKP-----VSFFNG-------FSRETLEAALNTKWETIQRVLFG  858
              ++TP  F+ F  A  K P      SF +G       FS + LEAA +   E +++  FG
Sbjct  240   PVNTPDLFEEFFPAGYKDPEPGSDYSFLHGTESYYSVFSSDLLEAAFDVPREQLEKA-FG  298

Query  857   EPQEEGPFLKVTEEQLRSLSQEGDEG--GIRPFRGDETSKNRSINVFPHKTV-SNQYGVI  687
             + + EG  ++ ++EQL +LS++       + P+  D    + + N+   + + SN YG  
Sbjct  299   QQKREGMIIRASKEQLEALSKQPSPWWRKLVPWSMD---SDLNFNLLSQRPLHSNNYGKF  355

Query  686   YEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPK----  519
             YE     F  L +++V+ A ++I    M+ P +N++AT + +V++G G+ EM CPK    
Sbjct  356   YEAPPQEFNQLQDMNVSVAMLDINPEAMMVPHYNTKATYLMMVVDGMGYFEMACPKFTIP  415

Query  518   -----------------NNYQTVRSKLKTGMVVVIPPGYPYVNVA-------TSNPSKSL  411
                                Y  V  KL  G V VIP G+P   VA         N +++L
Sbjct  416   ASEEEMKYQEEQADQQSGAYVKVSGKLSLGDVFVIPAGHPVSIVAQNNNPNNNGNQNQNL  475

Query  410   QFGWFDINGRGNERVTLAGTN-NLFLKLGNAAKDLSFAAGSDKESV  276
             +   F IN   N R  LAG   N+  ++   A +L+F  G + E +
Sbjct  476   RIVGFGINAGNNIRNFLAGQEGNIMKQMEREATELTF--GQEMEQI  519



>ref|XP_009369890.1| PREDICTED: beta-conglycinin, beta chain-like [Pyrus x bretschneideri]
Length=591

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 127/394 (32%), Positives = 195/394 (49%), Gaps = 47/394 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEG-IKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F +     +  + E  + +L   +  S    G IK+YRLA  L    TFV+P H DA
Sbjct  161   PYYFPKSTLLNRFGAEEGGYVVLNSLTRLSPFLRGRIKNYRLALFLTAPGTFVLPYHIDA  220

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E    V  G+G++  + ++ KESF I EGDV+R+P G TTY++N  + +   L    LIR
Sbjct  221   ESAFVVSAGKGTLTFVVKNKKESFKIEEGDVIRVPGGATTYLINHHSSEH--LNLVQLIR  278

Query  1001  SISTPGRF-QFFSGAAGKKPV----------SFFNGFSRETLEAALNTKWETIQRVLFGE  855
              ++ P  F +FF G    +            S+++ FS + LEAA NT  E +++ L G+
Sbjct  279   PVNIPDLFEEFFPGGYKIRDREDYSILDDVESYYSVFSNDILEAAFNTPREQLEKAL-GQ  337

Query  854   PQEEGPFLKVTEEQLRSLSQEGDEGGIR---PFRGDETSKNRSINVFPHKTV-SNQYGVI  687
              + EG  +K ++EQL++LS++ D    R   P+   E + +   N+   K + SN YG  
Sbjct  338   QRPEGMIIKASKEQLKALSKQ-DPSWWRKLVPWWSSEDT-DLKFNLQSQKPLHSNNYGKF  395

Query  686   YEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP-----  522
             YE     F  L +V+V+   V I    M+ P +NS+AT + +V+ G GW EM  P     
Sbjct  396   YEASPQEFNQLLDVNVSVVIVEINSETMMVPHYNSKATYLMMVVSGTGWFEMASPQFTLP  455

Query  521   ---------------KNNYQTVRSKLKTGMVVVIPPGYPYV-----NVATSNPSKSLQFG  402
                            +  Y  V  KL  G V V+P G P V     N  ++N +++L+  
Sbjct  456   GSEEEIEYQEDQGEQRGMYTKVSGKLSLGDVFVVPAGRPVVFVSQNNDESNNQNQNLRIV  515

Query  401   WFDINGRGNERVTLAGT-NNLFLKLGNAAKDLSF  303
              F IN   N R  LAG  +N+   + + AK L+F
Sbjct  516   GFGINAPNNIRNFLAGQEDNIMKMMESEAKQLTF  549



>ref|NP_001236872.1| beta-conglycinin beta-subunit precursor [Glycine max]
 dbj|BAB64305.1| beta-conglycinin beta-subunit [Glycine max]
 dbj|BAB64306.1| beta-conglycinin beta-subunit [Glycine max]
Length=439

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 119/397 (30%), Positives = 202/397 (51%), Gaps = 31/397 (8%)
 Frame = -2

Query  1358  PFVFQREE-FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F+    F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA
Sbjct  33    PFYFRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADA  92

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             +F+  V+ GR  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L  
Sbjct  93    DFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAI  150

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPF  834
              ++ P R+  F  ++ +   S+  GFS   LE + ++++E I RVLFG    + Q+EG  
Sbjct  151   PVNKPSRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI  210

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP  657
             +++++EQ+R LS+          R   +S++   N+     + SN +G  +E+       
Sbjct  211   VELSKEQIRQLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQ  266

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------N  513
               ++D+  + V+I EG +L P FNS+A  + V+ EG+  +E+ G  +             
Sbjct  267   PRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLE  326

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFL  336
              Q  R++L    V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  
Sbjct  327   VQRYRAELSEDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVR  382

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             ++    ++L+F   +  + V  +   Q    F  A P
Sbjct  383   QIERQVQELAFPGSA--QDVERLLKKQRESYFVDAQP  417



>gb|ACU18513.1| unknown [Glycine max]
Length=439

 Score =   166 bits (420),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 197/388 (51%), Gaps = 30/388 (8%)
 Frame = -2

Query  1334  FETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAEFICTVVLG  1155
             F+T   +     R L RF+ RS   E ++DYR+     +  T ++P+H DA+F+  V+ G
Sbjct  42    FQTLFENQNGRIRFLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSG  101

Query  1154  RGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRSISTPGRFQ  975
             R  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L   ++ PGR+ 
Sbjct  102   RAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAIPVNKPGRYD  159

Query  974   FFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPFLKVTEEQLR  807
              F  ++ +   S+  GFS   LE +  +++E I RVLFG    + Q+EG  +++++EQ+R
Sbjct  160   DFFLSSTQAQQSYLQGFSHNILETSFYSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIR  219

Query  806   SLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKPLDEVDVNAA  630
              LS+          R   +S++   N+     + SN +G  +E+       L ++D+  +
Sbjct  220   QLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLS  275

Query  629   FVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------NYQTVRSKLK  486
              V+I EG +L P FNS+A  + V+ EG+  +E+ G  +              Q  R++L 
Sbjct  276   SVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELS  335

Query  485   TGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFLKLGNAAKDL  309
                V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  ++    ++L
Sbjct  336   EDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQEL  391

Query  308   SFAAGSDKESVNVVFGSQPLELFFKAPP  225
              F   +  + V  +   Q    F  A P
Sbjct  392   VFPGSA--QDVERLLKKQRESYFVDAQP  417



>ref|XP_007225626.1| hypothetical protein PRUPE_ppa003838mg [Prunus persica]
 gb|EMJ26825.1| hypothetical protein PRUPE_ppa003838mg [Prunus persica]
Length=545

 Score =   168 bits (425),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 196/405 (48%), Gaps = 50/405 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEG-IKDYRLAFLLVESQTFVVPNHEDA  1182
             P+ F +     +  + E  + +L  F+  S L  G I++YR A L     TFV+P H DA
Sbjct  125   PYYFPKFGLRPRFLAEEGAYFVLGSFARLSHLLRGRIQNYRAALLQTTPGTFVLPYHLDA  184

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             E I  V  GRG++ ++ +D K+SF I  GDV+R+P G TTY++N    +   L    L +
Sbjct  185   ESIFVVWNGRGTLTLVMKDTKQSFKIENGDVIRVPAGATTYLINNHTTEN--LSLVHLFQ  242

Query  1001  SISTPGRFQFFSGAAGKKP-----VSFFNG-------FSRETLEAALNTKWETIQRVLFG  858
              ++TP  F+ F  A  K P      SF +G       FS + LEAA +   E +++  FG
Sbjct  243   PVNTPDLFEEFFPAGYKGPEPGSDYSFLHGTESYYSVFSNDLLEAAFDVPREQLEKA-FG  301

Query  857   EPQEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYE  681
             + + EG  ++ ++EQL +LS++      R         + + N+   + + SN YG  YE
Sbjct  302   QQKREGMIIRASKEQLEALSKQASP-WWRKLVPWSMGSDLNFNLLSQRPLHSNNYGKFYE  360

Query  680   VGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNN----  513
                  FK L +++V+ A ++I    M+ P +NS+AT + +V++G G+ EM CPK      
Sbjct  361   ASPQEFKQLQDMNVSVAMLDINPEAMMVPHYNSKATYLMMVVDGMGYFEMACPKFTIPAS  420

Query  512   -----------------YQTVRSKLKTGMVVVIPPGYPYVNVA--------TSNPSKSLQ  408
                              Y  V  KL  G V VIP G+P   VA          N +++L+
Sbjct  421   EEEMEYQEEQADQQSGVYSKVSGKLSLGDVFVIPAGHPVSIVAQNNNNNNNGGNQNQNLR  480

Query  407   FGWFDINGRGNERVTLAGTN-NLFLKLGNAAKDLSFAAGSDKESV  276
                F IN   N R  LAG   N+  ++   A  L+F  G + E V
Sbjct  481   IVGFGINAGNNMRNFLAGQEGNIMKQMEREATQLTF--GQEMEQV  523



>emb|CAR78998.1| convicilin storage protein 2 [Lotus japonicus]
Length=588

 Score =   168 bits (425),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 198/405 (49%), Gaps = 39/405 (10%)
 Frame = -2

Query  1358  PFVFQRE--EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             PF F+     F+T+  +     R+L RF +RS LFE +++YR+     +  T V+P+H D
Sbjct  173   PFYFRSSSSRFQTRFQNEYGYVRVLQRFDERSKLFENLQNYRIFEFKAKPHTVVLPHHND  232

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A+ I  ++ G+  + ++  + +ESFN+  GDVL  P GT  Y+ N D+ + + +   I+ 
Sbjct  233   ADSIVVILSGKAIITLVNPNDRESFNLERGDVLVHPAGTIAYVANHDDNENLRIAKIII-  291

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF--GEP-QEEGPF  834
               ++ PG FQ F  +  +   S+ NGFSR  LEA+ N ++  I+RVL   GE  QE+G  
Sbjct  292   -PVNRPGEFQAFYPSNTEPQESYLNGFSRNILEASFNAEYNEIERVLLRGGEQRQEQGLI  350

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYGVIYEVGTTHFKP  657
             +KV+ + ++ LS+       +    +    N RS +       SN++G  +E+       
Sbjct  351   VKVSRDLIQQLSRHAKSSSRKRTSSEPEPFNLRSRD----PIYSNEFGKHFEINPNRNSQ  406

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGC----------------  525
             L + D+  +   I EG +  P +NSR+T + VV EG G  E+                  
Sbjct  407   LRDFDIFLSSTEIREGSIFLPHYNSRSTVILVVNEGRGEFELVAQRKQQQQRRNEEDEEE  466

Query  524   ----PKNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                 P+   Q  R++L  G VVVIP G+P       N S  L F  F IN   N+R  LA
Sbjct  467   EEEQPRIEAQRFRARLSPGDVVVIPAGHP----VAINASSDLNFIAFGINAENNQRHFLA  522

Query  356   -GTNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
              G +N+  ++    K+++F   +  E +  +  +Q    F  A P
Sbjct  523   GGDDNVISQIEKVVKEIAFPGSA--EDIERLIKNQRNSHFANAQP  565



>emb|CAD87731.1| allergen Len c 1.0102 [Lens culinaris]
Length=415

 Score =   165 bits (417),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 123/416 (30%), Positives = 199/416 (48%), Gaps = 50/416 (12%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+   F+T   +     R+L +F  RS +FE +++YRL     +  T  +P + DA+
Sbjct  8     PFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD  67

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
             FI  V+ G+  + V+  + + SFN+  GD +++P GT  Y+ N D+ +   L    L   
Sbjct  68    FILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNED--LRVLDLAIP  125

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLF----GEPQ------  849
             ++ PG+ + F  +  +   SF +GF++  LEAA NT +E I++VL      EPQ      
Sbjct  126   VNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLR  185

Query  848   -------EEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYG  693
                    +E   +KV+ EQ++ LS+       +    +    N RS N       SN++G
Sbjct  186   DRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRN----PIYSNKFG  241

Query  692   VIYEVGTTHFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKN-  516
               +E+       L ++D+    V I EG +L P +NSRA  +  V EG+G+ E+   +N 
Sbjct  242   KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE  301

Query  515   ------------------NYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDI  390
                                 Q  R+KL  G V V+P G+P       N S  L    F I
Sbjct  302   NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHP----VAINASSDLNLIGFGI  357

Query  389   NGRGNERVTLAG-TNNLFLKLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             N + N+R  LAG  +N+  ++    K+L+F  GS +E V+ +  +Q    F  A P
Sbjct  358   NAKNNQRNFLAGEEDNVISQIQRPVKELAF-PGSSRE-VDRLLTNQKQSHFANAQP  411



>emb|CAP06317.1| cvc [Lathyrus hirsutus]
Length=576

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/364 (33%), Positives = 185/364 (51%), Gaps = 38/364 (10%)
 Frame = -2

Query  1358  PFVFQREEFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDAE  1179
             PF+F+  +F T   +     R L RF +RSD+FE +++YRL     +  T  +P H DA+
Sbjct  224   PFLFKSNKFLTLFENENGHIRRLQRFDERSDIFENLQNYRLVEYKAKPHTMFLPQHIDAD  283

Query  1178  FICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIRS  999
              I  V+ G+  + V+  + + S+N+  GD +++P GTT+Y+VN D+ +   L    L   
Sbjct  284   LIIVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEED--LRVVDLAIP  341

Query  998   ISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEP-----------  852
             ++ PG+F+ F  +A K    +  GFS+  LEA LNTK+ETI++VL  E            
Sbjct  342   VNRPGKFEAFGLSANKN--QYLRGFSKNILEAFLNTKYETIEKVLLEEQERRDRKGRQQG  399

Query  851   QEEGPFLKVTEEQLRSLSQEGDEGGIRPFRGDETSKN-RSINVFPHKTVSNQYGVIYEVG  675
             QE    +KV+ EQ+  L +       +    +    N RS N       SN++G ++E+ 
Sbjct  400   QETNAIVKVSREQIEELRKLAKSSSKKSLLSESEPINLRSQNP----KYSNKFGKLFEIT  455

Query  674   TTHFKP-LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCPKNNYQTVR  498
                  P L ++DV+ + V I EG  L P +NSRA  + +V EG+G LE+   KN  Q  R
Sbjct  456   PEKKYPQLQDLDVSISCVEINEGAPLLPHYNSRAIVLLLVNEGKGNLELVGFKNEQQRQR  515

Query  497   -------------SKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLA  357
                          ++L  G VVVIP G+P    A+ N    L    F +N   N+R  L 
Sbjct  516   ENEERNKKVQRYEARLSPGDVVVIPAGHPVAISASLN----LNLVGFGVNAENNQRNFLT  571

Query  356   GTNN  345
             G+++
Sbjct  572   GSDD  575



>ref|NP_566714.1| protein PAP85 [Arabidopsis thaliana]
 dbj|BAB01239.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24193.1| AT3g22640/MWI23_1 [Arabidopsis thaliana]
 gb|AAL90968.1| AT3g22640/MWI23_1 [Arabidopsis thaliana]
 gb|AEE76660.1| cupin family protein [Arabidopsis thaliana]
Length=486

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 192/388 (49%), Gaps = 36/388 (9%)
 Frame = -2

Query  1361  YPFVFQREEFETQAASGESIFRMLPRFSDRS-DLFEGIKDYRLAFLLVESQTFVVPNHED  1185
             +P+ F++  F     S E   R+LP+F+  +  LF GI++YR + + +E  TF VP+H D
Sbjct  62    HPYHFRKRSFSDWFQSKEGFVRVLPKFTKHAPALFRGIENYRFSLVEMEPTTFFVPHHLD  121

Query  1184  AEFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILI  1005
             A+ +  V+ G+G +  +    KESF+I +GDV+RIP G T +I NT+  + VPL    + 
Sbjct  122   ADAVFIVLQGKGVIEFVTDKTKESFHITKGDVVRIPSGVTNFITNTN--QTVPLRLAQIT  179

Query  1004  RSISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFGEPQ-EEGPFLK  828
               ++ PG ++ +  AA +   S+FNGF++E L  + N   E + R++    +  +G   +
Sbjct  180   VPVNNPGNYKDYFPAASQFQQSYFNGFTKEVLSTSFNVPEELLGRLVTRSKEIGQGIIRR  239

Query  827   VTEEQLRSLSQEGDEGGIRPFRGDETSKNRSI-------NVFPHKTV-SNQYGVIYEVGT  672
             ++ +Q++ L++       +     E  +++ +       N+F    + SN +G  +E   
Sbjct  240   ISPDQIKELAEHATSPSNKHKAKKEKEEDKDLRTLWTPFNLFAIDPIYSNDFGHFHEAHP  299

Query  671   THFKPLDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEMGCP----------  522
              ++  L ++ + AA+ N+T+G +  P FNS+ T V  V  G    EM  P          
Sbjct  300   KNYNQLQDLHIAAAWANMTQGSLFLPHFNSKTTFVTFVENGCARFEMATPYKFQRGQQQW  359

Query  521   -----------KNNYQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGN  375
                          N   V S++  G V ++P G+P+  ++      ++ FG +  N +  
Sbjct  360   PGQGQEEEEDMSENVHKVVSRVCKGEVFIVPAGHPFTILSQDQDFIAVGFGIYATNSK--  417

Query  374   ERVTLAGTNNLFLKLGNAAKDLSFAAGS  291
              R  LAG  NL   L  AA  ++F  GS
Sbjct  418   -RTFLAGEENLLSNLNPAATRVTFGVGS  444



>dbj|BAK53446.1| beta-conglycinin beta subunit [Glycine max]
Length=435

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 200/397 (50%), Gaps = 35/397 (9%)
 Frame = -2

Query  1358  PFVFQRE-EFETQAASGESIFRMLPRFSDRSDLFEGIKDYRLAFLLVESQTFVVPNHEDA  1182
             PF F+    F+T   +     R+L RF+ RS   E ++DYR+     +  T ++P+H DA
Sbjct  33    PFYFRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADA  92

Query  1181  EFICTVVLGRGSVAVIRQDGKESFNIYEGDVLRIPPGTTTYIVNTDNVKKVPLEFFILIR  1002
             +F+  V+ GR  + ++  D ++S+N++ GD  RIP GTT Y+VN  + +   L+   L  
Sbjct  93    DFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN--LKIIKLAI  150

Query  1001  SISTPGRFQFFSGAAGKKPVSFFNGFSRETLEAALNTKWETIQRVLFG----EPQEEGPF  834
              ++ PGR+  F  ++ +   S+  GFS   LE    T +  I RVLFG    + Q+EG  
Sbjct  151   PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILE----TSFHEINRVLFGEEEEQRQQEGVI  206

Query  833   LKVTEEQLRSLSQEGDEGGIRPFRGDETSKNRSINVFPHKTV-SNQYGVIYEVGTTHFKP  657
             +++++EQ+R LS+          R   +S++   N+     + SN +G  +E+       
Sbjct  207   VELSKEQIRQLSRRAKSSS----RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQ  262

Query  656   LDEVDVNAAFVNITEGGMLGPFFNSRATQVAVVLEGEGWLEM-GCPKN-----------N  513
             L ++D+  + V+I EG +L P FNS+A  + V+ EG+  +E+ G  +             
Sbjct  263   LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLE  322

Query  512   YQTVRSKLKTGMVVVIPPGYPYVNVATSNPSKSLQFGWFDINGRGNERVTLAG-TNNLFL  336
              Q  R++L    V VIP  YP+V  ATSN    L F  F IN   N+R  LAG  +N+  
Sbjct  323   VQRYRAELSEDDVFVIPAAYPFVVNATSN----LNFLAFGINAENNQRNFLAGEKDNVVR  378

Query  335   KLGNAAKDLSFAAGSDKESVNVVFGSQPLELFFKAPP  225
             ++    ++L+F   +  + V  +   Q    F  A P
Sbjct  379   QIERQVQELAFPGSA--QDVERLLKKQRESYFVDAQP  413



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4318295211160