BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85727_g1_i1 len=676 path=[1:0-675]

Length=676
                                                                      Score     E

ref|XP_002521893.1|  lipid binding protein, putative                    134   6e-36   Ricinus communis
emb|CDP05424.1|  unnamed protein product                                130   1e-34   
ref|XP_008220967.1|  PREDICTED: non-specific lipid-transfer prote...    130   2e-34   
gb|KEH20240.1|  Lipid transfer protein                                  130   2e-34   
gb|AFK35164.1|  unknown                                                 130   3e-34   
ref|XP_009777451.1|  PREDICTED: non-specific lipid-transfer prote...    129   3e-34   
gb|KDP38197.1|  hypothetical protein JCGZ_04840                         129   4e-34   
ref|NP_001238490.1|  uncharacterized protein LOC100500207 precursor     127   3e-33   
ref|XP_010041160.1|  PREDICTED: non-specific lipid-transfer prote...    125   1e-32   
ref|XP_003530550.2|  PREDICTED: lipid transfer-like protein VAS-like    125   2e-32   
ref|XP_011024956.1|  PREDICTED: non-specific lipid-transfer prote...    125   2e-32   
gb|KHN37154.1|  hypothetical protein glysoja_038774                     125   2e-32   
ref|XP_009351616.1|  PREDICTED: non-specific lipid-transfer prote...    124   4e-32   
ref|XP_004297800.1|  PREDICTED: non-specific lipid-transfer prote...    124   5e-32   
ref|XP_002281828.1|  PREDICTED: non-specific lipid transfer prote...    124   6e-32   Vitis vinifera
ref|XP_010066527.1|  PREDICTED: non-specific lipid-transfer prote...    124   7e-32   
ref|XP_004509596.1|  PREDICTED: uncharacterized protein LOC101514838    122   1e-31   
ref|XP_010043902.1|  PREDICTED: non-specific lipid-transfer prote...    122   2e-31   
gb|AFK49597.1|  unknown                                                 122   3e-31   
ref|XP_002314750.1|  protease inhibitor/seed storage/lipid transf...    121   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006492279.1|  PREDICTED: non-specific lipid-transfer prote...    121   7e-31   
ref|XP_002312490.2|  hypothetical protein POPTR_0008s14060g             120   8e-31   Populus trichocarpa [western balsam poplar]
gb|KHG18737.1|  Non-specific lipid-transfer 4 -like protein             120   1e-30   
ref|XP_008340543.1|  PREDICTED: lipid transfer-like protein VAS         119   2e-30   
ref|XP_010680101.1|  PREDICTED: uncharacterized protein LOC104895329    119   2e-30   
ref|XP_006368104.1|  PREDICTED: lipid transfer-like protein VAS-like    119   5e-30   
ref|XP_011021704.1|  PREDICTED: non-specific lipid-transfer prote...    119   5e-30   
gb|AFH57276.1|  lipid transfer protein                                  119   6e-30   
ref|XP_004297799.1|  PREDICTED: non-specific lipid-transfer prote...    116   5e-29   
ref|XP_006410985.1|  hypothetical protein EUTSA_v10017444mg             116   5e-29   
ref|XP_009143445.1|  PREDICTED: non-specific lipid-transfer prote...    115   8e-29   
gb|KEH20238.1|  Lipid transfer protein                                  115   1e-28   
ref|XP_006448051.1|  hypothetical protein CICLE_v10018228mg             116   1e-28   
ref|XP_007045399.1|  Bifunctional inhibitor/lipid-transfer protei...    117   3e-28   
ref|NP_565872.1|  protease inhibitor/seed storage/lipid transfer ...    114   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879712.1|  protease inhibitor/seed storage/lipid transf...    114   3e-28   
gb|KHG13426.1|  Non-specific lipid-transfer 4 -like protein             114   3e-28   
gb|KFK36683.1|  hypothetical protein AALP_AA4G156000                    113   5e-28   
ref|XP_006295228.1|  hypothetical protein CARUB_v10024313mg             113   6e-28   
ref|XP_007226549.1|  hypothetical protein PRUPE_ppa024837mg             118   1e-27   
ref|XP_008466820.1|  PREDICTED: protein YLS3                            112   1e-27   
ref|XP_004151148.1|  PREDICTED: uncharacterized protein LOC101207781    112   1e-27   
emb|CDX93346.1|  BnaC04g45500D                                          112   2e-27   
emb|CAN60832.1|  hypothetical protein VITISV_004738                     116   7e-27   Vitis vinifera
ref|XP_010509268.1|  PREDICTED: non-specific lipid-transfer prote...    110   8e-27   
emb|CDX91388.1|  BnaC04g07620D                                          110   1e-26   
emb|CDX74929.1|  BnaA05g06750D                                          110   1e-26   
ref|XP_007156387.1|  hypothetical protein PHAVU_003G282100g             109   2e-26   
emb|CDY18422.1|  BnaA04g21650D                                          109   3e-26   
ref|XP_010505385.1|  PREDICTED: non-specific lipid-transfer prote...    108   5e-26   
ref|XP_010105521.1|  hypothetical protein L484_019263                   108   6e-26   
ref|XP_010517065.1|  PREDICTED: non-specific lipid-transfer prote...    107   7e-26   
gb|KCW64440.1|  hypothetical protein EUGRSUZ_G02057                     107   1e-25   
ref|XP_010276272.1|  PREDICTED: non-specific lipid-transfer prote...    107   1e-25   
ref|XP_010530425.1|  PREDICTED: non-specific lipid-transfer prote...    105   5e-25   
ref|XP_010068681.1|  PREDICTED: non-specific lipid-transfer prote...    108   5e-25   
ref|XP_006849508.1|  hypothetical protein AMTR_s00024p00140200          101   3e-23   
gb|ABR16461.1|  unknown                                               96.7    1e-21   Picea sitchensis
gb|ABK20923.1|  unknown                                               96.7    1e-21   Picea sitchensis
gb|ABK24954.1|  unknown                                               96.7    1e-21   Picea sitchensis
gb|ABK25641.1|  unknown                                               95.9    2e-21   Picea sitchensis
ref|XP_004970576.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    9e-20   
ref|XP_002458765.1|  hypothetical protein SORBIDRAFT_03g039880        90.9    2e-19   Sorghum bicolor [broomcorn]
ref|NP_001150159.1|  LOC100283788 precursor                           90.5    3e-19   Zea mays [maize]
dbj|BAJ88730.1|  predicted protein                                    88.2    2e-18   
ref|XP_009139277.1|  PREDICTED: putative lipid-transfer protein DIR1  88.2    2e-18   
ref|XP_006645014.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    4e-18   
ref|XP_003567269.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   
ref|XP_006850430.1|  hypothetical protein AMTR_s00165p00049610        87.0    4e-18   
ref|NP_001044807.1|  Os01g0849000                                     86.7    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_190966.1|  Bifunctional inhibitor/lipid-transfer protein/s...  86.3    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623166.1|  Protease inhibitor/seed storage/LTP family p...  86.3    9e-18   
gb|AAM65889.1|  unknown                                               85.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46593.1|  unknown                                               85.9    1e-17   
gb|KFK34645.1|  hypothetical protein AALP_AA5G172600                  85.5    2e-17   
ref|XP_002871191.1|  protease inhibitor/seed storage/lipid transf...  85.5    2e-17   
ref|XP_006429231.1|  hypothetical protein CICLE_v10013135mg           85.1    2e-17   
ref|XP_006292076.1|  hypothetical protein CARUB_v10018271mg           85.1    2e-17   
emb|CDM84993.1|  unnamed protein product                              85.1    2e-17   
ref|XP_007140457.1|  hypothetical protein PHAVU_008G113900g           84.7    3e-17   
ref|XP_006837776.1|  hypothetical protein AMTR_s00104p00068440        84.7    4e-17   
ref|XP_010491144.1|  PREDICTED: uncharacterized protein LOC104768790  84.7    4e-17   
ref|XP_002877950.1|  protease inhibitor/seed storage/lipid transf...  84.3    4e-17   
ref|XP_010452505.1|  PREDICTED: uncharacterized protein LOC104734599  84.3    5e-17   
ref|NP_001238303.1|  uncharacterized protein LOC100305635 precursor   84.0    6e-17   
ref|XP_003529127.1|  PREDICTED: putative lipid-transfer protein D...  84.0    6e-17   
ref|XP_008785478.1|  PREDICTED: uncharacterized protein LOC103704106  84.0    6e-17   
ref|XP_002315191.1|  protease inhibitor/seed storage/lipid transf...  83.6    9e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011036038.1|  PREDICTED: putative lipid-transfer protein DIR1  83.2    1e-16   
ref|XP_007009154.1|  Bifunctional inhibitor/lipid-transfer protei...  83.2    1e-16   
ref|XP_006429230.1|  hypothetical protein CICLE_v10013132mg           82.8    2e-16   
gb|EMT24714.1|  hypothetical protein F775_26225                       82.8    2e-16   
gb|AFK42353.1|  unknown                                               82.8    2e-16   
ref|XP_008233680.1|  PREDICTED: probable non-specific lipid-trans...  82.4    2e-16   
ref|XP_006849510.1|  hypothetical protein AMTR_s00024p00141270        82.4    2e-16   
gb|KHG10558.1|  putative non-specific lipid-transfer 2                82.4    2e-16   
gb|ABR17125.1|  unknown                                               82.0    3e-16   Picea sitchensis
gb|AFK41239.1|  unknown                                               82.0    3e-16   
ref|XP_010068679.1|  PREDICTED: uncharacterized protein LOC104455613  82.4    3e-16   
ref|XP_007026870.1|  RHO guanyl-nucleotide exchange factor 7          87.4    3e-16   
ref|XP_010558098.1|  PREDICTED: uncharacterized protein LOC104826866  82.0    4e-16   
gb|AFK45984.1|  unknown                                               82.0    4e-16   
ref|NP_568160.1|  bifunctional inhibitor/lipid-transfer protein/s...  81.6    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923195.1|  PREDICTED: uncharacterized protein LOC105046333  81.6    4e-16   
ref|XP_010423403.1|  PREDICTED: uncharacterized protein LOC104708517  81.6    4e-16   
ref|XP_009351247.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    5e-16   
emb|CDP00155.1|  unnamed protein product                              81.3    5e-16   
gb|ABQ53995.1|  protease inhibitor/seed storage/LTP family protein    80.9    6e-16   Cicer arietinum [garbanzo]
emb|CDX76181.1|  BnaA04g04450D                                        81.3    7e-16   
ref|NP_001052760.1|  Os04g0415800                                     81.3    7e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CDY13162.1|  BnaC04g26730D                                        81.3    8e-16   
ref|XP_009378876.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    8e-16   
ref|XP_006399057.1|  hypothetical protein EUTSA_v10015048mg           80.9    9e-16   
ref|XP_009380621.1|  PREDICTED: putative lipid-transfer protein DIR1  80.9    9e-16   
ref|XP_004492374.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
gb|KDO57976.1|  hypothetical protein CISIN_1g033430mg                 80.5    1e-15   
ref|XP_010923196.1|  PREDICTED: uncharacterized protein LOC105046334  80.5    1e-15   
ref|XP_006361967.1|  PREDICTED: putative lipid-transfer protein D...  80.5    1e-15   
ref|XP_008785477.1|  PREDICTED: uncharacterized protein LOC103704105  80.5    1e-15   
ref|XP_011084993.1|  PREDICTED: uncharacterized protein LOC105167116  80.1    1e-15   
ref|XP_006576151.1|  PREDICTED: uncharacterized protein LOC100306...  80.9    1e-15   
ref|XP_004235052.1|  PREDICTED: uncharacterized protein LOC101258342  80.1    2e-15   
gb|KHG23087.1|  Putative lipid-transfer DIR1 -like protein            80.1    2e-15   
ref|XP_007026867.1|  Bifunctional inhibitor/lipid-transfer protei...  80.1    2e-15   
ref|XP_008391039.1|  PREDICTED: uncharacterized protein LOC103453274  80.1    2e-15   
gb|KFK24991.1|  hypothetical protein AALP_AA8G052300                  80.1    2e-15   
ref|XP_007133944.1|  hypothetical protein PHAVU_010G005500g           80.1    2e-15   
gb|KHG28167.1|  putative non-specific lipid-transfer 2                79.7    2e-15   
ref|XP_004975591.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
ref|XP_006360200.1|  PREDICTED: putative lipid-transfer protein D...  79.7    2e-15   
ref|XP_010256754.1|  PREDICTED: uncharacterized protein LOC104597063  79.7    2e-15   
gb|ADQ57297.1|  xylem sap protein 10 kDa                              79.7    2e-15   
gb|KCW82679.1|  hypothetical protein EUGRSUZ_C04056                   80.1    2e-15   
ref|XP_009122201.1|  PREDICTED: uncharacterized protein LOC103846942  79.7    2e-15   
ref|XP_006652272.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
emb|CAH59408.1|  hypothetical protein                                 79.3    3e-15   Plantago major [cart-track plant]
emb|CDX98890.1|  BnaC09g49450D                                        79.3    3e-15   
ref|XP_011037534.1|  PREDICTED: putative lipid-transfer protein DIR1  79.0    4e-15   
ref|XP_002272871.2|  PREDICTED: uncharacterized protein LOC100240776  79.0    5e-15   Vitis vinifera
emb|CBI30470.3|  unnamed protein product                              78.6    5e-15   
ref|XP_009799912.1|  PREDICTED: uncharacterized protein LOC104245907  78.6    5e-15   
ref|XP_002312129.1|  protease inhibitor/seed storage/lipid transf...  78.6    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010067464.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    6e-15   
gb|EYU19957.1|  hypothetical protein MIMGU_mgv11b015357mg             77.0    7e-15   
ref|XP_008388088.1|  PREDICTED: uncharacterized protein LOC103450502  78.2    7e-15   
ref|XP_003579714.1|  PREDICTED: non-specific lipid transfer prote...  78.2    9e-15   
ref|XP_007206156.1|  hypothetical protein PRUPE_ppa013525mg           77.8    1e-14   
ref|XP_008240113.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    1e-14   
ref|NP_001151364.1|  LOC100284997 precursor                           77.8    1e-14   Zea mays [maize]
ref|XP_002524256.1|  lipid binding protein, putative                  77.4    1e-14   Ricinus communis
ref|NP_001148327.1|  lipid binding protein precursor                  77.4    1e-14   Zea mays [maize]
ref|XP_009419916.1|  PREDICTED: uncharacterized protein LOC103999...  77.4    1e-14   
ref|XP_010041554.1|  PREDICTED: uncharacterized protein LOC104430507  77.4    1e-14   
ref|XP_010067466.1|  PREDICTED: uncharacterized protein LOC104454347  77.4    1e-14   
ref|XP_010051669.1|  PREDICTED: uncharacterized protein LOC104440439  77.0    2e-14   
ref|XP_010088546.1|  hypothetical protein L484_016938                 77.0    2e-14   
ref|XP_010691722.1|  PREDICTED: uncharacterized protein LOC104904979  77.0    2e-14   
ref|XP_006435584.1|  hypothetical protein CICLE_v10033080mg           77.0    2e-14   
gb|AII99866.1|  protease inhibitor/seed storage/ltp family            76.6    3e-14   
ref|XP_009597227.1|  PREDICTED: uncharacterized protein LOC104093206  76.6    3e-14   
dbj|BAK01229.1|  predicted protein                                    76.6    3e-14   
ref|XP_010108368.1|  hypothetical protein L484_010375                 76.3    3e-14   
gb|ACN31618.1|  unknown                                               76.3    4e-14   Zea mays [maize]
dbj|BAJ96826.1|  predicted protein                                    76.3    4e-14   
ref|XP_010051668.1|  PREDICTED: uncharacterized protein LOC104440438  76.6    4e-14   
ref|NP_001149502.1|  lipid binding protein precursor                  75.9    4e-14   Zea mays [maize]
ref|XP_008370014.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    4e-14   
ref|XP_011094930.1|  PREDICTED: uncharacterized protein LOC105174503  77.0    4e-14   
ref|XP_007026868.1|  Bifunctional inhibitor/lipid-transfer protei...  75.9    5e-14   
ref|XP_006289082.1|  hypothetical protein CARUB_v10002488mg           75.9    5e-14   
ref|XP_003516311.1|  PREDICTED: putative lipid-transfer protein D...  75.9    6e-14   
ref|XP_008441410.1|  PREDICTED: uncharacterized protein LOC103485536  75.9    6e-14   
ref|XP_002323530.1|  protease inhibitor/seed storage/lipid transf...  75.5    7e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004967664.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    7e-14   
dbj|BAB10801.1|  unnamed protein product                              76.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623161.1|  Protease inhibitor/seed storage/LTP family p...  77.4    7e-14   
ref|NP_001152452.1|  LOC100286092 precursor                           75.1    8e-14   Zea mays [maize]
ref|XP_006851361.1|  hypothetical protein AMTR_s00050p00224240        75.1    8e-14   
ref|XP_010529789.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    1e-13   
ref|XP_004307588.1|  PREDICTED: uncharacterized protein LOC101311041  74.7    1e-13   
ref|XP_003579713.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    1e-13   
ref|XP_003568670.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    1e-13   
ref|NP_001236334.1|  uncharacterized protein LOC100306273 precursor   74.7    2e-13   
ref|XP_009421327.1|  PREDICTED: uncharacterized protein LOC104000899  75.1    2e-13   
ref|XP_004975590.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
ref|XP_002281554.1|  PREDICTED: putative lipid-transfer protein DIR1  73.6    3e-13   Vitis vinifera
ref|XP_010321678.1|  PREDICTED: uncharacterized protein LOC101257668  73.6    3e-13   
ref|XP_004138444.1|  PREDICTED: uncharacterized protein LOC101209106  73.6    4e-13   
ref|XP_008233678.1|  PREDICTED: putative lipid-transfer protein DIR1  73.6    4e-13   
gb|KCW64435.1|  hypothetical protein EUGRSUZ_G02050                   73.2    4e-13   
ref|XP_002446446.1|  hypothetical protein SORBIDRAFT_06g016170        73.2    5e-13   Sorghum bicolor [broomcorn]
ref|XP_010068677.1|  PREDICTED: uncharacterized protein LOC104455611  73.2    5e-13   
gb|ABQ41972.1|  protease inhibitor/seed storage/lipid transfer pr...  72.8    6e-13   Sonneratia apetala
ref|XP_010553268.1|  PREDICTED: putative lipid-transfer protein DIR1  72.4    7e-13   
gb|ABQ41969.1|  protease inhibitor/seed storage/lipid transfer pr...  72.4    8e-13   Sonneratia alba
gb|ABQ41971.1|  protease inhibitor/seed storage/lipid transfer pr...  72.4    9e-13   Sonneratia ovata
ref|XP_010427061.1|  PREDICTED: putative lipid-transfer protein DIR1  72.0    1e-12   
ref|XP_010066526.1|  PREDICTED: uncharacterized protein LOC104453617  73.2    1e-12   
gb|ABQ41970.1|  protease inhibitor/seed storage/lipid transfer pr...  72.0    1e-12   Sonneratia caseolaris
ref|XP_010504186.1|  PREDICTED: putative lipid-transfer protein DIR1  71.6    1e-12   
ref|XP_010515910.1|  PREDICTED: putative lipid-transfer protein DIR1  71.6    1e-12   
ref|XP_006403632.1|  hypothetical protein EUTSA_v10010835mg           70.9    2e-12   
gb|EMT13746.1|  hypothetical protein F775_52528                       71.2    3e-12   
ref|XP_004302694.1|  PREDICTED: uncharacterized protein LOC101304...  70.9    3e-12   
ref|XP_010239887.1|  PREDICTED: non-specific lipid transfer prote...  70.1    5e-12   
ref|XP_009358795.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    6e-12   
gb|ACN28324.1|  unknown                                               69.7    7e-12   Zea mays [maize]
ref|XP_007010260.1|  Bifunctional inhibitor/lipid-transfer protei...  69.7    8e-12   
ref|XP_008233679.1|  PREDICTED: uncharacterized protein LOC103332713  68.6    2e-11   
ref|XP_006654200.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
emb|CAN84006.1|  hypothetical protein VITISV_033735                   68.6    4e-11   Vitis vinifera
ref|XP_002446445.1|  hypothetical protein SORBIDRAFT_06g016160        67.4    4e-11   Sorghum bicolor [broomcorn]
ref|XP_011000060.1|  PREDICTED: probable non-specific lipid-trans...  67.4    5e-11   
gb|ACS96447.1|  protease inhibitor/seed storage/lipid transfer pr...  67.0    6e-11   Jatropha curcas
ref|NP_001054721.1|  Os05g0160300                                     65.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009419915.1|  PREDICTED: uncharacterized protein LOC103999...  65.9    2e-10   
gb|KCW64434.1|  hypothetical protein EUGRSUZ_G02049                   65.9    2e-10   
gb|EEE55673.1|  hypothetical protein OsJ_04081                        65.5    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AFG58173.1|  hypothetical protein CL3835Contig1_02                 64.7    3e-10   
gb|AFG58172.1|  hypothetical protein CL3835Contig1_02                 64.3    3e-10   
gb|AFG58175.1|  hypothetical protein CL3835Contig1_02                 64.3    3e-10   
gb|AFG58174.1|  hypothetical protein CL3835Contig1_02                 64.3    4e-10   
ref|XP_007219063.1|  hypothetical protein PRUPE_ppa014695mg           64.7    4e-10   
ref|XP_004302693.1|  PREDICTED: uncharacterized protein LOC101304...  64.3    5e-10   
gb|ACS68664.1|  protease inhibitor/seed storage/lipid transfer pr...  64.3    5e-10   Sonneratia alba
emb|CAN78091.1|  hypothetical protein VITISV_021194                   64.3    6e-10   Vitis vinifera
dbj|BAJ93968.1|  predicted protein                                    63.9    8e-10   
ref|XP_004977979.1|  PREDICTED: uncharacterized protein LOC101756310  65.1    1e-09   
ref|XP_010037780.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|NP_001052761.1|  Os04g0415900                                     62.4    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EMT13747.1|  hypothetical protein F775_29623                       62.0    3e-09   
ref|XP_010327364.1|  PREDICTED: uncharacterized protein LOC104649594  62.4    3e-09   
gb|EEC77252.1|  hypothetical protein OsI_15839                        62.4    3e-09   Oryza sativa Indica Group [Indian rice]
gb|ABK23220.1|  unknown                                               62.4    4e-09   Picea sitchensis
gb|ACJ09611.1|  unknown                                               60.8    5e-09   Cupressus sempervirens
gb|EMS64438.1|  Rop guanine nucleotide exchange factor 1              65.1    7e-09   
ref|XP_009344102.1|  PREDICTED: uncharacterized protein LOC103935988  60.8    1e-08   
ref|XP_007219744.1|  hypothetical protein PRUPE_ppa024140mg           60.1    1e-08   
ref|XP_008372190.1|  PREDICTED: uncharacterized protein LOC103435578  59.7    2e-08   
gb|KDP24532.1|  hypothetical protein JCGZ_25096                       59.3    5e-08   
gb|EMS64378.1|  hypothetical protein TRIUR3_11133                     57.8    2e-07   
ref|XP_007009152.1|  Uncharacterized protein isoform 1                57.4    3e-07   
gb|ABB13624.1|  LTP-like protein 2                                    57.0    4e-07   Astragalus sinicus
ref|XP_010108369.1|  hypothetical protein L484_010376                 55.8    6e-07   
gb|EEC71805.1|  hypothetical protein OsI_04438                        54.3    7e-07   Oryza sativa Indica Group [Indian rice]
gb|EMT10440.1|  hypothetical protein F775_27055                       56.2    7e-07   
emb|CDY07566.1|  BnaC06g14980D                                        55.1    1e-06   
emb|CAH67591.1|  OSIGBa0092M08.3                                      55.5    1e-06   Oryza sativa [red rice]
gb|AFG46650.1|  hypothetical protein 0_4936_01                        53.9    2e-06   
gb|KDO57975.1|  hypothetical protein CISIN_1g043659mg                 53.9    3e-06   
gb|AFG62515.1|  hypothetical protein UMN_CL9Contig2_03                51.6    1e-05   
gb|KHN47443.1|  hypothetical protein glysoja_044055                   50.4    2e-05   
gb|AEW09373.1|  hypothetical protein UMN_CL9Contig2_03                50.1    4e-05   
gb|KHN07618.1|  hypothetical protein glysoja_019725                   50.4    5e-05   
gb|AFG62514.1|  hypothetical protein UMN_CL9Contig2_03                49.7    6e-05   
ref|XP_003552652.1|  PREDICTED: uncharacterized protein LOC100811611  50.1    7e-05   
ref|XP_001759809.1|  predicted protein                                49.7    1e-04   
ref|XP_006601974.1|  PREDICTED: uncharacterized protein LOC100779526  48.9    2e-04   
ref|NP_001239670.1|  uncharacterized protein LOC100785417 precursor   48.9    2e-04   
ref|XP_006429229.1|  hypothetical protein CICLE_v10013663mg           49.3    2e-04   
ref|XP_007050549.1|  Bifunctional inhibitor/lipid-transfer protei...  49.3    5e-04   
ref|XP_007050548.1|  Bifunctional inhibitor/lipid-transfer protei...  48.9    5e-04   
gb|KEH43852.1|  Lipid transfer protein                                48.5    5e-04   
emb|CAC84496.1|  hypothetical protein                                 46.2    6e-04   Pinus pinaster [cluster pine]
ref|XP_006601975.1|  PREDICTED: uncharacterized protein LOC100783288  47.4    7e-04   
gb|KHN07615.1|  hypothetical protein glysoja_019722                   47.4    7e-04   



>ref|XP_002521893.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF40529.1| lipid binding protein, putative [Ricinus communis]
Length=120

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -3

Query  608  NMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTC  429
            +M+  +AA +++LLAS   L D   A  CG+    +  AASL PCL A  + RA VPP C
Sbjct  4    SMRACFAAVLVFLLASNGFLSDVDAAGECGKTPIRSA-AASLSPCLTAVGNVRASVPPAC  62

Query  428  CGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            C KVGAL+KTAPKCLC VLLSPLAM+ G+ P IA+TIPKRC IKNRPVGKKCGRYT+P
Sbjct  63   CSKVGALIKTAPKCLCAVLLSPLAMQAGIKPGIAITIPKRCNIKNRPVGKKCGRYTVP  120



>emb|CDP05424.1| unnamed protein product [Coffea canephora]
Length=120

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = -3

Query  599  VSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGK  420
            +S    ++YL+AS A+ F +A+AAG       N  A SL PCLGAA++ARA+V P CCGK
Sbjct  7    ISIVTLLVYLVASHAI-FQQASAAGECGRTPINGAATSLSPCLGAARNARARVTPICCGK  65

Query  419  VGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            V AL++TAP+CLC VLLSPLA K G+NPA+A+TIPKRC I+NRP GKKCG YT+P
Sbjct  66   VNALIRTAPRCLCAVLLSPLAGKAGINPAVAITIPKRCNIRNRPAGKKCGPYTVP  120



>ref|XP_008220967.1| PREDICTED: non-specific lipid-transfer protein 4 [Prunus mume]
Length=116

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -3

Query  605  MKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCC  426
            MK       ++L+AS+A  F++  AAG          AASL PCL +A++ RAKVPPTCC
Sbjct  1    MKGCLVCVFVFLVASRA-FFEEVGAAGECGKTPIRSAAASLSPCLSSARNVRAKVPPTCC  59

Query  425  GKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             KVGAL++TAPKCLC VLLSPLA + G+NPAIA+TIPKRC I+NRP GKKCGRY +P
Sbjct  60   TKVGALIRTAPKCLCAVLLSPLAKQAGINPAIAITIPKRCKIRNRPAGKKCGRYVVP  116



>gb|KEH20240.1| Lipid transfer protein [Medicago truncatula]
Length=120

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = -3

Query  611  FNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPT  432
            F ++   A  V++LLAS   + +   A  CG+   G+  AASL PCLGA ++ RAKVPP 
Sbjct  3    FKVRTFLATVVMFLLASSVFILESEAAGECGRTPIGSA-AASLSPCLGAVRNVRAKVPPV  61

Query  431  CCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            CC +VGALL+T+P+CLC VLLSPLA +  +NPAIA+T+PKRC I+NRP GKKCGRYT+P
Sbjct  62   CCARVGALLRTSPRCLCSVLLSPLAKQAKINPAIAITVPKRCNIRNRPAGKKCGRYTLP  120



>gb|AFK35164.1| unknown [Medicago truncatula]
Length=120

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -3

Query  611  FNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPT  432
            F ++   A  V++LLAS   + +      CG+   G+  AASL PCLGA ++ RAKVPP 
Sbjct  3    FKVRTFLATVVMFLLASSVFILESEAVGECGRTPIGSA-AASLSPCLGAVRNVRAKVPPV  61

Query  431  CCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            CC +VGALL+T+P+CLC VLLSPLA +  +NPAIA+T+PKRC I+NRP GKKCGRYT+P
Sbjct  62   CCARVGALLRTSPRCLCSVLLSPLAKQAKINPAIAITVPKRCNIRNRPAGKKCGRYTLP  120



>ref|XP_009777451.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=120

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -3

Query  497  PAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
            PAASL PCLGAAK+ R KVPP CCGK+GALLKT+PKCLC  LLSP A   GVNPAIAVTI
Sbjct  40   PAASLIPCLGAAKNGRTKVPPACCGKIGALLKTSPKCLCAALLSPAAKNAGVNPAIAVTI  99

Query  317  PKRCIIKNRPVGKKCGRYTIP  255
            PKRC IKNRPVGK+CGRY +P
Sbjct  100  PKRCNIKNRPVGKRCGRYVVP  120



>gb|KDP38197.1| hypothetical protein JCGZ_04840 [Jatropha curcas]
Length=121

 Score =   129 bits (324),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = -3

Query  620  MTLFNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKV  441
            M  +NM+   A F+  L+AS A + D   A  CG+    +  A SL PCL AA +A+A V
Sbjct  1    MVTYNMRDCLATFLALLIASNAFIGDVNAAGECGKTPIRSA-AISLNPCLLAAGNAKASV  59

Query  440  PPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYT  261
            PP CC KVGAL+ TAPKCLC ++LSPLA + G+NP IA+TIPKRC IKNRP GKKCGRYT
Sbjct  60   PPACCSKVGALINTAPKCLCAIILSPLAKQSGINPGIAITIPKRCNIKNRPAGKKCGRYT  119

Query  260  IP  255
            +P
Sbjct  120  VP  121



>ref|NP_001238490.1| uncharacterized protein LOC100500207 precursor [Glycine max]
 gb|ACU15200.1| unknown [Glycine max]
 gb|KHN17392.1| hypothetical protein glysoja_049069 [Glycine soja]
Length=123

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -3

Query  608  NMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTC  429
            N +    AF+++LLAS+ VL  +A  AG          AASL PCLGA  + RAKVP  C
Sbjct  7    NGRALLVAFLMFLLASE-VLILEAEGAGECGKTPIGSAAASLSPCLGAVSNVRAKVPLAC  65

Query  428  CGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            C +VGALLKTAP+CLC VLLSPLA +  +NPA A+TIPKRC I+NRP GKKCGRYT+P
Sbjct  66   CARVGALLKTAPRCLCAVLLSPLAKQAKINPATAITIPKRCNIRNRPAGKKCGRYTVP  123



>ref|XP_010041160.1| PREDICTED: non-specific lipid-transfer protein 4-like [Eucalyptus 
grandis]
 gb|KCW44580.1| hypothetical protein EUGRSUZ_L01908 [Eucalyptus grandis]
Length=123

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAAK+ARAKVPPTCC KV AL++T+P+CLC VLLSPLA + G+ PA A++IP
Sbjct  44   AASLSPCLGAAKNARAKVPPTCCAKVNALIRTSPRCLCAVLLSPLAKQAGIMPATAISIP  103

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GKKCGRYT+P
Sbjct  104  KRCNIRNRPAGKKCGRYTVP  123



>ref|XP_003530550.2| PREDICTED: lipid transfer-like protein VAS-like [Glycine max]
Length=125

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = -3

Query  620  MTLFNMK---VSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDAR  450
            M + +MK   +   A +++LLAS+ ++ +   A G          AASL PCLGA  + +
Sbjct  1    MMMRDMKGRVLFLVALLMFLLASEVLILEAEGAGGECGKTPIGSAAASLSPCLGAVSNVK  60

Query  449  AKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCG  270
            AKVP  CC +VGALLKTAP+CLC VLLSPLA +  +NPA A+TIPKRC I+NRP GKKCG
Sbjct  61   AKVPLACCARVGALLKTAPRCLCAVLLSPLAKQAKINPATAITIPKRCNIRNRPAGKKCG  120

Query  269  RYTIP  255
            RYT+P
Sbjct  121  RYTLP  125



>ref|XP_011024956.1| PREDICTED: non-specific lipid-transfer protein 4-like [Populus 
euphratica]
Length=136

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = -3

Query  641  P*TLLETMTLFNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAA  462
            P + +ETM+  NM+      +  L+AS   + D   A  CG+    +  AASL PCL AA
Sbjct  10   PSSRIETMS-SNMRAWVVVMLACLVASNVFICDVNAAGECGKTPIRSA-AASLSPCLSAA  67

Query  461  KDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVG  282
             + RA VPPTCC KVG+L+KTAPKCLC VLLSPLA + G+ P IA+TIPKRC I NRP G
Sbjct  68   GNVRAAVPPTCCSKVGSLIKTAPKCLCAVLLSPLAKQAGIKPGIAITIPKRCNIGNRPAG  127

Query  281  KKCGRYTIP  255
            KKCGRYT+P
Sbjct  128  KKCGRYTLP  136



>gb|KHN37154.1| hypothetical protein glysoja_038774 [Glycine soja]
Length=120

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -3

Query  587  AFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            A +++LLAS+ ++ +   A G          AASL PCLGA  + +AKVP  CC +VGAL
Sbjct  10   ALLMFLLASEVLILEAEGAGGECGKTPIGSAAASLSPCLGAVSNVKAKVPLACCARVGAL  69

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            LKTAP+CLC VLLSPLA +  +NPA A+TIPKRC I+NRP GKKCGRYT+P
Sbjct  70   LKTAPRCLCAVLLSPLAKQAKINPATAITIPKRCNIRNRPAGKKCGRYTLP  120



>ref|XP_009351616.1| PREDICTED: non-specific lipid-transfer protein 4 [Pyrus x bretschneideri]
Length=116

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = -3

Query  605  MKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCC  426
            MK    +  L+LLA+  V  ++  AAG       +  A SL PCL AA++ RAKVPP CC
Sbjct  1    MKAFIVSVFLFLLATN-VFVEEVVAAGECGKTPISSAATSLSPCLSAARNVRAKVPPLCC  59

Query  425  GKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             KVGAL+KT PKCLC VLLSPLA + G+NPAIA+TI KRC I+ RPVGKKCGRY +P
Sbjct  60   TKVGALIKTTPKCLCAVLLSPLAKQAGINPAIAITIAKRCNIRKRPVGKKCGRYVVP  116



>ref|XP_004297800.1| PREDICTED: non-specific lipid-transfer protein 4-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=121

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = -3

Query  587  AFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            AFV +L+A+Q  L ++  AAG          A SL PCL AA++ARAKVPP CC KVGAL
Sbjct  13   AFV-FLVATQ-FLVEEVGAAGECGKTPIRTAATSLSPCLSAARNARAKVPPACCTKVGAL  70

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            +KTAPKCLC VLLSPLA + G+NPAIA+ IPK+C I+NRP GKKCGRY +P
Sbjct  71   IKTAPKCLCAVLLSPLAKQAGINPAIAIAIPKKCNIRNRPAGKKCGRYVVP  121



>ref|XP_002281828.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2 
[Vitis vinifera]
 emb|CBI26757.3| unnamed protein product [Vitis vinifera]
Length=120

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = -3

Query  608  NMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTC  429
            NM   +AA +  +L SQA    +AN AG          AASL  CL AA +A+AKVPPTC
Sbjct  4    NMPTCFAAVMALMLVSQA-FVQEANGAGECGKTPIQSAAASLSSCLSAAGNAKAKVPPTC  62

Query  428  CGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            C KV AL+ TAPKCLC V+LSPLA K G+ PAIA+TIPKRC IKNRPVGKKCG Y IP
Sbjct  63   CTKVTALINTAPKCLCAVVLSPLAKKAGIKPAIAITIPKRCNIKNRPVGKKCGSYIIP  120



>ref|XP_010066527.1| PREDICTED: non-specific lipid-transfer protein 4-like [Eucalyptus 
grandis]
 gb|KCW64439.1| hypothetical protein EUGRSUZ_G02055 [Eucalyptus grandis]
Length=123

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAAK+ARAKVPP CC KV AL++T+P+CLC VLLSPLA + G+ PA A++IP
Sbjct  44   AASLSPCLGAAKNARAKVPPACCAKVNALIRTSPRCLCAVLLSPLAKQAGIMPATAISIP  103

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GKKCGRYT+P
Sbjct  104  KRCNIRNRPAGKKCGRYTVP  123



>ref|XP_004509596.1| PREDICTED: uncharacterized protein LOC101514838 [Cicer arietinum]
Length=122

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -3

Query  611  FNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPT  432
            F +K   A  +++LLAS+ ++ +   A  CG+   G+  AASL PCL A ++ RAKV   
Sbjct  5    FKIKTFIATVLIFLLASRVMILEADGAGECGKTPIGS-AAASLSPCLDATRNVRAKVSSA  63

Query  431  CCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            CCG+VGALL T+PKCLC VLLSPLA +  +NPAIA+T+PKRC I+NRP GKKCG+YT+P
Sbjct  64   CCGRVGALLTTSPKCLCAVLLSPLAKQAKINPAIAITVPKRCNIRNRPAGKKCGKYTLP  122



>ref|XP_010043902.1| PREDICTED: non-specific lipid-transfer protein 4.1-like [Eucalyptus 
grandis]
 gb|KCW85922.1| hypothetical protein EUGRSUZ_B02633 [Eucalyptus grandis]
Length=122

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -3

Query  584  FVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGALL  405
             VL+L++S A L  +A AAG       +  AASL PCL AA +A+AKVPP CC KVGAL+
Sbjct  14   LVLFLVSSMASL-QEAVAAGECGKTPISTAAASLSPCLSAAGNAKAKVPPACCTKVGALI  72

Query  404  KTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             TAPKCLC VLLSPLA + G+N  IA+TIPKRC IK RPVGKKCGRYT+P
Sbjct  73   TTAPKCLCAVLLSPLAKQAGINLGIAITIPKRCNIKKRPVGKKCGRYTLP  122



>gb|AFK49597.1| unknown [Lotus japonicus]
Length=120

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 1/119 (1%)
 Frame = -3

Query  611  FNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPT  432
            F ++      +++LLAS  ++ +   A  CG+   G+  AASL PCL A ++ RAKVPP 
Sbjct  3    FKVRTFLTTILMFLLASNILILESEAAGECGRTPIGS-AAASLSPCLAATRNVRAKVPPA  61

Query  431  CCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            CC +VGALL+T+P+CLC VLLSPLA +  +N  IA+TIPKRC I+NRP GKKCGRYT+P
Sbjct  62   CCARVGALLRTSPRCLCAVLLSPLAKQAKINLGIAITIPKRCNIRNRPAGKKCGRYTLP  120



>ref|XP_002314750.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEF00921.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=120

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAA +ARA VPP CC KV AL+KTAPKCLC VLLSPLA + G+ P IA+TIP
Sbjct  41   AASLSPCLGAAGNARAAVPPACCSKVTALIKTAPKCLCAVLLSPLAKQAGIKPGIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC IKNR  GKKCG+YT+P
Sbjct  101  KRCSIKNRQAGKKCGKYTLP  120



>ref|XP_006492279.1| PREDICTED: non-specific lipid-transfer protein 4-like [Citrus 
sinensis]
 gb|KDO41166.1| hypothetical protein CISIN_1g033404mg [Citrus sinensis]
Length=120

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = -3

Query  620  MTLFNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKV  441
            M   +MK  + A  ++LL S+  L ++ +AAG          AASL PCLGAA++ RAK 
Sbjct  1    MVNSSMKTCFVALFVFLLVSE-TLIEETDAAGECGRTPIRSAAASLTPCLGAARNGRAKP  59

Query  440  PPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYT  261
            PP CC K+GAL++TAP+CLC VLLSPLA + G+ PAIA++IPKRC ++ RPVGKKC RYT
Sbjct  60   PPICCSKLGALIRTAPRCLCAVLLSPLAKQAGIKPAIAISIPKRCNLR-RPVGKKCERYT  118

Query  260  IP  255
            IP
Sbjct  119  IP  120



>ref|XP_002312490.2| hypothetical protein POPTR_0008s14060g [Populus trichocarpa]
 gb|EEE89857.2| hypothetical protein POPTR_0008s14060g [Populus trichocarpa]
Length=120

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL AA + RA VPPTCC KVG+L+KTAPKCLC VLLSPLA + G+ P IA+TIP
Sbjct  41   AASLSPCLSAAGNVRAAVPPTCCSKVGSLIKTAPKCLCAVLLSPLAKQAGIKPGIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP GKKCGRYT+P
Sbjct  101  KRCNIGNRPAGKKCGRYTLP  120



>gb|KHG18737.1| Non-specific lipid-transfer 4 -like protein [Gossypium arboreum]
Length=121

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAA++ARAKVPP CC KVGALL+T+P+CLC +LLSPLA + G+ P IA+ IP
Sbjct  42   AASLSPCLGAARNARAKVPPACCAKVGALLRTSPRCLCAILLSPLAKQAGIMPGIAIAIP  101

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            K+C I+NR  GKKCGRYT+P
Sbjct  102  KKCNIRNRQAGKKCGRYTVP  121



>ref|XP_008340543.1| PREDICTED: lipid transfer-like protein VAS [Malus domestica]
Length=116

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -3

Query  605  MKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCC  426
            MK    +  L+LLA+  V  ++  AAG          A SL PCL AA+D RAKVP  CC
Sbjct  1    MKAFIVSVFLFLLATN-VFVEEVVAAGECGKTPIRSAATSLSPCLSAARDVRAKVPQLCC  59

Query  425  GKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             KVGAL+KT PKCLC VLLSPLA + G+NPA A+TI KRC I+ RP GKKCGRY +P
Sbjct  60   TKVGALIKTTPKCLCAVLLSPLAKQAGINPATAITIAKRCNIRKRPAGKKCGRYVVP  116



>ref|XP_010680101.1| PREDICTED: uncharacterized protein LOC104895329 [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = -3

Query  605  MKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCC  426
            M+  + A + ++L S A L+ K NAAG           AS+  CL AA++ RA+V P CC
Sbjct  1    MRAIHIAILCFMLTSNA-LYKKGNAAGECGRTPIPSATASMTACLAAARNVRARVSPPCC  59

Query  425  GKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             KV AL+KTAP+CLC VLLSPLA + G+NP IA+TI KRC IKNRP+GKKCGRYT+P
Sbjct  60   SKVAALIKTAPRCLCAVLLSPLARQAGINPGIAITIAKRCSIKNRPIGKKCGRYTVP  116



>ref|XP_006368104.1| PREDICTED: lipid transfer-like protein VAS-like, partial [Solanum 
tuberosum]
Length=117

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  497  PAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
            PAASL PCLGAAK A+AKVPP CCGKVGALLKT+PKCLC  +LSP+A   G NP +AVTI
Sbjct  42   PAASLVPCLGAAKIAKAKVPPICCGKVGALLKTSPKCLCAAILSPIAKNAGANPTVAVTI  101

Query  317  PKRCIIKNRPVGKKCG  270
            PKRC IKNRP+GKKCG
Sbjct  102  PKRCNIKNRPIGKKCG  117



>ref|XP_011021704.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=120

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAA +ARA VPP CC KV AL+KT PKCLC VLLSP A + G+ P IA+TIP
Sbjct  41   AASLSPCLGAAGNARAAVPPACCSKVAALIKTTPKCLCAVLLSPSAKQAGIKPGIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC IKNR  GKKCG+YTIP
Sbjct  101  KRCSIKNRQAGKKCGKYTIP  120



>gb|AFH57276.1| lipid transfer protein [Gossypium hirsutum]
Length=121

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAA++ARAKVPP CC KVGALL+T+P+CLC +LLSPLA + G+ P IA+ IP
Sbjct  42   AASLSPCLGAARNARAKVPPACCVKVGALLRTSPRCLCAILLSPLAKQAGIMPGIAIAIP  101

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            K+C I+NR  GKKCGRYT+P
Sbjct  102  KKCNIRNRQAGKKCGRYTVP  121



>ref|XP_004297799.1| PREDICTED: non-specific lipid-transfer protein 4-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=125

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = -3

Query  587  AFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            AFV +L+A+Q  L ++  AAG          A SL PCL AA++ARAKVPP CC KVGAL
Sbjct  13   AFV-FLVATQ-FLVEEVGAAGECGKTPIRTAATSLSPCLSAARNARAKVPPACCTKVGAL  70

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCG  270
            +KTAPKCLC VLLSPLA + G+NPAIA+ IPK+C I+NRP GKKCG
Sbjct  71   IKTAPKCLCAVLLSPLAKQAGINPAIAIAIPKKCNIRNRPAGKKCG  116



>ref|XP_006410985.1| hypothetical protein EUTSA_v10017444mg [Eutrema salsugineum]
 gb|ESQ52438.1| hypothetical protein EUTSA_v10017444mg [Eutrema salsugineum]
Length=115

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = -3

Query  584  FVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGALL  405
            FV   L S  + F    AAG          AASL PCL A K+ R KVPP CC KVGAL+
Sbjct  6    FVTVALMSLVITFASIEAAGECGRMPIGQAAASLSPCLPATKNPRGKVPPVCCAKVGALI  65

Query  404  KTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            +T P+CLC V+LSPLA K G+NP IA+ +PKRC I+NRP GK+CGRY +P
Sbjct  66   RTNPRCLCAVMLSPLAKKAGINPGIAIAVPKRCNIRNRPAGKRCGRYIVP  115



>ref|XP_009143445.1| PREDICTED: non-specific lipid-transfer protein 1 [Brassica rapa]
Length=115

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA K G+NP +A+ IP
Sbjct  36   AASLSPCLAATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKKAGINPGVAIAIP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GK+CGRY +P
Sbjct  96   KRCNIRNRPSGKRCGRYIVP  115



>gb|KEH20238.1| Lipid transfer protein [Medicago truncatula]
Length=113

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = -3

Query  611  FNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPT  432
            F ++   A  V++LLAS   + +      CG+   G+  AASL PCLGA ++ RAKVPP 
Sbjct  3    FKVRTFLATVVMFLLASSVFILESEAGGECGRTPIGSA-AASLSPCLGAVRNVRAKVPPV  61

Query  431  CCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKK  276
            CC +VGALL+T+P+CLC VLLSPLA +  +NPAIA+T+PKRC I+NRP GKK
Sbjct  62   CCARVGALLRTSPRCLCSVLLSPLAKQAKINPAIAITVPKRCNIRNRPAGKK  113



>ref|XP_006448051.1| hypothetical protein CICLE_v10018228mg [Citrus clementina]
 gb|ESR61291.1| hypothetical protein CICLE_v10018228mg [Citrus clementina]
Length=148

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 91/136 (67%), Gaps = 4/136 (3%)
 Frame = -3

Query  620  MTLFNMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKV  441
            M   +MK  + A  ++LL S+  L ++ +AAG          AASL PCLGAA++ RAK 
Sbjct  1    MVNSSMKTCFVALFVFLLVSE-TLIEETDAAGECGRTPIRSAAASLTPCLGAARNGRAKP  59

Query  440  PPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGR--  267
            PP CC K+GAL++TAP+CLC VLLSPLA + G+ PAIA++IPKRC ++ RPVGKKCG+  
Sbjct  60   PPICCSKLGALIRTAPRCLCAVLLSPLAKQAGIKPAIAISIPKRCNLR-RPVGKKCGKHA  118

Query  266  YTIP*EDIVTRHYLQV  219
            Y  P   ++ R   QV
Sbjct  119  YEQPNLHLILRDCDQV  134



>ref|XP_007045399.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY01231.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=215

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAA +A+AKVPP CC KV ALLKT PKCLC +LLSPLA + G+ P IA+ IP
Sbjct  136  AASLSPCLGAAGNAKAKVPPACCSKVAALLKTTPKCLCAILLSPLAKQAGIKPGIAIGIP  195

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NR  GKKCG YT+P
Sbjct  196  KRCNIRNRQAGKKCGSYTVP  215



>ref|NP_565872.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAK96826.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL66904.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09460.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=115

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA K G+NP IA+ +P
Sbjct  36   AASLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKKAGINPGIAIGVP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GK+CGRY +P
Sbjct  96   KRCNIRNRPAGKRCGRYIVP  115



>ref|XP_002879712.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55971.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=115

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA K G+NP IA+ +P
Sbjct  36   AASLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKKAGINPGIAIGVP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GK+CGRY +P
Sbjct  96   KRCNIRNRPAGKRCGRYIVP  115



>gb|KHG13426.1| Non-specific lipid-transfer 4 -like protein [Gossypium arboreum]
Length=121

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A SL PCLGAA +A+AKVPP CC KVGALLK +P+CLC +LLSPLA + G+ P IA+ IP
Sbjct  42   AVSLSPCLGAAGNAKAKVPPACCSKVGALLKASPRCLCAILLSPLAKQAGIKPGIAIGIP  101

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NR  GKKCG YT+P
Sbjct  102  KRCNIRNRQAGKKCGSYTVP  121



>gb|KFK36683.1| hypothetical protein AALP_AA4G156000 [Arabis alpina]
Length=115

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC K+GAL++T P+CLC V+LSPLA + G+NP IA+ +P
Sbjct  36   AASLSPCLPATKNPRGKVPPVCCAKIGALIRTNPRCLCAVMLSPLAKQAGINPGIAIAVP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GK+CGRY +P
Sbjct  96   KRCNIRNRPAGKRCGRYIVP  115



>ref|XP_006295228.1| hypothetical protein CARUB_v10024313mg, partial [Capsella rubella]
 gb|EOA28126.1| hypothetical protein CARUB_v10024313mg, partial [Capsella rubella]
Length=130

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA + G+NP IA+ +P
Sbjct  51   AASLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKRAGINPGIAIGVP  110

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NR  GK+CGRYT+P
Sbjct  111  KRCNIRNRQAGKRCGRYTVP  130



>ref|XP_007226549.1| hypothetical protein PRUPE_ppa024837mg [Prunus persica]
 gb|EMJ27748.1| hypothetical protein PRUPE_ppa024837mg [Prunus persica]
Length=371

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = -3

Query  578  LYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGALLKT  399
            ++L+AS+A  F++  AAG          A SL PCL +A++ RAKVPPTCC KVGAL+ T
Sbjct  10   VFLVASRA-FFEEVGAAGECGKTPIRSAATSLSPCLSSARNVRAKVPPTCCTKVGALIST  68

Query  398  APKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCG  270
            APKCLC VLLSPLA + G+NPAIA+TIPKRC IKNR  GKKCG
Sbjct  69   APKCLCAVLLSPLAKQAGINPAIAITIPKRCKIKNRRAGKKCG  111



>ref|XP_008466820.1| PREDICTED: protein YLS3 [Cucumis melo]
Length=121

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PCLGA +D +AKV   CC KVGA+  ++PKCLC +LLSPLA + G+NP IA+TIP
Sbjct  42   AMGLTPCLGAVRDVKAKVTGACCNKVGAMFNSSPKCLCAILLSPLAKQAGINPGIAITIP  101

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GKKCG+YT+P
Sbjct  102  KRCNIRNRPRGKKCGKYTLP  121



>ref|XP_004151148.1| PREDICTED: uncharacterized protein LOC101207781 [Cucumis sativus]
 ref|XP_004170364.1| PREDICTED: uncharacterized protein LOC101231501 [Cucumis sativus]
 gb|KGN49748.1| hypothetical protein Csa_5G099500 [Cucumis sativus]
Length=120

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PCLGA +D +AKV   CC KVGA+  ++PKCLC +LLSPLA + G+NP IA+TIP
Sbjct  41   AMGLTPCLGAVRDVKAKVTGACCSKVGAMFNSSPKCLCAILLSPLAKQAGINPGIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GKKCG+YT+P
Sbjct  101  KRCNIRNRPKGKKCGKYTLP  120



>emb|CDX93346.1| BnaC04g45500D [Brassica napus]
Length=115

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA   G+NP +A+ IP
Sbjct  36   AASLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVVLSPLAKNAGINPGVAIAIP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRP GK+CGRY +P
Sbjct  96   KRCNIRNRPAGKRCGRYIVP  115



>emb|CAN60832.1| hypothetical protein VITISV_004738 [Vitis vinifera]
Length=441

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = -3

Query  608  NMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTC  429
            NM   +AA +  +L SQA +  +AN AG          AASL  CL AA +A+AKVPPTC
Sbjct  4    NMPTCFAAVMALMLVSQAFV-QEANGAGECGKTPIQSAAASLSSCLSAAGNAKAKVPPTC  62

Query  428  CGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCG  270
            C KV AL+ TAPKCLC V+LSPLA K G+ PAIA+TIPKRC IKNRPVGKKCG
Sbjct  63   CTKVTALINTAPKCLCAVVLSPLAKKAGIKPAIAITIPKRCNIKNRPVGKKCG  115



>ref|XP_010509268.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=115

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A ++ R+KVPP CC KVGAL++T P+CLC V+LSPLA + G+NP IA+ +P
Sbjct  36   AASLSPCLPATQNPRSKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKRAGINPGIAIGVP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NR  GK+CGRY +P
Sbjct  96   KRCNIRNRQAGKRCGRYIVP  115



>emb|CDX91388.1| BnaC04g07620D [Brassica napus]
Length=116

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA K G+NP +A+ IP
Sbjct  36   AASLSPCLAATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKKAGINPGVAIAIP  95

Query  314  KRCIIKNRPVGKKCGRYTI  258
            KRC I+NRP GK+CGR  +
Sbjct  96   KRCNIRNRPSGKRCGRMDL  114



>emb|CDX74929.1| BnaA05g06750D [Brassica napus]
Length=116

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA K G+NP +A+ IP
Sbjct  36   AASLSPCLAATKNPRGKVPPVCCAKVGALVRTNPRCLCAVMLSPLAKKAGINPGVAIAIP  95

Query  314  KRCIIKNRPVGKKCGRYTI  258
            KRC I+NRP GK+CGR  +
Sbjct  96   KRCNIRNRPSGKRCGRMDL  114



>ref|XP_007156387.1| hypothetical protein PHAVU_003G282100g [Phaseolus vulgaris]
 gb|ESW28381.1| hypothetical protein PHAVU_003G282100g [Phaseolus vulgaris]
Length=119

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A  + +AKVP  CC +VGALL+T PKCLC VLLSPLA +  +N A A+TIP
Sbjct  40   AASLSPCLSAVSNVKAKVPLACCSRVGALLRTTPKCLCAVLLSPLAKQAKINVATAITIP  99

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP GKKCG+YT+P
Sbjct  100  KRCNINNRPAGKKCGKYTLP  119



>emb|CDY18422.1| BnaA04g21650D [Brassica napus]
Length=126

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A K+ R KVPP CC KVGAL++T P+CLC V+LSPLA   G+NP +A+ IP
Sbjct  36   AASLSPCLAATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKNAGINPGVAIAIP  95

Query  314  KRCIIKNRPVGKKCGRYTIP*EDIVTRHY  228
            KRC I+NRP GK+CGR       +++  Y
Sbjct  96   KRCNIRNRPAGKRCGRMDSILLSLISNVY  124



>ref|XP_010505385.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=115

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A ++ R+KVPP CC KVGAL++T P CLC V+LSPLA + G+NP IA+ +P
Sbjct  36   AASLTPCLPATQNPRSKVPPVCCAKVGALIRTNPSCLCAVMLSPLAKRAGINPGIAIGVP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            +RC I+NR  GK+CGRY +P
Sbjct  96   RRCNIRNRQAGKRCGRYIVP  115



>ref|XP_010105521.1| hypothetical protein L484_019263 [Morus notabilis]
 gb|EXC05016.1| hypothetical protein L484_019263 [Morus notabilis]
Length=120

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL AA +A+AKVPP CC KVGAL+KT P+CLC VLLSPLA +VG+  AIA+TIP
Sbjct  39   AASLSPCLSAAGNAKAKVPPACCAKVGALIKTVPRCLCAVLLSPLAKQVGIKVAIAITIP  98

Query  314  KRCIIKNRPVGKKCG  270
            KRC I+NR  GKKCG
Sbjct  99   KRCNIRNRQAGKKCG  113



>ref|XP_010517065.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=115

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCL A ++ R+KVPP CC KV AL++T P+CLC V+LSPLA + G+NP IA+ +P
Sbjct  36   AASLTPCLPATQNPRSKVPPVCCAKVSALIRTNPRCLCAVMLSPLAKRAGINPGIAIGVP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NR  GK+CGRY +P
Sbjct  96   KRCNIRNRQAGKRCGRYIVP  115



>gb|KCW64440.1| hypothetical protein EUGRSUZ_G02057, partial [Eucalyptus grandis]
Length=102

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAAKDARAKVPP CC +V AL+ T+P+C C VLLSPLA + G+ PA A++IP
Sbjct  28   AASLSPCLGAAKDARAKVPPACCTRVNALIGTSPRCFCAVLLSPLAKQAGIMPATAISIP  87

Query  314  KRCIIKNRPVGKKCG  270
            KRC +KN P GKKCG
Sbjct  88   KRCNLKNGPAGKKCG  102



>ref|XP_010276272.1| PREDICTED: non-specific lipid-transfer protein 4.1 [Nelumbo nucifera]
Length=145

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PC  A +   A VPP CC KV AL K +PKCLC VLLSPL  + G+N  IA+TIP
Sbjct  66   AASLSPCATATQSKTAMVPPACCSKVSALFKISPKCLCAVLLSPLVKQAGINLGIAITIP  125

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I+NRPVGKKCG YT+P
Sbjct  126  KRCNIRNRPVGKKCGSYTLP  145



>ref|XP_010530425.1| PREDICTED: non-specific lipid-transfer protein 3 [Tarenaya hassleriana]
Length=110

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  473  LGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKN  294
            L A+K  RAKVPP+CC KV AL++T P+CLC V+LSPLA + G+NPAIA+ IPKRC I+N
Sbjct  38   LAASKTPRAKVPPSCCAKVTALIRTNPRCLCAVMLSPLAARAGINPAIAIGIPKRCSIRN  97

Query  293  RPVGKKCGRYTIP  255
            RP GK+CGRY +P
Sbjct  98   RPAGKRCGRYVVP  110



>ref|XP_010068681.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
[Eucalyptus grandis]
Length=228

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AASL PCLGAAKDARAKVPP CC +V AL+ T+P+C C VLLSPLA + G+ PA A++IP
Sbjct  44   AASLSPCLGAAKDARAKVPPACCTRVNALIGTSPRCFCAVLLSPLAKQAGIMPATAISIP  103

Query  314  KRCIIKNRPVGKKCG  270
            KRC +KN P GKKCG
Sbjct  104  KRCNLKNGPAGKKCG  118



>ref|XP_006849508.1| hypothetical protein AMTR_s00024p00140200 [Amborella trichopoda]
 gb|ERN11089.1| hypothetical protein AMTR_s00024p00140200 [Amborella trichopoda]
Length=131

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AAS+  CL AAK A AKVPP CC +V A++K++P CLC V LSPL    GVNPA+AV+IP
Sbjct  42   AASMSSCLVAAKSATAKVPPACCARVTAMIKSSPACLCAVFLSPLVKNAGVNPAVAVSIP  101

Query  314  KRCIIKNRPVGKKCG  270
            KRC IKNRP G KCG
Sbjct  102  KRCNIKNRPAGHKCG  116



>gb|ABR16461.1| unknown [Picea sitchensis]
 gb|ABR16653.1| unknown [Picea sitchensis]
 gb|ABR16953.1| unknown [Picea sitchensis]
 gb|ACN40766.1| unknown [Picea sitchensis]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A S+ PC+GAA +A+  VPP CC +V  +L   PKC+C V LSP+A + G+NPA+A+TIP
Sbjct  38   ALSMSPCIGAANNAKVSVPPACCTQVKKVLAM-PKCMCAVFLSPIAKQAGINPAVAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NR  GKKCG Y +P
Sbjct  97   KRCKIANRSAGKKCGSYIVP  116



>gb|ABK20923.1| unknown [Picea sitchensis]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A S+ PC+GAA +A+  VPP CC +V  +L   PKC+C V LSP+A + G+NPA+A+TIP
Sbjct  38   ALSMSPCIGAANNAKVSVPPACCTQVKKVLAM-PKCMCAVFLSPIAKQAGINPAVAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NR  GKKCG Y +P
Sbjct  97   KRCKIANRSAGKKCGSYIVP  116



>gb|ABK24954.1| unknown [Picea sitchensis]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A S+ PC+GAA +A+  VPP CC +V  +L   PKC+C V LSP+A + G+NPA+A+TIP
Sbjct  38   ALSMSPCIGAANNAKVSVPPACCTQVRKVLAM-PKCMCAVFLSPIAKQAGINPAVAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NR  GKKCG Y +P
Sbjct  97   KRCKIANRSAGKKCGSYIVP  116



>gb|ABK25641.1| unknown [Picea sitchensis]
Length=116

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A SL PC+GAA +A+A VPP CC +V   L   P CLC V LSP+A + G+NPA+AV+IP
Sbjct  38   ALSLSPCIGAANNAKASVPPACCTQVRKTLAM-PACLCAVFLSPIAKQAGINPAVAVSIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NR  GKKCG Y +P
Sbjct  97   KRCKIANRSAGKKCGSYIVP  116



>ref|XP_004970576.1| PREDICTED: non-specific lipid-transfer protein-like [Setaria 
italica]
Length=118

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ RA+VPP+CC +V A+ +  PKCLC V+LS  A K GV PA+A+TIP
Sbjct  40   ALKLAPCAAATQNPRARVPPSCCAQVRAIGRN-PKCLCAVMLSDTARKAGVKPAVAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCAIANRPVGYKCGPYTLP  118



>ref|XP_002458765.1| hypothetical protein SORBIDRAFT_03g039880 [Sorghum bicolor]
 gb|EES03885.1| hypothetical protein SORBIDRAFT_03g039880 [Sorghum bicolor]
Length=118

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ RA VPP+CC +V A+ ++ PKCLC V+LS  A K GV PA+A+TIP
Sbjct  40   ALKLAPCAAATQNPRAAVPPSCCAQVRAIGRS-PKCLCAVMLSDTARKAGVKPAVAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCAIANRPVGYKCGPYTLP  118



>ref|NP_001150159.1| LOC100283788 precursor [Zea mays]
 gb|ACG38078.1| lipid binding protein [Zea mays]
 tpg|DAA56831.1| TPA: lipid binding protein isoform 1 [Zea mays]
 tpg|DAA56832.1| TPA: lipid binding protein isoform 2 [Zea mays]
Length=118

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ RA VPP+CC +V A+ +  PKCLC V+LS  A K GV PA+A+TIP
Sbjct  40   ALKLAPCAAATQNPRAAVPPSCCAQVRAIGRV-PKCLCAVMLSDTARKAGVKPAVAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCAIANRPVGYKCGPYTLP  118



>dbj|BAJ88730.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=116

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ R+KV P CC ++ ++ ++ PKCLC V+LS  A + GVNPA+A+TIP
Sbjct  38   ALKLAPCAAATQNPRSKVAPGCCAQIRSIGRS-PKCLCAVMLSSTARQAGVNPAVAMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  97   KRCAIANRPVGYKCGPYTLP  116



>ref|XP_009139277.1| PREDICTED: putative lipid-transfer protein DIR1 [Brassica rapa]
Length=114

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCVGAAQDANAAVPGGCCAQIKRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGAYTLP  114



>ref|XP_006645014.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
Length=119

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  A ++ RA VPP+CC +V  + +  PKCLC V+LS  A   GV PA+A+TIPKRC
Sbjct  44   LAPCAAATQNPRAAVPPSCCAQVRTIGRN-PKCLCAVMLSNTARSAGVKPAVAMTIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
             I NRP+G KCG YT+P
Sbjct  103  AIANRPIGYKCGPYTLP  119



>ref|XP_003567269.1| PREDICTED: non-specific lipid-transfer protein 3-like [Brachypodium 
distachyon]
Length=117

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ RA VPP+CC +V  + +  PKCLC V+LS  A + GV PA+A+TIP
Sbjct  39   ALKLAPCAAATQNPRAAVPPSCCAQVRGIGRN-PKCLCAVMLSNTARQAGVKPAVAMTIP  97

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP+G KCG YT+P
Sbjct  98   KRCAIANRPIGYKCGPYTLP  117



>ref|XP_006850430.1| hypothetical protein AMTR_s00165p00049610 [Amborella trichopoda]
 gb|ERN12011.1| hypothetical protein AMTR_s00165p00049610 [Amborella trichopoda]
Length=116

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+DA A V  +CC +V  L +  P CLC V+LSP A   GVNP +AVTIPKRC
Sbjct  41   LAPCAEAAQDANAVVDSSCCAQVKKLSQK-PSCLCAVMLSPTAKSAGVNPEVAVTIPKRC  99

Query  305  IIKNRPVGKKCGRYTIP  255
               +RPVG KCG YT+P
Sbjct  100  NFADRPVGYKCGAYTLP  116



>ref|NP_001044807.1| Os01g0849000 [Oryza sativa Japonica Group]
 dbj|BAD82674.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06721.1| Os01g0849000 [Oryza sativa Japonica Group]
 dbj|BAG88488.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97137.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ RA VPP CC +V ++ +  PKCLC V+LS  A   GV PA+A+TIP
Sbjct  40   ALKLAPCAAATQNPRAAVPPNCCAQVRSIGRN-PKCLCAVMLSNTARSAGVKPAVAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP+G KCG YT+P
Sbjct  99   KRCAIANRPIGYKCGPYTLP  118



>ref|NP_190966.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_850700.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB88360.1| putative protein [Arabidopsis thaliana]
 gb|AAO00805.1| putative protein [Arabidopsis thaliana]
 gb|AAP21327.1| At3g53980 [Arabidopsis thaliana]
 gb|AEE79167.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE79168.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=114

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA + VP  CC ++    +  PKCLC +LLS  A   GV+P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANSAVPGGCCTQIKRFSQN-PKCLCAILLSDTAKASGVDPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGAYTLP  114



>ref|XP_003623166.1| Protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AES79384.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK35244.1| unknown [Medicago truncatula]
Length=117

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA+D  A V  TCC +   L +  P CLC VLLS +A   GVNP IAVT
Sbjct  37   MEAFKLAPCASAAQDENASVSQTCCAQTKKLGQN-PSCLCAVLLSNVAKMSGVNPQIAVT  95

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC   NRPVG KCG YT+P
Sbjct  96   IPKRCNFANRPVGYKCGPYTLP  117



>gb|AAM65889.1| unknown [Arabidopsis thaliana]
Length=110

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA + VP  CC ++    +  PKCLC +LLS  A   GV+P +A+TIP
Sbjct  32   AMKLAPCAGAAQDANSAVPGGCCTQIKRFSQN-PKCLCAILLSDTAKASGVDPEVALTIP  90

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  91   KRCNFANRPVGYKCGAYTLP  110



>gb|AFK46593.1| unknown [Lotus japonicus]
Length=120

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + K  P CLC V+LS +A   GVNP IA+TIP
Sbjct  42   AMKLIPCASAAQDENASVSQSCCAQVQKIGKN-PSCLCAVVLSNMAKMSGVNPKIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRP+G KCG YT+P
Sbjct  101  KRCNLDNRPIGYKCGPYTLP  120



>gb|KFK34645.1| hypothetical protein AALP_AA5G172600 [Arabis alpina]
Length=114

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA + VP  CC ++    +  PKCLC +LLS  A   GV+P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANSAVPGGCCAQIKRFSQN-PKCLCAILLSDTAKASGVDPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>ref|XP_002871191.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47450.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A+V PTCC +V  + +  PKCLC V+LS  A   G  P I++TIP
Sbjct  38   AIKLAPCAMAAQDTSARVSPTCCARVKQMGQN-PKCLCAVMLSSTARSSGAKPEISMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP+G KCG YT+P
Sbjct  97   KRCNIANRPIGYKCGAYTLP  116



>ref|XP_006429231.1| hypothetical protein CICLE_v10013135mg [Citrus clementina]
 ref|XP_006480910.1| PREDICTED: uncharacterized protein LOC102622162 [Citrus sinensis]
 gb|ESR42471.1| hypothetical protein CICLE_v10013135mg [Citrus clementina]
 gb|KDO57977.1| hypothetical protein CISIN_1g033458mg [Citrus sinensis]
Length=119

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D +A V  +CC +V  + +  PKCLC VLLS  A   GVNP +A+TIPKRC
Sbjct  44   LAPCATAAQDEKASVSGSCCAQVKRMGQN-PKCLCAVLLSDTAKASGVNPQVAITIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
               NRPVG KCG YT+P
Sbjct  103  NFANRPVGYKCGPYTLP  119



>ref|XP_006292076.1| hypothetical protein CARUB_v10018271mg [Capsella rubella]
 gb|EOA24974.1| hypothetical protein CARUB_v10018271mg [Capsella rubella]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA + VP  CC ++    +  PKCLC +LLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANSAVPGGCCSQIKRFSQN-PKCLCAILLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>emb|CDM84993.1| unnamed protein product [Triticum aestivum]
 emb|CDM85000.1| unnamed protein product [Triticum aestivum]
Length=116

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++ RAKV P CC ++ ++ ++ PKCLC V+LS  A + GV PA+A+TIP
Sbjct  38   ALKLAPCAAATQNPRAKVAPGCCAQIRSIGRS-PKCLCAVMLSSTARQAGVKPAVAMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRP+G KCG YT+P
Sbjct  97   KRCALANRPIGYKCGPYTLP  116



>ref|XP_007140457.1| hypothetical protein PHAVU_008G113900g [Phaseolus vulgaris]
 gb|ESW12451.1| hypothetical protein PHAVU_008G113900g [Phaseolus vulgaris]
Length=116

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + +  P CLC VLLS  A   GVNP IAVTIP
Sbjct  38   AFKLAPCSSAAQDENASVSQSCCAQVKKIGQN-PSCLCAVLLSNTAKMAGVNPQIAVTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRPVG KCG YT+P
Sbjct  97   KRCNLANRPVGYKCGPYTLP  116



>ref|XP_006837776.1| hypothetical protein AMTR_s00104p00068440 [Amborella trichopoda]
 gb|ERN00345.1| hypothetical protein AMTR_s00104p00068440 [Amborella trichopoda]
Length=121

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = -3

Query  608  NMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTC  429
            NMK  + A + YLL S A+L   +  A CG     ++ A  L  C+ AAK+   K P +C
Sbjct  4    NMKTLFIA-ISYLLFSNAILLGVSGDAPCGNTSIFSV-AWGLTSCVDAAKNPSVKPPRSC  61

Query  428  CGKVGALL-KTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGR  267
            C K   +  +T+  C+C V LSPLA +VG+ PA+A+TIPKRC +K RPVG KCGR
Sbjct  62   CTKTADIFSRTSASCICSVFLSPLAKQVGIKPAVAITIPKRCGLKKRPVGYKCGR  116



>ref|XP_010491144.1| PREDICTED: uncharacterized protein LOC104768790 [Camelina sativa]
Length=124

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A++D  AKV PTCC +V  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  46   AIKLAPCAMASQDTSAKVSPTCCARVREMGKN-PKCLCAVMLSSTARSSGAKPEISMTIP  104

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RP+G KCG YT+P
Sbjct  105  KRCNITSRPIGYKCGAYTLP  124



>ref|XP_002877950.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54209.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA   VP  CC ++    +  PKCLC +LLS  A   GV+P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANTAVPGGCCTQIKRFSQN-PKCLCAILLSDTAKASGVDPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>ref|XP_010452505.1| PREDICTED: uncharacterized protein LOC104734599 [Camelina sativa]
Length=124

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A++D  AKV PTCC +V  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  46   AIKLAPCAMASQDTSAKVSPTCCARVREMGKN-PKCLCAVMLSSTARSSGAKPEISMTIP  104

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RP+G KCG YT+P
Sbjct  105  KRCNIASRPIGYKCGAYTLP  124



>ref|NP_001238303.1| uncharacterized protein LOC100305635 precursor [Glycine max]
 gb|ACU13419.1| unknown [Glycine max]
 gb|KHN06988.1| hypothetical protein glysoja_042146 [Glycine soja]
Length=120

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + +  P CLC VLLS  A   GVNP +AVTIP
Sbjct  42   AYKLAPCASAAQDENASVSQSCCAQVKKIGQN-PSCLCAVLLSNTAKMAGVNPQVAVTIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRPVG KCG YT+P
Sbjct  101  KRCNLANRPVGYKCGPYTLP  120



>ref|XP_003529127.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
 gb|KHN05108.1| hypothetical protein glysoja_034934 [Glycine soja]
Length=118

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + +  P CLC VLLS  A   GVNP +AVTIP
Sbjct  40   AYKLAPCASAAQDENASVSQSCCAQVKKIGQN-PSCLCAVLLSNTAKMAGVNPQVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRPVG KCG YT+P
Sbjct  99   KRCNLANRPVGYKCGPYTLP  118



>ref|XP_008785478.1| PREDICTED: uncharacterized protein LOC103704106 [Phoenix dactylifera]
Length=118

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC  A++DA A+V  TCC +V  L +  P CLC V+LS  A   GV P +A+TIP
Sbjct  40   AFRMAPCASASQDAEAQVSSTCCAEVQKLGQN-PSCLCAVMLSDTAKSAGVKPEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCNLADRPVGYKCGAYTVP  118



>ref|XP_002315191.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEF01362.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=119

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = -3

Query  584  FVLYLLASQAVLFDKanaagcgqggcg-NIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            FV++L      LF++ + AG        +  A  L PC  AA+D  A V   CC KV  +
Sbjct  10   FVMFLATLSIALFNQVDGAGECGKTTTPDKEAFKLAPCASAAQDENASVSSQCCAKVKRI  69

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             +  P CLC V+LS  A   G++P IA+TIPKRC I +RPVG KCG YT+P
Sbjct  70   EQN-PACLCAVMLSNTAKSSGIDPEIAMTIPKRCNIADRPVGYKCGAYTLP  119



>ref|XP_011036038.1| PREDICTED: putative lipid-transfer protein DIR1 [Populus euphratica]
Length=119

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = -3

Query  584  FVLYLLASQAVLFDKanaagcgqggcg-NIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            FV++L      LF++ + AG        +  A  L PC  AA+D  A V   CC +V  +
Sbjct  10   FVMFLATLSIALFNQVDGAGECGKTTTPDKEAFKLAPCASAAQDENASVSSQCCARVKKI  69

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             +  P CLC V+LS  A   G++P IA+TIPKRC I +RPVG KCG YT+P
Sbjct  70   EQN-PACLCAVMLSSTAKSSGIDPEIAMTIPKRCNIADRPVGYKCGAYTLP  119



>ref|XP_007009154.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY17964.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=114

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D+ A+V  +CC +V  + +  P+CLC V+LS  A   GV P IAVTIP
Sbjct  36   AWKLAPCAMAAQDSNAQVSDSCCQQVKKMGQN-PRCLCAVMLSNTAKSSGVKPEIAVTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG KCG YT+P
Sbjct  95   KRCNIPDRPVGYKCGDYTLP  114



>ref|XP_006429230.1| hypothetical protein CICLE_v10013132mg [Citrus clementina]
 ref|XP_006480909.1| PREDICTED: non-specific lipid-transfer protein Cw18-like [Citrus 
sinensis]
 gb|ESR42470.1| hypothetical protein CICLE_v10013132mg [Citrus clementina]
Length=119

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D +A V  +CC +V  + +  P CLC VLLS  A   GVNP +A++IPKRC
Sbjct  44   LAPCAAAAQDEKASVSASCCAQVKRIGQN-PSCLCAVLLSDTAKASGVNPQVAMSIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
               NRPVG KCG YT+P
Sbjct  103  NFANRPVGYKCGPYTLP  119



>gb|EMT24714.1| hypothetical protein F775_26225 [Aegilops tauschii]
Length=116

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A ++  AKV P CC ++ ++ ++ PKCLC V+LS  A + GV PA+A+TIP
Sbjct  38   ALKLAPCAAATQNPGAKVAPGCCAQIRSIGRS-PKCLCAVMLSATARQAGVKPAVAMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP+G KCG YT+P
Sbjct  97   KRCAIANRPIGYKCGPYTLP  116



>gb|AFK42353.1| unknown [Lotus japonicus]
Length=120

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V    +  P CLC VLLS  A   G++P IA+TIP
Sbjct  42   AMKLAPCAAAAQDENASVSQSCCAQVKKFSQN-PGCLCAVLLSNTAKMSGIDPKIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRP+G KCG YT+P
Sbjct  101  KRCSFANRPIGYKCGSYTLP  120



>ref|XP_008233680.1| PREDICTED: probable non-specific lipid-transfer protein 2 [Prunus 
mume]
Length=118

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = -3

Query  587  AFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            AFV+ L  +Q   FD A  AG       +  A  L PCL AA+DA A V   CC +V  +
Sbjct  12   AFVVILGINQ---FDGAYGAGECGKSSPDKEAWKLAPCLEAAQDANAAVSDKCCSQVKRI  68

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             +  P CLC V+LS  A   G+ P IA+TIPKRC I +RPVG KCG YT+P
Sbjct  69   GQN-PSCLCAVMLSNTAKSAGIKPEIALTIPKRCNIVDRPVGFKCGAYTLP  118



>ref|XP_006849510.1| hypothetical protein AMTR_s00024p00141270 [Amborella trichopoda]
 gb|ERN11091.1| hypothetical protein AMTR_s00024p00141270 [Amborella trichopoda]
Length=117

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  605  MKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCC  426
            M+  + A + YLL S A+L   +    CG     ++ A  L  C+ AAK+  AK P +CC
Sbjct  1    MRTMFIA-ISYLLFSNAILLGVSGDGPCGNTSIFSL-AWGLTSCVDAAKNPSAKPPRSCC  58

Query  425  GKVGALL-KTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGR  267
             K   +  KT+  C+C + LSPLA +VG+ PA+A+TIPKRC +K RPVG KCGR
Sbjct  59   TKTADIFSKTSAGCICSIFLSPLAKQVGIKPAVAITIPKRCGLKKRPVGYKCGR  112



>gb|KHG10558.1| putative non-specific lipid-transfer 2 [Gossypium arboreum]
Length=116

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + ++ PKCLC V+LS  A   G+ P IA+TIP
Sbjct  38   AMKLAPCAEAAQDENAPVSASCCAQVRKIGQS-PKCLCAVMLSNTAKASGIKPEIAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  97   KRCNIANRPVGYKCGAYTLP  116



>gb|ABR17125.1| unknown [Picea sitchensis]
Length=111

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+ AA++A A V   CC  V     T P CLC VLLS  A   G++PA+AV+IP
Sbjct  33   ATKMAPCVEAAQNANAPVSAGCCNAVHKF-STDPACLCSVLLSKTAKDAGIDPAVAVSIP  91

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   +RPVG KCG YT+P
Sbjct  92   KRCQFSDRPVGYKCGAYTVP  111



>gb|AFK41239.1| unknown [Lotus japonicus]
Length=120

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V    +  P CLC VLLS  A   G++P IA+TIP
Sbjct  42   AMKLAPCATAAQDENASVSQSCCAQVKKFSQN-PGCLCAVLLSNTAKMSGIDPKIAITIP  100

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRP+G KCG YT+P
Sbjct  101  KRCSFANRPIGYKCGSYTLP  120



>ref|XP_010068679.1| PREDICTED: uncharacterized protein LOC104455613 [Eucalyptus grandis]
Length=142

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            ASL PC+ AA+D RAKVPP CC +V  L++T P+CL  V  SP A   G+ PA A++IPK
Sbjct  70   ASLSPCMVAARDPRAKVPPLCCDRVNTLIRTNPRCLYTVFHSPAAKFAGIVPAAAMSIPK  129

Query  311  RCIIKNRPVGKK  276
            RC I+NRP  + 
Sbjct  130  RCNIRNRPARRN  141



>ref|XP_007026870.1| RHO guanyl-nucleotide exchange factor 7 [Theobroma cacao]
 gb|EOY07372.1| RHO guanyl-nucleotide exchange factor 7 [Theobroma cacao]
Length=757

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + ++ P CLC V+LS  A   G+ P IA+TIP
Sbjct  679  ALKLAPCAEAAQDQNAAVSASCCDQVRKIGRS-PSCLCAVMLSNTAKASGIKPEIAITIP  737

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  738  KRCNIANRPVGYKCGPYTLP  757



>ref|XP_010558098.1| PREDICTED: uncharacterized protein LOC104826866 [Tarenaya hassleriana]
Length=116

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  ++V  TCC +V  + K+ PKCLC V+LS  A   G  P IA+TIP
Sbjct  38   AIKLAPCAMAAQDQNSRVSVTCCDRVRQIGKS-PKCLCAVMLSNTAKSSGAKPEIAMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG KCG YT+P
Sbjct  97   KRCNIADRPVGYKCGAYTLP  116



>gb|AFK45984.1| unknown [Medicago truncatula]
 gb|AES79379.2| Lipid transfer protein [Medicago truncatula]
Length=117

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AAKD  A V  +CC +V  L +  P CLC V+LS +A   G NP IAVTIP
Sbjct  39   AFKLIPCASAAKDENASVSQSCCAQVKKLGQN-PSCLCAVMLSNVAKMSGANPQIAVTIP  97

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  98   KRCNLADRPVGYKCGPYTLP  117



>ref|NP_568160.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAM64483.1| unknown [Arabidopsis thaliana]
 gb|ABD38889.1| At5g05960 [Arabidopsis thaliana]
 gb|AED90945.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=116

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV   CC +V  + +  PKCLC V+LS  A   G  P I++TIP
Sbjct  38   AIKLAPCAMAAQDTSAKVSAICCARVKQMGQN-PKCLCAVMLSSTARSSGAKPEISMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  97   KRCNIANRPVGYKCGAYTLP  116



>ref|XP_010923195.1| PREDICTED: uncharacterized protein LOC105046333 [Elaeis guineensis]
Length=118

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+ A+++ RA+V   CC +V  L K  P+CLC V+LS  A + GV PAIA+TIP
Sbjct  40   ALRMAPCVPASQNTRARVSAECCLEVQKLGKN-PRCLCAVMLSNTAKRAGVKPAIAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG KCG YT+P
Sbjct  99   KRCRIAHRPVGYKCGGYTLP  118



>ref|XP_010423403.1| PREDICTED: uncharacterized protein LOC104708517 [Camelina sativa]
Length=124

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L  C  A++D  AKV PTCC +V  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  46   AIKLATCAMASQDTSAKVSPTCCARVREMGKN-PKCLCAVMLSSTARSSGAKPEISMTIP  104

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RP+G KCG YT+P
Sbjct  105  KRCNIASRPIGYKCGAYTLP  124



>ref|XP_009351247.1| PREDICTED: non-specific lipid-transfer protein 1-like [Pyrus 
x bretschneideri]
Length=118

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+DA+A V  +CC +V  + +  P CLC V+LS  A   GV P IAVTIPKRC
Sbjct  43   LAPCASAAQDAQAPVSASCCSQVKRIGQN-PSCLCAVMLSNTAKMSGVKPEIAVTIPKRC  101

Query  305  IIKNRPVGKKCGRYTIP  255
             I +RPVG KCG YT+P
Sbjct  102  NIADRPVGFKCGAYTLP  118



>emb|CDP00155.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA+DA A V   CC +V  L +  PKCLC V+LS  A   GV P IAVT
Sbjct  38   MEAMKLIPCAEAAQDANAPVSSGCCAQVKKLGQN-PKCLCAVMLSDTAKYSGVKPEIAVT  96

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + +RPVG KCG YT+P
Sbjct  97   IPKRCNLADRPVGYKCGAYTLP  118



>gb|ABQ53995.1| protease inhibitor/seed storage/LTP family protein [Cicer arietinum]
Length=101

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D  A V  +CC +V  L +  P CLC V+LS  A   G +P IAVTIPKRC
Sbjct  26   LAPCASAAQDENASVSQSCCAQVKKLGQN-PSCLCAVMLSNTAKMSGADPQIAVTIPKRC  84

Query  305  IIKNRPVGKKCGRYTIP  255
             I  RPVG KCG YT+P
Sbjct  85   NIATRPVGYKCGPYTLP  101



>emb|CDX76181.1| BnaA04g04450D [Brassica napus]
Length=129

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCVGAAQDANAAVPGGCCAQIKRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCG  270
            KRC   NRPVG KCG
Sbjct  95   KRCNFANRPVGYKCG  109



>ref|NP_001052760.1| Os04g0415800 [Oryza sativa Japonica Group]
 emb|CAE01522.1| OJ991214_12.11 [Oryza sativa Japonica Group]
 dbj|BAF14674.1| Os04g0415800 [Oryza sativa Japonica Group]
 emb|CAH67590.1| OSIGBa0092M08.2 [Oryza sativa Indica Group]
 gb|EAY94062.1| hypothetical protein OsI_15838 [Oryza sativa Indica Group]
 gb|EAY94066.1| hypothetical protein OsI_15842 [Oryza sativa Indica Group]
 gb|EAZ30698.1| hypothetical protein OsJ_14756 [Oryza sativa Japonica Group]
Length=116

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AAKD ++     CC  V  + K +PKCLC V+LS      G+ P +A+TIP
Sbjct  37   ALKLAPCASAAKDPKSTPSSGCCTAVHTIGKQSPKCLCAVMLSSTTRNAGIKPEVAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG KCG YT+P
Sbjct  97   KRCNIADRPVGYKCGDYTLP  116



>emb|CDY13162.1| BnaC04g26730D [Brassica napus]
Length=129

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCVGAAQDANAAVPGGCCAQIKRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCG  270
            KRC   NRPVG KCG
Sbjct  95   KRCNFANRPVGYKCG  109



>ref|XP_009378876.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=118

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            AA L PC  AA+D +A V  +CC +V  + +  P CLC +LLS  A   GV   +A+TIP
Sbjct  40   AAKLAPCADAAQDEKAAVSASCCQQVKRMGQN-PSCLCAILLSDTAKSSGVKLEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  99   KRCNFANRPVGTKCGGYTLP  118



>ref|XP_006399057.1| hypothetical protein EUTSA_v10015048mg [Eutrema salsugineum]
 gb|ESQ40510.1| hypothetical protein EUTSA_v10015048mg [Eutrema salsugineum]
Length=116

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV  TCC +V  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  38   AIKLAPCAMAAQDKSAKVSATCCVRVKQMGKN-PKCLCAVMLSSTARSSGAKPEISMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RP+G KCG YT+P
Sbjct  97   KRCNIADRPIGYKCGAYTLP  116



>ref|XP_009380621.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=118

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA+ +V   CC  V  + +  P CLC V+LS  A  VG  P +AVTIP
Sbjct  40   ALQLAPCASAAQDAQVQVSAACCSAVQRVGQN-PACLCAVMLSDTAKSVGAKPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRPVG +CG YTIP
Sbjct  99   KRCNLANRPVGYECGGYTIP  118



>ref|XP_004492374.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  L +  P CLC V+LS  A   G +P IAVTIP
Sbjct  38   AFKLAPCASAAQDENASVSQSCCAQVKKLGQN-PSCLCAVMLSNTAKMSGADPQIAVTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I  RPVG KCG YT+P
Sbjct  97   KRCNIATRPVGYKCGPYTLP  116



>gb|KDO57976.1| hypothetical protein CISIN_1g033430mg [Citrus sinensis]
Length=119

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D +A V  +CC +V  + +  P CLC VLLS  A   GVNP +A++IPKRC
Sbjct  44   LAPCAAAAQDEKASVSASCCAQVKRIGQN-PICLCAVLLSDTAKASGVNPQVAMSIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
               NRPVG KCG YT+P
Sbjct  103  NFANRPVGYKCGPYTLP  119



>ref|XP_010923196.1| PREDICTED: uncharacterized protein LOC105046334 [Elaeis guineensis]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC  A++DA+A+V   CC +V  L +  P CLC V+LS  A   GV+P +A+TIP
Sbjct  40   AFRMAPCASASQDAQAQVSSRCCAEVQKLGQN-PSCLCAVMLSDTAKSAGVDPEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
             RC + +RPVG KCG YT+P
Sbjct  99   MRCNLADRPVGYKCGGYTLP  118



>ref|XP_006361967.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=112

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D  A V  +CC ++  L +  PKCLC V+LS  A   G NP +A+T
Sbjct  32   MEAMKLIPCAEAASDENASVSRSCCLQIQKLGQN-PKCLCAVMLSNTAKSSGANPEVAIT  90

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + NRPVG KCG YT+P
Sbjct  91   IPKRCNLANRPVGYKCGPYTLP  112



>ref|XP_008785477.1| PREDICTED: uncharacterized protein LOC103704105 [Phoenix dactylifera]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC  A+ DARA V   CC  V  L K  P+CLC V+LS  A + GV PAIA+TIP
Sbjct  40   ALRMAPCASASHDARAPVSAQCCLVVQKLGKN-PRCLCAVMLSNTAKRAGVKPAIAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCRLAHRPVGYKCGGYTLP  118



>ref|XP_011084993.1| PREDICTED: uncharacterized protein LOC105167116 [Sesamum indicum]
Length=111

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = -3

Query  584  FVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGALL  405
            F+L LLA  +  F+ A AAG       ++ A  L PC  AA+D  A V  +CC +V  + 
Sbjct  5    FILGLLAISS--FNYAYAAGECPRSTPDMEAMKLIPCAEAAQDPNASVSSSCCAQVKRIG  62

Query  404  KTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            +  PKCLC V+LS +A   GV P IA+TIPKRC   +RPVG KCG YT+P
Sbjct  63   QN-PKCLCAVMLSDVAKSSGVKPEIALTIPKRCNFADRPVGYKCGPYTLP  111



>ref|XP_006576151.1| PREDICTED: uncharacterized protein LOC100306273 isoform X1 [Glycine 
max]
Length=135

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ AAKD   KV   CC ++  L K  P CLC V+LS  A   G +P +A+TIP
Sbjct  57   AIKLIPCVSAAKDENVKVTKNCCAQIEKLGKN-PSCLCAVMLSNTAKMSGADPKVAITIP  115

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + NRPVG KCG YT+P
Sbjct  116  KRCNLANRPVGYKCGPYTLP  135



>ref|XP_004235052.1| PREDICTED: uncharacterized protein LOC101258342 [Solanum lycopersicum]
Length=112

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D  A V  +CC ++  L    PKCLC V+LS  A   G NP +A+T
Sbjct  32   MEAMKLIPCAEAASDENASVSRSCCLQIQKLGHN-PKCLCAVMLSNTAKSSGANPEVAIT  90

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + NRPVG KCG YT+P
Sbjct  91   IPKRCNLANRPVGYKCGPYTLP  112



>gb|KHG23087.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=118

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC  AA+D  A V  TCC +V  +    P CLC V+LS  A   G+ P IA+TIP
Sbjct  40   AMKMIPCAEAAQDENAPVSATCCTQVRQIGHN-PSCLCAVMLSSTAKSSGIKPEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP+G KCG YT+P
Sbjct  99   KRCNIANRPIGYKCGAYTLP  118



>ref|XP_007026867.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07369.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 1 [Theobroma cacao]
Length=118

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + ++ P CLC V+LS  A   G+ P IA+TIP
Sbjct  40   AIKLAPCAEAAQDQNAAVSASCCDQVRKIGRS-PSCLCAVMLSNTAKASGIKPEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCNIANRPVGYKCGPYTLP  118



>ref|XP_008391039.1| PREDICTED: uncharacterized protein LOC103453274 [Malus domestica]
 ref|XP_008360377.1| PREDICTED: uncharacterized protein LOC103424081 [Malus domestica]
Length=118

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D +A V  +CC +V  + +  P CLC V+LS  A   GV P IAVTIP
Sbjct  40   ALKLAPCASAAQDEKAPVSASCCSQVKRIGQN-PSCLCAVMLSNTAKMSGVKPEIAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG KCG YT+P
Sbjct  99   KRCNIADRPVGFKCGAYTLP  118



>gb|KFK24991.1| hypothetical protein AALP_AA8G052300 [Arabis alpina]
Length=116

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV  TCC +V  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  38   AIKLAPCAMAAQDKSAKVSSTCCVRVREMGKN-PKCLCAVMLSSTARSSGAKPEISMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I  RP+G KCG YT+P
Sbjct  97   KRCNIATRPIGYKCGAYTLP  116



>ref|XP_007133944.1| hypothetical protein PHAVU_010G005500g [Phaseolus vulgaris]
 gb|ESW05938.1| hypothetical protein PHAVU_010G005500g [Phaseolus vulgaris]
Length=119

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV  +CC +V  L K  P CLC V+LS  A   G +P +AVTIP
Sbjct  41   ALKLIPCASAAQDENAKVSSSCCAQVQKLGKN-PSCLCAVMLSNTAKLSGADPKVAVTIP  99

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC +  RPVG KCG YT+P
Sbjct  100  KRCNLSTRPVGYKCGPYTLP  119



>gb|KHG28167.1| putative non-specific lipid-transfer 2 [Gossypium arboreum]
Length=115

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D+ A V  +CC +V  + +  P+CLC V+LS  A   G+ P IA+TIP
Sbjct  37   AWKLAPCAMAAQDSNAPVSSSCCQQVKKIGQN-PRCLCAVMLSNTAKSSGIKPEIAITIP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG +CG YT+P
Sbjct  96   KRCNIADRPVGYQCGEYTLP  115



>ref|XP_004975591.1| PREDICTED: non-specific lipid-transfer protein-like isoform X2 
[Setaria italica]
Length=112

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AAK   +     CC  V  + K +P+CLC V+LS  AMK G+ P +A+TIP
Sbjct  33   AQKLAPCESAAKKPNSAPSSGCCNAVHTIGKQSPECLCAVMLSKAAMKHGIKPEVAITIP  92

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  93   KRCNLVDRPVGYKCGAYTLP  112



>ref|XP_006360200.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=113

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D  A V  +CC ++  L K  PKCLC V+LS  A   G NP +A+T
Sbjct  33   MEAMKLIPCAEAASDENASVSRSCCLQIQKLGKN-PKCLCAVMLSNTAKLSGANPEVAIT  91

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + NRPVG KCG YT+P
Sbjct  92   IPKRCNLANRPVGFKCGPYTLP  113



>ref|XP_010256754.1| PREDICTED: uncharacterized protein LOC104597063 [Nelumbo nucifera]
Length=118

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A+V   CC +V  + +  P CLC V+LS  A   GV P +AVTIP
Sbjct  40   AFKLAPCASAAQDEHAQVSDKCCLQVKQMGQR-PSCLCAVMLSQTAKNSGVKPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCNLADRPVGYKCGAYTLP  118



>gb|ADQ57297.1| xylem sap protein 10 kDa [Solanum lycopersicum]
Length=112

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D  A V  +CC ++  L    PKCLC V+LS  A   G NP +A+T
Sbjct  32   MEAMKLIPCAKAASDENASVSRSCCLQIQKLGHN-PKCLCAVMLSNTAKSSGANPEVAIT  90

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + NRPVG KCG YT+P
Sbjct  91   IPKRCNLANRPVGYKCGPYTLP  112



>gb|KCW82679.1| hypothetical protein EUGRSUZ_C04056 [Eucalyptus grandis]
Length=130

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            A L PCLGAA+D +AKVPP CC  V AL+   P+CLC VLLSP A +V + P  A++IPK
Sbjct  43   AMLSPCLGAARDPQAKVPPPCCANVSALIGKGPRCLCAVLLSPAAKEVRIIPKAAISIPK  102

Query  311  RCIIKNRPVGKKC-GRYTIP*EDIVTRHYL  225
            RC +  R  G +C G Y +   + +   YL
Sbjct  103  RCNM--RKAGSECRGEYNLSINNSLLCSYL  130



>ref|XP_009122201.1| PREDICTED: uncharacterized protein LOC103846942 [Brassica rapa]
 emb|CDX70107.1| BnaA10g24560D [Brassica napus]
Length=124

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV  TCC ++  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  46   AIKLAPCAMAAQDKSAKVSATCCVRIRQMGKN-PKCLCAVMLSSTARNSGAKPEISMTIP  104

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RP+G KCG Y++P
Sbjct  105  KRCNIADRPIGYKCGAYSLP  124



>ref|XP_006652272.1| PREDICTED: non-specific lipid-transfer protein Cw18-like [Oryza 
brachyantha]
Length=119

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AAKD ++     CC  V  + K +PKCLC V+LS      G+ P +A+TIP
Sbjct  40   ALKLAPCASAAKDPKSTPSTGCCTAVHTIGKQSPKCLCAVMLSNTTRSSGIQPEVAITIP  99

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   +RP+G KCG YT+P
Sbjct  100  KRCNFADRPIGYKCGDYTLP  119



>emb|CAH59408.1| hypothetical protein [Plantago major]
Length=118

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D+ A V   CC +V  L    PKCLC V+LS  A   GV P +AVT
Sbjct  38   MEAMKLIPCASAASDSNAPVSSGCCAQVKTLGHN-PKCLCAVMLSNTAKSSGVKPEVAVT  96

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + +RP+G KCG YT+P
Sbjct  97   IPKRCNLADRPIGYKCGAYTLP  118



>emb|CDX98890.1| BnaC09g49450D [Brassica napus]
Length=123

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV  TCC ++  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  45   AIKLAPCAMAAQDKSAKVSATCCVRIKQMGKN-PKCLCAVMLSSTARNSGAKPEISMTIP  103

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RP+G KCG Y++P
Sbjct  104  KRCNIADRPIGYKCGAYSLP  123



>ref|XP_011037534.1| PREDICTED: putative lipid-transfer protein DIR1 [Populus euphratica]
Length=119

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  + PC  AA+D  + V   CC +V  + +  P CLC V+LS  A   G+ P IA+T
Sbjct  39   MEAFKMAPCASAAQDENSSVSSQCCARVKKIGQN-PACLCAVMLSNTAKSSGIKPEIAMT  97

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC I +RPVG KCG YT+P
Sbjct  98   IPKRCNIADRPVGYKCGAYTLP  119



>ref|XP_002272871.2| PREDICTED: uncharacterized protein LOC100240776 [Vitis vinifera]
Length=122

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA D  A V  +CC +V  +++  P CLC V+LS +A   GVNP IA+TIP
Sbjct  44   ALKLIPCATAASDKNAAVSSSCCLQVKKIIQN-PSCLCAVVLSNMAKFSGVNPEIAITIP  102

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            +RC   +RPVG KCG YT+P
Sbjct  103  ERCNFADRPVGFKCGAYTLP  122



>emb|CBI30470.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA D  A V  +CC +V  +++  P CLC V+LS +A   GVNP IA+TIP
Sbjct  40   ALKLIPCATAASDKNAAVSSSCCLQVKKIIQN-PSCLCAVVLSNMAKFSGVNPEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            +RC   +RPVG KCG YT+P
Sbjct  99   ERCNFADRPVGFKCGAYTLP  118



>ref|XP_009799912.1| PREDICTED: uncharacterized protein LOC104245907 [Nicotiana sylvestris]
Length=118

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D+ A V  +CC ++  L +  PKCLC V+LS  A   G  P +A+T
Sbjct  38   MEAMKLIPCAEAASDSNASVSRSCCQQMQKLGQN-PKCLCAVMLSNTAKDSGAKPEVAIT  96

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + NRP+G KCG YT+P
Sbjct  97   IPKRCNLANRPMGYKCGPYTLP  118



>ref|XP_002312129.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEE89496.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=119

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  + PC  AA+D  + V   CC +V  + +  P CLC V+LS  A   G+ P IA+T
Sbjct  39   MEAFKMAPCASAAQDENSSVSSQCCARVKKIGQN-PACLCAVMLSNTAKSSGIKPEIAMT  97

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC I +RPVG KCG YT+P
Sbjct  98   IPKRCNIADRPVGYKCGAYTLP  119



>ref|XP_010067464.1| PREDICTED: non-specific lipid-transfer protein 4.1-like [Eucalyptus 
grandis]
 gb|KCW65608.1| hypothetical protein EUGRSUZ_G02998 [Eucalyptus grandis]
Length=119

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ AA+D  A V  +CC +V  + +  P CLC  +LS  A   G+ P +AVTIP
Sbjct  41   AFKLAPCMSAAQDETAPVSSSCCAQVKRIGQN-PSCLCAAMLSNTAKMAGIKPGVAVTIP  99

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RP G KCG YT+P
Sbjct  100  KRCNLSDRPTGYKCGDYTVP  119



>gb|EYU19957.1| hypothetical protein MIMGU_mgv11b015357mg [Erythranthe guttata]
Length=78

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  A +D+ A V   CC +V  + +  P+CLC VLLS +A   GV P IA+TIPKRC
Sbjct  3    LIPCASAVQDSSAAVSGGCCAQVKKIGQN-PRCLCAVLLSNMAKAAGVKPEIAITIPKRC  61

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RP+G KCG YT+P
Sbjct  62   NLSDRPIGYKCGAYTLP  78



>ref|XP_008388088.1| PREDICTED: uncharacterized protein LOC103450502 [Malus domestica]
Length=118

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A    PC  AAK  +A V  +CC +V  L    P CLC +LLS  A   GV P +A+TIP
Sbjct  40   AFKFAPCADAAKYEKAAVSDSCCXQVKRLGHN-PSCLCAILLSNTAKSSGVKPEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  99   KRCNFANRPVGYKCGAYTMP  118



>ref|XP_003579714.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
isoform X2 [Brachypodium distachyon]
Length=118

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PCL AAKD  A    +CC  V  +   + +CLC VLLS    + GV   +A+TIP
Sbjct  35   ALKLAPCLTAAKDPEASPSKSCCAAVVDIWGHSTECLCAVLLSNTLKRFGVKVEVAITIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRP+G KCG YT+P
Sbjct  95   KRCNIANRPIGYKCGDYTLP  114



>ref|XP_007206156.1| hypothetical protein PRUPE_ppa013525mg [Prunus persica]
 gb|EMJ07355.1| hypothetical protein PRUPE_ppa013525mg [Prunus persica]
Length=118

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA A V   CC +V  L +  P CLC VLLS  A   GV   +A+TIP
Sbjct  40   AIKLAPCASAAQDANAPVSSGCCQQVKRLGQN-PSCLCAVLLSDTAKNSGVKAEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  99   KRCNFANRPVGYKCGPYTLP  118



>ref|XP_008240113.1| PREDICTED: non-specific lipid-transfer protein Cw18 [Prunus mume]
Length=118

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA A V   CC +V  L +  P CLC VLLS  A   GV   +A+TIP
Sbjct  40   AIKLAPCASAAQDANAPVSSGCCQQVKRLGQN-PSCLCAVLLSDTAKNSGVKAEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  99   KRCNFANRPVGYKCGPYTLP  118



>ref|NP_001151364.1| LOC100284997 precursor [Zea mays]
 gb|ACG42561.1| lipid binding protein [Zea mays]
Length=119

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D  +    +CC  V A+ K +P+CLC V+LS  A   G+   +A+TIPKRC
Sbjct  43   LAPCASAAEDPGSAPSGSCCSAVHAIGKQSPRCLCAVMLSNTARSAGIKAEVAITIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  103  NLADRPVGYKCGDYTLP  119



>ref|XP_002524256.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF38180.1| lipid binding protein, putative [Ricinus communis]
Length=119

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA+D  + V   CC +V  + +  P CLC V+LS  A   GV P  A+T
Sbjct  39   MEAFKLAPCASAAQDTTSPVSSQCCAQVKKMGQN-PPCLCAVMLSNTAKSSGVQPENAIT  97

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC I NRPVG KCG YT+P
Sbjct  98   IPKRCNIANRPVGYKCGAYTLP  119



>ref|NP_001148327.1| lipid binding protein precursor [Zea mays]
 gb|ACF87803.1| unknown [Zea mays]
 gb|ACG25515.1| lipid binding protein [Zea mays]
 gb|ACG30688.1| lipid binding protein [Zea mays]
 tpg|DAA37881.1| TPA: lipid binding protein [Zea mays]
Length=119

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D  +    +CC  V A+ K +P+CLC V+LS  A   G+   +A+TIPKRC
Sbjct  43   LAPCASAAEDPGSAPSGSCCSAVHAIGKQSPRCLCAVMLSNTARSAGIKAEVAITIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  103  NLADRPVGYKCGDYTLP  119



>ref|XP_009419916.1| PREDICTED: uncharacterized protein LOC103999788 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC  AA+DAR  V   CC  V  + +  P CLC V+LS  A  VGV P +A+TIP
Sbjct  40   ALQMAPCASAAQDARLPVSAGCCAAVKKMGRN-PSCLCAVMLSDTAKSVGVKPDVAMTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCNLADRPVGYKCGGYTLP  118



>ref|XP_010041554.1| PREDICTED: uncharacterized protein LOC104430507 [Eucalyptus grandis]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            A L PC+ AA+DA+AKVPP CC +V +L++  P+CL  V  SP A   G+ PA+A++I K
Sbjct  46   AGLSPCMVAARDAQAKVPPACCDRVKSLMQINPRCLYAVFHSPAARFAGIIPAVAMSISK  105

Query  311  RCIIKNRPVGKK  276
            RC I+NRP  + 
Sbjct  106  RCNIRNRPARRN  117



>ref|XP_010067466.1| PREDICTED: uncharacterized protein LOC104454347 [Eucalyptus grandis]
 gb|KCW65610.1| hypothetical protein EUGRSUZ_G03000 [Eucalyptus grandis]
Length=119

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ AA+D  A V  +CC +V  + +  P CLC  +LS  A   G+ P +AVTIP
Sbjct  41   AFKLAPCMSAAQDETAPVSSSCCAQVKRIGQK-PSCLCAAMLSNTAKMAGIKPEVAVTIP  99

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RP G KCG YT+P
Sbjct  100  KRCNLSDRPAGYKCGDYTVP  119



>ref|XP_010051669.1| PREDICTED: uncharacterized protein LOC104440439 [Eucalyptus grandis]
Length=110

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            A L PCLGAA+D +AKVPP CC +VG L+   P+CLC V LSP A +V + PA A++IP 
Sbjct  28   AKLSPCLGAARDPQAKVPPACCARVGVLVGAGPRCLCAVFLSPAAKEVRIVPAAALSIPN  87

Query  311  RCIIKN  294
            RC ++ 
Sbjct  88   RCHMRK  93



>ref|XP_010088546.1| hypothetical protein L484_016938 [Morus notabilis]
 gb|EXB36687.1| hypothetical protein L484_016938 [Morus notabilis]
Length=115

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D +A V  +CC +V  + +  P CLC VLLS  A   G+NP +A+TIP
Sbjct  40   AMKLAPCAVAAQDEKAAVSESCCLQVKKIGQN-PSCLCAVLLSDTAKSSGINPVVAITIP  98

Query  314  KRCIIKNRPVGKKCGR  267
            KRC   NRPVG KCGR
Sbjct  99   KRCKFANRPVGYKCGR  114



>ref|XP_010691722.1| PREDICTED: uncharacterized protein LOC104904979 [Beta vulgaris 
subsp. vulgaris]
Length=118

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A +D  A V   CC K+  L +  P CLC V+LS  A   GV P +AVTIP
Sbjct  40   AYKLVPCAVAGQDVNAPVSDACCAKIKQLGQN-PSCLCAVMLSNTAKSSGVKPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCNLADRPVGYKCGAYTLP  118



>ref|XP_006435584.1| hypothetical protein CICLE_v10033080mg [Citrus clementina]
 ref|XP_006486435.1| PREDICTED: uncharacterized protein LOC102613787 [Citrus sinensis]
 gb|ESR48824.1| hypothetical protein CICLE_v10033080mg [Citrus clementina]
 gb|KDO69228.1| hypothetical protein CISIN_1g033228mg [Citrus sinensis]
Length=124

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V   CC +V  L +  P CLC V+LS +A   G+ P +A+TIP
Sbjct  46   AFKLAPCAMAAQDPNADVSSQCCMQVQKLGQN-PSCLCAVMLSNVAKSSGIKPDVAITIP  104

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  105  KRCNLADRPVGYKCGAYTLP  124



>gb|AII99866.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=115

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  L +  P CLC V+LS  A   G +P IAVTIP
Sbjct  38   AFKLAPCASAAQDENASVSQSCCAQVKKLGQN-PSCLCAVMLSNTAKMSGADPQIAVTIP  96

Query  314  KRCIIKNRPVGKKCGR  267
            KRC I  RPVG KCGR
Sbjct  97   KRCNIATRPVGYKCGR  112



>ref|XP_009597227.1| PREDICTED: uncharacterized protein LOC104093206 [Nicotiana tomentosiformis]
Length=119

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D    V  +CC ++  L +  PKCLC V+LS  A   G  P +AVT
Sbjct  39   MEAMKLIPCAEAASDPNVSVSRSCCQQIQKLGQN-PKCLCAVMLSNTAKDSGAKPEVAVT  97

Query  320  IPKRCIIKNRPVGKKCGRYTIP  255
            IPKRC + NRPVG KCG YT+P
Sbjct  98   IPKRCNLANRPVGYKCGPYTLP  119



>dbj|BAK01229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=119

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  A +D ++     CC  V  + K +PKCLC V+LS  A   G+ P +A++IPKRC
Sbjct  43   LAPCASAGQDPKSAPSSGCCTAVHTIGKQSPKCLCAVMLSDTAKSAGIKPEVAMSIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  103  DLVDRPVGYKCGAYTLP  119



>ref|XP_010108368.1| hypothetical protein L484_010375 [Morus notabilis]
 gb|EXC19359.1| hypothetical protein L484_010375 [Morus notabilis]
Length=116

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA+D  A V   CC +V  + +  P+CLC V+LS  A   GVN  +A+T
Sbjct  39   MEAFKLAPCASAAQDENASVSARCCAQVKKIGQN-PRCLCAVMLSNTARSSGVNAEVAIT  97

Query  320  IPKRCIIKNRPVGKKCGR  267
            IPKRC I +RPVG KCGR
Sbjct  98   IPKRCNIGDRPVGYKCGR  115



>gb|ACN31618.1| unknown [Zea mays]
Length=115

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA++  +     CC  V  + K +P+CLC V+LS  A K G+ P +A+TIP
Sbjct  36   ALKLAPCASAAQNPSSAPSNGCCTAVHTIGKQSPQCLCAVMLSKTAKKSGIKPEVAITIP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  96   KRCNLVDRPVGYKCGDYTLP  115



>dbj|BAJ96826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=119

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  A +D ++     CC  V  + K +PKCLC V+LS  A   G+ P +A++IPKRC
Sbjct  43   LAPCASAGQDPKSAPSSGCCTAVHTIGKQSPKCLCAVMLSDTAKSAGIKPEVAMSIPKRC  102

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  103  NLVDRPVGYKCGAYTLP  119



>ref|XP_010051668.1| PREDICTED: uncharacterized protein LOC104440438 [Eucalyptus grandis]
Length=133

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            A L PCLGAA+D +AKVPP CC  V AL+   P+CLC VLLSP A +V + P  A++IPK
Sbjct  43   AMLSPCLGAARDPQAKVPPPCCANVSALIGKGPRCLCAVLLSPAAKEVRIIPKAAISIPK  102

Query  311  RCIIKNRPVGKKC---GRYTIP  255
            RC +  R  G +C    + T+P
Sbjct  103  RCNM--RKAGSECRVAAKSTVP  122



>ref|NP_001149502.1| lipid binding protein precursor [Zea mays]
 gb|ACG35643.1| lipid binding protein [Zea mays]
Length=115

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA++  +     CC  V  + K +P+CLC V+LS  A K G+ P +A+TIP
Sbjct  36   ALKLAPCASAAQNPSSAPSNGCCTAVHTIGKQSPQCLCAVMLSKTAKKSGIKPEVAITIP  95

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  96   KRCNLVDRPVGYKCGDYTLP  115



>ref|XP_008370014.1| PREDICTED: non-specific lipid-transfer protein 3 [Malus domestica]
Length=118

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -3

Query  497  PAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
             AA L PC  AA+D +A V  +CC  V  + +    CLC +LLS  A   GV   +A+TI
Sbjct  39   EAAKLAPCADAAQDEKAAVSASCCQIVKRMGQN-TSCLCAILLSDAAKSSGVKLEVAITI  97

Query  317  PKRCIIKNRPVGKKCGRYTIP  255
            PKRC + NRPVG KCG YT+P
Sbjct  98   PKRCNLANRPVGYKCGGYTLP  118



>ref|XP_011094930.1| PREDICTED: uncharacterized protein LOC105174503 [Sesamum indicum]
Length=167

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D +A V  +CC +V  + +  P+CLC VLLS  A   GV P +A++IP
Sbjct  89   AVQLAPCAAAARDGKAPVSKSCCLQVKRIGQN-PRCLCAVLLSNAAKAAGVKPQVAISIP  147

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   +RPVG KCG YT+P
Sbjct  148  KRCGFAHRPVGYKCGPYTLP  167



>ref|XP_007026868.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY07370.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 2 [Theobroma cacao]
Length=116

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V  +CC +V  + ++ P CLC V+LS  A   G+ P IA+TIP
Sbjct  40   AIKLAPCAEAAQDQNAAVSASCCDQVRKIGRS-PSCLCAVMLSNTAKASGIKPEIAITIP  98

Query  314  KRCIIKNRPVGKKCGR  267
            KRC I NRPVG KCGR
Sbjct  99   KRCNIANRPVGYKCGR  114



>ref|XP_006289082.1| hypothetical protein CARUB_v10002488mg [Capsella rubella]
 gb|EOA21980.1| hypothetical protein CARUB_v10002488mg [Capsella rubella]
Length=130

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  AKV  TCC +V  + K  PKCLC V+LS  A   G  P I++TIP
Sbjct  38   AIKLAPCAMAAQDTSAKVSSTCCARVKQMGKN-PKCLCAVMLSSTARSSGAKPEISMTIP  96

Query  314  KRCIIKNRPVGKKCGRYTI  258
            KRC I  RP+G KCG   I
Sbjct  97   KRCNIATRPIGYKCGGNNI  115



>ref|XP_003516311.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=127

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ AAKD +A+V   CC ++  L K  P CLC V+LS  A   G +P +A+TIP
Sbjct  41   AIKLIPCVSAAKDEKAEVTQNCCAQIEKLGKN-PSCLCAVMLSNTAKMSGADPKVAITIP  99

Query  314  KRCIIKNRPVGKKCG  270
            KRC + NRP+G KCG
Sbjct  100  KRCNLANRPIGYKCG  114



>ref|XP_008441410.1| PREDICTED: uncharacterized protein LOC103485536 [Cucumis melo]
Length=125

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+GA+KDA   V   CC +V  L ++   CLC V+LS  A  VG  P IA+TIP
Sbjct  47   AFKMMPCMGASKDADYPVSQRCCDQVKKLGQST-SCLCAVMLSKTAELVGSKPEIAITIP  105

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG  CG Y +P
Sbjct  106  KRCNIVDRPVGYNCGGYILP  125



>ref|XP_002323530.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEF05291.1| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=116

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D +A V  +CC +V   +   P CLC V+LS  A   GV    A+TIP
Sbjct  38   AMKLAPCAEAAQDEKAAVSDSCCLQV-KRMGQKPSCLCAVMLSDTAKASGVKIETAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  97   KRCNIANRPVGYKCGGYTLP  116



>ref|XP_004967664.1| PREDICTED: non-specific lipid-transfer protein 4-like [Setaria 
italica]
Length=114

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC+ AA D ++    +CC  V  + ++ P CLC V+LS  A   G+ P +A+TIPKRC
Sbjct  39   LAPCISAADDPQSTPTSSCCSAVHTIGQS-PSCLCAVMLSRTASAAGIKPEVAITIPKRC  97

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  98   NMADRPVGYKCGDYTLP  114



>dbj|BAB10801.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAH56925.1| AT5G05960 [Arabidopsis thaliana]
Length=174

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  497  PAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
             A  L PC  AA+D  AKV   CC +V  + +  PKCLC V+LS  A   G  P I++TI
Sbjct  37   EAIKLAPCAMAAQDTSAKVSAICCARVKQMGQN-PKCLCAVMLSSTARSSGAKPEISMTI  95

Query  317  PKRCIIKNRPVGKKCG  270
            PKRC I NRPVG KCG
Sbjct  96   PKRCNIANRPVGYKCG  111



>ref|XP_003623161.1| Protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
Length=238

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AAKD  A V  +CC +V  L +  P CLC V+LS +A   G NP IAVTIP
Sbjct  39   AFKLIPCASAAKDENASVSQSCCAQVKKLGQN-PSCLCAVMLSNVAKMSGANPQIAVTIP  97

Query  314  KRCIIKNRPVGKKCGR  267
            KRC + +RPVG KCGR
Sbjct  98   KRCNLADRPVGYKCGR  113


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            L   P CLC VLLS +A   GVNP IA TIPKRC + +RPVG KCG YT+P
Sbjct  188  LGQNPSCLCAVLLSNVAKMSGVNPQIASTIPKRCNLADRPVGYKCGPYTLP  238



>ref|NP_001152452.1| LOC100286092 precursor [Zea mays]
 ref|XP_008669779.1| PREDICTED: non-specific lipid-transfer protein 4-like [Zea mays]
 gb|ACG47693.1| lipid binding protein [Zea mays]
 tpg|DAA38906.1| TPA: lipid binding protein [Zea mays]
 tpg|DAA44295.1| TPA: lipid binding protein [Zea mays]
Length=111

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            + PC+ AA D ++    +CC  V  + ++ P CLC V+LS  A   G+ P +A+TIPKRC
Sbjct  36   MAPCISAADDPQSTPTSSCCSAVHTIGQS-PSCLCAVMLSGTARAAGIKPEVAITIPKRC  94

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  95   NMADRPVGYKCGDYTLP  111



>ref|XP_006851361.1| hypothetical protein AMTR_s00050p00224240 [Amborella trichopoda]
 gb|ERN12942.1| hypothetical protein AMTR_s00050p00224240 [Amborella trichopoda]
Length=114

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = -3

Query  608  NMKVSYAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTC  429
            NMK  + A + YLL S A+L   +    CG     ++ A  L  C+ AAK+   K P +C
Sbjct  4    NMKTLFIA-ISYLLFSNAILLGVSGDGACGNTSIFSV-AWGLTSCVDAAKNPSVKPPRSC  61

Query  428  CGKVGALL-KTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKC  273
            C K   +  KT+  C+C V  SP A +VG+ PA+A+TI KRC +KN+PVG +C
Sbjct  62   CAKTADIFSKTSAGCICSVFFSPHARQVGIKPAVAITILKRCGLKNQPVGYRC  114



>ref|XP_010529789.1| PREDICTED: non-specific lipid-transfer protein 3-like [Tarenaya 
hassleriana]
Length=114

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D+ A VP  CC +V    +  PKCLC VLLS  A   GVNP IA++IP
Sbjct  36   AMKLAPCAAAAQDSNAAVPAACCAQVKRFGQN-PKCLCAVLLSDTAKASGVNPEIAISIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>ref|XP_004307588.1| PREDICTED: uncharacterized protein LOC101311041 [Fragaria vesca 
subsp. vesca]
Length=118

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = -3

Query  587  AFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKVPPTCCGKVGAL  408
            AFV+ L  +Q   F+ A  AG       +  A  L PC  AA+   A V   CC +V  +
Sbjct  12   AFVVLLGVAQ---FNAAYGAGECGKSSPDSEAWKLIPCASAAQSENAAVSAKCCTQVKRI  68

Query  407  LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
             +  P CLC V+LS  A   GV P IA+TIPKRC I +RP+G KCG YT+P
Sbjct  69   GQN-PSCLCAVMLSNTAKSSGVKPEIAITIPKRCNIPDRPIGYKCGAYTLP  118



>ref|XP_003579713.1| PREDICTED: non-specific lipid-transfer protein-like [Brachypodium 
distachyon]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  A +D  +     CC  V  + K +PKCLC V+LS  A   G+ P  A+TIPKRC
Sbjct  44   LAPCASAGQDPASAPSSGCCTAVHTIGKQSPKCLCAVMLSNTARSAGIKPEAAITIPKRC  103

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  104  NLVDRPVGYKCGAYTLP  120



>ref|XP_003568670.1| PREDICTED: non-specific lipid-transfer protein 4-like [Brachypodium 
distachyon]
Length=118

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            + PC+ AA D  +    +CC  V  + K+ P CLC V+LS  A   G+ P +A+TIPKRC
Sbjct  43   MAPCISAADDPNSAPTSSCCSAVHTIGKS-PSCLCAVMLSNTANMAGIKPEVAITIPKRC  101

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RP+G KCG YT+P
Sbjct  102  NMADRPIGYKCGDYTLP  118



>ref|NP_001236334.1| uncharacterized protein LOC100306273 precursor [Glycine max]
 gb|ACU14379.1| unknown [Glycine max]
Length=125

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ AAKD   KV   CC ++  L K  P CLC V+LS  A   G +P +A+TIP
Sbjct  41   AIKLIPCVSAAKDENVKVTKNCCAQIEKLGKN-PSCLCAVMLSNTAKMSGADPKVAITIP  99

Query  314  KRCIIKNRPVGKKCG  270
            KRC + NRPVG KCG
Sbjct  100  KRCNLANRPVGYKCG  114



>ref|XP_009421327.1| PREDICTED: uncharacterized protein LOC104000899 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            + PC  A +DA+  VP  CC  V    +  P CLC ++LS  +   GV P IAVTIPKRC
Sbjct  78   VTPCGAATRDAKVVVPGRCCAAVQRFGRN-PICLCAIMLSTTSKNAGVKPEIAVTIPKRC  136

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  137  NLADRPVGYKCGDYTLP  153



>ref|XP_004975590.1| PREDICTED: non-specific lipid-transfer protein-like isoform X1 
[Setaria italica]
Length=114

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA++  +     CC  V  + K + +CLC V+LS  A   G+ P +A+TIPKRC
Sbjct  38   LAPCASAAQNPSSAPSAGCCSAVRTIGKQSRECLCAVMLSSTARSAGIKPEVAITIPKRC  97

Query  305  IIKNRPVGKKCGRYTIP  255
             I +RPVG KCG YT+P
Sbjct  98   NIADRPVGYKCGAYTLP  114



>ref|XP_002281554.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
 emb|CBI31585.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA++ +A    +CC +V  + +  P CLC V+LS  A   G+ P +AVTIP
Sbjct  40   AWKLAPCEAAAQNEKAAPSKSCCLQVKKIGQN-PDCLCAVMLSNTAKSSGIKPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCNLADRPVGYKCGAYTLP  118



>ref|XP_010321678.1| PREDICTED: uncharacterized protein LOC101257668 [Solanum lycopersicum]
Length=114

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  500  IPAASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVT  321
            + A  L PC  AA D  A V  +CC ++  L +   KCLC V+LS  A   G NP +A+T
Sbjct  32   MEAMKLIPCAEAASDENASVSRSCCLQIKKLGQNT-KCLCAVMLSNTAKSSGANPVVAIT  90

Query  320  IPKRCIIKNRPVGKKCGRYTI  258
            IPKRC + NRPVG KCG + +
Sbjct  91   IPKRCNLANRPVGYKCGYHVM  111



>ref|XP_004138444.1| PREDICTED: uncharacterized protein LOC101209106 [Cucumis sativus]
 ref|XP_004159792.1| PREDICTED: uncharacterized protein LOC101223941 [Cucumis sativus]
 gb|KGN45753.1| hypothetical protein Csa_6G008840 [Cucumis sativus]
Length=123

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+GA+KD    V   CC +V  L ++   CLC V+LS  A  VG  P IA+TIP
Sbjct  45   AFKMMPCMGASKDVDYPVSQRCCDQVKKLGQST-SCLCAVMLSKTAELVGSKPDIAITIP  103

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I +RPVG  CG Y +P
Sbjct  104  KRCNIVDRPVGYNCGGYVLP  123



>ref|XP_008233678.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=122

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D   +VPP CC     + K    CLC ++LS  A  +G+NP +AVTIP
Sbjct  45   AYKLAPCAAAAQDKNVEVPPNCCS---LMQKVRTSCLCAIILSKEAKSLGINPVVAVTIP  101

Query  314  KRCIIKNRPVGKKCGRYTI  258
            KRC +  RP G KCG Y +
Sbjct  102  KRCKVAGRPRGYKCGAYVM  120



>gb|KCW64435.1| hypothetical protein EUGRSUZ_G02050 [Eucalyptus grandis]
Length=109

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            A L PC+ A ++A+AKVPP CC +V +L++  P+CL VV  SP A   G+ PA A++IPK
Sbjct  37   AGLSPCMVAGRNAQAKVPPACCDRVKSLMQINPRCLDVVFHSPAARFAGIVPAAAMSIPK  96

Query  311  RCIIKNRPVGKK  276
            RC I+N P  + 
Sbjct  97   RCNIRNGPARRN  108



>ref|XP_002446446.1| hypothetical protein SORBIDRAFT_06g016170 [Sorghum bicolor]
 gb|EES10774.1| hypothetical protein SORBIDRAFT_06g016170 [Sorghum bicolor]
Length=117

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D  +    +CCG V ++ K +PKCLC V+LS  A   G+   +A+TIPKRC
Sbjct  41   LAPCASAAEDPSSAPSSSCCGAVHSIGKQSPKCLCAVMLSNTAKSAGIKAEVAITIPKRC  100

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  101  NLVDRPVGYKCGDYTLP  117



>ref|XP_010068677.1| PREDICTED: uncharacterized protein LOC104455611 [Eucalyptus grandis]
Length=118

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            A L PC+ A ++A+AKVPP CC +V +L++  P+CL VV  SP A   G+ PA A++IPK
Sbjct  46   AGLSPCMVAGRNAQAKVPPACCDRVKSLMQINPRCLDVVFHSPAARFAGIVPAAAMSIPK  105

Query  311  RCIIKNRPVGKK  276
            RC I+N P  + 
Sbjct  106  RCNIRNGPARRN  117



>gb|ABQ41972.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Sonneratia apetala]
Length=118

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA+A V  +CC +V ++ +  P CLC V+LS +A   G+   IA+TIP
Sbjct  40   AMKLAPCAMAAQDAKAAVSDSCCAQVRSIGQN-PSCLCAVMLSDMAKASGIKAEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCNIANRPVGYKCGDYTLP  118



>ref|XP_010553268.1| PREDICTED: putative lipid-transfer protein DIR1 [Tarenaya hassleriana]
Length=113

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D+ A VP  CC +V    +  PKCLC VLLS  A   GV P IA++IP
Sbjct  35   AMKLAPCAAAAQDSNAAVPAACCAQVKRFGQN-PKCLCAVLLSDTAKASGVRPEIAISIP  93

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  94   KRCNFANRPVGYKCGPYTLP  113



>gb|ABQ41969.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Sonneratia alba]
Length=118

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA+A V  +CC +V ++ +  P CLC V+LS +A   G+   IA+TIP
Sbjct  40   AMKLAPCAMAAQDAKAAVSDSCCAQVRSIGQN-PSCLCAVMLSDMAKASGIKAEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCNIANRPVGYKCGDYTLP  118



>gb|ABQ41971.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Sonneratia ovata]
Length=118

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA+A V  +CC +V ++ +  P CLC V+LS +A   G+   IA+TIP
Sbjct  40   AMKLAPCAMAAQDAKAAVSDSCCAQVRSIGQN-PSCLCSVMLSDMAKASGIKAEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCNIANRPVGYKCGDYTLP  118



>ref|XP_010427061.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=114

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANAAVPGGCCAQIKRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>ref|XP_010066526.1| PREDICTED: uncharacterized protein LOC104453617 [Eucalyptus grandis]
Length=179

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -3

Query  488  SLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKR  309
            +L PC+ AA+DA+AKV  TCC +V +L ++ P+CL  V  SP A  VGV PA+A++IPKR
Sbjct  108  NLNPCMVAARDAKAKVSHTCCERVKSLRQSNPRCLYAVFHSPEARFVGVVPAVAMSIPKR  167

Query  308  CIIKN  294
            C I N
Sbjct  168  CNIGN  172



>gb|ABQ41970.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Sonneratia caseolaris]
Length=118

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA+A V  +CC +V ++ +  P CLC V+LS +A   G+   IA+TIP
Sbjct  40   AMKLAPCAMAAQDAKAAVSDSCCTQVRSIGQN-PSCLCAVMLSDMAKASGIKAEIAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  99   KRCNIANRPVGYKCGDYTLP  118



>ref|XP_010504186.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
 ref|XP_010515908.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=114

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANAAVPGGCCAQIKRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>ref|XP_010515910.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=114

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANAAVPGGCCAQIKRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFANRPVGYKCGPYTLP  114



>ref|XP_006403632.1| hypothetical protein EUTSA_v10010835mg [Eutrema salsugineum]
 gb|ESQ45085.1| hypothetical protein EUTSA_v10010835mg [Eutrema salsugineum]
Length=114

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC GAA+DA A VP  CC ++    +  PKCLC VLLS  A   GV P +A+TIP
Sbjct  36   AMKLAPCAGAAQDANAAVPGGCCAQIRRFSQN-PKCLCAVLLSDTAKASGVQPEVALTIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  95   KRCNFVNRPVGYKCGPYTLP  114



>gb|EMT13746.1| hypothetical protein F775_52528 [Aegilops tauschii]
Length=123

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ A KD  +K    CC  V  + + +P CLC VLLS +  +VGV P +A+T+ 
Sbjct  40   ALKLVPCVAAGKDPDSKPSDRCCAAVKEIGERSPACLCAVLLSKIVRRVGVKPEVAITM-  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
             RC + +RP+G KCG YT+P
Sbjct  99   -RCALADRPIGYKCGDYTMP  117



>ref|XP_004302694.1| PREDICTED: uncharacterized protein LOC101304684 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=112

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A SL PC  AA+DA+A V   CC +V   +   P CLC VLLS  A   GV P +A+TIP
Sbjct  34   AMSLAPCAMAAQDAKAAVSDGCCKQV-KRIGANPSCLCAVLLSDTAKSSGVKPEVAITIP  92

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  93   KRCNFANRPVGYKCGAYTLP  112



>ref|XP_010239887.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
isoform X1 [Brachypodium distachyon]
Length=125

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PCL AAKD  A    +CC  V  +   + +CLC VLLS    + GV   +A+TIP
Sbjct  35   ALKLAPCLTAAKDPEASPSKSCCAAVVDIWGHSTECLCAVLLSNTLKRFGVKVEVAITIP  94

Query  314  KRCIIKNRPVGKKCG  270
            KRC I NRP+G KCG
Sbjct  95   KRCNIANRPIGYKCG  109



>ref|XP_009358795.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=127

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A    PC  AA+  +A V  +CC +V  L +  P CLC +LLS  A   GV P +A+TIP
Sbjct  49   AFKFAPCAAAAQYEKAAVSNSCCQQVKRLGQN-PTCLCAILLSNTAKSSGVKPEVAITIP  107

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC   NRPVG KCG YT+P
Sbjct  108  KRCNFANRPVGYKCGAYTMP  127



>gb|ACN28324.1| unknown [Zea mays]
 tpg|DAA37880.1| TPA: hypothetical protein ZEAMMB73_166906 [Zea mays]
Length=119

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC  AA+D  +    +CC  V A+ K +P+CLC V+LS  A   G+   +A+TIPKRC
Sbjct  43   LAPCASAAEDPGSAPSGSCCSAVHAIGKQSPRCLCAVMLSNTARSAGIKAEVAITIPKRC  102

Query  305  IIKNRPVGKKCG  270
             + +RPVG KCG
Sbjct  103  NLADRPVGYKCG  114



>ref|XP_007010260.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY19070.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=118

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D +A V  +CC  +   LK  P CLC ++LS  A   GV P +AVTIP
Sbjct  40   AEKLAPCTKAAQDLKAPVSKSCCTVMEKKLKN-PGCLCAIMLSHTAKNAGVKPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRY  264
            KRC I  RPVG KCG +
Sbjct  99   KRCNIPVRPVGHKCGAF  115



>ref|XP_008233679.1| PREDICTED: uncharacterized protein LOC103332713 [Prunus mume]
Length=122

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L  C  + +D   +VPP CCG    + +    CLC ++LS  A  +G+NP +AVTIPKRC
Sbjct  48   LSSCAASGQDKNVEVPPKCCG---LMQRVRTSCLCAIILSKEARSLGINPVVAVTIPKRC  104

Query  305  IIKNRPVGKKCGRYTI  258
             I  RP   KCG Y +
Sbjct  105  KIAGRPRAYKCGAYVV  120



>ref|XP_006654200.1| PREDICTED: non-specific lipid-transfer protein 4-like [Oryza 
brachyantha]
Length=113

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L PC+ AA D ++    +CC  V  + ++ P CLC V+LS  A   G+ P +A+TIPKRC
Sbjct  38   LAPCVSAADDPQSAPSSSCCSAVHTIGQS-PSCLCAVMLSSTARAAGIKPEVAITIPKRC  96

Query  305  IIKNRPVGKKCGRYTIP  255
             + +RPVG KCG YT+P
Sbjct  97   NMADRPVGYKCGDYTLP  113



>emb|CAN84006.1| hypothetical protein VITISV_033735 [Vitis vinifera]
Length=170

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA D  A V  +CC +V  +++  P CLC V+LS  A   GVNP IA+TIP
Sbjct  40   ALKLIPCATAASDKNAAVSSSCCLQVKKIIQN-PSCLCAVVLSNXAKFSGVNPEIAITIP  98

Query  314  KRCIIKNRPVGKKCG  270
             RC   +RPVG KCG
Sbjct  99   XRCNXADRPVGFKCG  113



>ref|XP_002446445.1| hypothetical protein SORBIDRAFT_06g016160 [Sorghum bicolor]
 gb|EES10773.1| hypothetical protein SORBIDRAFT_06g016160 [Sorghum bicolor]
Length=117

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA++  +    +CC  V ++ K +PKCLC V+LS  A   G+   +A+TIP
Sbjct  38   ALKLAPCASAAQNPSSAPSSSCCSAVHSIGKQSPKCLCAVMLSKTAKSAGIKAEVAITIP  97

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RP+G KCG YT+P
Sbjct  98   KRCNLVDRPIGYKCGDYTLP  117



>ref|XP_011000060.1| PREDICTED: probable non-specific lipid-transfer protein 2 [Populus 
euphratica]
 ref|XP_011011691.1| PREDICTED: probable non-specific lipid-transfer protein 2 [Populus 
euphratica]
Length=116

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D +A V  +CC +V   +   P CLC V+LS  A   GV   IA+TIP
Sbjct  38   AMKLAPCAEAAQDEQAAVSDSCCLQV-KRMGQKPSCLCAVMLSDTAKASGVKTEIAITIP  96

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I NRPVG KCG YT+P
Sbjct  97   KRCNIANRPVGYKCGGYTLP  116



>gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Jatropha curcas]
 gb|ADU56178.1| hypothetical protein [Jatropha curcas]
Length=115

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
             +L  C  A  D  A V  +CC +   +++    CLC ++LS  A   G+ P +A+TIPK
Sbjct  38   GNLRSCGDAIHDQDAPVSESCCLEAKKIVQDT-SCLCAIVLSNTAKAAGMIPEVAITIPK  96

Query  311  RCIIKNRPVGKKCGRYTIP  255
            RC I +RPVG +CG YT+P
Sbjct  97   RCNIADRPVGHQCGDYTLP  115



>ref|NP_001054721.1| Os05g0160300 [Oryza sativa Japonica Group]
 gb|AAT93913.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV43925.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16635.1| Os05g0160300 [Oryza sativa Japonica Group]
 gb|EAY96643.1| hypothetical protein OsI_18557 [Oryza sativa Indica Group]
 dbj|BAH01661.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62419.1| hypothetical protein OsJ_17210 [Oryza sativa Japonica Group]
Length=117

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC+ AA D ++    +CC  V  + ++ P CLC V+LS  A   G+ P +A+TIP
Sbjct  39   ALRLAPCVSAADDPQSAPSSSCCSAVHTIGQS-PSCLCAVMLSNTARVAGIKPEVAITIP  97

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  98   KRCNMADRPVGYKCGDYTLP  117



>ref|XP_009419915.1| PREDICTED: uncharacterized protein LOC103999788 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=130

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC  AA+DAR  V   CC  V  + +  P CLC V+LS  A  VGV P +A+TIP
Sbjct  40   ALQMAPCASAAQDARLPVSAGCCAAVKKMGRN-PSCLCAVMLSDTAKSVGVKPDVAMTIP  98

Query  314  KRCIIKNRPVGKK  276
            KRC + +RPVG K
Sbjct  99   KRCNLADRPVGYK  111



>gb|KCW64434.1| hypothetical protein EUGRSUZ_G02049, partial [Eucalyptus grandis]
Length=131

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  488  SLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
            +L PC+ AA+DA+AKV  TCC +V +L ++ P+CL  V  SP A  VGV PA+A++IPK
Sbjct  73   NLNPCMVAARDAKAKVSHTCCERVKSLRQSNPRCLYAVFHSPEARFVGVVPAVAMSIPK  131



>gb|EEE55673.1| hypothetical protein OsJ_04081 [Oryza sativa Japonica Group]
Length=118

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  422  KVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            + GA  +  PKCLC V+LS  A   GV PA+A+TIPK   I NRP+G KCG YT+P
Sbjct  63   RAGAQHRANPKCLCAVMLSNTARSAGVKPAVAMTIPKGWAIANRPIGYKCGPYTLP  118



>gb|AFG58173.1| hypothetical protein CL3835Contig1_02, partial [Pinus taeda]
Length=88

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
            A SL PC+GAA +A+A VPP CC +V  +LK  P C+C V LSP+A +  +NPA+A++I
Sbjct  31   ALSLSPCIGAANNAKASVPPACCTQVKKVLKM-PSCMCAVFLSPIAKQARINPAVAISI  88



>gb|AFG58172.1| hypothetical protein CL3835Contig1_02, partial [Pinus taeda]
Length=88

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
            A SL PC+GAA +A+A VPP CC +V  +LK  P C+C V LSP+A +  +NPA+A++I
Sbjct  31   ALSLSPCIGAANNAKASVPPACCTQVKKVLKM-PTCMCAVFLSPIAKQARINPAVAISI  88



>gb|AFG58175.1| hypothetical protein CL3835Contig1_02, partial [Pinus taeda]
Length=88

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
            A SL PC+GAA +A+A VPP CC +V  +LK  P C+C V LSP+A +  +NPA+A++I
Sbjct  31   ALSLSPCIGAANNAKASVPPACCTQVKKVLKM-PTCMCAVFLSPIAKQARINPAVAISI  88



>gb|AFG58174.1| hypothetical protein CL3835Contig1_02, partial [Pinus taeda]
Length=88

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTI  318
            A SL PC+GAA +A+A VPP CC +V  +LK  P C+C V LSP+A +  +NPA+A++I
Sbjct  31   ALSLSPCIGAANNAKASVPPACCTQVKKVLKM-PACMCAVFLSPIAKQARINPAVAISI  88



>ref|XP_007219063.1| hypothetical protein PRUPE_ppa014695mg, partial [Prunus persica]
 gb|EMJ20262.1| hypothetical protein PRUPE_ppa014695mg, partial [Prunus persica]
Length=121

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L  C  + +D   +VPP CCG    + K    CLC ++LS  A  +G+NP +A TIPKRC
Sbjct  28   LASCAPSGQDENVEVPPKCCG---LIQKVRTSCLCAIILSKEAKSLGINPVVAATIPKRC  84

Query  305  IIKNRPVGKKCG  270
             I  RP G KCG
Sbjct  85   KIAGRPKGYKCG  96



>ref|XP_004302693.1| PREDICTED: uncharacterized protein LOC101304684 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=118

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A SL PC  AA+DA+A V   CC +V   +   P CLC VLLS  A   GV P +A+TIP
Sbjct  34   AMSLAPCAMAAQDAKAAVSDGCCKQV-KRIGANPSCLCAVLLSDTAKSSGVKPEVAITIP  92

Query  314  KRCIIKNRPVGKKC-GRYT  261
            KRC   NRPVG KC G YT
Sbjct  93   KRCNFANRPVGYKCGGNYT  111



>gb|ACS68664.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Sonneratia alba]
 gb|ACS68734.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Sonneratia alba]
Length=107

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+DA+A V  +CC +V ++ +  P CLC V+LS +A   G+   IA+TIP
Sbjct  34   AMKLAPCAMAAQDAKAAVSDSCCAQVRSIGQN-PSCLCAVMLSDMAKASGIKAEIAITIP  92

Query  314  KRCIIKNRPVGKKCG  270
            KRC I NRPVG KCG
Sbjct  93   KRCNIANRPVGYKCG  107



>emb|CAN78091.1| hypothetical protein VITISV_021194 [Vitis vinifera]
Length=118

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA++ +A    +CC +V  + +  P CLC V+LS  A   G+ P +AVTIP
Sbjct  40   AWKLAPCAAAAQNEKAAPSKSCCLQVKKIGQN-PDCLCAVMLSNTAKSSGIXPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  99   KRCNLADRPVGYKCGAYTLP  118



>dbj|BAJ93968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=114

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+ AA +  +    +CC  V  + K+ P CLC V+LS  A   G+ P +A+TIP
Sbjct  36   ALRMAPCISAADEPDSAPSSSCCSAVHTIGKS-PSCLCAVMLSGTAKMAGIKPEVAITIP  94

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG YT+P
Sbjct  95   KRCNMADRPVGYKCGDYTLP  114



>ref|XP_004977979.1| PREDICTED: uncharacterized protein LOC101756310 [Setaria italica]
Length=211

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGAL-LKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKR  309
            L PC  A +D  +     CC  V  +  + +P CLC +LLS      GVN    +TIPKR
Sbjct  130  LAPCASAVEDPESAPSAGCCAAVRDVGRRHSPGCLCALLLSDTVRHSGVNLDAVITIPKR  189

Query  308  CIIKNRPVGKKCGRYTIP  255
            C + +RPVG KCG YT+P
Sbjct  190  CNLASRPVGYKCGEYTLP  207



>ref|XP_010037780.1| PREDICTED: non-specific lipid-transfer protein 3-like [Eucalyptus 
grandis]
 gb|KCW49516.1| hypothetical protein EUGRSUZ_K03041 [Eucalyptus grandis]
Length=115

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -3

Query  443  VPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRY  264
            V  +CC +V ++ K  P CLC V+LS  A   G+    A+TIPKRC I +RPVG KCG Y
Sbjct  54   VSDSCCAQVKSIGKN-PSCLCAVMLSNTAKASGIKLETAITIPKRCNIADRPVGYKCGAY  112

Query  263  TIP  255
            T+P
Sbjct  113  TLP  115



>ref|NP_001052761.1| Os04g0415900 [Oryza sativa Japonica Group]
 emb|CAE01523.2| OJ991214_12.12 [Oryza sativa Japonica Group]
 dbj|BAF14675.1| Os04g0415900 [Oryza sativa Japonica Group]
 gb|EEE60975.1| hypothetical protein OsJ_14757 [Oryza sativa Japonica Group]
Length=123

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  389  CLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            CLC VLLS    + GV P +A+TIPKRC + NRPVG KCG YT+P
Sbjct  75   CLCAVLLSSTVRRSGVKPEVAITIPKRCKLANRPVGYKCGAYTLP  119



>gb|EMT13747.1| hypothetical protein F775_29623 [Aegilops tauschii]
Length=92

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -3

Query  428  CGKVGA---LLKTAP-KCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYT  261
            CGK  A    LK AP KCLC V+LS  A   G+ P +A++IPKRC + +RPVG KCG YT
Sbjct  31   CGKTPADKMALKLAPPKCLCAVMLSDTAKSAGIKPEVAMSIPKRCNLVDRPVGYKCGAYT  90

Query  260  IP  255
            +P
Sbjct  91   LP  92



>ref|XP_010327364.1| PREDICTED: uncharacterized protein LOC104649594 [Solanum lycopersicum]
Length=126

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  413  ALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            AL K     LC V+LS  A   G NP +A+TIPKRC + NRPVG KCG YT+P
Sbjct  74   ALDKEYEGFLCAVMLSNTAKSSGANPEVAITIPKRCNLANRPVGYKCGPYTLP  126



>gb|EEC77252.1| hypothetical protein OsI_15839 [Oryza sativa Indica Group]
Length=123

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  389  CLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            CLC VLLS    + GV P +A+TIPKRC + NRPVG KCG YT+P
Sbjct  75   CLCAVLLSSTVRRSGVKPEVAITIPKRCKLANRPVGYKCGAYTLP  119



>gb|ABK23220.1| unknown [Picea sitchensis]
Length=129

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 47/90 (52%), Gaps = 14/90 (16%)
 Frame = -3

Query  488  SLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVL-------------LSPLAMKV  348
            SL PC+GAA DA+A VP  CC +V  +L + P CLC V                 +  ++
Sbjct  40   SLTPCIGAASDAKASVPAICCIQVKKVL-SFPTCLCAVYSLFPGKQNKTDEKTDEIVQRI  98

Query  347  GVNPAIAVTIPKRCIIKNRPVGKKCGRYTI  258
            G N   A+TIP RC I N   G+KCG  TI
Sbjct  99   GFNMTSAITIPIRCNITNFLDGQKCGNKTI  128



>gb|ACJ09611.1| unknown [Cupressus sempervirens]
Length=76

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  401  TAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYT  261
            T   C+C V LSP+A + G+NPA+A+ IPKRC I NR  GK CG ++
Sbjct  3    TMHACMCAVFLSPIAKQAGINPAVAIGIPKRCNIANRYAGKSCGNWS  49



>gb|EMS64438.1| Rop guanine nucleotide exchange factor 1 [Triticum urartu]
Length=643

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  398  APKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGR  267
            +PKCLC V+LS  A + GV PA+A+TIPKRC I NRP+G KCG 
Sbjct  502  SPKCLCAVMLSSTARQAGVKPAVAMTIPKRCAIANRPIGYKCGH  545



>ref|XP_009344102.1| PREDICTED: uncharacterized protein LOC103935988 [Pyrus x bretschneideri]
Length=125

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L  C  +A+D    VP  CC  V    K    CLC +LLS  A  +G+ P +A TIPKRC
Sbjct  51   LASCAASAQDKNVAVPNKCCAVVS---KVRANCLCSILLSKEAKSLGIRPDVAATIPKRC  107

Query  305  IIKNRPVGKKCGRYTIP  255
             +  R  G KCG + +P
Sbjct  108  NVARRTRGYKCGAFIVP  124



>ref|XP_007219744.1| hypothetical protein PRUPE_ppa024140mg, partial [Prunus persica]
 gb|EMJ20943.1| hypothetical protein PRUPE_ppa024140mg, partial [Prunus persica]
Length=107

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+D  A V   CC +V  + +  P CLC V+LS  A   G+ P IA+TIP
Sbjct  28   AWKLAPCAAAAQDENAAVSDKCCSQVKRIGQN-PSCLCAVMLSNTAKSAGIKPEIALTIP  86

Query  314  KRCIIKNRPVGKKCG  270
            KRC I +RPVG KCG
Sbjct  87   KRCNIVDRPVGFKCG  101



>ref|XP_008372190.1| PREDICTED: uncharacterized protein LOC103435578 [Malus domestica]
 ref|XP_008343577.1| PREDICTED: uncharacterized protein LOC103406362 [Malus domestica]
Length=125

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = -3

Query  485  LEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRC  306
            L  C  +++D    VP  CC  V    K    CLC +LLS  A  +G+ P +A TIPKRC
Sbjct  51   LASCAASSQDKNVAVPNKCCAVVS---KVRTNCLCSILLSKEAKSLGIRPDVAATIPKRC  107

Query  305  IIKNRPVGKKCGRYTIP  255
             +  R  G KCG + +P
Sbjct  108  NVARRTRGYKCGAFIVP  124



>gb|KDP24532.1| hypothetical protein JCGZ_25096 [Jatropha curcas]
Length=147

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  491  ASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPK  312
             +L  C  A  D  A V  +CC +   +++    CLC ++LS  A   G+ P +A+TIPK
Sbjct  38   GNLRSCGDAIHDQDAPVSESCCLEAKKIVQDT-SCLCAIVLSNTAKAAGMIPEVAITIPK  96

Query  311  RCIIKNRPVGKKCG  270
            RC I +RPVG +CG
Sbjct  97   RCNIADRPVGHQCG  110



>gb|EMS64378.1| hypothetical protein TRIUR3_11133 [Triticum urartu]
Length=149

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+ AA +  +    +CC  V  L K+ P CLC V+LS  A   G+ P +A+TIP
Sbjct  40   ALRMAPCISAADEPDSAPSSSCCSAVHTLGKS-PSCLCAVMLSGTAKMAGIKPEVAITIP  98

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC + +RPVG KCG    P
Sbjct  99   KRCNMADRPVGYKCGAMLSP  118



>ref|XP_007009152.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY17962.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=156

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  AA+   A V   CC  +   LK  P CLC ++ S  A   GVNP +AVTIP
Sbjct  40   AEKLAPCTKAAQYLEAPVSKRCCTVMEKKLKN-PDCLCAIMFSHTARSAGVNPEVAVTIP  98

Query  314  KRCIIKNRPVGKKCGR  267
            KRC I  RP+     R
Sbjct  99   KRCNIPVRPLSHWFKR  114



>gb|ABB13624.1| LTP-like protein 2 [Astragalus sinicus]
Length=148

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (49%), Gaps = 3/117 (3%)
 Frame = -3

Query  614  LFNMKVS--YAAFVLYLLASQAVLFDKanaagcgqggcgNIPAASLEPCLGAAKDARAKV  441
            + N KV+      V+ L+AS+ ++ +             ++ A SL PCL AA +    V
Sbjct  2    VMNFKVTSFIITMVMILMASRVLVLEADLIWPHCGRTYKSV-ARSLNPCLDAAHNMTTNV  60

Query  440  PPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCG  270
            P  CC  V  LL+  P CLC  LLS +A+K  +  + AV IP RC +      KKC 
Sbjct  61   PTICCSMVDVLLQMQPLCLCETLLSYIAIKPEIILSAAVAIPSRCNLHYPYNIKKCA  117



>ref|XP_010108369.1| hypothetical protein L484_010376 [Morus notabilis]
 gb|EXC19360.1| hypothetical protein L484_010376 [Morus notabilis]
Length=119

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L  C  A K     VP  CC  V ++ +  P+CLC V LS  A KVGV P IA+ + 
Sbjct  37   AWKLGTCELATKARNIDVPVKCCNLVRSMAQN-PRCLCTVALSETARKVGVLPHIALDVV  95

Query  314  KRCIIKNRPVGKK  276
            KRC + NRPVG  
Sbjct  96   KRCGVSNRPVGSN  108



>gb|EEC71805.1| hypothetical protein OsI_04438 [Oryza sativa Indica Group]
Length=40

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  374  LLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGRYTIP  255
            +LS  A   GV PA+A+TIPKRC I NRP+G KCG YT+P
Sbjct  1    MLSNTARSAGVKPAVAMTIPKRCAIANRPIGYKCGPYTLP  40



>gb|EMT10440.1| hypothetical protein F775_27055 [Aegilops tauschii]
Length=155

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  + PC+ AA +  +    +CC  V  + K+ P CLC V+LS  A   G+ P +A+TIP
Sbjct  51   ALRMAPCISAADEPDSAPSSSCCSAVHTIGKS-PSCLCAVMLSGTAKMAGIKPEVAITIP  109

Query  314  KRCIIKNRPVGKKCG  270
            KRC + +RPVG KCG
Sbjct  110  KRCNMADRPVGYKCG  124



>emb|CDY07566.1| BnaC06g14980D [Brassica napus]
Length=107

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  392  KCLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCGR-YT  261
            KCLC VLLS      GV P  A+TIPKRC   NRP+G KCGR YT
Sbjct  56   KCLCAVLLSDTVKASGVQPETALTIPKRCNFANRPIGYKCGRKYT  100



>emb|CAH67591.1| OSIGBa0092M08.3 [Oryza sativa Indica Group]
Length=124

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  389  CLCVVLLSPLAMKVGVNPAIAVTIPKRCIIKNRPVGKKCG  270
            CLC VLLS    + GV P +A+TIPKRC + NRPVG KCG
Sbjct  75   CLCAVLLSSTVRRSGVKPEVAITIPKRCKLANRPVGYKCG  114



>gb|AFG46650.1| hypothetical protein 0_4936_01, partial [Pinus taeda]
 gb|AFG46651.1| hypothetical protein 0_4936_01, partial [Pinus taeda]
 gb|AFG46652.1| hypothetical protein 0_4936_01, partial [Pinus taeda]
 gb|AFG46653.1| hypothetical protein 0_4936_01, partial [Pinus taeda]
 gb|AFG46654.1| hypothetical protein 0_4936_01, partial [Pinus taeda]
Length=99

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVL-LSP-------LAMKVGVN  339
            A S+ PC+ AA D  A VP  CC +V  LL + P C C +   SP       L  ++G+N
Sbjct  14   AVSMVPCVEAASDGNASVPALCCIQVKKLL-SFPTCACAIYKYSPPGQQQDELVQRLGIN  72

Query  338  PAIAVTIPKRCIIKNRPVGKKCGRYT  261
             ++A+TIP+RC + +    ++CG  T
Sbjct  73   ISVAITIPQRCNLSDLLAQQRCGNNT  98



>gb|KDO57975.1| hypothetical protein CISIN_1g043659mg, partial [Citrus sinensis]
Length=112

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query  494  AASLEPCLGAAKDARAKVPPTCCGKVGALLKTAPKCLCVVLLSPLAMKVGVNPAIAVTIP  315
            A  L PC  A +D +  V   C   V  + +  P CLC VLLS  A   GV P +A+TIP
Sbjct  34   AMKLSPCATAPQDEKVPVSAGCRRNVQRIGQN-PNCLCAVLLSDTAKLSGVKPQVAITIP  92

Query  314  KRCIIKNRPVGKKCGRYTIP  255
            KRC I   P    CG  TIP
Sbjct  93   KRCNITKLPADYVCGPCTIP  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1022319201388