BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85685_g1_i1 len=2194 path=[2172:0-2193]

Length=2194
                                                                      Score     E

ref|XP_009781147.1|  PREDICTED: cellulose synthase-like protein H...    777   0.0      
ref|XP_009588345.1|  PREDICTED: cellulose synthase-like protein H1      770   0.0      
ref|XP_006364166.1|  PREDICTED: cellulose synthase-like protein H...    762   0.0      
ref|XP_004243487.1|  PREDICTED: cellulose synthase-like protein H1      754   0.0      
ref|XP_006364167.1|  PREDICTED: cellulose synthase-like protein H...    714   0.0      
emb|CDP19391.1|  unnamed protein product                                682   0.0      
ref|XP_008229979.1|  PREDICTED: cellulose synthase-like protein B...    680   0.0      
ref|XP_010035546.1|  PREDICTED: cellulose synthase-like protein H...    675   0.0      
ref|XP_010035545.1|  PREDICTED: cellulose synthase-like protein B4      671   0.0      
ref|XP_008229978.1|  PREDICTED: cellulose synthase-like protein B...    671   0.0      
ref|XP_007049091.1|  Cellulose synthase-like B3, putative               670   0.0      
ref|XP_010657216.1|  PREDICTED: cellulose synthase-like protein H1      669   0.0      
ref|XP_007217027.1|  hypothetical protein PRUPE_ppa001909mg             667   0.0      
ref|XP_002529325.1|  transferase, putative                              665   0.0      Ricinus communis
ref|XP_010089469.1|  Cellulose synthase-like protein H1                 665   0.0      
ref|XP_002302868.1|  cellulose synthase family protein                  664   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI28826.3|  unnamed protein product                                662   0.0      
ref|XP_009353304.1|  PREDICTED: cellulose synthase-like protein H...    662   0.0      
ref|XP_007217825.1|  hypothetical protein PRUPE_ppa026099mg             661   0.0      
gb|KDP30772.1|  hypothetical protein JCGZ_13715                         659   0.0      
ref|XP_009353303.1|  PREDICTED: cellulose synthase-like protein H...    660   0.0      
ref|XP_011047235.1|  PREDICTED: cellulose synthase-like protein H1      659   0.0      
ref|XP_009347136.1|  PREDICTED: cellulose synthase-like protein H1      657   0.0      
ref|XP_008229980.1|  PREDICTED: cellulose synthase-like protein B...    657   0.0      
ref|XP_002269831.2|  PREDICTED: cellulose synthase-like protein H1      657   0.0      Vitis vinifera
ref|XP_011007182.1|  PREDICTED: cellulose synthase-like protein H1      656   0.0      
ref|XP_010657214.1|  PREDICTED: cellulose synthase-like protein H1      654   0.0      
ref|XP_010252472.1|  PREDICTED: cellulose synthase-like protein H...    654   0.0      
gb|AFZ78580.1|  cellulose synthase-like protein                         651   0.0      
emb|CBI28833.3|  unnamed protein product                                673   0.0      
ref|XP_008229981.1|  PREDICTED: cellulose synthase-like protein B...    645   0.0      
ref|XP_004287960.1|  PREDICTED: cellulose synthase-like protein H...    646   0.0      
ref|XP_010035551.1|  PREDICTED: cellulose synthase-like protein B4      644   0.0      
emb|CBI28829.3|  unnamed protein product                                643   0.0      
ref|XP_007049092.1|  Cellulose synthase-like B3, putative isoform 1     642   0.0      
ref|XP_010657215.1|  PREDICTED: cellulose synthase-like protein H1      641   0.0      
ref|XP_003633282.1|  PREDICTED: cellulose synthase-like protein H1      640   0.0      
gb|KCW46974.1|  hypothetical protein EUGRSUZ_K00782                     643   0.0      
ref|XP_008229982.1|  PREDICTED: cellulose synthase-like protein B...    627   0.0      
ref|XP_009416905.1|  PREDICTED: cellulose synthase-like protein H1      626   0.0      
ref|XP_008342031.1|  PREDICTED: cellulose synthase-like protein H...    626   0.0      
ref|XP_009347146.1|  PREDICTED: cellulose synthase-like protein H1      624   0.0      
ref|XP_008342032.1|  PREDICTED: cellulose synthase-like protein H...    623   0.0      
ref|XP_010252474.1|  PREDICTED: cellulose synthase-like protein H...    617   0.0      
ref|XP_006592368.1|  PREDICTED: uncharacterized LOC100500469 isof...    622   0.0      
gb|KHN21212.1|  Cellulose synthase-like protein H1                      620   0.0      
ref|XP_003540273.1|  PREDICTED: cellulose synthase-like protein H...    620   0.0      
gb|KHN44861.1|  Cellulose synthase-like protein B3                      617   0.0      
ref|XP_007132522.1|  hypothetical protein PHAVU_011G101500g             617   0.0      
ref|XP_010930912.1|  PREDICTED: cellulose synthase-like protein H...    616   0.0      
ref|XP_006582368.1|  PREDICTED: cellulose synthase-like protein H...    615   0.0      
ref|XP_007049095.1|  Cellulose synthase-like B4, putative isoform 1     613   0.0      
gb|KDO54720.1|  hypothetical protein CISIN_1g006639mg                   610   0.0      
ref|XP_007049096.1|  Cellulose synthase-like B4, putative isoform 2     613   0.0      
ref|XP_003539496.1|  PREDICTED: cellulose synthase-like protein H...    613   0.0      
ref|XP_006582367.1|  PREDICTED: cellulose synthase-like protein H...    613   0.0      
gb|KEH29713.1|  cellulose synthase H1-like protein                      613   0.0      
ref|XP_008781463.1|  PREDICTED: cellulose synthase-like protein H...    613   0.0      
ref|XP_004487427.1|  PREDICTED: cellulose synthase-like protein H...    612   0.0      
ref|XP_004151897.1|  PREDICTED: cellulose synthase-like protein H...    611   0.0      
ref|XP_008342030.1|  PREDICTED: cellulose synthase-like protein H1      610   0.0      
ref|XP_006469655.1|  PREDICTED: cellulose synthase-like protein B...    610   0.0      
ref|XP_008455914.1|  PREDICTED: cellulose synthase-like protein H...    610   0.0      
ref|XP_004487429.1|  PREDICTED: cellulose synthase-like protein H...    609   0.0      
ref|XP_003596942.1|  Cellulose synthase-like protein H1                 609   0.0      
gb|KHN44862.1|  Cellulose synthase-like protein H1                      609   0.0      
ref|XP_004487428.1|  PREDICTED: cellulose synthase-like protein H...    608   0.0      
ref|XP_003539497.1|  PREDICTED: cellulose synthase-like protein H...    608   0.0      
gb|KHN18003.1|  Cellulose synthase-like protein H1                      607   0.0      
ref|XP_003540275.1|  PREDICTED: cellulose synthase-like protein H...    608   0.0      
ref|XP_010244467.1|  PREDICTED: cellulose synthase-like protein H...    608   0.0      
ref|XP_010244466.1|  PREDICTED: cellulose synthase-like protein H...    608   0.0      
ref|XP_003540290.1|  PREDICTED: cellulose synthase-like protein H...    606   0.0      
ref|XP_008781464.1|  PREDICTED: cellulose synthase-like protein H...    606   0.0      
ref|XP_010035547.1|  PREDICTED: cellulose synthase-like protein H...    602   0.0      
ref|XP_004151937.1|  PREDICTED: cellulose synthase-like protein H...    604   0.0      
ref|XP_004151936.1|  PREDICTED: cellulose synthase-like protein H...    604   0.0      
ref|XP_007217162.1|  hypothetical protein PRUPE_ppa001889mg             604   0.0      
gb|EMT26547.1|  Cellulose synthase-like protein H1                      603   0.0      
gb|KGN63228.1|  hypothetical protein Csa_2G416190                       603   0.0      
ref|XP_004158577.1|  PREDICTED: cellulose synthase-like protein H...    602   0.0      
ref|XP_004151939.1|  PREDICTED: cellulose synthase-like protein H...    602   0.0      
gb|KHN18006.1|  Cellulose synthase-like protein H1                      602   0.0      
gb|KGN63235.1|  hypothetical protein Csa_2G416250                       602   0.0      
ref|XP_008455906.1|  PREDICTED: cellulose synthase-like protein H...    602   0.0      
ref|XP_004287961.1|  PREDICTED: cellulose synthase-like protein H...    602   0.0      
ref|XP_003579750.1|  PREDICTED: cellulose synthase-like protein H1      601   0.0      
ref|XP_007149991.1|  hypothetical protein PHAVU_005G116700g             601   0.0      
ref|XP_003596945.1|  Cellulose synthase-like protein H1                 600   0.0      
ref|XP_004487424.1|  PREDICTED: cellulose synthase-like protein B...    599   0.0      
ref|XP_004487423.1|  PREDICTED: cellulose synthase-like protein B...    598   0.0      
ref|XP_008455907.1|  PREDICTED: cellulose synthase-like protein H...    598   0.0      
ref|XP_006594901.1|  PREDICTED: cellulose synthase-like protein H...    597   0.0      
gb|KHN36521.1|  Cellulose synthase-like protein B3                      596   0.0      
gb|AES67197.2|  cellulose synthase H1-like protein                      596   0.0      
ref|XP_004506255.1|  PREDICTED: cellulose synthase-like protein H...    592   0.0      
ref|XP_004506254.1|  PREDICTED: cellulose synthase-like protein H...    592   0.0      
gb|ADO34997.1|  cellulose synthase-like protein H1                      591   0.0      
gb|ACN67534.1|  cellulose synthase-like protein H1                      588   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_003596946.1|  Cellulose synthase-like protein H1                 585   0.0      
ref|XP_009781148.1|  PREDICTED: cellulose synthase-like protein B...    572   0.0      
ref|XP_007049097.1|  Cellulose synthase-like B3, putative isoform 3     575   0.0      
ref|XP_008669411.1|  PREDICTED: cellulose synthase-like protein H...    581   0.0      
gb|KEH39000.1|  cellulose synthase H1-like protein                      573   0.0      
ref|XP_008669412.1|  PREDICTED: cellulose synthase-like protein H...    578   0.0      
ref|XP_008455908.1|  PREDICTED: cellulose synthase-like protein H...    570   0.0      
ref|XP_008669410.1|  PREDICTED: cellulose synthase-like protein H...    577   0.0      
ref|XP_006847115.1|  hypothetical protein AMTR_s00017p00225060          575   0.0      
gb|KDO54721.1|  hypothetical protein CISIN_1g006639mg                   568   0.0      
gb|AAL38531.1|AF435646_1  CSLH1                                         573   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064384.1|  Os10g0341700                                       573   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AES67199.2|  cellulose synthase H1-like protein                      572   0.0      
gb|KGN63226.1|  hypothetical protein Csa_2G416170                       572   0.0      
ref|XP_004975623.1|  PREDICTED: cellulose synthase-like protein H...    574   0.0      
ref|XP_007149989.1|  hypothetical protein PHAVU_005G116500g             590   0.0      
ref|XP_007149984.1|  hypothetical protein PHAVU_005G116200g             571   0.0      
ref|XP_006469656.1|  PREDICTED: cellulose synthase-like protein B...    568   0.0      
ref|XP_008455913.1|  PREDICTED: cellulose synthase-like protein H1      570   0.0      
gb|EAY78097.1|  hypothetical protein OsI_33141                          570   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004975624.1|  PREDICTED: cellulose synthase-like protein H...    572   0.0      
ref|XP_004953418.1|  PREDICTED: cellulose synthase-like protein H...    569   0.0      
gb|AAN01252.1|  Unknown protein similar to putative cellulose syn...    573   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003596948.1|  Cellulose synthase-like protein H1                 568   0.0      
gb|KDO39591.1|  hypothetical protein CISIN_1g006357mg                   564   0.0      
gb|KEH39004.1|  cellulose synthase H1-like protein                      555   0.0      
ref|XP_006653400.1|  PREDICTED: cellulose synthase-like protein H...    558   0.0      
ref|XP_004975622.1|  PREDICTED: cellulose synthase-like protein H...    558   0.0      
ref|XP_004165439.1|  PREDICTED: cellulose synthase-like protein H...    546   0.0      
ref|XP_006653401.1|  PREDICTED: putative cellulose synthase-like ...    550   0.0      
ref|XP_004953420.1|  PREDICTED: cellulose synthase-like protein H...    546   0.0      
emb|CDM80574.1|  unnamed protein product                                543   0.0      
gb|ABB47241.1|  Cellulose synthase family protein, expressed            540   1e-180   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47240.2|  Cellulose synthase family protein, expressed            540   2e-180   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66410.1|  OSIGBa0093L02.6                                        545   1e-179   Oryza sativa Indica Group [Indian rice]
ref|XP_006447594.1|  hypothetical protein CICLE_v10014586mg             538   5e-179   
ref|XP_010522355.1|  PREDICTED: cellulose synthase-like protein B...    541   2e-178   
ref|XP_006592369.1|  PREDICTED: uncharacterized LOC100500469 isof...    539   3e-178   
ref|XP_006846949.1|  hypothetical protein AMTR_s00017p00025710          534   9e-177   
ref|XP_010089468.1|  Cellulose synthase-like protein H1                 532   4e-175   
tpg|DAA37782.1|  TPA: hypothetical protein ZEAMMB73_545753              535   4e-175   
ref|XP_010469575.1|  PREDICTED: cellulose synthase-like protein B3      530   3e-174   
ref|XP_006594902.1|  PREDICTED: cellulose synthase-like protein H...    521   2e-173   
gb|KCW46973.1|  hypothetical protein EUGRSUZ_K00781                     518   2e-173   
ref|XP_002447843.1|  hypothetical protein SORBIDRAFT_06g016760          528   3e-173   Sorghum bicolor [broomcorn]
ref|XP_010556995.1|  PREDICTED: cellulose synthase-like protein B...    527   5e-173   
ref|XP_010522356.1|  PREDICTED: cellulose synthase-like protein B...    521   1e-172   
ref|XP_004151940.1|  PREDICTED: cellulose synthase-like protein H...    524   1e-172   
ref|XP_010510001.1|  PREDICTED: cellulose synthase-like protein B3      526   2e-172   
ref|XP_002447842.1|  hypothetical protein SORBIDRAFT_06g016750          527   3e-172   Sorghum bicolor [broomcorn]
ref|XP_010413984.1|  PREDICTED: cellulose synthase-like protein B...    524   1e-171   
ref|XP_010413985.1|  PREDICTED: cellulose synthase-like protein B...    524   1e-171   
gb|KGN63232.1|  hypothetical protein Csa_2G416220                       514   1e-171   
ref|NP_180821.1|  cellulose synthase-like protein B2                    521   6e-171   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17468.1|  unknown                                                 521   2e-170   Picea sitchensis
ref|XP_002879394.1|  hypothetical protein ARALYDRAFT_902308             517   3e-169   
ref|XP_010469576.1|  PREDICTED: cellulose synthase-like protein B3      517   4e-169   
ref|XP_002868214.1|  hypothetical protein ARALYDRAFT_329979             517   4e-169   
ref|XP_010556996.1|  PREDICTED: cellulose synthase-like protein B...    509   9e-169   
ref|XP_004144597.1|  PREDICTED: cellulose synthase-like protein H...    515   1e-168   
ref|XP_002529324.1|  conserved hypothetical protein                     508   5e-168   Ricinus communis
ref|XP_006293730.1|  hypothetical protein CARUB_v10022692mg             514   7e-168   
ref|XP_006410386.1|  hypothetical protein EUTSA_v10016289mg             514   8e-168   
ref|XP_010451508.1|  PREDICTED: cellulose synthase-like protein B6      513   2e-167   
gb|KFK31116.1|  hypothetical protein AALP_AA6G070100                    508   2e-167   
ref|XP_004171456.1|  PREDICTED: cellulose synthase-like protein H...    511   6e-167   
ref|XP_002879395.1|  hypothetical protein ARALYDRAFT_482180             511   9e-167   
ref|XP_008455453.1|  PREDICTED: cellulose synthase-like protein B4      509   2e-166   
ref|NP_850190.1|  cellulose synthase-like protein B3                    510   2e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510006.1|  PREDICTED: cellulose synthase-like protein B...    503   4e-166   
sp|O23386.2|CSLB6_ARATH  RecName: Full=Cellulose synthase-like pr...    508   1e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953419.1|  PREDICTED: cellulose synthase-like protein H...    506   2e-165   
ref|XP_010510005.1|  PREDICTED: cellulose synthase-like protein B...    504   2e-165   
emb|CDY52052.1|  BnaCnng21680D                                          507   2e-165   
ref|XP_010510003.1|  PREDICTED: cellulose synthase-like protein B...    504   3e-165   
ref|XP_009107681.1|  PREDICTED: cellulose synthase-like protein B6      506   9e-165   
ref|NP_180813.1|  cellulose synthase-like protein B4                    506   1e-164   Arabidopsis thaliana [mouse-ear cress]
gb|AAC25935.1|  putative cellulose synthase                             504   1e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144501.1|  PREDICTED: cellulose synthase-like protein H...    504   4e-164   
ref|XP_006293362.1|  hypothetical protein CARUB_v10022674mg             505   4e-164   
ref|XP_009141248.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    503   1e-163   
ref|XP_009141247.1|  PREDICTED: cellulose synthase-like protein B3      503   1e-163   
ref|XP_010413973.1|  PREDICTED: cellulose synthase-like protein B2      502   2e-163   
ref|XP_009141249.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    498   5e-162   
ref|NP_193264.3|  cellulose synthase-like protein B5                    492   2e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010657348.1|  PREDICTED: cellulose synthase-like protein H1      484   5e-159   
dbj|BAE99708.1|  cellulose synthase like protein                        490   8e-159   Arabidopsis thaliana [mouse-ear cress]
emb|CDP20180.1|  unnamed protein product                                478   1e-158   
gb|KDP24850.1|  hypothetical protein JCGZ_24444                         478   3e-158   
ref|NP_180820.2|  cellulose synthase-like protein B1                    486   5e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285915.1|  hypothetical protein CARUB_v10007426mg             485   8e-157   
ref|XP_002879400.1|  hypothetical protein ARALYDRAFT_320998             484   1e-156   
ref|XP_006296344.1|  hypothetical protein CARUB_v10025516mg             482   1e-155   
gb|EEC77287.1|  hypothetical protein OsI_15924                          480   8e-155   Oryza sativa Indica Group [Indian rice]
sp|Q7PC71.1|CSLH2_ORYSI  RecName: Full=Cellulose synthase-like pr...    480   1e-154   Oryza sativa Indica Group [Indian rice]
ref|NP_001052811.2|  Os04g0429500                                       480   1e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004158578.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    475   8e-154   
gb|KFK31114.1|  hypothetical protein AALP_AA6G069800                    478   1e-153   
ref|XP_004151938.1|  PREDICTED: cellulose synthase-like protein B...    463   8e-150   
ref|XP_006592807.1|  PREDICTED: cellulose synthase-like protein H...    464   2e-149   
ref|XP_007163870.1|  hypothetical protein PHAVU_L009400g                456   2e-149   
ref|XP_004171879.1|  PREDICTED: cellulose synthase-like protein B...    453   1e-147   
gb|AAQ22621.1|  At4g15290                                               458   1e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016137.1|  PREDICTED: cellulose synthase-like protein H1      452   1e-147   
gb|AAC25943.1|  putative cellulose synthase                             461   1e-147   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31113.1|  hypothetical protein AALP_AA6G069700                    448   4e-145   
emb|CDY19146.1|  BnaA04g18860D                                          451   2e-144   
ref|XP_006408795.1|  hypothetical protein EUTSA_v10001915mg             452   3e-144   
ref|NP_001052812.2|  Os04g0429600                                       453   5e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008455916.1|  PREDICTED: cellulose synthase-like protein B...    441   1e-143   
emb|CBI28828.3|  unnamed protein product                                443   9e-143   
ref|XP_008455915.1|  PREDICTED: cellulose synthase-like protein H...    443   3e-142   
gb|KEH39001.1|  cellulose synthase H1-like protein                      438   3e-142   
ref|XP_010089466.1|  Cellulose synthase-like protein H1                 431   8e-138   
emb|CAN66095.1|  hypothetical protein VITISV_017805                     429   2e-137   Vitis vinifera
ref|XP_006582369.1|  PREDICTED: cellulose synthase-like protein H...    431   1e-136   
gb|EAZ30773.1|  hypothetical protein OsJ_14837                          427   4e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010473890.1|  PREDICTED: cellulose synthase-like protein B2      424   5e-134   
ref|XP_010930913.1|  PREDICTED: cellulose synthase-like protein H...    417   7e-133   
emb|CAN60146.1|  hypothetical protein VITISV_041923                     420   6e-129   Vitis vinifera
emb|CAB10308.1|  cellulose synthase like protein                        408   1e-127   Arabidopsis thaliana [mouse-ear cress]
gb|EEE50784.1|  hypothetical protein OsJ_31143                          403   8e-127   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72832.1|  hypothetical protein VITISV_017982                     417   2e-125   Vitis vinifera
gb|KDO54722.1|  hypothetical protein CISIN_1g006639mg                   392   4e-125   
gb|ABR16035.1|  unknown                                                 401   2e-124   Picea sitchensis
ref|XP_006375533.1|  hypothetical protein POPTR_0014s15340g             386   6e-124   
ref|XP_006447593.1|  hypothetical protein CICLE_v10014586mg             391   1e-123   
gb|AAL85026.1|  putative cellulose synthase                             385   5e-122   Arabidopsis thaliana [mouse-ear cress]
gb|EMS55737.1|  Cellulose synthase-like protein H1                      391   1e-121   
ref|XP_004165438.1|  PREDICTED: cellulose synthase-like protein H...    384   4e-121   
emb|CBI28830.3|  unnamed protein product                                374   1e-118   
gb|EEC77288.1|  hypothetical protein OsI_15925                          378   5e-118   Oryza sativa Indica Group [Indian rice]
gb|KEH39002.1|  cellulose synthase H1-like protein                      370   9e-118   
ref|XP_010088430.1|  Cellulose synthase-like protein E1                 380   2e-116   
ref|XP_010057780.1|  PREDICTED: cellulose synthase-like protein E1      374   1e-114   
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    382   2e-114   
ref|XP_006387031.1|  hypothetical protein POPTR_2114s00200g             365   2e-114   
gb|KCW75092.1|  hypothetical protein EUGRSUZ_E03849                     374   3e-114   
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           381   5e-114   Hordeum vulgare [barley]
ref|XP_010057783.1|  PREDICTED: cellulose synthase-like protein E6      372   8e-114   
ref|XP_003635328.1|  PREDICTED: cellulose synthase-like protein E6      372   1e-113   
dbj|BAJ96780.1|  predicted protein                                      380   1e-113   
ref|XP_011038831.1|  PREDICTED: cellulose synthase-like protein E1      372   2e-113   
ref|XP_002274290.2|  PREDICTED: cellulose synthase-like protein E6      371   3e-113   Vitis vinifera
gb|KHG04072.1|  putative cellulose synthase A catalytic subunit 8...    379   4e-113   
ref|XP_009766951.1|  PREDICTED: cellulose synthase A catalytic su...    377   4e-113   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    377   1e-112   
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                377   1e-112   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    377   1e-112   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             377   1e-112   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   377   1e-112   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    377   1e-112   
ref|XP_002960761.1|  cellulose synthase 4-1                             377   1e-112   
ref|XP_011002349.1|  PREDICTED: cellulose synthase-like protein E6      369   2e-112   
ref|XP_002983910.1|  family 2 glycosyltransferase                       377   2e-112   
emb|CBI29435.3|  unnamed protein product                                366   2e-112   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    376   2e-112   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    376   2e-112   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    376   3e-112   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    376   3e-112   
emb|CBI23494.3|  unnamed protein product                                367   3e-112   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    376   3e-112   
gb|AGJ71354.1|  cellulose synthase 3                                    376   3e-112   
ref|XP_010646988.1|  PREDICTED: cellulose synthase-like protein E6      368   3e-112   
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     375   3e-112   
ref|XP_010091161.1|  OsCesA7 protein                                    375   4e-112   
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     375   4e-112   
ref|XP_011097753.1|  PREDICTED: cellulose synthase-like protein E1      368   4e-112   
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           375   4e-112   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    375   5e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73700.1|  hypothetical protein VITISV_013112                     375   5e-112   Vitis vinifera
gb|AGE09566.1|  cellulose synthase-like protein                         375   5e-112   
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    375   5e-112   Vitis vinifera
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    375   6e-112   
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    375   6e-112   
ref|XP_003635559.1|  PREDICTED: cellulose synthase-like protein E...    367   7e-112   
gb|AFR58756.2|  cellulose synthase 3                                    375   7e-112   
ref|XP_003635361.2|  PREDICTED: cellulose synthase-like protein E6      367   9e-112   
ref|XP_010657351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    355   9e-112   
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    374   1e-111   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          374   1e-111   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             374   1e-111   
gb|EMT11411.1|  Putative cellulose synthase A catalytic subunit 5...    374   2e-111   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             373   2e-111   
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    374   2e-111   
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   373   3e-111   
emb|CBI37171.3|  unnamed protein product                                372   3e-111   
ref|XP_002269728.2|  PREDICTED: cellulose synthase-like protein E6      365   4e-111   
gb|AET04269.2|  cellulose synthase-like protein                         372   4e-111   
ref|XP_006578126.1|  PREDICTED: cellulose synthase A catalytic su...    371   4e-111   
ref|XP_010905025.1|  PREDICTED: cellulose synthase A catalytic su...    372   5e-111   
gb|AFZ78594.1|  cellulose synthase-like protein                         365   5e-111   
ref|XP_011002350.1|  PREDICTED: cellulose synthase-like protein E6      365   6e-111   
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                     372   6e-111   
gb|AEK31217.1|  cellulose synthase A                                    372   7e-111   
ref|XP_002300383.1|  cellulose synthase family protein                  365   7e-111   
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    372   1e-110   
ref|XP_008792332.1|  PREDICTED: cellulose synthase A catalytic su...    370   1e-110   
ref|XP_004233024.1|  PREDICTED: cellulose synthase A catalytic su...    370   1e-110   
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    371   2e-110   
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    371   2e-110   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    371   2e-110   
ref|XP_006380865.1|  hypothetical protein POPTR_0006s00610g             363   2e-110   
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    371   2e-110   
ref|XP_011085972.1|  PREDICTED: cellulose synthase A catalytic su...    369   2e-110   
ref|XP_008218336.1|  PREDICTED: cellulose synthase-like protein E6      363   2e-110   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    370   2e-110   
gb|KEH19939.1|  cellulose synthase-like protein                         364   3e-110   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    370   3e-110   
gb|AFB18638.1|  CESA10                                                  371   3e-110   
ref|XP_010924731.1|  PREDICTED: cellulose synthase A catalytic su...    369   3e-110   
ref|XP_006453580.1|  hypothetical protein CICLE_v10010165mg             370   3e-110   
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    371   4e-110   
emb|CDX70762.1|  BnaC03g08460D                                          369   4e-110   
ref|XP_003600351.1|  Cellulose synthase-like protein E1                 363   4e-110   
ref|XP_007208061.1|  hypothetical protein PRUPE_ppa001952mg             363   4e-110   
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    370   4e-110   
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    370   4e-110   
ref|XP_007028786.1|  Cellulose synthase family protein                  370   5e-110   
ref|XP_006283112.1|  hypothetical protein CARUB_v10004131mg             365   5e-110   
gb|EPS60781.1|  hypothetical protein M569_14019                         370   5e-110   
ref|XP_007149986.1|  hypothetical protein PHAVU_005G1163000g            356   6e-110   
ref|XP_009406777.1|  PREDICTED: cellulose synthase A catalytic su...    368   6e-110   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             369   6e-110   
ref|XP_003526279.1|  PREDICTED: cellulose synthase A catalytic su...    368   8e-110   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                369   9e-110   
emb|CDY26085.1|  BnaC06g11110D                                          361   1e-109   
ref|XP_009591676.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    375   1e-109   
ref|XP_010040670.1|  PREDICTED: cellulose synthase-like protein E1      361   1e-109   
gb|KDO62271.1|  hypothetical protein CISIN_1g039678mg                   368   1e-109   
gb|ACJ38665.1|  cellulose synthase                                      369   1e-109   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    369   1e-109   
gb|KHN06411.1|  Cellulose synthase A catalytic subunit 8 [UDP-for...    367   1e-109   
emb|CDX78749.1|  BnaA03g06610D                                          367   1e-109   
ref|XP_006474030.1|  PREDICTED: cellulose synthase A catalytic su...    368   1e-109   
gb|KHN48007.1|  Cellulose synthase A catalytic subunit 8 [UDP-for...    367   2e-109   
gb|EPS65651.1|  hypothetical protein M569_09122                         368   2e-109   
ref|XP_006474029.1|  PREDICTED: cellulose synthase A catalytic su...    368   2e-109   
gb|AEE60894.1|  cellulose synthase                                      367   2e-109   
gb|AFB18636.1|  CESA7                                                   368   2e-109   
ref|XP_002522779.1|  cellulose synthase, putative                       360   2e-109   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             368   2e-109   
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        368   2e-109   
gb|AFZ78566.1|  cellulose synthase                                      367   2e-109   
ref|XP_010686462.1|  PREDICTED: cellulose synthase A catalytic su...    374   3e-109   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    369   3e-109   
gb|KEH36631.1|  cellulose synthase-like protein                         367   3e-109   
emb|CDY62555.1|  BnaA03g58390D                                          366   3e-109   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          368   3e-109   
ref|XP_004296325.1|  PREDICTED: cellulose synthase-like protein E...    360   3e-109   
emb|CBI29575.3|  unnamed protein product                                367   4e-109   
gb|KFK28549.1|  hypothetical protein AALP_AA7G010900                    366   4e-109   
emb|CDY64918.1|  BnaC07g50180D                                          366   4e-109   
ref|XP_009136956.1|  PREDICTED: cellulose synthase A catalytic su...    366   4e-109   
gb|ACS68199.1|  cellulose synthase 8.2 catalytic subunit                366   5e-109   
gb|ACT67415.1|  cellulose synthase                                      367   5e-109   
ref|XP_007136980.1|  hypothetical protein PHAVU_009G090100g             365   5e-109   
ref|XP_009416421.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    366   5e-109   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    367   6e-109   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    367   6e-109   
gb|ACS68198.1|  cellulose synthase 8.1 catalytic subunit                366   6e-109   
ref|XP_008337189.1|  PREDICTED: cellulose synthase A catalytic su...    362   6e-109   
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    367   6e-109   
ref|XP_010999776.1|  PREDICTED: cellulose synthase A catalytic su...    365   6e-109   
gb|ADY68801.1|  cellulose synthase A1                                   365   7e-109   
ref|XP_009419218.1|  PREDICTED: cellulose synthase-like protein E6      359   7e-109   
ref|XP_010274921.1|  PREDICTED: cellulose synthase A catalytic su...    365   7e-109   
ref|XP_002307850.1|  hypothetical protein POPTR_0006s00620g             359   7e-109   
ref|XP_007159472.1|  hypothetical protein PHAVU_002G240200g             365   8e-109   
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    367   9e-109   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    366   9e-109   
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    366   9e-109   
ref|XP_006346125.1|  PREDICTED: cellulose synthase-like protein E...    359   9e-109   
gb|ACD56660.1|  cellulose synthase                                      365   1e-108   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    367   1e-108   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    367   1e-108   
gb|ADY68796.1|  cellulose synthase A1                                   365   1e-108   
gb|AEN70837.1|  cellulose synthase                                      365   1e-108   
emb|CDY08263.1|  BnaA05g13560D                                          358   1e-108   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    366   1e-108   
gb|AEN70819.1|  cellulose synthase                                      365   1e-108   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    366   1e-108   
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    366   1e-108   
gb|AAT09897.1|  cellulose synthase                                      365   1e-108   
gb|AEN70825.1|  cellulose synthase                                      365   1e-108   
emb|CDY61071.1|  BnaCnng37280D                                          352   1e-108   
gb|AEN70830.1|  cellulose synthase                                      365   1e-108   
gb|AAB37766.1|  cellulose synthase                                      365   1e-108   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    366   1e-108   
ref|XP_006452619.1|  hypothetical protein CICLE_v10007571mg             359   1e-108   
gb|AEN70820.1|  cellulose synthase                                      364   1e-108   
gb|AAX18647.1|  cellulose synthase catalytic subunit                    365   1e-108   
gb|AFB18637.1|  CESA8                                                   366   2e-108   
gb|ADY68800.1|  cellulose synthase A1                                   364   2e-108   
ref|NP_567564.1|  cellulose synthase A catalytic subunit 8 [UDP-f...    365   2e-108   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    366   2e-108   
gb|AEN70827.1|  cellulose synthase                                      364   2e-108   
gb|AEN70821.1|  cellulose synthase                                      364   2e-108   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             366   2e-108   
gb|AAX18649.1|  cellulose synthase catalytic subunit                    366   2e-108   
ref|XP_011101454.1|  PREDICTED: cellulose synthase A catalytic su...    370   2e-108   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    365   2e-108   
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...    365   2e-108   
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    365   2e-108   
gb|AEN70822.1|  cellulose synthase                                      364   2e-108   
gb|AEN70835.1|  cellulose synthase                                      364   2e-108   
gb|KHN48936.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    359   2e-108   
ref|XP_003628669.1|  Cellulose synthase                                 364   2e-108   
ref|XP_003629793.1|  Cellulose synthase                                 371   2e-108   
gb|AAK08700.1|AF267742_1  cellulose synthase catalytic subunit          364   2e-108   
ref|XP_004485918.1|  PREDICTED: cellulose synthase A catalytic su...    364   2e-108   
gb|AAT57672.1|  cellulose synthase catalytic subunit                    366   3e-108   
ref|XP_004296326.1|  PREDICTED: cellulose synthase-like protein E...    358   3e-108   
ref|XP_010439812.1|  PREDICTED: cellulose synthase A catalytic su...    364   3e-108   
ref|XP_006358142.1|  PREDICTED: cellulose synthase A catalytic su...    370   3e-108   
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    365   3e-108   
ref|XP_002867977.1|  hypothetical protein ARALYDRAFT_492981             363   3e-108   
ref|XP_004485917.1|  PREDICTED: cellulose synthase A catalytic su...    363   3e-108   
ref|XP_010434497.1|  PREDICTED: cellulose synthase A catalytic su...    363   3e-108   
gb|AEN70839.1|  cellulose synthase                                      363   4e-108   
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    365   4e-108   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    365   4e-108   
ref|XP_010449470.1|  PREDICTED: cellulose synthase A catalytic su...    363   4e-108   
gb|AEN70824.1|  cellulose synthase                                      363   5e-108   
ref|XP_009418093.1|  PREDICTED: cellulose synthase-like protein E6      357   5e-108   
gb|AEN70826.1|  cellulose synthase                                      363   5e-108   
ref|XP_010644596.1|  PREDICTED: cellulose synthase-like protein E1      357   5e-108   
gb|AEN70840.1|  cellulose synthase                                      362   7e-108   
gb|AII73574.1|  cellulose synthase 7-A                                  364   8e-108   
ref|XP_009144733.1|  PREDICTED: cellulose synthase-like protein E1      356   9e-108   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    364   9e-108   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    364   9e-108   
ref|XP_010324247.1|  PREDICTED: cellulose synthase-like protein E1      361   1e-107   
gb|AFZ78595.1|  cellulose synthase-like protein                         356   1e-107   
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          363   1e-107   
ref|XP_002305060.1|  cellulose synthase family protein                  363   1e-107   
ref|XP_003541367.1|  PREDICTED: cellulose synthase A catalytic su...    360   2e-107   
ref|NP_001063207.1|  Os09g0422500                                       363   2e-107   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    363   2e-107   
ref|XP_003600348.1|  Cellulose synthase-like protein E1                 355   2e-107   
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   363   2e-107   
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            363   2e-107   
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    363   2e-107   
ref|XP_006586375.1|  PREDICTED: cellulose synthase A catalytic su...    368   2e-107   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    363   2e-107   
emb|CDP02834.1|  unnamed protein product                                362   3e-107   
gb|KFK35563.1|  hypothetical protein AALP_AA4G007100                    355   3e-107   
gb|KHG12106.1|  Cellulose synthase-like protein E6                      355   3e-107   
ref|XP_006346126.1|  PREDICTED: cellulose synthase-like protein E...    360   3e-107   
emb|CBI39755.3|  unnamed protein product                                354   3e-107   
emb|CDX85455.1|  BnaA02g03580D                                          361   3e-107   
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    362   3e-107   
ref|XP_004498142.1|  PREDICTED: cellulose synthase-like protein E...    355   3e-107   
ref|XP_010538576.1|  PREDICTED: cellulose synthase A catalytic su...    361   4e-107   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             362   4e-107   
ref|XP_010538575.1|  PREDICTED: cellulose synthase A catalytic su...    360   5e-107   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    362   5e-107   
ref|XP_007149988.1|  hypothetical protein PHAVU_005G1164000g            348   5e-107   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               362   5e-107   
gb|AFP93559.1|  cellulose synthase A1                                   362   6e-107   
gb|KDP39303.1|  hypothetical protein JCGZ_01060                         354   6e-107   
ref|XP_009349150.1|  PREDICTED: uncharacterized protein LOC103940710    367   6e-107   
ref|XP_006474867.1|  PREDICTED: cellulose synthase-like protein E...    354   9e-107   
dbj|BAJ85783.1|  predicted protein                                      361   1e-106   
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    361   1e-106   
ref|XP_004957121.1|  PREDICTED: cellulose synthase-like protein E...    353   2e-106   
ref|XP_006452624.1|  hypothetical protein CICLE_v10007586mg             353   2e-106   
gb|KDP21123.1|  hypothetical protein JCGZ_21594                         359   2e-106   
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    360   2e-106   
ref|XP_002522238.1|  wd40 protein, putative                             366   2e-106   
gb|AFZ78551.1|  cellulose synthase                                      360   2e-106   
gb|AFZ78552.1|  cellulose synthase                                      359   2e-106   
ref|XP_008805493.1|  PREDICTED: cellulose synthase-like protein E6      353   2e-106   
ref|XP_008805495.1|  PREDICTED: cellulose synthase-like protein E...    352   3e-106   
gb|EEC84759.1|  hypothetical protein OsI_31766                          352   3e-106   
emb|CDO96844.1|  unnamed protein product                                358   3e-106   
ref|XP_006392596.1|  hypothetical protein EUTSA_v10011262mg             352   3e-106   
gb|AFV94634.1|  cellulose synthase                                      357   5e-106   
ref|XP_002522778.1|  coated vesicle membrane protein, putative          357   5e-106   
ref|XP_006452617.1|  hypothetical protein CICLE_v10010783mg             352   5e-106   
ref|XP_004509860.1|  PREDICTED: cellulose synthase A catalytic su...    358   5e-106   
ref|NP_001063469.1|  Os09g0478100                                       352   6e-106   
ref|XP_004969957.1|  PREDICTED: cellulose synthase A catalytic su...    358   6e-106   
gb|AAK11588.2|  cellulose synthase CesA-1                               357   6e-106   
ref|XP_006474851.1|  PREDICTED: cellulose synthase-like protein E...    351   8e-106   
ref|XP_003600349.1|  Cellulose synthase-like protein E1                 351   9e-106   
ref|XP_002891856.1|  hypothetical protein ARALYDRAFT_337666             351   1e-105   
ref|XP_007132524.1|  hypothetical protein PHAVU_011G101700g             338   1e-105   
ref|XP_010928075.1|  PREDICTED: cellulose synthase-like protein E...    350   1e-105   
ref|XP_006414059.1|  hypothetical protein EUTSA_v10024314mg             357   2e-105   
ref|XP_010928073.1|  PREDICTED: cellulose synthase-like protein E...    350   2e-105   
tpg|DAA36974.1|  TPA: putative cellulose synthase family protein        356   2e-105   
ref|XP_010501211.1|  PREDICTED: cellulose synthase-like protein E...    350   2e-105   
ref|XP_010910021.1|  PREDICTED: probable cellulose synthase A cat...    353   2e-105   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    357   2e-105   
ref|XP_007206429.1|  hypothetical protein PRUPE_ppa001936mg             350   3e-105   
ref|XP_008218356.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    350   3e-105   
ref|XP_003532180.1|  PREDICTED: cellulose synthase-like protein E...    350   3e-105   
ref|XP_007208168.1|  hypothetical protein PRUPE_ppa001941mg             350   3e-105   
ref|XP_007030088.1|  Cellulose synthase like E1                         352   4e-105   
ref|XP_002266273.1|  PREDICTED: cellulose synthase-like protein E6      349   5e-105   



>ref|XP_009781147.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nicotiana 
sylvestris]
Length=749

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/607 (61%), Positives = 455/607 (75%), Gaps = 11/607 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE K R N +SR +E+ IL LL SL+AYR+ +L +HG   ++ LAL+CESWFTF+W+
Sbjct  8     LPLYEIKYRKNVISRGIELFILFLLFSLLAYRLLSLKNHGLNLSFFLALICESWFTFLWI  67

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+VSTKWNQVE  TYP R L+W    + EFPAVDMF+TTA+P LEPP++TVNT+LSLLA+
Sbjct  68    LIVSTKWNQVEPKTYPLRLLKW----TSEFPAVDMFITTADPVLEPPLITVNTMLSLLAV  123

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACY+SDD ASP+T+Y+LVEA+KFAKLWVPFCKKYN+A+RAPFRYFNA+ + P 
Sbjct  124   DYPANKLACYISDDGASPITYYSLVEAAKFAKLWVPFCKKYNIALRAPFRYFNANLSPPQ  183

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPS----LFNKFATFADLDPNDHSTIIKVIC  1102
             +SS  F  +WK+M DEY  LC KIE A+ + S        F  F+ ++  +H TIIKVI 
Sbjct  184   DSSQGFLEDWKRMKDEYKQLCEKIEDASTQDSEACDFAGDFGVFSKIERKNHPTIIKVIL  243

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E +A G+PHL+YISREKRPKH H+FKAGAMNVLTRVSG+MTNAPFMLNVDCD + NN
Sbjct  244   ENKEGIADGLPHLVYISREKRPKHPHHFKAGAMNVLTRVSGLMTNAPFMLNVDCDMFANN  303

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+VV HAMC+ LGAKDE+D GFVQFPQ FYDGLKDDPY +Q+K+++   GRG A IQG F
Sbjct  304   PQVVQHAMCYFLGAKDEKDCGFVQFPQYFYDGLKDDPYGNQFKLLHEYFGRGIAGIQGPF  363

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIF---Vtsatttlsgslsse  1633
             Y GTGCFHRRK+IYGLSPND +   +L D  LQK YGKS+     V    +  S  +   
Sbjct  364   YQGTGCFHRRKIIYGLSPNDKINTGELRDEYLQKTYGKSQKLLASVAQTLSAGSNIIEQL  423

Query  1634  tFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                 LS ++E A Q+ +CGYEFGT WG  +GW YGS TEDI TG+ I   GW++ +C P+
Sbjct  424   NSDSLSSTIEEAQQIGSCGYEFGTAWGQKLGWLYGSATEDIHTGLSIHGRGWRSAYCTPD  483

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
              P FLGC PS G   + Q KRWA+G  EI+F  K PI   LFG LQ RQC+AY+   LW 
Sbjct  484   PPAFLGCAPSGGPAIMIQQKRWATGLFEIIFFSKSPIIGTLFGKLQLRQCMAYLYIQLWA  543

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
             +R IFE+CYA LP YCLITNS+FLPK NE ++ IPASIFIIYNLY L EY+   ESI+AW
Sbjct  544   LRSIFEVCYAILPAYCLITNSNFLPKANEPSMTIPASIFIIYNLYGLSEYVRANESIKAW  603

Query  2174  WNNQRMW  2194
              NNQRMW
Sbjct  604   LNNQRMW  610



>ref|XP_009588345.1| PREDICTED: cellulose synthase-like protein H1 [Nicotiana tomentosiformis]
Length=751

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/607 (61%), Positives = 453/607 (75%), Gaps = 11/607 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE K R N +SR +E+ IL LL SL+AYR+ +L +HG+   + LAL+CESWFTF+W+
Sbjct  8     LPLYEIKYRKNIISRGIELFILFLLFSLLAYRLLSLKNHGFSLPFFLALICESWFTFLWI  67

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++ KWNQVE  TYP R LE     + EFPAVDMF+TTA+P LEPP++TVNT+LSLLA+
Sbjct  68    LTINAKWNQVEPKTYPLRLLE----RTAEFPAVDMFITTADPILEPPLITVNTMLSLLAV  123

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD ASP+T+Y+LVEASKFAKLWVPFCKKYN+A+RAPFRYF+A+   P 
Sbjct  124   DYPANKLACYVSDDGASPITYYSLVEASKFAKLWVPFCKKYNIALRAPFRYFSANSLPPQ  183

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPS----LFNKFATFADLDPNDHSTIIKVIC  1102
             ++S  F  +WK+M DEY  LC KIE A+ + +        FA F+ ++  +H TIIKVI 
Sbjct  184   DTSQGFPEDWKRMKDEYKQLCEKIEDASTQEAEACDFSGDFAVFSKIERKNHPTIIKVIL  243

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E +A G+PHL+YISREKRPKH H+FKAGAMNVLTRVSG+MTNAPFMLNVDCD Y NN
Sbjct  244   ENKEGIADGLPHLVYISREKRPKHPHHFKAGAMNVLTRVSGLMTNAPFMLNVDCDMYANN  303

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+VV HAMC+ LGAKDE+D GFVQFPQ FYDGLKDDPY +Q K+++  LGRG A IQG F
Sbjct  304   PQVVQHAMCYFLGAKDEKDCGFVQFPQYFYDGLKDDPYGNQLKVLHEYLGRGFAGIQGPF  363

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIF---Vtsatttlsgslsse  1633
             Y GTGCFHRRK+IYGLSPN+ +   +L D  LQK YGKS+     V    +  S ++   
Sbjct  364   YQGTGCFHRRKIIYGLSPNEKINTGELRDEYLQKTYGKSQKLLASVAQTLSAGSNNIEQV  423

Query  1634  tFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                 LS  +E A Q+ +CGYEFGT WG  +GW YG  TED+LTG+ IQ  GW++ +C P+
Sbjct  424   NSDSLSSFIEEAQQIGSCGYEFGTAWGQKLGWLYGCATEDVLTGLLIQGKGWRSAYCAPD  483

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
              P FLG  PS G  S+ Q KRWA+G  EILF  K PI   LFG LQ RQC+AY+   LW 
Sbjct  484   PPAFLGTAPSGGPASMTQQKRWANGLFEILFFSKSPIIGTLFGKLQLRQCMAYLYIQLWA  543

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
             +R IFE+CYA LPPYCLITNS FLPK NE ++VIPASIFIIYNLY L EY+   E I+AW
Sbjct  544   LRSIFEVCYAILPPYCLITNSSFLPKANEPSMVIPASIFIIYNLYGLSEYVRANEPIKAW  603

Query  2174  WNNQRMW  2194
              NNQRMW
Sbjct  604   LNNQRMW  610



>ref|XP_006364166.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Solanum tuberosum]
Length=739

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/604 (63%), Positives = 457/604 (76%), Gaps = 11/604 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE K R N +SR +E+ IL LL SL+AYR   L  HG    WLLAL+CESWFTFIW+
Sbjct  9     LPLYEIKYRKNYISRVIELFILFLLFSLLAYRFLTLKFHGL--QWLLALICESWFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L VS+KWNQVE TTYP R LE     + +FPAVD+FVTTA+P LEPP++T+NTVLSLLA+
Sbjct  67    LTVSSKWNQVEPTTYPLRLLE----RTLKFPAVDIFVTTADPVLEPPLITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD AS VT+Y+LVEASKFAK WVPFCKKYN+A+RAPFRYF+ + + P 
Sbjct  123   DYPANKLACYVSDDGASIVTYYSLVEASKFAKHWVPFCKKYNIALRAPFRYFSGNSSPPQ  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYA-TQKPSLFNKFATFADLDPNDHSTIIKVICEND  1111
             +SS EF+++W +M DEY  LC KIE A TQ+P   + F  F+++   +H TIIKVI EN 
Sbjct  183   DSSQEFQQDWTRMKDEYKQLCKKIEDASTQEPETCD-FDVFSNIQQKNHPTIIKVILENK  241

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
             E +A G+PHL+YISREKRPKH H FKAGAMNVLTRVSGVMTNAPFMLNVDCD Y NNP+V
Sbjct  242   EGVADGLPHLVYISREKRPKHPHQFKAGAMNVLTRVSGVMTNAPFMLNVDCDMYANNPQV  301

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             VLHAMC+ LGAKDE D GFVQFPQ FYDGLK+DPY +Q K+++   GRG + IQG FY G
Sbjct  302   VLHAMCYFLGAKDEIDCGFVQFPQFFYDGLKEDPYGNQLKVLHEYFGRGISGIQGPFYQG  361

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKS-KIFVtsatttlsgslssetFG--  1642
             +GCFHRRKVIYG SP + +TA +L D  +QK YG S K+  + A T L GS   E F   
Sbjct  362   SGCFHRRKVIYGSSPYEKITAGELKDEYIQKTYGMSEKLSTSIAKTLLEGSNIIEQFNSD  421

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
               S S+E A QV +CG+EFGT WG  +GW YGSV EDILTG+ IQ  GWK+ +C+P+ P 
Sbjct  422   SPSSSIEIAHQVGSCGFEFGTAWGQKLGWLYGSVAEDILTGLFIQSRGWKSAYCLPDPPA  481

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             FLGC P+ G  S+ Q KRWA+G  E+L + K PI   LFG LQ RQC+AY+   LW +R 
Sbjct  482   FLGCAPAAGPASMIQQKRWATGLFEVLLNSKSPIIGTLFGKLQLRQCMAYLQIQLWGLRS  541

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             IFE+CYA LP YCLITNSHFLP+ NE++IVIPASIFIIYNLY L EY+   E I AW NN
Sbjct  542   IFEVCYAILPAYCLITNSHFLPQANELSIVIPASIFIIYNLYVLSEYIRANEPIIAWMNN  601

Query  2183  QRMW  2194
             QRMW
Sbjct  602   QRMW  605



>ref|XP_004243487.1| PREDICTED: cellulose synthase-like protein H1 [Solanum lycopersicum]
Length=743

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/607 (62%), Positives = 456/607 (75%), Gaps = 13/607 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE   R N +SR +E+ IL LL SL+AYR   L  HG    WLLAL+CESWFTFIW+
Sbjct  9     LPLYEINYRKNYISRGIELFILFLLFSLLAYRFLTLKFHGL--QWLLALICESWFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L VSTKWNQVE  TYP R LE   N    FPAVD+FVTTA+P LEPP++T+NTVLSLLA+
Sbjct  67    LTVSTKWNQVEPKTYPPRLLERTWN----FPAVDIFVTTADPVLEPPLITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD AS +T+Y+LVEASKFAK+W+PFCKKYN+++RAPFRYF+ + + P 
Sbjct  123   DYPANKLACYVSDDGASIITYYSLVEASKFAKIWIPFCKKYNISLRAPFRYFSGNSSPPQ  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYA-TQKP---SLFNKFATFADLDPNDHSTIIKVIC  1102
             + S EF+++W ++ DEY  LC KI+ A TQ+P        FA F+++ P +H TIIKVI 
Sbjct  183   DGSKEFQQDWIRIKDEYKQLCKKIQDASTQEPETCDFAGDFAVFSNIQPKNHPTIIKVIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E +A G+PHL+YISREKRPKH H FKAGAMNVLTRVSGVMTNAPFMLNVDCD Y NN
Sbjct  243   ENKEGVADGLPHLVYISREKRPKHPHQFKAGAMNVLTRVSGVMTNAPFMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+V+LHAMC+ LGAKDE D GFVQFPQ FYDGLK+DPY +Q K+++   GRG   IQG F
Sbjct  303   PQVILHAMCYFLGAKDEIDCGFVQFPQFFYDGLKEDPYGNQLKVLHEYFGRGIGGIQGPF  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKS-KIFVtsatttlsgslssetF  1639
             Y G+GCFHRRKVIYGLSP++ +TA  L D  ++K YGKS K+  + A T L GS   E F
Sbjct  363   YQGSGCFHRRKVIYGLSPHEKITAGGLKDEYIKKTYGKSEKLSTSIAKTLLEGSHIIEQF  422

Query  1640  GVLSYS--LEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                S S  ++ A QV +CG+E+GT WG  +GW YGSVTED+LTG+ IQ  GWK+ +C+P+
Sbjct  423   NSDSPSSFIDIAHQVGSCGFEYGTAWGQKLGWLYGSVTEDVLTGLFIQSRGWKSAYCLPD  482

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
                FLGC P+ G  ++ Q KRWA+G  E+LF+ K PI   LFG LQ RQC+AY+   LW 
Sbjct  483   PAAFLGCAPTAGPATMIQQKRWATGLFEVLFNTKSPIIGTLFGKLQLRQCMAYLYVQLWA  542

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
             +R IFE+CYA LP YCLITNS+FLPK NEV+IVIP SIFIIYNLY L EY+   E I AW
Sbjct  543   LRSIFEVCYAILPAYCLITNSYFLPKANEVSIVIPTSIFIIYNLYGLSEYIRANEPIIAW  602

Query  2174  WNNQRMW  2194
              NNQRMW
Sbjct  603   MNNQRMW  609



>ref|XP_006364167.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Solanum tuberosum]
Length=700

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/603 (61%), Positives = 433/603 (72%), Gaps = 48/603 (8%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE K R N +SR +E+ IL LL SL+AYR   L  HG    WLLAL+CESWFTFIW+
Sbjct  9     LPLYEIKYRKNYISRVIELFILFLLFSLLAYRFLTLKFHGL--QWLLALICESWFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L VS+KWNQVE TTYP R LE     + +FPAVD+FVTTA+P LEPP++T+NTVLSLLA+
Sbjct  67    LTVSSKWNQVEPTTYPLRLLE----RTLKFPAVDIFVTTADPVLEPPLITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD AS VT+Y+LVEASKFAK WVPFCKKYN+A+RAPFRYF+ + + P 
Sbjct  123   DYPANKLACYVSDDGASIVTYYSLVEASKFAKHWVPFCKKYNIALRAPFRYFSGNSSPPQ  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDE  1114
             +SS EF+++W +M                                       KVI EN E
Sbjct  183   DSSQEFQQDWTRM---------------------------------------KVILENKE  203

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
              +A G+PHL+YISREKRPKH H FKAGAMNVLTRVSGVMTNAPFMLNVDCD Y NNP+VV
Sbjct  204   GVADGLPHLVYISREKRPKHPHQFKAGAMNVLTRVSGVMTNAPFMLNVDCDMYANNPQVV  263

Query  1295  LHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
             LHAMC+ LGAKDE D GFVQFPQ FYDGLK+DPY +Q K+++   GRG + IQG FY G+
Sbjct  264   LHAMCYFLGAKDEIDCGFVQFPQFFYDGLKEDPYGNQLKVLHEYFGRGISGIQGPFYQGS  323

Query  1475  GCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKS-KIFVtsatttlsgslssetFG--V  1645
             GCFHRRKVIYG SP + +TA +L D  +QK YG S K+  + A T L GS   E F    
Sbjct  324   GCFHRRKVIYGSSPYEKITAGELKDEYIQKTYGMSEKLSTSIAKTLLEGSNIIEQFNSDS  383

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
              S S+E A QV +CG+EFGT WG  +GW YGSV EDILTG+ IQ  GWK+ +C+P+ P F
Sbjct  384   PSSSIEIAHQVGSCGFEFGTAWGQKLGWLYGSVAEDILTGLFIQSRGWKSAYCLPDPPAF  443

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
             LGC P+ G  S+ Q KRWA+G  E+L + K PI   LFG LQ RQC+AY+   LW +R I
Sbjct  444   LGCAPAAGPASMIQQKRWATGLFEVLLNSKSPIIGTLFGKLQLRQCMAYLQIQLWGLRSI  503

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             FE+CYA LP YCLITNSHFLP+ NE++IVIPASIFIIYNLY L EY+   E I AW NNQ
Sbjct  504   FEVCYAILPAYCLITNSHFLPQANELSIVIPASIFIIYNLYVLSEYIRANEPIIAWMNNQ  563

Query  2186  RMW  2194
             RMW
Sbjct  564   RMW  566



>emb|CDP19391.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/603 (57%), Positives = 422/603 (70%), Gaps = 13/603 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE K     + R +E+ IL L  SL+ YR+ +L +HG+   WL+AL+CESWFTFIW+
Sbjct  7     LPLYERKHLTKIIPRLIELTILFLCFSLLGYRLLHLKNHGF--IWLVALLCESWFTFIWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +VV+ KWN +   TYPER L+     + E P +DMFVTTA+P LEPPI+TVNTV+SLL++
Sbjct  65    VVVNIKWNPIAIKTYPERLLQ----RNLELPPLDMFVTTADPVLEPPIITVNTVISLLSV  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACY+SDD+ASP+T++ LVEAS+FAKLW+PFCKKYNV VRAPFRYF+    F  
Sbjct  121   DYPANKLACYLSDDAASPLTYFCLVEASEFAKLWIPFCKKYNVPVRAPFRYFSDQSLFTG  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
               S EF+ +W  M +EY  LC KIE A QK     L   FA F D+D   H TIIKVI E
Sbjct  181   NGSSEFQEDWNIMKEEYTRLCQKIEEAAQKSVPCELTGDFAAFVDIDRRSHPTIIKVISE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E L  G+P ++YISREKRP H H+FKAGAMNVL RVSGVMTNAPFMLNVDCD + NNP
Sbjct  241   NKEGLPDGLPPIVYISREKRPNHAHHFKAGAMNVLARVSGVMTNAPFMLNVDCDMFANNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +VVLHAMC LLG KDE D GFVQFPQ FYDGLKDDP+ +Q  ++   LGRG A  QG  Y
Sbjct  301   QVVLHAMCLLLGVKDETDCGFVQFPQQFYDGLKDDPFGNQMVVMIKYLGRGLAGHQGPLY  360

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF-G  1642
              GTGCFHRRKVIYG SP D     K+   +    +GKS  F       LS S  +     
Sbjct  361   GGTGCFHRRKVIYGSSPEDKSGHGKMNTGE---AFGKSTKFNKFVAQALSSSSRTAECPE  417

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              +S S++ A QVA+CGYE+GT WG  IGW YGS TED+LTG+ I   GW+T +      G
Sbjct  418   SISKSIDEACQVASCGYEYGTAWGKEIGWIYGSTTEDVLTGLNIHWRGWRTMWLRTNPNG  477

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             FLG  PS G  +L Q KRW++G  E+LF+ K P F  LFG L+FRQCL Y+  +LW  R 
Sbjct  478   FLGSAPSCGPNTLIQQKRWSTGLLEVLFAPKSPFFGTLFGKLEFRQCLNYLFFLLWGPRS  537

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             IFE+CYA LP  C+ TN++FLPK NE AI+IP SIF+++N Y + EY++  +SI++WWNN
Sbjct  538   IFEICYAALPACCIFTNTNFLPKVNEPAILIPISIFVVFNTYCVSEYIQTNQSIKSWWNN  597

Query  2183  QRM  2191
              RM
Sbjct  598   HRM  600



>ref|XP_008229979.1| PREDICTED: cellulose synthase-like protein B4 isoform X2 [Prunus 
mume]
Length=747

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/603 (58%), Positives = 434/603 (72%), Gaps = 15/603 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E     N + + +E +IL LLLSL+ YR+ + +++G+  TWL+A +CE  FTF W+
Sbjct  7     LPLHERFEHKNTLHKVMEFIILFLLLSLLVYRLLSFNNNGF--TWLIAFLCELSFTFNWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + +S KWN VE  TYP+R L+ V     E P VDMFVTTA+PELEPPI+T+NTVLSLLAL
Sbjct  65    ITISNKWNIVEYKTYPDRLLQRV--AEHELPPVDMFVTTADPELEPPIITINTVLSLLAL  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHT-FP  931
             +YPA+KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKY+V VRAPFRYF+ ++T F 
Sbjct  123   DYPADKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYDVQVRAPFRYFSNNNTMFT  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
                S EF+REWK + DEY  L  K+EYA  K   F+    FA F+D++ N+H TIIKV+ 
Sbjct  183   GNKSNEFKREWKTLKDEYEQLSRKVEYAVGKSIPFDLSGDFAVFSDIEGNNHPTIIKVVW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN    + G+PHL+YISREKRPKH H+ KAGAMNVLTRVSG+M NAPFMLNVDCD  VNN
Sbjct  243   ENKVGASNGLPHLVYISREKRPKHPHHSKAGAMNVLTRVSGLMRNAPFMLNVDCDMLVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P ++ HAMC LLG+K+E +  FVQFPQTFYDGLKDDP+ +Q  +++   GRG + IQG F
Sbjct  303   PNMMFHAMCMLLGSKNETENAFVQFPQTFYDGLKDDPFGNQMTVLWKYAGRGISGIQGPF  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGC HRRKVIYGLSPND     K+T+ DL K +G SK F  S    L G        
Sbjct  363   YLGTGCVHRRKVIYGLSPNDV----KMTN-DLLKTFGNSKEFTKSVDDALQGKTEYP--D  415

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
             +LS S+EAA QV +CGYE+GT WG  +GW YGS TEDILTG+ I + GW++  C P+ P 
Sbjct  416   MLSKSMEAAHQVGDCGYEYGTNWGKKVGWMYGSTTEDILTGLSIHKRGWRSIICSPDPPA  475

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F GC P+ G  S+ Q KRWA+G  EIL S  CP+F  +F NL+FR  LAY     W +R 
Sbjct  476   FQGCAPTGGPASMTQQKRWATGLLEILLSKNCPVFHTIFANLKFRMFLAYFWVFSWALRS  535

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             + ELCYA LP Y +ITN+HFLPKG E    IP ++F++Y++YTL EY++   SIRAWWNN
Sbjct  536   VPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVLYHVYTLSEYLQTGLSIRAWWNN  595

Query  2183  QRM  2191
             QRM
Sbjct  596   QRM  598



>ref|XP_010035546.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Eucalyptus 
grandis]
Length=753

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/610 (57%), Positives = 426/610 (70%), Gaps = 20/610 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     +   RAVE+ IL LL+SL+AYR+ +L  HG    W +ALVCESWFTF+WVL
Sbjct  9     PLYEKISLKSNAKRAVEIFILFLLVSLLAYRLVHLKDHGL--EWQVALVCESWFTFVWVL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             VVS+KW+ V+  TYP+R L+ V     E P VD+FVTTA+P+LEPPI+TVNTVLSL+A++
Sbjct  67    VVSSKWSPVDYQTYPQRVLQRVT----ELPPVDVFVTTADPQLEPPIITVNTVLSLMAVD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTF--P  931
             YPA+KLACYVSDD  SP+TFY+L+EA+KFAKLWVPFCKKYN+ +RAPFRYF  D T    
Sbjct  123   YPAHKLACYVSDDGCSPLTFYSLMEAAKFAKLWVPFCKKYNIQLRAPFRYFAGDVTTLSG  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
              + S EF++    M DEY  L  KIE A+Q    F+   +FA F++ + ++H +IIK+I 
Sbjct  183   EDCSWEFQQARDTMKDEYEKLSRKIEDASQGSVPFDLTGEFAAFSNTERSNHPSIIKIIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E     +PHLIYISREKRPK  H++KAGAMNVLTRVSG+MTNAPFMLNVDCD + NN
Sbjct  243   ENKEGHPDALPHLIYISREKRPKQPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMHANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++VLHA+C LLG K ERD  +VQ PQ FYDGLKDDP+ +Q  +++  +GRG   IQG F
Sbjct  303   PQIVLHALCLLLGTKRERDCAYVQCPQIFYDGLKDDPFGNQMVVLFEYMGRGIVGIQGPF  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAE-------KLTDHDLQKIYGKSKIFVtsatttlsgs  1621
             Y GTGCFHRRKVIYG  P+D  T         +LT  +L   +G SK F+   +   +  
Sbjct  363   YSGTGCFHRRKVIYGSWPDDMKTENSGLTSNGELTKENLLNEFGSSKQFI--NSAAQALQ  420

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              +S     LS SLE   QVA+C YE+ T WG  IGW YGS TEDILTG+ IQ  GWK+ +
Sbjct  421   GNSNHLEDLSSSLETVHQVASCTYEYDTDWGQKIGWMYGSTTEDILTGLAIQTKGWKSVY  480

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P  P FLGC PS G  S+ Q KRWA+G  E+L S K PI+  LF  L FRQCLAY+  
Sbjct  481   CSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLVSKKNPIYGTLFVQLHFRQCLAYLWL  540

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
             ++  +R I E  YA +P YC++TNSHFLPKG E A VIPA+IF+IYNLY L EY     S
Sbjct  541   LIRALRSIPEFLYALIPAYCIMTNSHFLPKGQEPASVIPAAIFVIYNLYCLHEYFMTNLS  600

Query  2162  IRAWWNNQRM  2191
             I  WWNN RM
Sbjct  601   ILEWWNNHRM  610



>ref|XP_010035545.1| PREDICTED: cellulose synthase-like protein B4 [Eucalyptus grandis]
 gb|KCW46971.1| hypothetical protein EUGRSUZ_K00779 [Eucalyptus grandis]
Length=754

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/610 (57%), Positives = 424/610 (70%), Gaps = 20/610 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N   RAVE+ IL LL+SL+AYR+ +L  HG    W +AL CESWFTF+W+L
Sbjct  9     PLYEKISLKNDAKRAVEIFILFLLVSLLAYRLIHLEDHGL--EWQVALACESWFTFVWIL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             V+STKWN V   TYP R L+ V     E P VDMFVTTA+P+LEPPI+TVNTVLSL+A++
Sbjct  67    VISTKWNPVSYKTYPHRILKRVS----ELPPVDMFVTTADPQLEPPIITVNTVLSLMAVD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP-  934
             YPA+KLACYVSDD  SP+T+Y+L+EA+KFAKLWVPFCKKY++ +RAPFRYF  D T    
Sbjct  123   YPAHKLACYVSDDGCSPLTYYSLMEAAKFAKLWVPFCKKYDIQLRAPFRYFAGDSTTSSG  182

Query  935   -ESSPEFRREWKKMNDEYANLCGKIEYAT--QKPS-LFNKFATFADLDPNDHSTIIKVIC  1102
              + S EF++    M DEY  L  KIE A+    PS +  +F  F++    +H TIIK++ 
Sbjct  183   EDCSLEFQQARDTMKDEYEKLSRKIEDASLGSVPSNVTGEFVAFSNTQRKNHPTIIKIML  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN       +PHLIYISREKRPKH H++KAGAMNVLTRVSG+MTNAP MLNVDCD Y NN
Sbjct  243   ENKGGHPDELPHLIYISREKRPKHPHHYKAGAMNVLTRVSGLMTNAPLMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++V HA+C LLG K ERD  FVQ PQ FYDG KDDP+ +Q  +++  LGRG   IQG  
Sbjct  303   PQIVYHALCLLLGTKYERDCAFVQCPQYFYDGAKDDPFGNQLVVLFEYLGRGIVGIQGPV  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEK-------LTDHDLQKIYGKSKIFVtsatttlsgs  1621
             Y GTGCFHRRKVIYG    D  T +K       LT  +  K +G SK F+ S    L G+
Sbjct  363   YGGTGCFHRRKVIYGSWAKDMKTEKKSLTSNGELTMVESLKGFGSSKQFINSVAYALQGN  422

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
               +     L  SLEAA QV NC YE+ T WG  +GW YGS TED+LTG+ I   GW++ +
Sbjct  423   SDNPK--DLWSSLEAAYQVTNCTYEYNTDWGKEVGWMYGSTTEDVLTGLAIHSKGWRSLY  480

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P+ P FLGC PS G  S+ Q KRWA+G  E+L S + PI+  LF +L FRQCLAY+  
Sbjct  481   CSPDPPAFLGCAPSGGPASMTQQKRWATGLLEVLMSKRSPIYGTLFMHLHFRQCLAYLWI  540

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
             ++W +R I E  YA LP YC++TNSHFLPKG E AI+IPA+IF+IYNLY L+EY+    S
Sbjct  541   VIWALRSIPEFLYALLPAYCIMTNSHFLPKGKEPAIIIPATIFVIYNLYCLYEYLAVGLS  600

Query  2162  IRAWWNNQRM  2191
             IRAWWNNQRM
Sbjct  601   IRAWWNNQRM  610



>ref|XP_008229978.1| PREDICTED: cellulose synthase-like protein B4 isoform X1 [Prunus 
mume]
Length=761

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/617 (56%), Positives = 434/617 (70%), Gaps = 29/617 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E     N + + +E +IL LLLSL+ YR+ + +++G+  TWL+A +CE  FTF W+
Sbjct  7     LPLHERFEHKNTLHKVMEFIILFLLLSLLVYRLLSFNNNGF--TWLIAFLCELSFTFNWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + +S KWN VE  TYP+R L+ V     E P VDMFVTTA+PELEPPI+T+NTVLSLLAL
Sbjct  65    ITISNKWNIVEYKTYPDRLLQRV--AEHELPPVDMFVTTADPELEPPIITINTVLSLLAL  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHT-FP  931
             +YPA+KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKY+V VRAPFRYF+ ++T F 
Sbjct  123   DYPADKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYDVQVRAPFRYFSNNNTMFT  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
                S EF+REWK + DEY  L  K+EYA  K   F+    FA F+D++ N+H TIIKV+ 
Sbjct  183   GNKSNEFKREWKTLKDEYEQLSRKVEYAVGKSIPFDLSGDFAVFSDIEGNNHPTIIKVVW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN    + G+PHL+YISREKRPKH H+ KAGAMNVLTRVSG+M NAPFMLNVDCD  VNN
Sbjct  243   ENKVGASNGLPHLVYISREKRPKHPHHSKAGAMNVLTRVSGLMRNAPFMLNVDCDMLVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P ++ HAMC LLG+K+E +  FVQFPQTFYDGLKDDP+ +Q  +++   GRG + IQG F
Sbjct  303   PNMMFHAMCMLLGSKNETENAFVQFPQTFYDGLKDDPFGNQMTVLWKYAGRGISGIQGPF  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGC HRRKVIYGLSPND     K+T+ DL K +G SK F  S    L G        
Sbjct  363   YLGTGCVHRRKVIYGLSPNDV----KMTN-DLLKTFGNSKEFTKSVDDALQGKTEYP--D  415

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
             +LS S+EAA QV +CGYE+GT WG  +GW YGS TEDILTG+ I + GW++  C P+ P 
Sbjct  416   MLSKSMEAAHQVGDCGYEYGTNWGKKVGWMYGSTTEDILTGLSIHKRGWRSIICSPDPPA  475

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F GC P+ G  S+ Q KRWA+G  EIL S  CP+F  +F NL+FR  LAY     W +R 
Sbjct  476   FQGCAPTGGPASMTQQKRWATGLLEILLSKNCPVFHTIFANLKFRMFLAYFWVFSWALRS  535

Query  2003  IFELCYAFLPPYCLITNSHFLPK--------------GNEVAIVIPASIFIIYNLYTLWE  2140
             + ELCYA LP Y +ITN+HFLPK              G E    IP ++F++Y++YTL E
Sbjct  536   VPELCYAALPAYSIITNTHFLPKVRAHPHPWTLGLMQGQEPTYYIPIALFVLYHVYTLSE  595

Query  2141  YMEEKESIRAWWNNQRM  2191
             Y++   SIRAWWNNQRM
Sbjct  596   YLQTGLSIRAWWNNQRM  612



>ref|XP_007049091.1| Cellulose synthase-like B3, putative [Theobroma cacao]
 gb|EOX93248.1| Cellulose synthase-like B3, putative [Theobroma cacao]
Length=750

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/610 (58%), Positives = 436/610 (71%), Gaps = 21/610 (3%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             LYE     N + RA+++ +L LL+SL+ YR+++L++HG+   WLLA  CESWFTF W L+
Sbjct  9     LYEKVACKNIIQRALDIALLFLLVSLLFYRLYSLNNHGF--VWLLAFFCESWFTFNWFLL  66

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             VS+KWN V+  TYPE   +       E P VDMFVTTA+P LEPPI+TVNT+LSLLA++Y
Sbjct  67    VSSKWNPVDFKTYPENLAQRFP----ELPLVDMFVTTADPVLEPPIITVNTILSLLAVDY  122

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADH-TFPPE  937
             PA+KLACY+SDD  SP+TFY+LVEASKFAKLWVPFCKKY + VRAPFRYF  D  +F   
Sbjct  123   PADKLACYLSDDGCSPLTFYSLVEASKFAKLWVPFCKKYKIQVRAPFRYFLDDPISFTSS  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPS---LFNKFATFADLDPNDHSTIIKVICEN  1108
             ++ EFR++WKKM  EY +L  KIE A +K     L  +FA F++++ ++H TIIK I +N
Sbjct  183   ANSEFRQDWKKMKAEYEHLSLKIEEAGRKSGPWDLTGEFAIFSNVERSNHPTIIKAIGDN  242

Query  1109  DESLAVG-VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
              +S + G VPHL+YISREKRPKH H++KAGAMNVLTRVSG++TNAP+MLNVDCD +VNNP
Sbjct  243   KQSSSDGDVPHLVYISREKRPKHAHHYKAGAMNVLTRVSGLITNAPYMLNVDCDMFVNNP  302

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +VV  AMC LL +K ER+  FVQ+PQ FYDG KDDPY +Q  ++   LGRG A IQG  Y
Sbjct  303   QVVRQAMCQLLDSKSEREIAFVQYPQCFYDGPKDDPYGNQLVVLMEYLGRGIAGIQGPCY  362

Query  1466  DGTGCFHRRKVIYGLSPND--------TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgs  1621
              GTGCFHRRKVIYGL P+D        T    KLTD++  K +GKSK F  S T  L G 
Sbjct  363   SGTGCFHRRKVIYGLWPDDSENQGRNHTSINGKLTDNEPLKEFGKSKEFSESVTYALKGK  422

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
                     +S SLEAA QV+ CGYEFGT+WG  +GW YGS+TED++TG+ I + GWK+ F
Sbjct  423   KGFS--NNISGSLEAAFQVSRCGYEFGTSWGTKVGWIYGSMTEDVITGLTIHKKGWKSTF  480

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
              +P  P FLGC PS G  ++ Q KRWA+G  EIL S K PIFA L   LQFR  LAY   
Sbjct  481   PMPNPPAFLGCAPSGGPAAMTQQKRWATGLLEILVSDKSPIFATLTDRLQFRMFLAYFWI  540

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
             + W +  I ELCYA LP YC+I NSHFLPK  + AI+IP +IF+IYNL TL EY++   S
Sbjct  541   LSWGLGSIPELCYAALPAYCIIANSHFLPKVQDPAILIPLAIFVIYNLLTLREYLKTGIS  600

Query  2162  IRAWWNNQRM  2191
             IRAWWNN RM
Sbjct  601   IRAWWNNMRM  610



>ref|XP_010657216.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=754

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/613 (56%), Positives = 424/613 (69%), Gaps = 20/613 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE   + N V R ++V I +LLL+L+AYR+ +L S+G+  +W  AL+CESWFTF+WV
Sbjct  7     LPLYEKLPQKNTVQRVLDVTIFVLLLTLLAYRILSLKSNGF--SWFFALLCESWFTFVWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++S+KWN V   TYPER L W++    E P VDMFVTTA+P LEPPI+TVNTVLSLLA 
Sbjct  65    VILSSKWNPVVYRTYPERLLFWID----ELPPVDMFVTTADPTLEPPIITVNTVLSLLAF  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF  +   P 
Sbjct  121   DYPANKLACYVSDDGCSPLTFYALLEASKFAKLWVPFCKKYGIHTRAPFRYFYDEEESPH  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK--PSLFN--KFATFADLDPNDHSTIIKVIC  1102
             ++S EF RE+ KM DEY  L  KIE AT+K  P   +  +F  F+D++  +H +IIKVI 
Sbjct  181   DNSTEFIREYTKMKDEYEVLRRKIEDATEKSIPCDLSSEEFVAFSDIERRNHPSIIKVIL  240

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E L  G+PHLIY+SREK PK+ H++KAGA+NVLTRVSG MTNAPF+LNVDCD Y NN
Sbjct  241   ENKEGLVDGLPHLIYVSREKCPKYPHHYKAGALNVLTRVSGAMTNAPFILNVDCDMYANN  300

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
              ++V HAMC LLG K  +D  F Q PQ FYDGLKDDP  +Q       +G G + +QG +
Sbjct  301   SQIVFHAMCLLLGCKKGQDFAFAQSPQIFYDGLKDDPLGNQLVATQKYIGEGISGLQGPY  360

Query  1463  YDGTGCFHRRKVIYGLSPNDTV---------TAEKLTDHDLQKIYGKSKIFVtsatttls  1615
             Y GTGCFHRRKV+YGL P+  +          A KLTD  L++ +G S+ F  +    LS
Sbjct  361   YSGTGCFHRRKVLYGLWPDGCMETGGRSPNCVAGKLTDEGLRQSFGHSREFSKTVERILS  420

Query  1616  gslssetFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
             G          LS S EAA+QVA+CGYE GT+WG  IGW YGS +ED+LTG+ I   GW+
Sbjct  421   GLSGKADCPYDLSSSAEAANQVADCGYECGTSWGTKIGWIYGSTSEDVLTGLKIHARGWR  480

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             +  C P+ P FLGC PS G  SL Q KRW +G  EILFS   P  A L   LQFRQCLAY
Sbjct  481   SAECKPDPPAFLGCAPSGGPASLTQQKRWVTGLLEILFSKNNPFIATLTAKLQFRQCLAY  540

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             M  + W +R I ELCY  LP YC+I NSHFLPK  E A +I A++F IYNL++L EY   
Sbjct  541   MYILSWGLRWIPELCYIALPAYCIIANSHFLPKVEEPAFLILAALFAIYNLHSLLEYCRI  600

Query  2153  KESIRAWWNNQRM  2191
               SIR WWNNQRM
Sbjct  601   GLSIRTWWNNQRM  613



>ref|XP_007217027.1| hypothetical protein PRUPE_ppa001909mg [Prunus persica]
 gb|EMJ18226.1| hypothetical protein PRUPE_ppa001909mg [Prunus persica]
Length=743

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/603 (57%), Positives = 430/603 (71%), Gaps = 12/603 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E     N + + +E +IL LLLSL+ YR+ + +++G+  TWL+A +CE  FTF W+
Sbjct  7     LPLHERFEHKNTLHKVMEFIILFLLLSLLVYRLLSFNNNGF--TWLIAFLCELSFTFNWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + ++ KWN VE  TYP+R L+ V     E P VDMFVTTA+PELEPPI+T+NTVLSLLAL
Sbjct  65    ITINNKWNIVEYKTYPDRLLQRV--AEHELPPVDMFVTTADPELEPPIITINTVLSLLAL  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHT-FP  931
             +YPA+KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKY+V VRAPFRYF+ ++T F 
Sbjct  123   DYPADKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYDVQVRAPFRYFSNNNTMFS  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYA--TQKP-SLFNKFATFADLDPNDHSTIIKVIC  1102
                S EF+REWK + DEY  L  K+  A  T  P  L   FA F+D++ N+H TIIKV+ 
Sbjct  183   GNKSNEFKREWKTLKDEYEQLSRKVVDAVGTSIPFDLSGDFAVFSDIEGNNHPTIIKVVW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN    + G+PHL+YISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNN
Sbjct  243   ENKVGASNGLPHLVYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMLVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P ++ HAMC LLG+K+E +  FVQFPQTFYDGLKDDP+ +Q  +++   GRG + IQG F
Sbjct  303   PNMMFHAMCMLLGSKNETENAFVQFPQTFYDGLKDDPFGNQMTVVWKYAGRGISGIQGPF  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGC HRRKVIYGLSPND          +L K +G S+ F+ SA   L G        
Sbjct  363   YLGTGCVHRRKVIYGLSPNDVKGTNG--KPELHKTFGNSQEFIKSADDALRGKTKYP--D  418

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
             +LS S+EAA QV +CGYE+ T WG  +GW YGS TEDILTG+ I + GW++  C P+ P 
Sbjct  419   MLSKSMEAAHQVGDCGYEYDTNWGKKVGWMYGSRTEDILTGLSIHKRGWRSIICSPDPPA  478

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F GC P+ G  S+ Q KRWA+G  EIL S  CPIF  +F NL+FR  LAY     W +R 
Sbjct  479   FQGCAPTGGPASMTQQKRWATGLLEILLSKNCPIFHTIFANLKFRMFLAYFWVFSWALRS  538

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             + ELCYA LP Y +ITN+HFLPKG E    IP ++F++Y++YTL EY++   SIRAWWNN
Sbjct  539   VPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVLYHVYTLSEYLQTGLSIRAWWNN  598

Query  2183  QRM  2191
             QRM
Sbjct  599   QRM  601



>ref|XP_002529325.1| transferase, putative [Ricinus communis]
 gb|EEF33042.1| transferase, putative [Ricinus communis]
Length=749

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/613 (55%), Positives = 427/613 (70%), Gaps = 23/613 (4%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N + R ++V +L LL SL+ YR+++L  HG+   W LAL+CESWFTFIW L
Sbjct  8     PLYERISIKNPIHRTLDVAVLFLLSSLLVYRLYSLDKHGF--AWFLALLCESWFTFIWFL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEF-PAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               + KWN V+  TYPE   + VE    EF PAVDMFVTTA+P LEPPI+T+NTVLSLLA+
Sbjct  66    TANAKWNPVKYKTYPEHLSQRVE----EFLPAVDMFVTTADPLLEPPIITMNTVLSLLAV  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP +KLACYVSDD  SP+T+Y+LVE SKFA+LWVPFCKKYN+ VRAPFRYF+ +     
Sbjct  122   DYPVHKLACYVSDDGCSPLTYYSLVETSKFAQLWVPFCKKYNIQVRAPFRYFSNESMISA  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
              +S EF++EWK + DEY     KI+ A  K     L +  A F+++D  +H +IIKVI E
Sbjct  182   RNSLEFQQEWKMLKDEYEKFSRKIQDAAGKSVPWDLNDDLAVFSNIDRRNHPSIIKVIWE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + L+ G+PHL+YISREKR KH H++KAGAMNVLTRVSG++TNAPFMLNVDCD YVN+P
Sbjct  242   NKKGLSDGLPHLVYISREKRLKHAHHYKAGAMNVLTRVSGLVTNAPFMLNVDCDMYVNDP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +VV  AMCFLLG+ +ER+  FVQFPQ FYD LKDDP+ S   ++Y  +GRG A +QG FY
Sbjct  302   QVVRRAMCFLLGSSNEREFAFVQFPQVFYDELKDDPFGSTLAVVYEYMGRGIAGLQGPFY  361

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEK-----------LTDHDLQKIYGKSKIFVtsatttl  1612
              GTGCFHRRKVIYGL P+D  T +             +D +L  I+G S  F+ SA   L
Sbjct  362   GGTGCFHRRKVIYGLCPDDVGTEKNNATPVSSTYFVHSDKELLNIFGNSMEFIKSAAQAL  421

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
              G  +S     LS  +E   QVA CGYE+GT WG  +GW+YGS TED+LTG+ I   GW+
Sbjct  422   QGKTTSPR--NLSNLVETEYQVAGCGYEYGTAWGTEVGWQYGSTTEDVLTGLMIHSRGWR  479

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +C PE P FLGC+PS+G   L Q KRWA+G  EIL   K PI  A+   LQFRQCL Y
Sbjct  480   SAYCTPEPPAFLGCSPSSGPTLLTQQKRWATGLVEILVCRKSPIVTAITAKLQFRQCLVY  539

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +  + W +R I ELCY  LP YC+I+NS+FLPK NE  I    ++ I+Y+LYT+ EY++ 
Sbjct  540   LFILTWGLRSIPELCYMLLPAYCIISNSNFLPKFNEPPIYGYIALIIVYSLYTILEYLQT  599

Query  2153  KESIRAWWNNQRM  2191
               SIRAWWN Q+M
Sbjct  600   GLSIRAWWNKQKM  612



>ref|XP_010089469.1| Cellulose synthase-like protein H1 [Morus notabilis]
 gb|EXB37862.1| Cellulose synthase-like protein H1 [Morus notabilis]
Length=763

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/613 (56%), Positives = 421/613 (69%), Gaps = 19/613 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYT-WLLALVCESWFTFIW  571
              PLYE   R N V    E++I  LLL L  YR+  L  H    + WLLA +CE WFTF W
Sbjct  10    LPLYERISRKNVVKNFFEIIIFFLLLPLPVYRIIFLRDHTVDSSYWLLAFLCELWFTFYW  69

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             V+++STKWN VE  T+P+R L+WV+    E P+VDMFVTTA+PELEPPI+T+NTVLSLLA
Sbjct  70    VILISTKWNPVEYKTHPDRLLQWVD----ELPSVDMFVTTADPELEPPIITINTVLSLLA  125

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHT-F  928
             ++YPA+KLACYVSDD  SP+  Y+L+EAS FAKLWVPFCKK+NV +RAPFRYF+++    
Sbjct  126   VDYPASKLACYVSDDGCSPIILYSLMEASNFAKLWVPFCKKHNVKLRAPFRYFSSESLPL  185

Query  929   PPESSPEFRREWKKMNDEYANLCGKI-----EYATQKPSLFNKFATFADLDPNDHSTIIK  1093
               E S EF+REWK M DEY  L  KI     E A+    L   F  F +++  +H TIIK
Sbjct  186   GHEYSREFQREWKAMKDEYEQLSRKIIGAVVEKASLPCDLVKDFEVFLNIERINHPTIIK  245

Query  1094  VICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFY  1273
             VI EN   +A  +PHL+YISREKRP H H++KAGAMNVL RVSG+MTNAPFMLNVDCD +
Sbjct  246   VIWENKRGIADEMPHLVYISREKRPTHPHHYKAGAMNVLARVSGLMTNAPFMLNVDCDMF  305

Query  1274  VNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
             VNNP+ VLHAMC LLG K+E++  F Q PQ FYDGLKDDP+ +Q  +++  L +G A IQ
Sbjct  306   VNNPKTVLHAMCLLLGPKNEKEVAFCQCPQVFYDGLKDDPFGNQLVVLFEYLAKGVAGIQ  365

Query  1454  GSFYDGTGCFHRRKVIYGLSPND---TVTAEKLTDHDLQKI-YGKSKIFVtsatttlsgs  1621
             G FY GTGCFHRRKVIYGLSP+D       +   DH L +I +G SK FVT+      G 
Sbjct  366   GPFYSGTGCFHRRKVIYGLSPDDIENNTNGKLAKDHKLLQISFGSSKDFVTAVADAFKGE  425

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              +      L  SLEAA+QVA CGYE GT WG  +GW YGS TEDI T + I R GW+T  
Sbjct  426   KTEFA-KSLENSLEAANQVAACGYESGTDWGKKVGWIYGSTTEDINTSLIIHRKGWRTVL  484

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
               P+ P FLGC P++G  ++ Q KRWA+G  EIL S  CPIF  LFG LQ RQ LAY+  
Sbjct  485   SWPDPPAFLGCAPTSGPTAMTQQKRWATGLLEILVSKNCPIFFTLFGKLQLRQGLAYLWI  544

Query  1982  ILWPVRPIFELCYAFLPPYCLITNS---HFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             + W +R I ELCYA L  Y +ITNS    FLPK  E A  IP ++F+IYNLYTL EY   
Sbjct  545   LCWGLRSIPELCYAALLAYSIITNSPFLPFLPKSQEPAFYIPIALFVIYNLYTLSEYFAT  604

Query  2153  KESIRAWWNNQRM  2191
              +SIRAWWNNQ+M
Sbjct  605   GQSIRAWWNNQKM  617



>ref|XP_002302868.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE82141.1| cellulose synthase family protein [Populus trichocarpa]
Length=749

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/608 (56%), Positives = 434/608 (71%), Gaps = 20/608 (3%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             LY+       + RA ++ IL+LL+SL+ YR+  + +HG+   WLLAL+CE+ FTF WVL 
Sbjct  10    LYDKVALKYPIHRAFDITILVLLISLLVYRLLYISNHGF--AWLLALLCETCFTFTWVLT  67

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             VS+KWN VE  TYPER  + ++    E P VD+FVTTA+P LEPPILTVNTV+SLLA++Y
Sbjct  68    VSSKWNPVEYKTYPERLSQKIQ----ELPPVDIFVTTADPVLEPPILTVNTVISLLAVDY  123

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PA+KLACYVSDD  SP T+Y+LVEASKFAKLW PFCKK+N+ VRAPFRYF+++   P  +
Sbjct  124   PADKLACYVSDDGCSPTTYYSLVEASKFAKLWAPFCKKHNIQVRAPFRYFSSE--VPLNN  181

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICEND  1111
             S EF++E+ KM DEY  L  KI  A +K    +L   FA F++++  +H  IIKV+ EN 
Sbjct  182   SSEFQQEYNKMKDEYEELASKINDADKKSIERNLSGDFAAFSNIEGKNHPAIIKVVWENK  241

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
               ++  +PHLIYISREKRPKH H++KAGAMNVLTRVSG+MTNAPFMLN+DCD +VNNP++
Sbjct  242   AGISDELPHLIYISREKRPKHPHHYKAGAMNVLTRVSGMMTNAPFMLNLDCDMFVNNPKI  301

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             V HAMC LLG+++E ++GFVQFPQ FYDGLKDDPY +Q+++ +  +G G   IQG FY G
Sbjct  302   VCHAMCLLLGSRNEMESGFVQFPQYFYDGLKDDPYGNQFEVWHKYIGNGIVGIQGPFYGG  361

Query  1472  TGCFHRRKVIYGLSPNDT-VTAEKL-------TDHDLQKIYGKSKIFVtsatttlsgsls  1627
             TGCFHRRKVIYG  P D  + A+ L       T   L KI+G SK FV SA   L G  +
Sbjct  362   TGCFHRRKVIYGSCPRDVGIQAKSLTPVHAVATSFLLLKIFGNSKEFVRSAAHALQGKAN  421

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                  +L   +EAA +VA CGYE+GT+WG  +GW+YGS TEDILTG+ I   GW++  C 
Sbjct  422   MSP-KILPNLIEAAHEVAGCGYEYGTSWGKEVGWQYGSATEDILTGLKIHARGWRSVLCT  480

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+   FLGC P  G  S+ Q KRWA+G  EIL S + PI A L   LQFRQCLAY+  ++
Sbjct  481   PDPRAFLGCAPRVGPISMTQQKRWATGLLEILMSERNPIIATLTARLQFRQCLAYLWILI  540

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I E+CYA LP YC+ITNS FLPK +E A+ I  ++F+ Y +Y L EY+E   SIR
Sbjct  541   WGLRSIPEICYAVLPAYCIITNSSFLPKAHEPAMYIHVALFLSYVIYGLLEYLETGLSIR  600

Query  2168  AWWNNQRM  2191
             AWWNNQRM
Sbjct  601   AWWNNQRM  608



>emb|CBI28826.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/609 (58%), Positives = 434/609 (71%), Gaps = 17/609 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL+E   + N   RA+++ I  LLLSL+AYR+ +L ++G+  TWLLA +CESWFTFIW+L
Sbjct  8     PLHEKFPQKNTFHRALDLTIFFLLLSLLAYRLLSLKNNGF--TWLLAFLCESWFTFIWIL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              VSTKWN V   TYPER L+       E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NVSTKWNPVSYKTYPERLLQCYRVD--ELPPVDMFVTTADPMLEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF+ +     +
Sbjct  124   YPANKLSCYVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYFSRELLPSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFAT-----FADLDPNDHSTIIKVIC  1102
             +S EF +E++K+ DEY  L  +IE+AT K S+ ++ +T     F+++    H TIIKVI 
Sbjct  184   NSTEFLQEYRKIMDEYEELRRRIEHATLK-SISHELSTADFVAFSNIKKGSHPTIIKVIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NN
Sbjct  243   ENKESRSDGLPHLVYVSREKDPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++  HAMC LLG+K+E+D GFVQ PQ FYDGLKDDP+ +Q  ++Y  LG G A +QG  
Sbjct  303   PQIFHHAMCLLLGSKNEQDCGFVQSPQCFYDGLKDDPFGNQLVVLYKYLGSGIAGLQGPT  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslss  1630
             Y GTGCFHRRKVIYGL P+  +  +    KLTD  +QK +G SK F  +A   LSG    
Sbjct  363   YIGTGCFHRRKVIYGLWPDGRMEIKGRSGKLTDERIQKTFGNSKEFTKTAARILSGLSGI  422

Query  1631  et--FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFC  1804
                 + +L+  +EAA +VA C YE+GT+WG  IG  YGS TED+LTG+ IQ  GWK+  C
Sbjct  423   SHCPYDLLN-RVEAAQEVATCSYEYGTSWGTKIGCLYGSTTEDVLTGMRIQARGWKSTDC  481

Query  1805  VPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISI  1984
              P+ P FLGC PS G  +L Q KRWA+G  EILFS   P  AA    LQFRQCLAY+  I
Sbjct  482   RPDPPAFLGCAPSGGPAALTQQKRWATGLLEILFSKNSPFIAAFTAKLQFRQCLAYLWFI  541

Query  1985  LWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESI  2164
              W +R I ELCY  LP YC++  SHFLPK  E A++IP S+F+ YN YTL+EY     SI
Sbjct  542   SWALRSIPELCYLALPAYCIMAGSHFLPKVQEPAVLIPISLFVSYNFYTLFEYYGAGFSI  601

Query  2165  RAWWNNQRM  2191
             RA WNN RM
Sbjct  602   RACWNNLRM  610



>ref|XP_009353304.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Pyrus 
x bretschneideri]
Length=747

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/606 (57%), Positives = 423/606 (70%), Gaps = 13/606 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E       + + +E +IL LLLSL+ +R+ + + HG+  TWL+A +CE  FT  WV
Sbjct  7     LPLHERIELRYTLHKVIEFIILFLLLSLLVHRLLSFNDHGF--TWLIAFLCELSFTLNWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + +S KWN VE  TYP+R L+ V     E P VDMFVTTAN ELEPPI+T+NTVLSLLA+
Sbjct  65    ITISNKWNIVEYKTYPDRLLQRVSKH--ELPPVDMFVTTANSELEPPIITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YP NKLACYVSDD  SP+TFY+L EASKFAKLWVPFCKKYNV VRAPFRYF N + TF 
Sbjct  123   DYPTNKLACYVSDDGCSPLTFYSLSEASKFAKLWVPFCKKYNVQVRAPFRYFSNNNTTFS  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
                S EF++EW  + DEY  L  KIE A  K   F+    F  F++++ N+H TIIKV+ 
Sbjct  183   SNDSSEFKQEWTLLKDEYEQLSRKIEDAVGKSIPFDVSQDFPVFSNIERNNHPTIIKVLW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E ++ G PHLIYISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNN
Sbjct  243   ENKEDVSDGPPHLIYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P ++LHAMC LLG+++E    F QFPQ FYDGLKDDP+ +Q  +++  +G G A IQG  
Sbjct  303   PNIMLHAMCTLLGSENETKNAFAQFPQIFYDGLKDDPFGNQMVVLWKFVGHGIAGIQGPI  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEK---LTDHDLQKIYGKSKIFVtsatttlsgslsse  1633
             Y GTGC HRRKVIYGLSP DT T E+   +   ++ K +G S+ F  SA   L G+    
Sbjct  363   YAGTGCVHRRKVIYGLSPTDTKTGERYPNIGKVEMLKNFGTSEEFTKSAGDALQGNTECV  422

Query  1634  tFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                  S S+EAA +V  C YE+GT WG  +GWRYGS TEDILTG+ I   GW + FC P+
Sbjct  423   NMS--SKSIEAAHRVGECEYEYGTNWGIKVGWRYGSTTEDILTGLSIHNKGWNSIFCTPD  480

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
              P FLGC P+ G  S+ Q KRWA+G  EIL S  CPIF  LF NLQFR  L Y   + W 
Sbjct  481   PPAFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPIFGTLFANLQFRMFLCYFWVLSWG  540

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
             +R I ELCYA LP Y +ITN+HFLPKG E    IP ++F++Y++YTL E+++   SIRAW
Sbjct  541   LRCIPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVLYHIYTLLEHLQTGLSIRAW  600

Query  2174  WNNQRM  2191
             WNNQRM
Sbjct  601   WNNQRM  606



>ref|XP_007217825.1| hypothetical protein PRUPE_ppa026099mg [Prunus persica]
 gb|EMJ19024.1| hypothetical protein PRUPE_ppa026099mg [Prunus persica]
Length=743

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/603 (56%), Positives = 428/603 (71%), Gaps = 15/603 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N + + +E +IL LLLSL+ YR+ +  +HG+   WL+A +CE WFT  WV+
Sbjct  8     PLYERLEHKNTMHKVMEFIILFLLLSLLVYRLLSFSNHGF--AWLVAFLCELWFTLYWVI  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S+KW+ VE  TYP+R L+ V     E P VDMFVTTA+ ELEPPI+T+NTVLSLLA++
Sbjct  66    TISSKWSFVEYKTYPDRLLQRV--AEHELPPVDMFVTTADSELEPPIITLNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP +KLACYVSDD  SP+TFY+LVEASKFA+LWVPFCKKYNV VRAPFRYFN D     +
Sbjct  124   YPTDKLACYVSDDGCSPLTFYSLVEASKFAELWVPFCKKYNVQVRAPFRYFNNDAIPSSK  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             +S EF++EWK M DEY  L  KIE A  K   F+    F+ F++++ N+H TIIKV+ + 
Sbjct  184   NSGEFKQEWKTMKDEYMKLNRKIEDAVGKSIPFDLSEDFSLFSNIERNNHPTIIKVVLDK  243

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
             +E  + G+P L+YISREKRPKH H+ KAGAMNVLTRVSG+MTNAP MLNVDCD + NNP 
Sbjct  244   EEGHSNGLPRLVYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPLMLNVDCDMFANNPS  303

Query  1289  VVLHAMCFLLGA-KDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             VVLHAMC LLG+ +++ +  F QFPQ FYDGLKDDP+ +Q  +I+  LG G   IQG FY
Sbjct  304   VVLHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDPFGNQMAVIWKYLGHGIQGIQGVFY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GTGCFHRR+VIYGLSPN+     KL + +L K +G SK    SA   L G        +
Sbjct  364   AGTGCFHRRQVIYGLSPNNG----KLGNQELLKTFGNSKELTNSAADALRGETKCP--SM  417

Query  1646  LSYSLEAAS-QVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
             L  S+EAA+ QVA+C YE+GT WG  +GW YGS TEDILTG+ I   GWK+  C P++P 
Sbjct  418   LLKSIEAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDILTGLSIHNRGWKSIICTPDQPA  477

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             FLGCTP+ G  S+ Q KRWA+G  E+L S  CPIF  +F +LQFRQCLAY+    W +R 
Sbjct  478   FLGCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTVFAHLQFRQCLAYLWIFTWGLRS  537

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             + E CYA LP Y +ITN+H  PKG E+A  IP ++F+  N+Y + +Y++   SIRAWWNN
Sbjct  538   LPETCYAALPAYSIITNTHIFPKGQELAYYIPIALFVTTNIYNISQYIQSGLSIRAWWNN  597

Query  2183  QRM  2191
             Q+M
Sbjct  598   QKM  600



>gb|KDP30772.1| hypothetical protein JCGZ_13715 [Jatropha curcas]
Length=704

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/610 (56%), Positives = 417/610 (68%), Gaps = 58/610 (10%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLY+   R N + RA+++ IL LL SLI YR+  L +HG+   WLLAL+CESWFTF+WVL
Sbjct  8     PLYQKFSRKNHIHRALDICILFLLTSLIFYRLLTLKNHGF--AWLLALLCESWFTFVWVL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              VSTKWN V+  TYPER  + VE      PAVDMFVTTA+P LEPPI+T+NTV+SLLA++
Sbjct  66    TVSTKWNPVDYKTYPERLPQRVEK---FLPAVDMFVTTADPVLEPPIITMNTVISLLAVD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP--  931
             YPANKLACY+SDD  SP+TFY+L+E SKFAKLWVPFCKKYN+ VRAPFRYF++    P  
Sbjct  123   YPANKLACYLSDDGCSPLTFYSLLETSKFAKLWVPFCKKYNIQVRAPFRYFSSTDHKPML  182

Query  932   --PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICE  1105
                 SS EF++EWKKM                                       K++ E
Sbjct  183   SSDASSLEFQQEWKKM---------------------------------------KIMWE  203

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E ++ G+PHLIY+SREKRP H H++KAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP
Sbjct  204   NKEGVSNGLPHLIYVSREKRPNHPHHYKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNP  263

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V HAMCF LG+K+E DT FVQ PQ FYDGLKDDP+ +Q  ++Y  +GRG   +QG FY
Sbjct  264   QIVRHAMCFFLGSKNEGDTAFVQTPQIFYDGLKDDPFGNQLVVLYEYMGRGIVGLQGPFY  323

Query  1466  DGTGCFHRRKVIYGLSPND--------TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgs  1621
              GTGCF RRKVIYGL PND        T     L D +L  I+G SK F+TSA   L   
Sbjct  324   GGTGCFRRRKVIYGLCPNDIGDFAKFLTPVTGNLDDKELLNIFGNSKEFITSAANALEEK  383

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              +      LS S+EAA  VA CGYE+GT WG  +GW+YGS TED+LTG+ I   GW++ +
Sbjct  384   TNRP--NDLSDSMEAAYHVAACGYEYGTAWGKQVGWQYGSTTEDVLTGLKIHGRGWRSVY  441

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P+ P FLGC PS G  S+ Q KRWA+G  EIL S + PIFA +FG LQ RQCLAY+  
Sbjct  442   CKPDPPAFLGCAPSGGPTSMTQQKRWATGLLEILVSKRNPIFATIFGKLQLRQCLAYLWI  501

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
              LW +R I ELCY  LP YC+ITNS+FLPK N+ AI    ++ IIYN YTL EY++   S
Sbjct  502   FLWGLRSIPELCYMVLPAYCIITNSNFLPKVNDPAIHGYIALLIIYNTYTLLEYLQTGLS  561

Query  2162  IRAWWNNQRM  2191
             IRAWWN QRM
Sbjct  562   IRAWWNKQRM  571



>ref|XP_009353303.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Pyrus 
x bretschneideri]
Length=749

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/608 (56%), Positives = 423/608 (70%), Gaps = 15/608 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E       + + +E +IL LLLSL+ +R+ + + HG+  TWL+A +CE  FT  WV
Sbjct  7     LPLHERIELRYTLHKVIEFIILFLLLSLLVHRLLSFNDHGF--TWLIAFLCELSFTLNWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + +S KWN VE  TYP+R L+ V     E P VDMFVTTAN ELEPPI+T+NTVLSLLA+
Sbjct  65    ITISNKWNIVEYKTYPDRLLQRVSKH--ELPPVDMFVTTANSELEPPIITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YP NKLACYVSDD  SP+TFY+L EASKFAKLWVPFCKKYNV VRAPFRYF N + TF 
Sbjct  123   DYPTNKLACYVSDDGCSPLTFYSLSEASKFAKLWVPFCKKYNVQVRAPFRYFSNNNTTFS  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
                S EF++EW  + DEY  L  KIE A  K   F+    F  F++++ N+H TIIKV+ 
Sbjct  183   SNDSSEFKQEWTLLKDEYEQLSRKIEDAVGKSIPFDVSQDFPVFSNIERNNHPTIIKVLW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E ++ G PHLIYISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNN
Sbjct  243   ENKEDVSDGPPHLIYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P ++LHAMC LLG+++E    F QFPQ FYDGLKDDP+ +Q  +++  +G G A IQG  
Sbjct  303   PNIMLHAMCTLLGSENETKNAFAQFPQIFYDGLKDDPFGNQMVVLWKFVGHGIAGIQGPI  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTD-----HDLQKIYGKSKIFVtsatttlsgsls  1627
             Y GTGC HRRKVIYGLSP DT T E+  +      ++ K +G S+ F  SA   L G+  
Sbjct  363   YAGTGCVHRRKVIYGLSPTDTKTGERYPNIGSGKVEMLKNFGTSEEFTKSAGDALQGNTE  422

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                    S S+EAA +V  C YE+GT WG  +GWRYGS TEDILTG+ I   GW + FC 
Sbjct  423   CVNMS--SKSIEAAHRVGECEYEYGTNWGIKVGWRYGSTTEDILTGLSIHNKGWNSIFCT  480

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+ P FLGC P+ G  S+ Q KRWA+G  EIL S  CPIF  LF NLQFR  L Y   + 
Sbjct  481   PDPPAFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPIFGTLFANLQFRMFLCYFWVLS  540

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I ELCYA LP Y +ITN+HFLPKG E    IP ++F++Y++YTL E+++   SIR
Sbjct  541   WGLRCIPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVLYHIYTLLEHLQTGLSIR  600

Query  2168  AWWNNQRM  2191
             AWWNNQRM
Sbjct  601   AWWNNQRM  608



>ref|XP_011047235.1| PREDICTED: cellulose synthase-like protein H1 [Populus euphratica]
Length=747

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/610 (55%), Positives = 430/610 (70%), Gaps = 20/610 (3%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             L++  V    + RA ++ I  LL+SL+ YR+  L +HG+   W+LAL+CES FTFIWV+ 
Sbjct  10    LFQKVVLKYPIHRAFDITIFFLLVSLLVYRLLYLSNHGF--AWVLALLCESCFTFIWVVT  67

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             VS+KWN VE  TYPER    +   + + P VDMFVT+A+P LEP ILTVNTV+SLLA++Y
Sbjct  68    VSSKWNPVEYKTYPER----LSQNAQDLPPVDMFVTSADPVLEPSILTVNTVISLLAVDY  123

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE-  937
             PA+KLACYVSDD  SP+T+Y+LVEASKFAK+WVPFCKKYN+  RAPFRYF+++       
Sbjct  124   PADKLACYVSDDGCSPITYYSLVEASKFAKIWVPFCKKYNIQTRAPFRYFSSELILTGSC  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVIC-E  1105
             +S EF++E+ KM D Y  L  KI+ A +K     L   FA F++++  +H TIIKVI  +
Sbjct  184   NSLEFQQEYNKMKDGYEELASKIKDAVEKSMEWDLIGDFAVFSNMERKNHPTIIKVIRDQ  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             ND  L+  +PHLIY+SREKRP+H H +KAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP
Sbjct  244   NDAGLSEALPHLIYVSREKRPEHPHRYKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++ LHAMC LLG+ DER++GFVQ PQ FYDGLKDDP+ +Q+ + +  +G+G A IQG FY
Sbjct  304   QIFLHAMCLLLGSNDERESGFVQCPQCFYDGLKDDPFGNQFVVEHKYMGKGAAGIQGPFY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEK--------LTDHDLQKIYGKSKIFVtsatttlsgs  1621
              GTGCFHRRKVIYG  P+D     K        L+  +  +I+G SK F+ SA   L G 
Sbjct  364   GGTGCFHRRKVIYGSCPDDIGNQAKRLTPVHGGLSYKEQLRIFGGSKEFIRSAAHALQGK  423

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              +      L   +EAA QVA CGYE+GT+WG  +GW+YGS TEDILTG+ IQ  GW++ F
Sbjct  424   ENISPQN-LPTLVEAAHQVAGCGYEYGTSWGIEVGWQYGSATEDILTGLMIQARGWRSLF  482

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P+   FLGC P  G  S+ Q KRWA+G  EIL S + PI A +   LQFRQCL Y+  
Sbjct  483   CTPDPRAFLGCAPPGGPISMTQQKRWATGLLEILISRRSPIVATVTARLQFRQCLVYLSF  542

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
             + W +R I ELCYA LP YC IT+S FLPK +E AI I  ++F+ Y +YTL EY+E   S
Sbjct  543   LTWGLRSIPELCYAVLPAYCTITDSSFLPKVHEPAIYIYMALFLSYVIYTLIEYLETGLS  602

Query  2162  IRAWWNNQRM  2191
             IRAWWNNQRM
Sbjct  603   IRAWWNNQRM  612



>ref|XP_009347136.1| PREDICTED: cellulose synthase-like protein H1 [Pyrus x bretschneideri]
Length=749

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/608 (56%), Positives = 424/608 (70%), Gaps = 15/608 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E       + + +E +IL LLLSL+ +R+ + + HG+  TWL+A +CE  FT  WV
Sbjct  7     LPLHERIELRYTLHKVIEFIILFLLLSLLVHRLLSFNDHGF--TWLIAFLCELSFTLNWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + +S KWN VE  TYP+R L+ V     E P VDMFVTTAN ELEPPI+T+NTVLSLLA+
Sbjct  65    ITISNKWNIVEYKTYPDRLLQRVSKH--ELPPVDMFVTTANSELEPPIITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YP NKLACYVSDD  SP+TFY+L EASKFAKLWVPFCKKYNV VRAPFRYF N + TF 
Sbjct  123   DYPTNKLACYVSDDGCSPLTFYSLSEASKFAKLWVPFCKKYNVQVRAPFRYFSNNNTTFS  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
                S EF++EW  + DEY  L  KIE A  +   F+    F  F++++ N+H TIIKV+ 
Sbjct  183   SNDSSEFKQEWTLLKDEYEQLSRKIEDAVGQSIPFDVSQDFTVFSNVERNNHPTIIKVLW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E ++ G+PHLIYISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNN
Sbjct  243   ENKEDVSDGLPHLIYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P ++L AMC LLG+++E    F QFPQ FYDGLKDDPY +Q  +++  +G G A IQG  
Sbjct  303   PNIMLQAMCALLGSENETKNAFAQFPQIFYDGLKDDPYGNQMVVLWKFVGHGIAGIQGPI  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKI-----YGKSKIFVtsatttlsgsls  1627
             Y GTGC HRRKVIYGLSP+D  T E+  +    K+     +G S+ F  SA   L G+  
Sbjct  363   YAGTGCVHRRKVIYGLSPSDAKTGERYPNIASGKVEMLNTFGTSEEFTKSAGDALQGNTE  422

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                    S S++AA +V  C YE+GT WG  +GWRYGS TEDILTG+ I   GWK+  C 
Sbjct  423   CVNMS--SKSIDAAHRVGGCEYEYGTNWGIKVGWRYGSTTEDILTGLSIHNKGWKSIICT  480

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+ PGFLGC P+ G  S+ Q KRWA+G  EIL S  CPIF  LF NLQFR  L Y  ++ 
Sbjct  481   PDPPGFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPIFGTLFANLQFRMFLCYFWALT  540

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I ELCYA LP Y +ITN++FLPKG E    IP ++F++Y++YTL E+++   SIR
Sbjct  541   WGLRCIPELCYAALPAYSIITNTYFLPKGQEPTYYIPVALFVLYHIYTLLEHLQTGLSIR  600

Query  2168  AWWNNQRM  2191
             AWWNNQRM
Sbjct  601   AWWNNQRM  608



>ref|XP_008229980.1| PREDICTED: cellulose synthase-like protein B4 isoform X1 [Prunus 
mume]
Length=736

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/601 (56%), Positives = 426/601 (71%), Gaps = 16/601 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N + + +E +IL LLLSL+ YR+ +  +HG+   WL+A +CE WFT  WV+
Sbjct  8     PLYERLEHKNTMHKVMEFIILFLLLSLLVYRLLSFSNHGF--AWLVAFLCELWFTLYWVI  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S KW+ VE  TYP+R L+ V     E P VDMFVTTA+ ELEPPI+T+NTVLSLLA++
Sbjct  66    TISNKWSFVEYKTYPDRLLQRV--AEHELPPVDMFVTTADSELEPPIITINTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP +KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKYNV VRAPFRYFN       +
Sbjct  124   YPTDKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYNVQVRAPFRYFNNAAIPSSK  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDHSTIIKVICENDE  1114
             ++ EF++EWK M DEY  L  KIE     P  L   F+ F++++ N+H TIIKV+ + +E
Sbjct  184   NAGEFKQEWKTMKDEYLQLNRKIE---DIPFDLSEDFSLFSNIERNNHPTIIKVVLDKEE  240

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
               + G+PHL+YISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD + NNP VV
Sbjct  241   GHSNGLPHLVYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFANNPSVV  300

Query  1295  LHAMCFLLGA-KDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             LHAMC LLG+ +++ +  F QFPQ FYDGLKDDP+ +Q  +I+  +G G   IQG FY G
Sbjct  301   LHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDPFGNQMAVIWKYMGHGIQGIQGIFYAG  360

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLS  1651
             TGCFHRR+VIYGLSPN+     KL + +L K +G SK    SA   L G        +L 
Sbjct  361   TGCFHRRQVIYGLSPNNG----KLGNQELLKTFGNSKELTKSAADALRGETKCP--SLLL  414

Query  1652  YSLEAAS-QVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
              S++AA+ QVA+C YE+GT WG  +GW YGS TEDILTG+ I   GWK+ FC P++P FL
Sbjct  415   KSIDAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDILTGLSIHNRGWKSIFCTPDQPAFL  474

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GCTP+ G  S+ Q KRWA+G  E+L S  CPIF  +F +LQFRQCLAY+    W +R + 
Sbjct  475   GCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTVFAHLQFRQCLAYLWIFTWGLRSLP  534

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
             E CYA LP Y +ITN+H  PK  E+A  IP ++F+  N+Y + +Y++   SIRAWWNNQ+
Sbjct  535   ETCYAALPAYSIITNTHIFPKHQELAYYIPITLFVTTNMYNISQYIQSGLSIRAWWNNQK  594

Query  2189  M  2191
             M
Sbjct  595   M  595



>ref|XP_002269831.2| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
 emb|CBI28824.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/608 (57%), Positives = 427/608 (70%), Gaps = 15/608 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   + N + RA+++ I  LLLSL+AYR+ +L ++G+  TWLLA +CESWFTFIW+L
Sbjct  8     PLYEKIPQKNTLHRALDLTIFFLLLSLLAYRLLSLKNNGF--TWLLAFLCESWFTFIWIL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              VSTKWN V   TYPER L+       E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NVSTKWNPVSYKTYPERLLQCYRVD--ELPPVDMFVTTADPMLEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRY + +     +
Sbjct  124   YPANKLSCYVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYISRELLPSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVICE  1105
             +S EF +E++K+  EY  L  +IE AT K   +      F  F+++    H TIIKVI E
Sbjct  184   NSTEFLQEYRKIMGEYEELRRRIEDATLKSISYEFSTADFVAFSNIKKGSHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NNP
Sbjct  244   NKESRSDGLPHLVYVSREKDPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
              +  HAMC LLG+K+E+D GFVQ PQ FYDGLKDDP+ +Q  ++Y  LG G A +QG  Y
Sbjct  304   LIFHHAMCLLLGSKNEQDCGFVQSPQCFYDGLKDDPFGNQLVVLYKYLGSGIAGLQGPTY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslsse  1633
              GTGCFHRRKVIYGL P+  +  +    KLTD  +QK +G SK F T+A   LSG     
Sbjct  364   SGTGCFHRRKVIYGLWPDGRMEIKGRSGKLTDERIQKTFGNSKEFTTTAARLLSGLSGIS  423

Query  1634  t--FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                + +L+  +EAA +VA C YE+GT+WG  IGW YG+ TED+LTG+ I   GWK+  C 
Sbjct  424   HCPYDLLN-RVEAAQEVATCSYEYGTSWGTKIGWLYGTTTEDVLTGMRIHARGWKSTDCR  482

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+ P FLGC PS G  +L Q KRWA+G  EILFS   P  A+    LQFRQCLAY+  I 
Sbjct  483   PDPPAFLGCAPSGGPAALTQQKRWATGFLEILFSKNSPFIASFTAKLQFRQCLAYVWLIS  542

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I ELCY  LP YC++  SHFLPK  E A++IP S+F+ YN Y L+EY     SIR
Sbjct  543   WALRSIPELCYLALPAYCIMAGSHFLPKVQEPAVLIPISLFVSYNFYNLFEYYGAGFSIR  602

Query  2168  AWWNNQRM  2191
             A WNN RM
Sbjct  603   ACWNNLRM  610



>ref|XP_011007182.1| PREDICTED: cellulose synthase-like protein H1 [Populus euphratica]
Length=750

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/608 (55%), Positives = 436/608 (72%), Gaps = 20/608 (3%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             LY+       + RA ++ IL+LL+SL+ YR+  + +HG+   WLLAL+CE+ FTF W + 
Sbjct  10    LYDKVDLKYPIHRAFDITILVLLISLLVYRLLYISNHGF--AWLLALLCETCFTFTWFVT  67

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             VS+KWN VE  TYPER  +  +    E P VD+FVTTA+P LEPPILTVNTV+SLLA++Y
Sbjct  68    VSSKWNPVEYKTYPERLSQKTQ----ELPPVDIFVTTADPVLEPPILTVNTVISLLAVDY  123

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PA+KLACYVSDD +SP+T+Y+LVEASKFAK W PFCKK+N+  RAPFRYF+++   P  +
Sbjct  124   PADKLACYVSDDGSSPITYYSLVEASKFAKHWAPFCKKHNIQARAPFRYFSSE--VPLNN  181

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICEND  1111
             S EF++E+ KM DEY  L  KI  A +K    +L   FA F++++  +H TIIKV+ EN 
Sbjct  182   SSEFQQEYNKMKDEYEELASKINDADKKSIERNLSGDFAAFSNIERKNHPTIIKVVWENK  241

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
               ++  +PHLIYISREKRP+H H++KAGAMNVLTRVSG+MTNAPFMLN+DCD +VNNP++
Sbjct  242   AGISDELPHLIYISREKRPQHPHHYKAGAMNVLTRVSGMMTNAPFMLNLDCDMFVNNPKI  301

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             V HAMC LLG+++ER++GFVQ PQ FYDGLKDDP+ +Q+++++  +G G   IQG FY G
Sbjct  302   VCHAMCLLLGSRNERESGFVQCPQYFYDGLKDDPFGNQFEVLHKYIGSGIVGIQGPFYGG  361

Query  1472  TGCFHRRKVIYGLSPNDT-VTAEK-------LTDHDLQKIYGKSKIFVtsatttlsgsls  1627
             TGCFHRRKVIYG  P D  + AE        LT+ +  +++G SK FV SA   L G  +
Sbjct  362   TGCFHRRKVIYGSCPRDVGIPAESLTPVHGGLTEKEQLRVFGNSKEFVRSAAHALQGKAN  421

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
             +    +L   +EAA QVA CGYE+GT+WG  +GW+YG  TEDILTG+ I   GW++  C 
Sbjct  422   TSP-EILPKLIEAAHQVAGCGYEYGTSWGKEVGWQYGPATEDILTGLKIHARGWRSVLCS  480

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+   FLGC P  G  S+ Q KRWA+G  EIL S + PI A L   LQFRQCLAY+  ++
Sbjct  481   PDPRAFLGCAPRVGPISMTQQKRWATGLLEILISERNPIIATLTARLQFRQCLAYLWILI  540

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I E+CYA LP YC+ITNS FLPK +E A+ I  ++F+ Y +Y+L EY+E   SIR
Sbjct  541   WGLRSIPEICYAVLPAYCIITNSSFLPKFHEPAMYIHVALFLSYVIYSLLEYLETGLSIR  600

Query  2168  AWWNNQRM  2191
             AWWNNQRM
Sbjct  601   AWWNNQRM  608



>ref|XP_010657214.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=747

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/604 (56%), Positives = 423/604 (70%), Gaps = 9/604 (1%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   + N + RA +V I  LLLSL+AYR+ +L ++G+  TWLLA +CESWFTFIW+L
Sbjct  8     PLYEKIPQKNTLHRASDVTIFFLLLSLLAYRLLSLKNNGF--TWLLAFLCESWFTFIWIL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S+KWN V   TYPER L+       E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NLSSKWNPVSYKTYPERLLQCYRVD--ELPPVDMFVTTADPMLEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TF+AL+EASKFAKLWVPFCKKY +  RAPFRYF+ +     +
Sbjct  124   YPANKLSCYVSDDGASPLTFFALLEASKFAKLWVPFCKKYGIQPRAPFRYFSRELLPSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVICE  1105
             +S EF +E++K+ +EY  L  +IE AT K   +      F  F+++    H TIIKVI E
Sbjct  184   NSMEFLQEYRKIKEEYEELRRRIEDATVKSISYELSTADFVAFSNIKKGSHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NNP
Sbjct  244   NKESRSDGLPHLVYVSREKHPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++  H+MC LLG+K+E+D GFVQ PQ+FYDGLKDDP+ +Q+ ++Y  +  G A +QG  Y
Sbjct  304   QIFHHSMCLLLGSKNEQDCGFVQTPQSFYDGLKDDPFGNQFGVLYKYVVSGIAGLQGPNY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GTGCFHRRKVIYGL P+  +  +   D  L+K +G SK F  +A   LSG         
Sbjct  364   SGTGCFHRRKVIYGLWPDGRMEFKGRIDERLEKTFGNSKEFTKTAARILSGLSGISDCPY  423

Query  1646  -LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              LS  +EAA Q+A+C YE+GT WG  IGW YG+ TEDILTG+ I   GWK+  C P+ P 
Sbjct  424   DLSNRVEAAHQIASCSYEYGTNWGTKIGWLYGTTTEDILTGMRIHARGWKSTDCRPDPPA  483

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             FLGC PS G  +L Q KRWA+G  E+LFS   P        LQFRQCLAYM  I W +RP
Sbjct  484   FLGCAPSGGPAALIQQKRWATGLLEVLFSKNSPFIVTFTAKLQFRQCLAYMWIISWGLRP  543

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             I ELCY  LP YC++  SHFLP   + A++IP S+F+ YN +TL EY     SIRA WNN
Sbjct  544   IPELCYLALPAYCIMAGSHFLPNVQDPAVLIPISLFVSYNFHTLLEYWGAGYSIRACWNN  603

Query  2183  QRMW  2194
              RMW
Sbjct  604   LRMW  607



>ref|XP_010252472.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nelumbo 
nucifera]
Length=743

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/606 (55%), Positives = 422/606 (70%), Gaps = 18/606 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E   RNN + RA +++I  L LSL++YR   L +HG    WLLA +CESWFT  WV
Sbjct  7     LPLQERIPRNNILQRATDIIIFFLFLSLLSYRFLTLSNHGV--AWLLAFLCESWFTLCWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +++ WN VE  TYPER L+ V     E P+VDMFVTTA+P LEPPI+TVNTVLSLLA+
Sbjct  65    LTINSNWNPVEYRTYPERLLQRVG----EVPSVDMFVTTADPLLEPPIITVNTVLSLLAV  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPA+KLACYVSDD AS +TFY+LVEASKFAKLWVPFCKKY++ VRAPF YF+ +     
Sbjct  121   DYPAHKLACYVSDDGASLLTFYSLVEASKFAKLWVPFCKKYSIRVRAPFVYFSTEIDESL  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK----PSLFNKFATFADLDPNDHSTIIKVIC  1102
             + SP+FR EWK M +EY  L  +IE A QK      L   FA F+ +DP +H +I+KVI 
Sbjct  181   DLSPDFRDEWKTMKNEYKQLRRRIEEAVQKNYIAGDLTGDFAAFSKIDPKNHPSIVKVIW  240

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E+L  G+PHLIY+SREKRP H H+FKAGAMNVLTRVSGVMTN+PF+LNVDCD +VNN
Sbjct  241   ENKENLPDGLPHLIYVSREKRPVHPHHFKAGAMNVLTRVSGVMTNSPFILNVDCDMFVNN  300

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYAS-QYKIIYHCLGRGNAAIQGS  1459
             P+ +LHAMC LLG + E+++GFVQFPQ FY  LKDDP+ + Q+ + +  +  G   IQG 
Sbjct  301   PQTILHAMCLLLGFEQEKESGFVQFPQIFYRSLKDDPFGNNQFIVFWKFIMPGIVGIQGP  360

Query  1460  FYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
             FY GTGCFHRRKVIYGLSP+     E      ++  +G S  F+ S    LSG       
Sbjct  361   FYGGTGCFHRRKVIYGLSPD-----EATIQGAMETTFGNSVHFMKSVPQILSGIKDKTDC  415

Query  1640  --GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                 LS + EAA++VA+C YE+ T+WG  +GW YGS TED+LTG+ I   GW++G+C P+
Sbjct  416   QPADLSSTEEAANEVASCVYEYNTSWGERVGWVYGSATEDVLTGLRIHSKGWRSGYCTPD  475

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
              P FLG TPS G   L Q KRWA+G  EIL S   PI   + G L  RQCL Y+  I+WP
Sbjct  476   PPAFLGDTPSGGPAILTQQKRWATGLLEILVSNYNPILGVIKGKLLIRQCLVYLSVIIWP  535

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
             +R + ELCYA LPPYC++T ++FLP   E AI + +++F+I +LY L  Y+    SIR+W
Sbjct  536   LRALPELCYALLPPYCILTTTYFLPTVWEPAIFVSSALFVILSLYNLSYYLRCGLSIRSW  595

Query  2174  WNNQRM  2191
             WNNQRM
Sbjct  596   WNNQRM  601



>gb|AFZ78580.1| cellulose synthase-like protein [Populus tomentosa]
Length=746

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/609 (55%), Positives = 431/609 (71%), Gaps = 19/609 (3%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             L++  V    + RA ++ I  LL+SL+ YR+  L +HG+   W+LAL+CES FTFIWV+ 
Sbjct  10    LFQKVVLKYPIHRAFDITIFFLLVSLLVYRLLYLSNHGF--AWVLALLCESCFTFIWVVT  67

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             VS KWN VE  TYPER  +  +    + P VDMFVT+A+P LEP ILTVNTV+SLLA++Y
Sbjct  68    VSCKWNPVEYKTYPERLSQKAQ----DLPPVDMFVTSADPVLEPSILTVNTVISLLAVDY  123

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE-  937
             PA+KLACYVSDD  SP+T+Y+LVEASKFAK+WVPFCKKYN+  RAPFRYF+++       
Sbjct  124   PADKLACYVSDDGCSPITYYSLVEASKFAKIWVPFCKKYNIQTRAPFRYFSSELILTGSC  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---FATFADLDPNDHSTIIKVICEN  1108
             +S EF++E+ KM DEY  L  KI+ A +K   +++   FA F++++  +H TIIKVI EN
Sbjct  184   NSLEFQQEYNKMKDEYEELASKIKDAVEKSMEWDQIGDFAIFSNIERKNHPTIIKVIREN  243

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
             +  L+  +PHLIYISREKRPKH + +KAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP+
Sbjct  244   EAGLSDALPHLIYISREKRPKHPNRYKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNPQ  303

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             + LHAMC LLG+K+ER++GFVQ PQ FYDGLKDDP+ +Q+ + +  +G G A IQG FY 
Sbjct  304   IFLHAMCLLLGSKNERESGFVQCPQYFYDGLKDDPFGNQFVVGHKFMGNGVAGIQGPFYG  363

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEK--------LTDHDLQKIYGKSKIFVtsatttlsgsl  1624
             GTGCFHRRKVIYG  P+D     K        L+  +  +I+G SK F+ SA   L G  
Sbjct  364   GTGCFHRRKVIYGSCPDDIGNQAKRLTPVHGGLSYKEQLRIFGDSKEFIRSAAHALQGKE  423

Query  1625  ssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFC  1804
             +      L   +EAA QVA CGYE+GT+WG  +GW+YGS TED+LTG+ I   G ++ FC
Sbjct  424   NISPKN-LPNLVEAAHQVAGCGYEYGTSWGTEVGWQYGSATEDVLTGLMIHARGKRSLFC  482

Query  1805  VPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISI  1984
              P+R  FLGC P  G  S+ Q KRWA+G  EIL S + PI A +   LQFRQ L Y++ +
Sbjct  483   TPDRRAFLGCAPRGGPISMTQQKRWATGLLEILISRRSPIVATVTARLQFRQSLMYLLFL  542

Query  1985  LWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESI  2164
              W +R + ELCYA LP YC IT+S FLP+ +E AI I  ++F+ Y +YTL EY+E   SI
Sbjct  543   TWGLRSVPELCYAELPAYCTITDSSFLPEVHEPAIYIYTALFLSYVIYTLMEYLETGLSI  602

Query  2165  RAWWNNQRM  2191
             RAWWNNQRM
Sbjct  603   RAWWNNQRM  611



>emb|CBI28833.3| unnamed protein product [Vitis vinifera]
Length=1566

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/607 (57%), Positives = 424/607 (70%), Gaps = 14/607 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE   + N V R ++V I +LLL+L+AYR+ +L S+G+  +W  AL+CESWFTF+WV
Sbjct  825   LPLYEKLPQKNTVQRVLDVTIFVLLLTLLAYRILSLKSNGF--SWFFALLCESWFTFVWV  882

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++S+KWN V   TYPER L W++    E P VDMFVTTA+P LEPPI+TVNTVLSLLA 
Sbjct  883   VILSSKWNPVVYRTYPERLLFWID----ELPPVDMFVTTADPTLEPPIITVNTVLSLLAF  938

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF  +   P 
Sbjct  939   DYPANKLACYVSDDGCSPLTFYALLEASKFAKLWVPFCKKYGIHTRAPFRYFYDEEESPH  998

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK--PSLFN--KFATFADLDPNDHSTIIKVIC  1102
             ++S EF RE+ KM DEY  L  KIE AT+K  P   +  +F  F+D++  +H +IIKVI 
Sbjct  999   DNSTEFIREYTKMKDEYEVLRRKIEDATEKSIPCDLSSEEFVAFSDIERRNHPSIIKVIL  1058

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E L  G+PHLIY+SREK PK+ H++KAGA+NVLTRVSG MTNAPF+LNVDCD Y NN
Sbjct  1059  ENKEGLVDGLPHLIYVSREKCPKYPHHYKAGALNVLTRVSGAMTNAPFILNVDCDMYANN  1118

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
              ++V HAMC LLG K  +D  F Q PQ FYDGLKDDP  +Q       +G G + +QG +
Sbjct  1119  SQIVFHAMCLLLGCKKGQDFAFAQSPQIFYDGLKDDPLGNQLVATQKYIGEGISGLQGPY  1178

Query  1463  YDGTGCFHRRKVIYGLSPN---DTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslsse  1633
             Y GTGCFHRRKV+YGL P+   +T    KLTD  L++ +G S+ F  +    LSG     
Sbjct  1179  YSGTGCFHRRKVLYGLWPDGCMETGGRSKLTDEGLRQSFGHSREFSKTVERILSGLSGKA  1238

Query  1634  tFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVP  1810
                  LS S EAA+QVA+CGYE GT+WG  IGW YGS +ED+LTG+ I   GW++  C P
Sbjct  1239  DCPYDLSSSAEAANQVADCGYECGTSWGTKIGWIYGSTSEDVLTGLKIHARGWRSAECKP  1298

Query  1811  ERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILW  1990
             + P FLGC PS G  SL Q KRW +G  EILFS   P  A L   LQFRQCLAYM  + W
Sbjct  1299  DPPAFLGCAPSGGPASLTQQKRWVTGLLEILFSKNNPFIATLTAKLQFRQCLAYMYILSW  1358

Query  1991  PVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRA  2170
              +R I ELCY  LP YC+I NSHFLPK  E A +I A++F IYNL++L EY     SIR 
Sbjct  1359  GLRWIPELCYIALPAYCIIANSHFLPKVEEPAFLILAALFAIYNLHSLLEYCRIGLSIRT  1418

Query  2171  WWNNQRM  2191
             WWNNQRM
Sbjct  1419  WWNNQRM  1425


 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/607 (56%), Positives = 425/607 (70%), Gaps = 13/607 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   + N + RA+++ I  LLLSL+AYR+ +L ++G   TWL+A +CESWFTF+WVL
Sbjct  8     PLYEKIPQKNTLHRALDLTIFFLLLSLLAYRLLSLKNNGL--TWLVAFLCESWFTFLWVL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S+KWN V   TYPER L+   +   E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NLSSKWNPVSYKTYPERLLQC--HRVDELPPVDMFVTTADPILEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF+++     +
Sbjct  124   YPANKLSCYVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYFSSELVSSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVICE  1105
             +S +F +E++K+ + Y  L  KIE A  K   +     +F  F++++  +H TIIKVI E
Sbjct  184   NSMDFLKEYRKIKEGYQELGRKIEDAALKSMPYELSTAEFVAFSNVERRNHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NNP
Sbjct  244   NKESSSDGLPHLVYVSREKHPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++  HAMC LLG+K E+D GFVQ PQ FYD +KDDP  +Q  +++  +G G A +QG  Y
Sbjct  304   QIFHHAMCLLLGSKSEQDCGFVQSPQMFYDVVKDDPLGNQMVVLFKYVGSGIAGLQGPLY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslsse  1633
              GTGCFHRRKVIYG  P+  +  +    KLTD  L+K +G SK F  +A   LSG     
Sbjct  364   SGTGCFHRRKVIYGSWPDGRMEIKGRNGKLTDERLEKTFGNSKEFTKTAARILSGLSGIS  423

Query  1634  tFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVP  1810
                  LS  +EAA Q+A+C YE+GT+WG  IGW YG+ TEDILTG+ I   GWK+  C P
Sbjct  424   DCPYDLSNRVEAAYQIASCSYEYGTSWGTKIGWLYGTTTEDILTGMRIHARGWKSTDCRP  483

Query  1811  ERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILW  1990
             + P FLGC PS G  +L Q KRWA+G  E+LFS   P  A     LQFRQCLAYM  I W
Sbjct  484   DPPAFLGCAPSDGPAALTQQKRWATGLLEVLFSKNSPPIATFTAKLQFRQCLAYMWIISW  543

Query  1991  PVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRA  2170
              +RPI ELCY  LP YC++  SHFLPK +E A++IP S+F+ Y  +TL+EY     SIRA
Sbjct  544   GLRPIPELCYLALPAYCIMAGSHFLPKVHEPAVLIPISLFVSYKFHTLFEYYGAGFSIRA  603

Query  2171  WWNNQRM  2191
               NN  M
Sbjct  604   CLNNLMM  610



>ref|XP_008229981.1| PREDICTED: cellulose synthase-like protein B4 isoform X2 [Prunus 
mume]
Length=730

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/601 (55%), Positives = 421/601 (70%), Gaps = 22/601 (4%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N + + +E +IL LLLSL+ YR+ +  +HG+   WL+A +CE WFT  WV+
Sbjct  8     PLYERLEHKNTMHKVMEFIILFLLLSLLVYRLLSFSNHGF--AWLVAFLCELWFTLYWVI  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S KW+ VE  TYP+R L+ V     E P VDMFVTTA+ ELEPPI+T+NTVLSLLA++
Sbjct  66    TISNKWSFVEYKTYPDRLLQRV--AEHELPPVDMFVTTADSELEPPIITINTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP +KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKYNV VRAPFRYFN       +
Sbjct  124   YPTDKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYNVQVRAPFRYFNNAAIPSSK  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDHSTIIKVICENDE  1114
             ++ EF++EWK M DEY  L  KIE     P  L   F+ F++++ N+H TIIKV+ + +E
Sbjct  184   NAGEFKQEWKTMKDEYLQLNRKIE---DIPFDLSEDFSLFSNIERNNHPTIIKVVLDKEE  240

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
               + G+PHL+YISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD + NNP VV
Sbjct  241   GHSNGLPHLVYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFANNPSVV  300

Query  1295  LHAMCFLLGA-KDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             LHAMC LLG+ +++ +  F QFPQ FYDGLKDDP+ +Q  +I+  +G G   IQG FY G
Sbjct  301   LHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDPFGNQMAVIWKYMGHGIQGIQGIFYAG  360

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLS  1651
             TGCFHRR+VIYG          KL + +L K +G SK    SA   L G        +L 
Sbjct  361   TGCFHRRQVIYG----------KLGNQELLKTFGNSKELTKSAADALRGETKCP--SLLL  408

Query  1652  YSLEAAS-QVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
              S++AA+ QVA+C YE+GT WG  +GW YGS TEDILTG+ I   GWK+ FC P++P FL
Sbjct  409   KSIDAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDILTGLSIHNRGWKSIFCTPDQPAFL  468

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GCTP+ G  S+ Q KRWA+G  E+L S  CPIF  +F +LQFRQCLAY+    W +R + 
Sbjct  469   GCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTVFAHLQFRQCLAYLWIFTWGLRSLP  528

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
             E CYA LP Y +ITN+H  PK  E+A  IP ++F+  N+Y + +Y++   SIRAWWNNQ+
Sbjct  529   ETCYAALPAYSIITNTHIFPKHQELAYYIPITLFVTTNMYNISQYIQSGLSIRAWWNNQK  588

Query  2189  M  2191
             M
Sbjct  589   M  589



>ref|XP_004287960.1| PREDICTED: cellulose synthase-like protein H1-like [Fragaria 
vesca subsp. vesca]
Length=755

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/616 (54%), Positives = 427/616 (69%), Gaps = 25/616 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     N + + +E ++L LLLSL+ YR+ + + HG   +W +AL+CE WFTF WV
Sbjct  7     LPLYERVEHRNTLHKVMEFIMLFLLLSLLVYRLLSFNKHGL--SWFIALLCELWFTFSWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + ++ KWN V    YP+R L+ V     E PAVD+FVTTA+ ELEPPI+T+NTVLSLLA+
Sbjct  65    ITMNNKWNMVNHKPYPDRLLQRVPKD--ELPAVDLFVTTADSELEPPIITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP NKLACYVSDD  SP+TFY+L+EASKFAK+WVPFCKKYNV VRAP RYF  + T   
Sbjct  123   DYPTNKLACYVSDDGCSPITFYSLMEASKFAKIWVPFCKKYNVQVRAPSRYFTNNSTLSG  182

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQK---PS--LFNKFATFADLDPNDHSTIIK  1093
                SS EF++EWK++ DEY  L  KIE A  K   PS  +   F+ F+++  NDH TIIK
Sbjct  183   NNNSSMEFKQEWKRLKDEYEKLSRKIEDAVLKSINPSDMIECDFSVFSNIQRNDHPTIIK  242

Query  1094  VICENDESLA-VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             V+ EN E+ +   VPHL+YISREKRPKH H+ KAGAMNVLTRVSG+MTN+P+MLNVDCD 
Sbjct  243   VVLENKEAHSNQSVPHLVYISREKRPKHPHHAKAGAMNVLTRVSGLMTNSPYMLNVDCDM  302

Query  1271  YVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAI  1450
             +VN+P ++LHAMC LLG K+E +  FVQ PQ FYDGLKDDP+ +Q  +++  + +G + I
Sbjct  303   FVNSPNIILHAMCMLLGPKNENENAFVQCPQVFYDGLKDDPFGNQMIVLWKYVAQGISGI  362

Query  1451  QGSFYDGTGCFHRRKVIYGLSPN---------DTVTAEKLTDHDLQKIYGKSKIFVtsat  1603
             QG FY GTGC HRRKVIYGL PN          T+   K  D +L  ++GK      + +
Sbjct  363   QGPFYSGTGCVHRRKVIYGLFPNFVKVGETNAKTMMKGKSADEELFHMFGKE----FAKS  418

Query  1604  ttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRM  1783
                + +  +E   +L+ ++EAA QVA   YE+GT WG+ +GW YGS TED+LTG+ I   
Sbjct  419   AANALNGKAECPDMLTTTIEAAYQVAGVDYEYGTHWGNKVGWMYGSTTEDVLTGLSIHNK  478

Query  1784  GWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQC  1963
             GW++    P+ P FLGC P+ G  S+ Q KRWA+G  EIL S  CPIF  LF NLQFRQC
Sbjct  479   GWRSILYAPKPPAFLGCAPTGGPASMTQQKRWATGLLEILISKNCPIFGTLFANLQFRQC  538

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEY  2143
             L Y+  + W +R + ELCYA LP Y +ITNS+FLPK  + A  IP ++F++Y++YTL EY
Sbjct  539   LGYLWILSWGLRSVPELCYAALPAYSIITNSNFLPKDQDPAYYIPLAVFVVYSMYTLSEY  598

Query  2144  MEEKESIRAWWNNQRM  2191
             +    SIRAWWNNQRM
Sbjct  599   LRTGLSIRAWWNNQRM  614



>ref|XP_010035551.1| PREDICTED: cellulose synthase-like protein B4 [Eucalyptus grandis]
Length=754

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/610 (57%), Positives = 419/610 (69%), Gaps = 20/610 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N   RAVE+ IL LL+SL+ YR+ +L  HG    W +AL CESWFTF+W+L
Sbjct  9     PLYEKISLKNDGKRAVEIFILFLLVSLLTYRLVHLEDHGL--EWQVALACESWFTFVWIL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             V+STKW+ V   TYP R L+ V     E P VD+FVTTA+P+LEPPI+ VNTVLSL+A++
Sbjct  67    VISTKWSPVSYKTYPHRILQRVS----ELPPVDVFVTTADPQLEPPIIIVNTVLSLMAVD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTF--P  931
             YPA+KLACYVSDD  S +TFY+L+EA+KFAKLWVPFCKKYN+ +RAPFRYF  D T    
Sbjct  123   YPAHKLACYVSDDGCSLLTFYSLMEAAKFAKLWVPFCKKYNIQLRAPFRYFAGDSTILSG  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQK--PSLF-NKFATFADLDPNDHSTIIKVIC  1102
              + S EF++    M DEY  L GKIE A+Q   PS F  +FA F++ +  +H TIIK+I 
Sbjct  183   EDCSLEFQQARDTMKDEYDKLSGKIEDASQGSVPSNFTGEFAAFSNTERKNHPTIIKIIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN    A  +PHLIYISREKRPKH H++KAGAMNVLTR+SG+MTNAP MLNVDCD Y NN
Sbjct  243   ENKGGHADELPHLIYISREKRPKHPHHYKAGAMNVLTRISGLMTNAPLMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++VLHA+C LLG K ER   FVQ PQ FYDG KDDP+ +Q  ++   L RG   IQG  
Sbjct  303   PQIVLHALCLLLGTKYERYCAFVQCPQYFYDGAKDDPFGNQLVVLQEYLVRGIVGIQGPV  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEK-------LTDHDLQKIYGKSKIFVtsatttlsgs  1621
             Y GTGCFHRRKVIYG  P D  T +K       LT       +G SK F+ SA   L G+
Sbjct  363   YGGTGCFHRRKVIYGSWPEDMKTEKKILTSNGELTKEKSLNGFGSSKQFIDSAAHALQGN  422

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
                     LS SLE A QVA+C YE+ T WG  +GW YGS  EDILTG+ I   GW++ +
Sbjct  423   PDHPK--DLSSSLEVACQVASCTYEYNTDWGKKVGWMYGSTAEDILTGVAIHTKGWRSLY  480

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P  P FLGC PS G  S+ Q KRWA+G  E+L S + PI+  LF +L FRQCLAY+  
Sbjct  481   CSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLLSKRSPIYGTLFMHLHFRQCLAYLWV  540

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
             ++W +R I E  YA LP YC++TNSHFLPKG E AI+I A+IFIIYNLY L+EY     S
Sbjct  541   LIWALRSIPEFLYALLPAYCIMTNSHFLPKGQEPAIIISAAIFIIYNLYCLYEYFAIGLS  600

Query  2162  IRAWWNNQRM  2191
             I AWWNNQR+
Sbjct  601   IHAWWNNQRI  610



>emb|CBI28829.3| unnamed protein product [Vitis vinifera]
Length=765

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/622 (55%), Positives = 423/622 (68%), Gaps = 27/622 (4%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   + N + RA +V I  LLLSL+AYR+ +L ++G+  TWLLA +CESWFTFIW+L
Sbjct  8     PLYEKIPQKNTLHRASDVTIFFLLLSLLAYRLLSLKNNGF--TWLLAFLCESWFTFIWIL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S+KWN V   TYPER L+       E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NLSSKWNPVSYKTYPERLLQCYRVD--ELPPVDMFVTTADPMLEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TF+AL+EASKFAKLWVPFCKKY +  RAPFRYF+ +     +
Sbjct  124   YPANKLSCYVSDDGASPLTFFALLEASKFAKLWVPFCKKYGIQPRAPFRYFSRELLPSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKV---  1096
             +S EF +E++K+ +EY  L  +IE AT K   +      F  F+++    H TIIKV   
Sbjct  184   NSMEFLQEYRKIKEEYEELRRRIEDATVKSISYELSTADFVAFSNIKKGSHPTIIKVLFF  243

Query  1097  ---------------ICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVM  1231
                            I EN ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG M
Sbjct  244   FKKKKVTNLSYNHLVILENKESRSDGLPHLVYVSREKHPKHPHHYKAGAMNVLTRVSGAM  303

Query  1232  TNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYK  1411
             TNAPFMLNVDCD Y NNP++  H+MC LLG+K+E+D GFVQ PQ+FYDGLKDDP+ +Q+ 
Sbjct  304   TNAPFMLNVDCDMYANNPQIFHHSMCLLLGSKNEQDCGFVQTPQSFYDGLKDDPFGNQFG  363

Query  1412  IIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFV  1591
             ++Y  +  G A +QG  Y GTGCFHRRKVIYGL P+  +  +   D  L+K +G SK F 
Sbjct  364   VLYKYVVSGIAGLQGPNYSGTGCFHRRKVIYGLWPDGRMEFKGRIDERLEKTFGNSKEFT  423

Query  1592  tsatttlsgslssetFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGI  1768
              +A   LSG          LS  +EAA Q+A+C YE+GT WG  IGW YG+ TEDILTG+
Sbjct  424   KTAARILSGLSGISDCPYDLSNRVEAAHQIASCSYEYGTNWGTKIGWLYGTTTEDILTGM  483

Query  1769  GIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNL  1948
              I   GWK+  C P+ P FLGC PS G  +L Q KRWA+G  E+LFS   P        L
Sbjct  484   RIHARGWKSTDCRPDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSPFIVTFTAKL  543

Query  1949  QFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLY  2128
             QFRQCLAYM  I W +RPI ELCY  LP YC++  SHFLP   + A++IP S+F+ YN +
Sbjct  544   QFRQCLAYMWIISWGLRPIPELCYLALPAYCIMAGSHFLPNVQDPAVLIPISLFVSYNFH  603

Query  2129  TLWEYMEEKESIRAWWNNQRMW  2194
             TL EY     SIRA WNN RMW
Sbjct  604   TLLEYWGAGYSIRACWNNLRMW  625



>ref|XP_007049092.1| Cellulose synthase-like B3, putative isoform 1 [Theobroma cacao]
 gb|EOX93249.1| Cellulose synthase-like B3, putative isoform 1 [Theobroma cacao]
Length=747

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/614 (56%), Positives = 420/614 (68%), Gaps = 27/614 (4%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   R N + R++++ +L LL+SL+ YR++ L++HG    W +ALVCE WFTF WVL
Sbjct  8     PLYEKIARKNTIQRSLDITLLFLLVSLLGYRLFCLNNHGL--PWFIALVCELWFTFNWVL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             VV+ KW+ VE  TYPE     +E    E P VDMFVTTA+P LEPPI+ VN VLSLLA +
Sbjct  66    VVNCKWSPVEYKTYPEN----LERRFPELPNVDMFVTTADPVLEPPIIAVNNVLSLLAAD  121

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPA+KLACYVSDD   P+TFY+LVEASKFAKLWVPFCKKY + VRAPFRYF  D    P 
Sbjct  122   YPADKLACYVSDDGCFPLTFYSLVEASKFAKLWVPFCKKYKIQVRAPFRYFFGDSE--PS  179

Query  938   SSP---EFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVI  1099
             S+    EF+++W KM  EY  L  KIE A +K     L   FA F D++  +H TIIK+I
Sbjct  180   STDGNLEFQQDWLKMKAEYEVLARKIEEAARKSVPCDLTGDFAVFCDVERRNHPTIIKII  239

Query  1100  CENDE--SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFY  1273
              +N E  S AV VP+ +YISREK PK  H++KAGAMNVLTRVSGVMTNAPF+LNVDCD +
Sbjct  240   VDNKEIHSNAV-VPNFVYISREKAPKQPHHYKAGAMNVLTRVSGVMTNAPFILNVDCDMF  298

Query  1274  VNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
             VNNP+V  HAMC LLG+K+ER+T FVQ+PQ FYDGL+DDPY +Q+ + Y  + RG A IQ
Sbjct  299   VNNPQVFRHAMCQLLGSKNERETAFVQYPQVFYDGLRDDPYGNQFVVPYQYMCRGIAGIQ  358

Query  1454  GSFYDGTGCFHRRKVIYGLSPND--------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
             G FY GTGCFHRRKVIYG+ P D        T    K  D  L   +G S+  + SA   
Sbjct  359   GPFYGGTGCFHRRKVIYGVWPRDRENEARNCTSINGKSVDDTLLNEFGNSEELINSAVQA  418

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L G         LS SLEAA +VA+C YE+GT+WG   GW YG+  ED+LTG+ I   GW
Sbjct  419   LKGKKGFP--NNLSNSLEAACKVASCSYEYGTSWGTKCGWIYGATAEDLLTGLKIHAKGW  476

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              +   +PE PGF+GCTPS G  ++ Q KRWA+G  EIL    CPI A L   LQFR CLA
Sbjct  477   NSALHMPELPGFMGCTPSGGPEAMAQQKRWATGLAEILVGKNCPIIATLTAKLQFRMCLA  536

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y+  + W +R I +LCYA LP YC++ NSHFLPK  E AI IP + F+ YNL+TL EY++
Sbjct  537   YLWILFWGLRSIPQLCYAALPAYCILANSHFLPKVEEPAIWIPIATFVTYNLHTLREYLK  596

Query  2150  EKESIRAWWNNQRM  2191
                SIRAWWNN RM
Sbjct  597   AGLSIRAWWNNLRM  610



>ref|XP_010657215.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
 emb|CBI28832.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/609 (56%), Positives = 424/609 (70%), Gaps = 15/609 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   + N + RA +V I  LLLSL+AYR+ +L ++G+  TWLLA +CESWFTFIW+L
Sbjct  8     PLYEKIPQKNTLHRASDVTIFFLLLSLLAYRLLSLKNNGF--TWLLAFLCESWFTFIWIL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S+KWN V   TYPER L+       E P VDMFVT A+P LEPPI+TVNTVLSLLA++
Sbjct  66    NLSSKWNPVSYKTYPERLLQCYRVD--ELPPVDMFVTAADPMLEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TF+AL+EASKFAKLWVPFCKKY +  RAPFRYF+ +      
Sbjct  124   YPANKLSCYVSDDGASPLTFFALLEASKFAKLWVPFCKKYCIQPRAPFRYFSRELLPSHG  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFAT-----FADLDPNDHSTIIKVIC  1102
             +S EF +E++K+ +EY  L  +IE  T K S+ N+ +T     F+++    H TIIKVI 
Sbjct  184   NSMEFLQEYRKIKEEYEELRRRIEDETLK-SISNELSTAEFVAFSNIKRGSHPTIIKVIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NN
Sbjct  243   ENKESRSDGLPHLVYVSREKHPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++  H+MC LL +K+E+D GFVQ PQ+FYDGLKDDP+ +Q+ ++Y  +  G A +QG  
Sbjct  303   PQIFHHSMCLLLSSKNEQDCGFVQTPQSFYDGLKDDPFGNQFGVLYKYVASGIAGLQGPH  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslss  1630
             Y GTGCFHRRKVIYGL P+  +  +    KLTD  L+K +G SK F  +A   LSG    
Sbjct  363   YSGTGCFHRRKVIYGLWPDGRMEFKGRIGKLTDERLEKTFGNSKEFTKTAARILSGLSGV  422

Query  1631  etFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                   LS  +EAA Q+A+C YE+G  WG  IGW YG+ TEDILTG+ I   GWK+  C 
Sbjct  423   SDCPYDLSNRVEAAHQIASCSYEYGANWGTKIGWLYGTTTEDILTGMRIHARGWKSTDCR  482

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+ P FLGC PS G  +L Q KRWA+G  E+LFS   P        LQFRQCLAYM  + 
Sbjct  483   PDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSPFIITFTAKLQFRQCLAYMWILS  542

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +RPI EL Y  LP YC++  SHFLP   + A++IP S+F+ YN +TL EY     SIR
Sbjct  543   WGLRPIPELYYLALPAYCIMAGSHFLPNVQDPAVLIPISLFVSYNFHTLLEYWGAGYSIR  602

Query  2168  AWWNNQRMW  2194
             A WNN RMW
Sbjct  603   ACWNNLRMW  611



>ref|XP_003633282.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=751

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/607 (56%), Positives = 425/607 (70%), Gaps = 13/607 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   + N + RA+++ I  LLLSL+AYR+ +L ++G   TWL+A +CESWFTF+WVL
Sbjct  8     PLYEKIPQKNTLHRALDLTIFFLLLSLLAYRLLSLKNNGL--TWLVAFLCESWFTFLWVL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S+KWN V   TYPER L+   +   E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NLSSKWNPVSYKTYPERLLQC--HRVDELPPVDMFVTTADPILEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF+++     +
Sbjct  124   YPANKLSCYVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYFSSELVSSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVICE  1105
             +S +F +E++K+ + Y  L  KIE A  K   +     +F  F++++  +H TIIKVI E
Sbjct  184   NSMDFLKEYRKIKEGYQELGRKIEDAALKSMPYELSTAEFVAFSNVERRNHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NNP
Sbjct  244   NKESSSDGLPHLVYVSREKHPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++  HAMC LLG+K E+D GFVQ PQ FYD +KDDP  +Q  +++  +G G A +QG  Y
Sbjct  304   QIFHHAMCLLLGSKSEQDCGFVQSPQMFYDVVKDDPLGNQMVVLFKYVGSGIAGLQGPLY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslsse  1633
              GTGCFHRRKVIYG  P+  +  +    KLTD  L+K +G SK F  +A   LSG     
Sbjct  364   SGTGCFHRRKVIYGSWPDGRMEIKGRNGKLTDERLEKTFGNSKEFTKTAARILSGLSGIS  423

Query  1634  tFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVP  1810
                  LS  +EAA Q+A+C YE+GT+WG  IGW YG+ TEDILTG+ I   GWK+  C P
Sbjct  424   DCPYDLSNRVEAAYQIASCSYEYGTSWGTKIGWLYGTTTEDILTGMRIHARGWKSTDCRP  483

Query  1811  ERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILW  1990
             + P FLGC PS G  +L Q KRWA+G  E+LFS   P  A     LQFRQCLAYM  I W
Sbjct  484   DPPAFLGCAPSDGPAALTQQKRWATGLLEVLFSKNSPPIATFTAKLQFRQCLAYMWIISW  543

Query  1991  PVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRA  2170
              +RPI ELCY  LP YC++  SHFLPK +E A++IP S+F+ Y  +TL+EY     SIRA
Sbjct  544   GLRPIPELCYLALPAYCIMAGSHFLPKVHEPAVLIPISLFVSYKFHTLFEYYGAGFSIRA  603

Query  2171  WWNNQRM  2191
               NN  M
Sbjct  604   CLNNLMM  610



>gb|KCW46974.1| hypothetical protein EUGRSUZ_K00782 [Eucalyptus grandis]
Length=816

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/610 (57%), Positives = 419/610 (69%), Gaps = 20/610 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N   RAVE+ IL LL+SL+ YR+ +L  HG    W +AL CESWFTF+W+L
Sbjct  9     PLYEKISLKNDGKRAVEIFILFLLVSLLTYRLVHLEDHGL--EWQVALACESWFTFVWIL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             V+STKW+ V   TYP R L+ V     E P VD+FVTTA+P+LEPPI+ VNTVLSL+A++
Sbjct  67    VISTKWSPVSYKTYPHRILQRVS----ELPPVDVFVTTADPQLEPPIIIVNTVLSLMAVD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTF--P  931
             YPA+KLACYVSDD  S +TFY+L+EA+KFAKLWVPFCKKYN+ +RAPFRYF  D T    
Sbjct  123   YPAHKLACYVSDDGCSLLTFYSLMEAAKFAKLWVPFCKKYNIQLRAPFRYFAGDSTILSG  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQK--PSLFN-KFATFADLDPNDHSTIIKVIC  1102
              + S EF++    M DEY  L GKIE A+Q   PS F  +FA F++ +  +H TIIK+I 
Sbjct  183   EDCSLEFQQARDTMKDEYDKLSGKIEDASQGSVPSNFTGEFAAFSNTERKNHPTIIKIIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN    A  +PHLIYISREKRPKH H++KAGAMNVLTR+SG+MTNAP MLNVDCD Y NN
Sbjct  243   ENKGGHADELPHLIYISREKRPKHPHHYKAGAMNVLTRISGLMTNAPLMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++VLHA+C LLG K ER   FVQ PQ FYDG KDDP+ +Q  ++   L RG   IQG  
Sbjct  303   PQIVLHALCLLLGTKYERYCAFVQCPQYFYDGAKDDPFGNQLVVLQEYLVRGIVGIQGPV  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEK-------LTDHDLQKIYGKSKIFVtsatttlsgs  1621
             Y GTGCFHRRKVIYG  P D  T +K       LT       +G SK F+ SA   L G+
Sbjct  363   YGGTGCFHRRKVIYGSWPEDMKTEKKILTSNGELTKEKSLNGFGSSKQFIDSAAHALQGN  422

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
                     LS SLE A QVA+C YE+ T WG  +GW YGS  EDILTG+ I   GW++ +
Sbjct  423   PDHPK--DLSSSLEVACQVASCTYEYNTDWGKKVGWMYGSTAEDILTGVAIHTKGWRSLY  480

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P  P FLGC PS G  S+ Q KRWA+G  E+L S + PI+  LF +L FRQCLAY+  
Sbjct  481   CSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLLSKRSPIYGTLFMHLHFRQCLAYLWV  540

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
             ++W +R I E  YA LP YC++TNSHFLPKG E AI+I A+IFIIYNLY L+EY     S
Sbjct  541   LIWALRSIPEFLYALLPAYCIMTNSHFLPKGQEPAIIISAAIFIIYNLYCLYEYFAIGLS  600

Query  2162  IRAWWNNQRM  2191
             I AWWNNQR+
Sbjct  601   IHAWWNNQRI  610



>ref|XP_008229982.1| PREDICTED: cellulose synthase-like protein B4 isoform X3 [Prunus 
mume]
Length=713

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/601 (55%), Positives = 412/601 (69%), Gaps = 39/601 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     N + + +E +IL LLLSL+ YR+ +  +HG+   WL+A +CE WFT  WV+
Sbjct  8     PLYERLEHKNTMHKVMEFIILFLLLSLLVYRLLSFSNHGF--AWLVAFLCELWFTLYWVI  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              +S KW+ VE  TYP+R L+ V     E P VDMFVTTA+ ELEPPI+T+NTVLSLLA++
Sbjct  66    TISNKWSFVEYKTYPDRLLQRV--AEHELPPVDMFVTTADSELEPPIITINTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP +KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKYNV VRAPFRYFN       +
Sbjct  124   YPTDKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYNVQVRAPFRYFNNAAIPSSK  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDHSTIIKVICENDE  1114
             ++ EF++EWK M DEY  L  KIE     P  L   F+ F++++ N+H TIIKV+ + +E
Sbjct  184   NAGEFKQEWKTMKDEYLQLNRKIE---DIPFDLSEDFSLFSNIERNNHPTIIKVVLDKEE  240

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
               + G+PHL+YISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD + NNP VV
Sbjct  241   GHSNGLPHLVYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFANNPSVV  300

Query  1295  LHAMCFLLGA-KDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             LHAMC LLG+ +++ +  F QFPQ FYDGLKDDP+ +Q  +I+  +G G   IQG FY G
Sbjct  301   LHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDPFGNQMAVIWKYMGHGIQGIQGIFYAG  360

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLS  1651
             TGCFHRR+VIYGLSPN+     KL + +L K +G SK    SA   L G        +L 
Sbjct  361   TGCFHRRQVIYGLSPNNG----KLGNQELLKTFGNSKELTKSAADALRGETKCP--SLLL  414

Query  1652  YSLEAAS-QVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
              S++AA+ QVA+C YE+GT WG  +GW YGS TEDILTG+ I   GWK+ FC P++P FL
Sbjct  415   KSIDAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDILTGLSIHNRGWKSIFCTPDQPAFL  474

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GCTP+ G  S+ Q KRWA+G  E+L S  CPIF  +F +LQFRQCLAY+    W +R + 
Sbjct  475   GCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTVFAHLQFRQCLAYLWIFTWGLRSLP  534

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
             E CYA LP Y +ITN+H  PK                       Y++   SIRAWWNNQ+
Sbjct  535   ETCYAALPAYSIITNTHIFPK-----------------------YIQSGLSIRAWWNNQK  571

Query  2189  M  2191
             M
Sbjct  572   M  572



>ref|XP_009416905.1| PREDICTED: cellulose synthase-like protein H1 [Musa acuminata 
subsp. malaccensis]
Length=740

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/605 (53%), Positives = 412/605 (68%), Gaps = 14/605 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E     N++ +  +V++L LLLSL+AYR+ +LH H     WL+A  CESWFTF+W+
Sbjct  2     LPLQERVPLKNSLQKLSDVLVLSLLLSLLAYRLISLHRHAR--IWLIAFTCESWFTFVWL  59

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++ KW +    T+P+   E   +     PAVD+FVTTA+P LEPPI+T NTVLSLLA+
Sbjct  60    LYMNAKWTRATYKTFPQHLSEIYHD----LPAVDVFVTTADPTLEPPIVTANTVLSLLAV  115

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP +KL+CYVSDD+ASP+TFY+LVE++KFAKLWVPFCKK+NV VRAP  YF+ +     
Sbjct  116   DYPFHKLSCYVSDDAASPITFYSLVESAKFAKLWVPFCKKHNVRVRAPSVYFSTEPQPSH  175

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK---PSLFNKFATFADLDPNDHSTIIKVICE  1105
               S ++ REW+++ DEY  L  +IE A +    P + +    F   +  DH ++++VI E
Sbjct  176   SPSSDYMREWRRIKDEYEELIRRIETANEDQILPRVADGSKDFLKTERRDHPSMVEVIWE  235

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E    G PHLIY++REK+PK  H +KAGAMNVLTRVSGVMTNAPFMLNVDCD + NNP
Sbjct  236   NKEGSEDGFPHLIYVAREKKPKQSHQYKAGAMNVLTRVSGVMTNAPFMLNVDCDMFANNP  295

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             EVVLH MC LLG  DE  +GF Q PQ FY  LKDDP+ +Q  ++   +  G   +QG FY
Sbjct  296   EVVLHGMCLLLGVDDEVFSGFAQAPQQFYGALKDDPFGNQLVVLLKKILPGLQGLQGPFY  355

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEK---LTDHDLQKIYGKSKIFVtsatttlsgslsset  1636
              GTGCFHRRKVIYG SP    + EK   L+  +L+ IYG S  FV SA    SG      
Sbjct  356   TGTGCFHRRKVIYG-SPPGPPSIEKRGNLSCEELEMIYGNSLEFVESALQITSGYGKGLP  414

Query  1637  FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPER  1816
                LS  +EAA +VA+C YE  T+WG  IGW YGS+TEDILTG+ I  MGW++    PE 
Sbjct  415   AN-LSSRVEAAKKVADCAYEVNTSWGREIGWVYGSITEDILTGLRIHSMGWRSISMTPEP  473

Query  1817  PGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPV  1996
             P FLGC P+ G  SL Q KRWA+G  EIL S + PI A +   L  RQCLAY++ ++WP+
Sbjct  474   PAFLGCAPTGGPASLTQFKRWATGLLEILLSRRSPILAVMEEKLMLRQCLAYLLILVWPL  533

Query  1997  RPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
             R +FELCYA LP YCL+ +S FLPK +E+  ++P ++F+IYN+YTL EY +   SIRAWW
Sbjct  534   RSVFELCYALLPAYCLLADSAFLPKASELGFLVPMALFLIYNVYTLTEYFQYGLSIRAWW  593

Query  2177  NNQRM  2191
             NNQRM
Sbjct  594   NNQRM  598



>ref|XP_008342031.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Malus 
domestica]
Length=751

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/598 (53%), Positives = 407/598 (68%), Gaps = 17/598 (3%)
 Frame = +2

Query  407   ETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVS  586
             +T ++ NA+ + +E+ IL L + ++ YR+ +L  HG+   WLLA  CESWF F WVL++ 
Sbjct  12    KTALKINALQKTLEIAILFLFVFVLVYRLLSLRDHGF--VWLLAFACESWFAFNWVLILI  69

Query  587   TKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPA  766
             T+W  VE  T P   L+ V     E P VDMFVTTA+ +LEPPI+TVNTVLSLLA++YP 
Sbjct  70    TQWTPVEYKTNPHNLLQHVS----ELPPVDMFVTTADAKLEPPIITVNTVLSLLAVDYPT  125

Query  767   NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSP  946
             +KLACYVSDD  SP+T Y L+EASKFAKLWVPFCKKY+V VRAPFRYF+ +      +  
Sbjct  126   HKLACYVSDDGCSPLTLYTLIEASKFAKLWVPFCKKYHVQVRAPFRYFSNNPILSSYNLS  185

Query  947   EFRREWKKMNDEYANLCGKIEYATQK--PSLFNK-FATFADLDPNDHSTIIKVICENDES  1117
              F +EW KM DEY  LC KIE A +   P  F++ +  FA +D  +H TIIKVI +  E 
Sbjct  186   GFHQEWTKMKDEYEKLCKKIEDAVRNLAPLDFSRDYVDFARIDSRNHPTIIKVIWDAKER  245

Query  1118  LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
             ++ G+PHL+Y++REKRP H H++KAGAMN LTRVSGVMTNAPFMLNVDCD Y NNP++VL
Sbjct  246   ISNGLPHLVYVTREKRPNHSHHYKAGAMNALTRVSGVMTNAPFMLNVDCDMYANNPKIVL  305

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTG  1477
             HAMC LLG K E++  FVQFPQ FYD L+DDP+ S        +  G A IQG  Y GTG
Sbjct  306   HAMCLLLGFKHEKEGAFVQFPQMFYDTLEDDPFGSNVVEAVKKIWPGLAGIQGPIYAGTG  365

Query  1478  CFHRRKVIYGLSPND---TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             CFHRRKVIYGLS  D    +T+E+L     ++ +G S   +  + T +    + +    L
Sbjct  366   CFHRRKVIYGLSLTDNEGNLTSERLN----KECFGNSPELI-RSATQILLEENIDQLDDL  420

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
             S ++E A QVA   YE  T WG  +GW YGSV+ED+LTG+ I   GWK+  C PE PGFL
Sbjct  421   SCAVEIAYQVAGSEYEDDTLWGKKVGWVYGSVSEDVLTGMKIHARGWKSILCTPEPPGFL  480

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             G  PST    L Q KRW +G  EILFS  CPIFA L+  L+FRQCLAY+  ++W +  + 
Sbjct  481   GTGPSTTHVMLIQRKRWITGLLEILFSKNCPIFATLYAKLEFRQCLAYLRILIWGLLSVP  540

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             +LCYA LP YC+ITNSHFLPK  E  ++I A++F+I +LYTL  Y++   SIRAWWN 
Sbjct  541   DLCYALLPAYCIITNSHFLPKVEEPTLIIFAALFLIKHLYTLHSYLDSGRSIRAWWNQ  598



>ref|XP_009347146.1| PREDICTED: cellulose synthase-like protein H1 [Pyrus x bretschneideri]
Length=740

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/608 (54%), Positives = 415/608 (68%), Gaps = 24/608 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL+E       + + +E +IL LLLSL+ +R+ + + HG+  TWL+A +CE  FT  WV
Sbjct  7     LPLHERIELRYTLHKVIEFIILFLLLSLLVHRLLSFNDHGF--TWLIAFLCELSFTLNWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++S KWN VE  TYP+R L+ V     E P VDMFVTTA+ +LEPPI+T+NTVLSLLA+
Sbjct  65    IIISNKWNIVEYKTYPDRLLQRVSKH--ELPPVDMFVTTADSKLEPPIITINTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YP NKLACYVSDD  SP+TFY+L EASKFA+ WVPFC+KY+V VRAPFRYF N + TF 
Sbjct  123   DYPTNKLACYVSDDGCSPLTFYSLSEASKFAEHWVPFCRKYSVQVRAPFRYFSNNNATFS  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
                S EF++EW  + DEY  L  KIE A  K   F+    FA F++++ N+H TIIKV+ 
Sbjct  183   SNDSSEFKQEWTLLKDEYEQLSRKIEDAVGKSIPFDVSQDFAVFSNIERNNHPTIIKVLW  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E ++ G PHLIYISREKRPKH H+ KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNN
Sbjct  243   ENKEDVSDGPPHLIYISREKRPKHPHHSKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+++LHAMC LLG+++E    F QFPQ FYDGLKDDP+ +Q  ++   +G G A IQG  
Sbjct  303   PDIMLHAMCTLLGSENETKNAFAQFPQIFYDGLKDDPFGNQMVVLMKFVGHGIAGIQGPI  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTD-----HDLQKIYGKSKIFVtsatttlsgsls  1627
             Y GTGC HRRKVIYGLSP DT T E+  +      ++ K +G S+ F  SA   L G+  
Sbjct  363   YAGTGCVHRRKVIYGLSPTDTKTGERYPNIGSGKVEMLKNFGTSEEFTKSAGDALQGNTE  422

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                    S S++AA +V  C YE+GT WG  I          +LTG+ I   GW + FC 
Sbjct  423   CVNMS--SKSIDAAHRVGGCEYEYGTNWGIKI---------SLLTGLSIHNKGWNSIFCT  471

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+ P FLGC P+ G  S+ Q KRWA+G  EIL S  CPIF  LF NLQFR  L Y   + 
Sbjct  472   PDPPAFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPIFGTLFANLQFRMFLCYFWVLS  531

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I ELCYA LP Y +ITN+HFLPKG E    IP ++F++Y++YTL E+++   SIR
Sbjct  532   WGLRCIPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVLYHIYTLLEHLQTGLSIR  591

Query  2168  AWWNNQRM  2191
             AWWNNQRM
Sbjct  592   AWWNNQRM  599



>ref|XP_008342032.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Malus 
domestica]
Length=734

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/595 (53%), Positives = 402/595 (68%), Gaps = 28/595 (5%)
 Frame = +2

Query  407   ETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVS  586
             +T ++ NA+ + +E+ IL L + ++ YR+ +L  HG+   WLLA  CESWF F WVL++ 
Sbjct  12    KTALKINALQKTLEIAILFLFVFVLVYRLLSLRDHGF--VWLLAFACESWFAFNWVLILI  69

Query  587   TKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPA  766
             T+W  VE  T P   L+ V     E P VDMFVTTA+ +LEPPI+TVNTVLSLLA++YP 
Sbjct  70    TQWTPVEYKTNPHNLLQHVS----ELPPVDMFVTTADAKLEPPIITVNTVLSLLAVDYPT  125

Query  767   NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSP  946
             +KLACYVSDD  SP+T Y L+EASKFAKLWVPFCKKY+V VRAPFRYF+ +      +  
Sbjct  126   HKLACYVSDDGCSPLTLYTLIEASKFAKLWVPFCKKYHVQVRAPFRYFSNNPILSSYNLS  185

Query  947   EFRREWKKMNDEYANLCGKIEYATQK--PSLFNK-FATFADLDPNDHSTIIKVICENDES  1117
              F +EW KM DEY  LC KIE A +   P  F++ +  FA +D  +H TIIKVI +  E 
Sbjct  186   GFHQEWTKMKDEYEKLCKKIEDAVRNLAPLDFSRDYVDFARIDSRNHPTIIKVIWDAKER  245

Query  1118  LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
             ++ G+PHL+Y++REKRP H H++KAGAMN LTRVSGVMTNAPFMLNVDCD Y NNP++VL
Sbjct  246   ISNGLPHLVYVTREKRPNHSHHYKAGAMNALTRVSGVMTNAPFMLNVDCDMYANNPKIVL  305

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTG  1477
             HAMC LLG K E++  FVQFPQ FYD L+DDP+ S        +  G A IQG  Y GTG
Sbjct  306   HAMCLLLGFKHEKEGAFVQFPQMFYDTLEDDPFGSNVVEAVKKIWPGLAGIQGPIYAGTG  365

Query  1478  CFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYS  1657
             CFHRRKVIYGLS         LTD++ + I   ++I +           + +    LS +
Sbjct  366   CFHRRKVIYGLS---------LTDNE-ELIRSATQILL---------EENIDQLDDLSCA  406

Query  1658  LEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCT  1837
             +E A QVA   YE  T WG  +GW YGSV+ED+LTG+ I   GWK+  C PE PGFLG  
Sbjct  407   VEIAYQVAGSEYEDDTLWGKKVGWVYGSVSEDVLTGMKIHARGWKSILCTPEPPGFLGTG  466

Query  1838  PSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELC  2017
             PST    L Q KRW +G  EILFS  CPIFA L+  L+FRQCLAY+  ++W +  + +LC
Sbjct  467   PSTTHVMLIQRKRWITGLLEILFSKNCPIFATLYAKLEFRQCLAYLRILIWGLLSVPDLC  526

Query  2018  YAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             YA LP YC+ITNSHFLPK  E  ++I A++F+I +LYTL  Y++   SIRAWWN 
Sbjct  527   YALLPAYCIITNSHFLPKVEEPTLIIFAALFLIKHLYTLHSYLDSGRSIRAWWNQ  581



>ref|XP_010252474.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/575 (55%), Positives = 398/575 (69%), Gaps = 18/575 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E   RNN + RA +++I  L LSL++YR   L +HG    WLLA +CESWFT  WV
Sbjct  7     LPLQERIPRNNILQRATDIIIFFLFLSLLSYRFLTLSNHGV--AWLLAFLCESWFTLCWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +++ WN VE  TYPER L+ V     E P+VDMFVTTA+P LEPPI+TVNTVLSLLA+
Sbjct  65    LTINSNWNPVEYRTYPERLLQRVG----EVPSVDMFVTTADPLLEPPIITVNTVLSLLAV  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPA+KLACYVSDD AS +TFY+LVEASKFAKLWVPFCKKY++ VRAPF YF+ +     
Sbjct  121   DYPAHKLACYVSDDGASLLTFYSLVEASKFAKLWVPFCKKYSIRVRAPFVYFSTEIDESL  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK----PSLFNKFATFADLDPNDHSTIIKVIC  1102
             + SP+FR EWK M +EY  L  +IE A QK      L   FA F+ +DP +H +I+KVI 
Sbjct  181   DLSPDFRDEWKTMKNEYKQLRRRIEEAVQKNYIAGDLTGDFAAFSKIDPKNHPSIVKVIW  240

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E+L  G+PHLIY+SREKRP H H+FKAGAMNVLTRVSGVMTN+PF+LNVDCD +VNN
Sbjct  241   ENKENLPDGLPHLIYVSREKRPVHPHHFKAGAMNVLTRVSGVMTNSPFILNVDCDMFVNN  300

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYA-SQYKIIYHCLGRGNAAIQGS  1459
             P+ +LHAMC LLG + E+++GFVQFPQ FY  LKDDP+  +Q+ + +  +  G   IQG 
Sbjct  301   PQTILHAMCLLLGFEQEKESGFVQFPQIFYRSLKDDPFGNNQFIVFWKFIMPGIVGIQGP  360

Query  1460  FYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
             FY GTGCFHRRKVIYGLSP+     E      ++  +G S  F+ S    LSG       
Sbjct  361   FYGGTGCFHRRKVIYGLSPD-----EATIQGAMETTFGNSVHFMKSVPQILSGIKDKTDC  415

Query  1640  --GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                 LS + EAA++VA+C YE+ T+WG  +GW YGS TED+LTG+ I   GW++G+C P+
Sbjct  416   QPADLSSTEEAANEVASCVYEYNTSWGERVGWVYGSATEDVLTGLRIHSKGWRSGYCTPD  475

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
              P FLG TPS G   L Q KRWA+G  EIL S   PI   + G L  RQCL Y+  I+WP
Sbjct  476   PPAFLGDTPSGGPAILTQQKRWATGLLEILVSNYNPILGVIKGKLLIRQCLVYLSVIIWP  535

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP  2098
             +R + ELCYA LPPYC++T ++FLP  N  +   P
Sbjct  536   LRALPELCYALLPPYCILTTTYFLPTVNSPSTSRP  570



>ref|XP_006592368.1| PREDICTED: uncharacterized LOC100500469 isoform X1 [Glycine max]
Length=746

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/602 (53%), Positives = 413/602 (69%), Gaps = 11/602 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +   R  E ++ +LLL L+ YRV ++++  Y + W +A +CESWFT  W 
Sbjct  7     LPLYEKFWYKHNYKRVTESLLSVLLLWLLGYRVISINN--YSFPWFVAFLCESWFTISWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++T+W+   T TYP+R L+ V+    E P VD+FVTTA+PELEPPI+TVNTVLSLLAL
Sbjct  65    LALTTQWSPAVTKTYPDRLLQSVQ----ELPPVDLFVTTADPELEPPIITVNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YPA+KLACYVSDD  SP+TFYAL EASKFAK WVPFCKKY V VRAP RYF +      
Sbjct  121   DYPAHKLACYVSDDGCSPLTFYALQEASKFAKFWVPFCKKYEVQVRAPLRYFFDKPEVST  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYA--TQKPSLFNKFATFADLDPNDHSTIIKVICE  1105
               ++P+F++EW KM D Y  L  KI+    T+      +FATF++ +  +H +II+VI E
Sbjct  181   ANNTPKFKQEWLKMKDMYDQLSRKIDLDSFTKSNPCLGEFATFSNTERTNHPSIIQVIWE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N+ESLA G+PHLIYISREKRPK  H+FKAGAMNVLTRVSG++TNAPFMLNVDCD  V+NP
Sbjct  241   NNESLADGLPHLIYISREKRPKQPHHFKAGAMNVLTRVSGLITNAPFMLNVDCDMIVSNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+  LL  K E++  FVQ PQ FY  LKDDP+ +Q  I++  L  G A +QG FY
Sbjct  301   KIVLHALSILLDPKGEKEVAFVQCPQQFYATLKDDPFGNQMTILFKNLAPGLAGLQGPFY  360

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GT CFHRRKVIYG SP++      ++D + ++ +G SK F+ SA   L G + S     
Sbjct  361   GGTNCFHRRKVIYGRSPDNIEKGSGISDEEFKEKFGASKDFLKSAAFALKGRIYSPNDIN  420

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             +S  ++ ASQVA CGYE+GT WG  +GW YGS+TED+LTG+ I   GW++  C P    F
Sbjct  421   ISNVVDVASQVAGCGYEYGTGWGKQVGWIYGSITEDVLTGLTIHEKGWRSELCTPSPIPF  480

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
              G  P  G  S+ Q KRWA+G  EI     CPI ++LF  L  RQCLAYM  I W ++P+
Sbjct  481   TGFAPGGGPTSMAQQKRWATGMLEIFICKHCPIISSLFRKLTLRQCLAYMWIINWGLQPV  540

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             FE+CYA L  YC+ITNS+FLP+  ++ I IP + F IY +YT+ EY+    S+R WWNNQ
Sbjct  541   FEVCYACLLAYCIITNSNFLPQ--DLGIRIPIAFFAIYKVYTVCEYLAAGLSVREWWNNQ  598

Query  2186  RM  2191
             RM
Sbjct  599   RM  600



>gb|KHN21212.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=746

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/602 (53%), Positives = 413/602 (69%), Gaps = 11/602 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +   R  E ++ +LLL L+ YRV ++++  Y + W +A +CESWFT  W 
Sbjct  7     LPLYEKFWYKHNYKRVTESLLSVLLLWLLGYRVISINN--YSFPWFVAFLCESWFTISWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++T+W+   T TYP+R L+ V+    E P VD+FVTTA+PELEPPI+TVNTVLSLLAL
Sbjct  65    LALTTEWSPAVTKTYPDRLLQSVQ----ELPPVDLFVTTADPELEPPIITVNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YPA+KLACYVSDD  SP+TFYAL EASKFAK WVPFCKKY V VRAP RYF +      
Sbjct  121   DYPAHKLACYVSDDGCSPLTFYALQEASKFAKFWVPFCKKYEVQVRAPLRYFFDKPEVST  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYA--TQKPSLFNKFATFADLDPNDHSTIIKVICE  1105
               ++P+F++EW KM D Y  L  KI+    T+      +FATF++ +  +H +II+VI E
Sbjct  181   ANNTPKFKQEWLKMKDMYDQLSRKIDLDSFTKSNPCLGEFATFSNTERTNHPSIIQVIWE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N+ESLA G+PHLIYISREKRPK  H+FKAGAMNVLTRVSG++TNAPFMLNVDCD  V+NP
Sbjct  241   NNESLADGLPHLIYISREKRPKQPHHFKAGAMNVLTRVSGLITNAPFMLNVDCDMIVSNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+  LL  K E++  FVQ PQ FY  LKDDP+ +Q  I++  L  G A +QG FY
Sbjct  301   KIVLHALSILLDPKGEKEVAFVQCPQQFYATLKDDPFGNQMTILFKNLAPGLAGLQGPFY  360

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GT CFHRRKVIYG SP++      ++D + ++ +G SK F+ SA   L G + S     
Sbjct  361   GGTNCFHRRKVIYGRSPDNIEKGSGISDEEFKEKFGASKDFLKSAAFALKGRIYSPNDIN  420

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             +S  ++ ASQVA CGYE+GT WG  +GW YGS+TED+LTG+ I   GW++  C P    F
Sbjct  421   ISNVVDVASQVAGCGYEYGTGWGKQVGWIYGSITEDVLTGLTIHEKGWRSELCTPSPIPF  480

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
              G  P  G  S+ Q KRWA+G  +I     CPI ++LF  L  RQCLAYM  I W ++P+
Sbjct  481   TGFAPGGGPTSMAQQKRWATGMLKIFICKHCPIISSLFRKLTLRQCLAYMWIINWGLQPV  540

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             FE+CYA L  YC+ITNS+FLP+  ++ I IP + F IY +YT+ EY+    S+R WWNNQ
Sbjct  541   FEVCYACLLAYCIITNSNFLPQ--DLGICIPIAFFAIYKVYTVCEYLAAGLSVREWWNNQ  598

Query  2186  RM  2191
             RM
Sbjct  599   RM  600



>ref|XP_003540273.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=754

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/613 (53%), Positives = 412/613 (67%), Gaps = 21/613 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLY+     +  SRA++ +I LLLL L++YRV+++ SH Y + W LA +CESWFT  W+
Sbjct  8     LPLYQKLWLKHTFSRAMDSLIFLLLLILLSYRVYSI-SH-YSFPWFLATLCESWFTLTWL  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    TTT+ +R    V     E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  66    TTISTKWTPARTTTHLDRLFLRVG----ELPQVDVFVTTADPVLEPPIITINTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEA+KFAKLWVPFCKKYNV VRAPFRYF+ D T   
Sbjct  122   DYPANKLACYVSDDGCSPLTFYALVEATKFAKLWVPFCKKYNVQVRAPFRYFSEDATVDK  181

Query  935   ESS-PEFRREWKKMNDEYANLCGKIEYATQKPS---LFNKFATFADLDPNDHSTIIKVIC  1102
              +   EF +EW  M  EY  LC KI+ A+QK +   L  ++A F+  +  +H +IIKVI 
Sbjct  182   NTDLQEFEQEWSLMKKEYEQLCRKIQNASQKSNPCPLVGEYAVFSKTELKNHPSIIKVIW  241

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E L  GVPHLIYISREKRP+H H++KAGAMNVLTRVS +MTNAP++LNVDCD YVNN
Sbjct  242   ENKEGLRDGVPHLIYISREKRPQHPHHYKAGAMNVLTRVSALMTNAPYILNVDCDMYVNN  301

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++  HA+C  L +K E++  FVQ PQ FYD +KDD Y +Q   +   +G G A +QG  
Sbjct  302   PKIAQHALCIFLDSKGEKEVAFVQCPQRFYDTVKDDAYGNQLVALPMYIGGGFAGLQGII  361

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEK---------LTDHDLQKIYGKSKIFVtsatttls  1615
             Y GT CFHRRKVIYGLSP+  +   K          +     +I+G S+ FV SA   L 
Sbjct  362   YAGTNCFHRRKVIYGLSPDYDIQNMKKDFGFINGTKSQKKTMQIFGASRGFVESAKHALE  421

Query  1616  gslssetFGVL-SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 +    +  S  L+AA+QVA+C YE+ T WG  +GW YGS +ED+LTG+ +   GW+
Sbjct  422   EMTFTPNDKLFKSLELKAANQVASCDYEYSTAWGKQVGWLYGSTSEDVLTGLVMHTKGWR  481

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             +  C P+   F+GC+P   LG + Q KRW+SG  +I  S  CPIF  LFG LQFR+CLAY
Sbjct  482   SEVCSPDPMAFMGCSPQDNLGQMGQHKRWSSGLFDIFLSSHCPIFGTLFGKLQFRECLAY  541

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +    W +R + E+CYA LP YC+ITNS FLP   E  + IP S+F++YN+ TL E++  
Sbjct  542   VWITNWALRSVPEICYALLPAYCIITNSSFLP-NKEPGMWIPTSVFVMYNVATLLEHLIS  600

Query  2153  KESIRAWWNNQRM  2191
               S R WWNNQRM
Sbjct  601   GLSARTWWNNQRM  613



>gb|KHN44861.1| Cellulose synthase-like protein B3 [Glycine soja]
Length=746

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/604 (53%), Positives = 412/604 (68%), Gaps = 13/604 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE       + R ++ +IL LLL L+ YRV  L S+ + + W LAL+CESWFTF W+
Sbjct  8     LPLYEKVWLKRRLQRVIDTLILFLLLLLLNYRV--LSSNSFTFPWFLALLCESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++++KW+   T T+P+R L+WV     E P VD+ VTTANP LEPPI+TVNTVLSLLAL
Sbjct  66    VILNSKWSPAVTITHPDRLLQWVS----ELPPVDLLVTTANPILEPPIITVNTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEASKFAK WVPFCKKYNV VRAPFRYF+   T   
Sbjct  122   DYPANKLACYVSDDGCSPLTFYALVEASKFAKFWVPFCKKYNVQVRAPFRYFSDVATNKS  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW +M D Y NL  KIE  T K   F    +FA F++ D  +H +IIKVI E
Sbjct  182   EESLEFKQEWLQMKDMYENLSRKIEEVTCKTISFQLDGEFAVFSNTDQRNHPSIIKVIIE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + +  G+PHLIY+SREKRP++QHN+KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNNP
Sbjct  242   NKDGIFDGLPHLIYVSREKRPQYQHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V HA+C L+ ++  ++  FVQ  Q FYDG+KDDP+ +Q+ I +  + RG A +QG FY
Sbjct  302   KIVQHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPFGNQWVIAFEYIIRGMAGLQGPFY  361

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++  +    KL +  L + +G SK F+ SA   L G+  S   
Sbjct  362   GGTNTFHRRNAIYGLYPHEIESGRKGKLEEKILIRQFGSSKEFIKSAAHALGGNAYSAND  421

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                S  +EAA+QVANC YE  T WG  +GW YGS++ED+ TG+ IQR GW++  C P+  
Sbjct  422   ITPSNFIEAATQVANCEYEDDTFWGKQMGWLYGSISEDVPTGLNIQRRGWRSECCTPDPI  481

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRWASG T + F    P+   LFG +QFR  L+Y     W +R
Sbjct  482   AFTGCAPGGLLTTMVQQKRWASGLTVVFFGKHSPLMGMLFGKIQFRAGLSYFWLTNWGLR  541

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
               F +CY  L  YC+ITN++  PKG  + + IP ++F+IYN +TL EY+    S+R WWN
Sbjct  542   AFFLVCYVALLEYCIITNTNIFPKG--LGLWIPIALFVIYNAHTLLEYLTIGLSMRHWWN  599

Query  2180  NQRM  2191
             NQRM
Sbjct  600   NQRM  603



>ref|XP_007132522.1| hypothetical protein PHAVU_011G101500g [Phaseolus vulgaris]
 gb|ESW04516.1| hypothetical protein PHAVU_011G101500g [Phaseolus vulgaris]
Length=746

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/602 (52%), Positives = 410/602 (68%), Gaps = 11/602 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
             FPLYE     +   R  E ++L+LLL L+ YRV ++++  Y + W +A VCESWFT  W 
Sbjct  7     FPLYEKHWYKHTYKRVTESLLLILLLLLLGYRVISVNN--YSFPWFVAFVCESWFTISWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               ++T+W+     TYPER L+ V+    + P VD+FVTTA+  LEPPI+TVNTVLSLLAL
Sbjct  65    FTLATQWSPAVIKTYPERLLQSVQ----DLPPVDLFVTTADSVLEPPIITVNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNAD-HTFP  931
             +YP +KLACYVSDD  SP+TFYAL EASKFAK WVPFCKKY+V +RAPFRYF+       
Sbjct  121   DYPPHKLACYVSDDGCSPLTFYALQEASKFAKFWVPFCKKYDVQIRAPFRYFSDKLEVST  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEY-ATQKPSL-FNKFATFADLDPNDHSTIIKVICE  1105
               ++P+F++EW +M D Y +L  KIE  A+QK +  +  FA F++ +  +H +IIKVI E
Sbjct  181   SNNTPQFKQEWLQMKDMYGDLSRKIELEASQKSNPNYGDFAVFSNTEKTNHPSIIKVIWE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E L  G+PHLIYISREKRPKH H+FKAGAMNVLTRVSG++TNAPFMLNVDCD  VNNP
Sbjct  241   NKEELEDGLPHLIYISREKRPKHSHHFKAGAMNVLTRVSGLITNAPFMLNVDCDMIVNNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V  A+C LL  K +++  F QFPQ FY  LKDDP+ +Q  I+      G A +QG FY
Sbjct  301   KIVHDALCILLDPKGQKEVAFAQFPQQFYATLKDDPFGNQMAILIKYFATGLAGLQGPFY  360

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GT CFHRRKVIYGLSP+       +++ +L++ +G SK  + SA   L G   S     
Sbjct  361   AGTNCFHRRKVIYGLSPDYVHKGNSISEEELKQKFGASKEIMKSAGCALEGRRYSPNADN  420

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             ++  ++ ASQVA+CGYE+GT WG  +GW YGS+TED+LTG+ I   GW++  C P    F
Sbjct  421   IAQVIDLASQVASCGYEYGTGWGKQVGWIYGSLTEDVLTGLTIHEKGWRSELCTPRPIAF  480

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
              G  P  G  ++ Q KRWA G  EI  S  CPIFA LF  L FRQC+AYM  + W +RP 
Sbjct  481   TGFAPGGGPTTMAQQKRWAIGLLEIFLSKHCPIFATLFHKLTFRQCIAYMWIMNWGLRPF  540

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             FE+CYA L  +C+ITNS+FLP+  E  I IP +  +IY +YT+  Y+ E  S++AWWNNQ
Sbjct  541   FEVCYASLLAHCIITNSNFLPQ--EHGICIPVAFLVIYKVYTVSVYLAEGLSVKAWWNNQ  598

Query  2186  RM  2191
             RM
Sbjct  599   RM  600



>ref|XP_010930912.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Elaeis 
guineensis]
Length=745

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/568 (53%), Positives = 398/568 (70%), Gaps = 9/568 (2%)
 Frame = +2

Query  497   NLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVD  676
             +LHSHG    WL+A +CESWFTF+WVL ++ KWN V+  TYPER L+       + PAVD
Sbjct  41    SLHSHGP--IWLIAFLCESWFTFVWVLYMNGKWNPVKYKTYPERLLK---RSDIDLPAVD  95

Query  677   MFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLW  856
             +FVTTA+P+LEPPI+T NTVLSLLA+EYPA+KLACYVSDD+ SP+TFY+L+EASKFAKLW
Sbjct  96    IFVTTADPKLEPPIITANTVLSLLAVEYPAHKLACYVSDDAGSPITFYSLLEASKFAKLW  155

Query  857   VPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF  1036
             VPFCKKYNV VRAPF YF+++       S EF  +W+ M ++Y  L  +I+ A       
Sbjct  156   VPFCKKYNVRVRAPFVYFSSEPQASQALSQEFMDDWRYMKNKYEELSRRIDDAASHYK-D  214

Query  1037  NKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTR  1216
             ++ A F++++  +H ++IKVI EN + L  G+PHL+Y++REKRPKH H++KAGAMNVL R
Sbjct  215   DELADFSNIERGNHPSLIKVIWENKQGLEDGIPHLVYVAREKRPKHPHHYKAGAMNVLAR  274

Query  1217  VSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPY  1396
             VSGVMTNAPFMLNVDCD + NNPEV+LH MC LLG  +E  TGFVQ PQ FY  LKDDP+
Sbjct  275   VSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSTGFVQAPQQFYGALKDDPF  334

Query  1397  ASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN--DTVTAEKLTDHDLQKIY  1570
              +Q  ++    G G   IQG FY GTGCFHRRK++YG +P        + L+D + Q+IY
Sbjct  335   GNQLVVLQGITGVGFGGIQGPFYGGTGCFHRRKILYGSAPGLAGVSKHDDLSDKEPQRIY  394

Query  1571  GKSKIFVtsatttlsgslssetF-GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVT  1747
             G S+  + SA+  +SG +   +    LS  +E A +VA+C YEF T WG  IGW YGS+T
Sbjct  395   GDSRELMESASRIISGKIRESSCNNNLSSRVEVAKRVASCSYEFNTCWGKQIGWAYGSMT  454

Query  1748  EDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIF  1927
             ED+LTG+ I  MGWK+ + + + P FLG  P+ G  SL Q KRW++G  EI +    PI 
Sbjct  455   EDVLTGLRIHSMGWKSVYLILDPPAFLGSAPTGGPASLTQYKRWSTGLLEISWGRSSPIL  514

Query  1928  AALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASI  2107
             A     L+FR CLAY+++  W +R + ELCYA LP YCL+ N+ F+PK +E   VIP + 
Sbjct  515   ATFTKQLKFRMCLAYLLASTWALRSMGELCYALLPAYCLLANTSFMPKASEPVFVIPLAP  574

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             F+I N++++ EY +   S+RA+WNNQRM
Sbjct  575   FLISNIHSIIEYFQCGLSVRAYWNNQRM  602



>ref|XP_006582368.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Glycine max]
 gb|KHN41241.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=750

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/603 (53%), Positives = 412/603 (68%), Gaps = 12/603 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             P YE     +   R  + ++L+LLLSL+ YRV +++++  +  W +A +CESWFTF W L
Sbjct  8     PFYEKYWYKHNYKRVTDSLLLILLLSLLGYRVISINNYSLF-PWFVAFLCESWFTFSWFL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              ++T+W+   T TYP R L+ VE    E P VD+FVTTA+PELEPPI+TVNTVLSLLAL+
Sbjct  67    TLTTQWSPAVTKTYPHRLLQSVE----ELPPVDLFVTTADPELEPPIITVNTVLSLLALD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFN--ADHTFP  931
             YP +KLACYVSDD  SP TFYAL EAS+FAK WVPFCKKY+V VRAPFRYF+   +  F 
Sbjct  123   YPPHKLACYVSDDGCSPRTFYALQEASQFAKFWVPFCKKYHVQVRAPFRYFSDKPEEVFG  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPS--LFNKFATFADLDPNDHSTIIKVICE  1105
               ++PEF++EW +M D Y NL  KIE  +   S      FA F++ +  +H +II+VI E
Sbjct  183   ANNTPEFKQEWLQMKDMYDNLSSKIELDSSIISNPCNGDFAVFSNTERTNHPSIIQVIWE  242

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E +A G+PHLIYISREKRPK  H++KAGAMNVLTRVSG++TNAPFMLNVDCD  VNNP
Sbjct  243   NKEHIADGLPHLIYISREKRPKQPHHYKAGAMNVLTRVSGLITNAPFMLNVDCDMIVNNP  302

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V HA+  LL  K E++  FVQFPQ FY  LKDDP+ +Q  I+   L  G   +QG FY
Sbjct  303   KIVHHALSILLDHKGEKEVAFVQFPQKFYATLKDDPFGNQMTILAKYLAAGIGGLQGPFY  362

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GT CFHRRKVIYGLSP +      +++ +L++ +G SK  + S   TL G   S     
Sbjct  363   GGTNCFHRRKVIYGLSPENIEKGNSISEEELKQKFGTSKEIMKSVACTLEGRTYSYNDIN  422

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             +S  ++ ASQVA C YE+GT WG  + W YGSVTED+LTG+ I + GW++ FC+P   GF
Sbjct  423   ISNVVDVASQVAGCAYEYGTGWGKQMAWIYGSVTEDVLTGLTIHKKGWRSEFCMPSPIGF  482

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM-ISILWPVRP  2002
              G  P  G  S+ Q KRWA+G  E+ F   CPI + LF  L  RQCLAYM I   W +  
Sbjct  483   TGFAPGGGPNSMAQQKRWATGLLEMFFCKHCPIISTLFHKLTLRQCLAYMWIINHWGLMS  542

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             +FE+CYA L  YC+ITNS+FLP+  ++ I IPA+  +IY +YT  EY+ E  SIRAWWNN
Sbjct  543   VFEVCYACLLAYCIITNSNFLPQ--DLGICIPAAFLVIYKIYTASEYLAEGLSIRAWWNN  600

Query  2183  QRM  2191
             QRM
Sbjct  601   QRM  603



>ref|XP_007049095.1| Cellulose synthase-like B4, putative isoform 1 [Theobroma cacao]
 gb|EOX93252.1| Cellulose synthase-like B4, putative isoform 1 [Theobroma cacao]
Length=714

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/603 (52%), Positives = 407/603 (67%), Gaps = 12/603 (2%)
 Frame = +2

Query  395   FPLYE-TKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIW  571
              PLYE    +   + R ++V +  LLLSL+AYR+ +L + G+  TWLLA +CESWF F+W
Sbjct  7     LPLYERVSCKGIMIRRTLDVTVFCLLLSLLAYRLRSLSNQGF--TWLLAFLCESWFAFLW  64

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             +L +ST+WN VE  TYPE  L      S E P +DMFVTTA+P LEPP++TVNTVLSLLA
Sbjct  65    LLNLSTRWNPVEYKTYPENLLL----RSLELPPIDMFVTTADPVLEPPLVTVNTVLSLLA  120

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP  931
             ++YPA KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKY++ +RAPF+YF+A    P
Sbjct  121   VDYPAEKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYSIQIRAPFQYFSAKSLPP  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSL---FNKFATFADLDPNDHSTIIKVIC  1102
              +    F  EWKKM DEY +LC KIE A  K +L     ++A F +++ ++H +I+KVI 
Sbjct  181   VDGLSGFELEWKKMKDEYEHLCRKIEDAVHKLTLGPHSTEYAVFKNIERDNHPSIVKVIF  240

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E  +  +PHL+Y+SREKRP H H+FKAGAMNVLTRVSGVMTNAPFMLNVDCD + +N
Sbjct  241   ENKEDHSSCLPHLVYVSREKRPNHPHHFKAGAMNVLTRVSGVMTNAPFMLNVDCDMFASN  300

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+++LHA+C L+G  DE++  FVQ PQ FYD LKDDP+ ++  + +     G A IQG  
Sbjct  301   PKIILHAVCLLVGVDDEQECAFVQCPQIFYDALKDDPFGNRMTVPFTIFVGGMAGIQGPP  360

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGCFHRRK IYGL PN     +      L++ +GKS  F  S    L GS       
Sbjct  361   YAGTGCFHRRKAIYGLPPNHDFDIKDCK--ILEERFGKSTEFSESVAEILFGSGEKHFPC  418

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              +S    +A +VANC YE  T WG  +G  YGSVTED+LTG+ I  MGWK+   +P  P 
Sbjct  419   DISSITGSACRVANCSYENNTCWGIEVGLTYGSVTEDVLTGLRIHTMGWKSVLLMPSPPA  478

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+GC P  G  S+ QMKRW +G  E+LFS   PI +A    L FRQ LAY+  ++W  R 
Sbjct  479   FMGCAPPGGPVSMTQMKRWGTGLLEVLFSKHSPILSAFSTKLHFRQALAYLQIVMWASRS  538

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             I + CY  L  YC+ T+S FLPK +E    IP S  +I NL++L +Y++  ESI+AWWN+
Sbjct  539   IPQFCYNMLSAYCITTDSQFLPKVHEPFFYIPVSFSLISNLHSLSQYLQYGESIQAWWNH  598

Query  2183  QRM  2191
             QRM
Sbjct  599   QRM  601



>gb|KDO54720.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=637

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/602 (53%), Positives = 407/602 (68%), Gaps = 17/602 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     N   RA++V+IL LLL L+ YR+  L +HG+   W LA +CES FTFIW+
Sbjct  9     LPLYEKVFHKNTYHRALDVIILFLLLCLLFYRLSTLKNHGF--AWFLAFLCESCFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+V+ KW  +   TYP+R  E ++    E P VDMFVTTA+ ELEPPI+TVNTVLSLLA+
Sbjct  67    LIVNCKWTPLTYKTYPQRLQERIQ----ELPPVDMFVTTADAELEPPIITVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP +KLACYVSDD+ SP+ FY+LVEASKFAKLWVPFCKKYNV +RAPFRYF        
Sbjct  123   DYPVHKLACYVSDDACSPLNFYSLVEASKFAKLWVPFCKKYNVQIRAPFRYFPDSEPSDS  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
              S  E  ++WK M  EY  L   IE+A ++ SLF+       F++ +  +H TI+KVI E
Sbjct  183   SSG-ELLQDWKNMKKEYDKLSQNIEHAAKRSSLFDLTGGMTVFSNTERMNHPTIVKVISE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L+  +PHL+YISREKRPKH H++KAGAMNVLTRVSG+MTNAPFMLNVDCD Y NNP
Sbjct  242   NKGGLSDEIPHLVYISREKRPKHPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMYANNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             E+VL AMC  LG+K+E +  F+Q PQ FYD  ++    ++Y      +G+G   IQG FY
Sbjct  302   EIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPENLCILNEY------IGKGIVGIQGPFY  355

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GTG FHRR V+YGL  +       + + +L K +G SK F+ SA  TL G     +  +
Sbjct  356   QGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSKEFIKSAAQTLEGKTGGYSSNI  415

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
              S SL+ A +VA+CGYE+G++WG  +G  YG+  ED LTG+ I   GW++G+C+P    F
Sbjct  416   -SRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAF  474

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
             LGC   +G   + Q KRWA+G  EILFS + PI A L G LQFRQCLAY+  + W +R I
Sbjct  475   LGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSI  534

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
              ELCY  LP YC+ITNS FLPK  E  ++IP ++F+IY LYTL EY++   SIR+WW N 
Sbjct  535   PELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNN  594

Query  2186  RM  2191
              M
Sbjct  595   CM  596



>ref|XP_007049096.1| Cellulose synthase-like B4, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOX93253.1| Cellulose synthase-like B4, putative isoform 2, partial [Theobroma 
cacao]
Length=740

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/603 (52%), Positives = 407/603 (67%), Gaps = 12/603 (2%)
 Frame = +2

Query  395   FPLYE-TKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIW  571
              PLYE    +   + R ++V +  LLLSL+AYR+ +L + G+  TWLLA +CESWF F+W
Sbjct  26    LPLYERVSCKGIMIRRTLDVTVFCLLLSLLAYRLRSLSNQGF--TWLLAFLCESWFAFLW  83

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             +L +ST+WN VE  TYPE  L      S E P +DMFVTTA+P LEPP++TVNTVLSLLA
Sbjct  84    LLNLSTRWNPVEYKTYPENLLL----RSLELPPIDMFVTTADPVLEPPLVTVNTVLSLLA  139

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP  931
             ++YPA KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKY++ +RAPF+YF+A    P
Sbjct  140   VDYPAEKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYSIQIRAPFQYFSAKSLPP  199

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSL---FNKFATFADLDPNDHSTIIKVIC  1102
              +    F  EWKKM DEY +LC KIE A  K +L     ++A F +++ ++H +I+KVI 
Sbjct  200   VDGLSGFELEWKKMKDEYEHLCRKIEDAVHKLTLGPHSTEYAVFKNIERDNHPSIVKVIF  259

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E  +  +PHL+Y+SREKRP H H+FKAGAMNVLTRVSGVMTNAPFMLNVDCD + +N
Sbjct  260   ENKEDHSSCLPHLVYVSREKRPNHPHHFKAGAMNVLTRVSGVMTNAPFMLNVDCDMFASN  319

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+++LHA+C L+G  DE++  FVQ PQ FYD LKDDP+ ++  + +     G A IQG  
Sbjct  320   PKIILHAVCLLVGVDDEQECAFVQCPQIFYDALKDDPFGNRMTVPFTIFVGGMAGIQGPP  379

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGCFHRRK IYGL PN     +      L++ +GKS  F  S    L GS       
Sbjct  380   YAGTGCFHRRKAIYGLPPNHDFDIKDC--KILEERFGKSTEFSESVAEILFGSGEKHFPC  437

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              +S    +A +VANC YE  T WG  +G  YGSVTED+LTG+ I  MGWK+   +P  P 
Sbjct  438   DISSITGSACRVANCSYENNTCWGIEVGLTYGSVTEDVLTGLRIHTMGWKSVLLMPSPPA  497

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+GC P  G  S+ QMKRW +G  E+LFS   PI +A    L FRQ LAY+  ++W  R 
Sbjct  498   FMGCAPPGGPVSMTQMKRWGTGLLEVLFSKHSPILSAFSTKLHFRQALAYLQIVMWASRS  557

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             I + CY  L  YC+ T+S FLPK +E    IP S  +I NL++L +Y++  ESI+AWWN+
Sbjct  558   IPQFCYNMLSAYCITTDSQFLPKVHEPFFYIPVSFSLISNLHSLSQYLQYGESIQAWWNH  617

Query  2183  QRM  2191
             QRM
Sbjct  618   QRM  620



>ref|XP_003539496.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=746

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/604 (53%), Positives = 410/604 (68%), Gaps = 13/604 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE       + R ++ +IL LLL L+ YRV  L S+ + + W LAL+CESWFTF W+
Sbjct  8     LPLYEKVWLKRRLQRVIDTLILFLLLLLLNYRV--LSSNSFTFPWFLALLCESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++++KW+   T T+P+R L+WV     E P VD+ VTTANP LEPPI+TVNTVLSLLAL
Sbjct  66    VILNSKWSPAVTITHPDRLLQWVS----ELPPVDLLVTTANPILEPPIITVNTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEASKFAK WVPFCKKYNV VRAPFRYF+   T   
Sbjct  122   DYPANKLACYVSDDGCSPLTFYALVEASKFAKFWVPFCKKYNVQVRAPFRYFSDVATNKS  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW +M D Y NL  KIE  T K   F    +FA F++ D  +H +IIKVI E
Sbjct  182   EESLEFKQEWLQMKDMYENLSRKIEEVTCKTISFQLDGEFAVFSNTDQRNHPSIIKVIIE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + +  G+PHLIY SREKRP++ HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNNP
Sbjct  242   NKDGIFDGLPHLIYASREKRPQYHHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V HA+C L+ ++  ++  FVQ  Q FYDG+KDDP+ +Q+ I +  + RG A +QG FY
Sbjct  302   KIVQHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPFGNQWVIAFEYIIRGMAGLQGPFY  361

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++  +    KL +  L + +G SK F+ SA   L G+  S   
Sbjct  362   GGTNTFHRRNAIYGLYPHEIESGRKGKLEEKILIRQFGSSKEFIKSAAHALGGNAYSAND  421

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                S  +EAA+QVANC YE  T WG  +GW YGS++ED+ TG+ IQR GW++  C P+  
Sbjct  422   ITPSNFIEAATQVANCEYEDDTFWGKQMGWLYGSISEDVPTGLNIQRRGWRSECCTPDPI  481

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRWASG T + F    P+   LFG +QFR  L+Y     W +R
Sbjct  482   AFTGCAPGGLLTTMVQQKRWASGLTVVFFGKHSPLMGMLFGKIQFRAGLSYFWLTNWGLR  541

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
               F +CY  L  YC+ITN++  PKG  + + IP ++F+IYN +TL EY+    S+R WWN
Sbjct  542   AFFLVCYVALLEYCIITNTNIFPKG--LGLWIPIALFVIYNAHTLLEYLTIGLSMRHWWN  599

Query  2180  NQRM  2191
             NQRM
Sbjct  600   NQRM  603



>ref|XP_006582367.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Glycine max]
Length=754

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/607 (53%), Positives = 413/607 (68%), Gaps = 16/607 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             P YE     +   R  + ++L+LLLSL+ YRV +++++  +  W +A +CESWFTF W L
Sbjct  8     PFYEKYWYKHNYKRVTDSLLLILLLSLLGYRVISINNYSLF-PWFVAFLCESWFTFSWFL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              ++T+W+   T TYP R L+ VE    E P VD+FVTTA+PELEPPI+TVNTVLSLLAL+
Sbjct  67    TLTTQWSPAVTKTYPHRLLQSVE----ELPPVDLFVTTADPELEPPIITVNTVLSLLALD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFN--ADHTFP  931
             YP +KLACYVSDD  SP TFYAL EAS+FAK WVPFCKKY+V VRAPFRYF+   +  F 
Sbjct  123   YPPHKLACYVSDDGCSPRTFYALQEASQFAKFWVPFCKKYHVQVRAPFRYFSDKPEEVFG  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPS--LFNKFATFADLDPNDHSTIIKVICE  1105
               ++PEF++EW +M D Y NL  KIE  +   S      FA F++ +  +H +II+VI E
Sbjct  183   ANNTPEFKQEWLQMKDMYDNLSSKIELDSSIISNPCNGDFAVFSNTERTNHPSIIQVIWE  242

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E +A G+PHLIYISREKRPK  H++KAGAMNVLTRVSG++TNAPFMLNVDCD  VNNP
Sbjct  243   NKEHIADGLPHLIYISREKRPKQPHHYKAGAMNVLTRVSGLITNAPFMLNVDCDMIVNNP  302

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V HA+  LL  K E++  FVQFPQ FY  LKDDP+ +Q  I+   L  G   +QG FY
Sbjct  303   KIVHHALSILLDHKGEKEVAFVQFPQKFYATLKDDPFGNQMTILAKYLAAGIGGLQGPFY  362

Query  1466  DGTGCFHRRKVIYGLSP----NDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslsse  1633
              GT CFHRRKVIYGLSP     D  +   +++ +L++ +G SK  + S   TL G   S 
Sbjct  363   GGTNCFHRRKVIYGLSPENIEKDKFSGNSISEEELKQKFGTSKEIMKSVACTLEGRTYSY  422

Query  1634  tFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
                 +S  ++ ASQVA C YE+GT WG  + W YGSVTED+LTG+ I + GW++ FC+P 
Sbjct  423   NDINISNVVDVASQVAGCAYEYGTGWGKQMAWIYGSVTEDVLTGLTIHKKGWRSEFCMPS  482

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM-ISILW  1990
               GF G  P  G  S+ Q KRWA+G  E+ F   CPI + LF  L  RQCLAYM I   W
Sbjct  483   PIGFTGFAPGGGPNSMAQQKRWATGLLEMFFCKHCPIISTLFHKLTLRQCLAYMWIINHW  542

Query  1991  PVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRA  2170
              +  +FE+CYA L  YC+ITNS+FLP+  ++ I IPA+  +IY +YT  EY+ E  SIRA
Sbjct  543   GLMSVFEVCYACLLAYCIITNSNFLPQ--DLGICIPAAFLVIYKIYTASEYLAEGLSIRA  600

Query  2171  WWNNQRM  2191
             WWNNQRM
Sbjct  601   WWNNQRM  607



>gb|KEH29713.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=743

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/601 (53%), Positives = 411/601 (68%), Gaps = 11/601 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +   R ++ +IL+LLL L+ YRV  ++ + Y   W +AL+CE+WFT  W+
Sbjct  7     LPLYEKYWYKHNYKRVLDSLILILLLLLLGYRV--MYVNNYSIPWFIALICETWFTLSWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +ST+W+     T P+R L+ V+    E PAVD+FVTTA+ ELEP I+T+NTVLSLLAL
Sbjct  65    FTISTQWSPAFIKTNPDRLLQSVQ----ELPAVDLFVTTADDELEPAIITINTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP++KLACYVSDD  SP+ FYAL +ASKFAK WVPFCKKYNV +RAPFRYF  D+    
Sbjct  121   DYPSHKLACYVSDDGCSPLIFYALHKASKFAKHWVPFCKKYNVQIRAPFRYFCDDNDCT-  179

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK-PSLFNK-FATFADLDPNDHSTIIKVICEN  1108
              +  EFR+EW +M D Y NL  KI+   +  PSL  + FA F++ +  +H  IIKVI EN
Sbjct  180   TNDEEFRQEWLQMKDLYENLSHKIDVDPKSIPSLLEEEFAVFSNTNRTNHPAIIKVIWEN  239

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E    G+PHLIYISREKRPK  H+FKAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP 
Sbjct  240   KEMAEDGLPHLIYISREKRPKQPHHFKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNPN  299

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             +V+HA+C LL +K E++  F Q PQ FY  LKDDP+ +Q  I+Y  LG G A +QG FY 
Sbjct  300   IVMHALCILLDSKGEKEVAFAQCPQQFYATLKDDPFGNQMAILYKYLGAGLAGLQGIFYG  359

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             GT CFHRRKVIYGLSP+D      L++ +L++ +G SK  + S    L     S +   +
Sbjct  360   GTNCFHRRKVIYGLSPDDVEKGNNLSEVELKQKFGTSKELMKSVGHALEDRTYSASDISV  419

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
             + ++E A  VA+ GYE+GT WG  +GW YG++TEDILTG+ I + GW++  C P+   F 
Sbjct  420   NKAVEEAIHVASYGYEYGTGWGKQVGWMYGTMTEDILTGLTIHKKGWRSELCTPDPIAFT  479

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GC P  G   + Q KRWA+G  EI FS  CP+F A+F  L FRQ LAYM  + W   P+ 
Sbjct  480   GCAPIDGPTCMAQHKRWATGMLEIFFSKHCPVFGAIFDKLSFRQFLAYMWIMNWGFSPVA  539

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
             ++CYA L  YC+ITNS+FLPK  +  + IP +IF IY +YTL+EY+    SI+AWWNNQR
Sbjct  540   QVCYACLVAYCIITNSYFLPK--DWGMYIPTAIFGIYKVYTLYEYLASGLSIKAWWNNQR  597

Query  2189  M  2191
             M
Sbjct  598   M  598



>ref|XP_008781463.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Phoenix 
dactylifera]
Length=744

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/568 (54%), Positives = 396/568 (70%), Gaps = 11/568 (2%)
 Frame = +2

Query  503   HSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMF  682
             HSHG    WL+A +CESWFTFIWVL ++ KWN V+  TYPER L+     S + PAVDMF
Sbjct  43    HSHGS--IWLIAFLCESWFTFIWVLFMNAKWNPVKYKTYPERLLK----RSDDLPAVDMF  96

Query  683   VTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVP  862
             VTTA+P+LEPPI+T NTVLSLLA+EYPA+KLACYVSDD  SP+TFY+LVEASKFAKLWVP
Sbjct  97    VTTADPKLEPPIITANTVLSLLAVEYPAHKLACYVSDDGGSPITFYSLVEASKFAKLWVP  156

Query  863   FCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQ---KPSL  1033
             FCKKYNV VRAPF YF+++       S EF   W+ M ++Y  L  +I+ A +      +
Sbjct  157   FCKKYNVRVRAPFVYFSSEPQASQTLSQEFMDTWRYMKNKYEELSQRIDDAAKDYISHRM  216

Query  1034  FNKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLT  1213
              ++ A F++++  +H ++IKVI EN E L  G+PHL+Y++REKRPK  H++KAGAMNVL 
Sbjct  217   DDELADFSNIERGNHPSLIKVIWENKEGLEGGIPHLVYVAREKRPKLPHHYKAGAMNVLA  276

Query  1214  RVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDP  1393
             RVSGVMTNAPFMLNVDCD + NNPEV+LH MC LLG  +E  +GFVQ PQ FY  LKDDP
Sbjct  277   RVSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSSGFVQAPQQFYGALKDDP  336

Query  1394  YASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGL-SPNDTVTAEKLTDHDLQKIY  1570
             + +Q  ++      G   +QG FY GTGCFHRRK+I     P      ++L+ ++LQ+IY
Sbjct  337   FGNQLVVLQEITVGGTGGLQGPFYGGTGCFHRRKIICSTPRPAGVSKHDELSYNELQRIY  396

Query  1571  GKSKIFVtsatttlsgslsset-FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVT  1747
             G S+  + SA+   SG     +    LS S+EAA +VA+C YEF T WG+ IGW YGS+ 
Sbjct  397   GDSRELIESASQITSGKFREISCVDDLSSSVEAAKRVASCTYEFNTCWGNKIGWAYGSMA  456

Query  1748  EDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIF  1927
             ED+LTG+ I  MGWK+     + P FLG   + G  SL Q KRW++G  EIL + + PI 
Sbjct  457   EDVLTGLRIHSMGWKSVCLKLDPPAFLGSAATGGPASLTQNKRWSTGLLEILLTRRSPIL  516

Query  1928  AALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASI  2107
             A     L+FR CLAY++ I+W +R + ELCYA LP YCLI N+ F+PK +E   VIP ++
Sbjct  517   ATFTKQLEFRMCLAYLLVIVWALRSMGELCYALLPAYCLIANTSFMPKASEPVFVIPLAL  576

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             F+I N+++L EY++   S+RA+WNNQRM
Sbjct  577   FLICNMHSLMEYVQCGLSVRAYWNNQRM  604



>ref|XP_004487427.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Cicer arietinum]
Length=743

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/608 (52%), Positives = 403/608 (66%), Gaps = 17/608 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++ + LLLL  L+ YR+ + ++H + Y   +A +CESWFT  W+
Sbjct  7     LPLYEKIWAKHTFSRIMDSLTLLLLFLLLGYRISSHNNHTFPY--FVAFLCESWFTITWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V     + P +D+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    TTMSTKWTPSHTKTFLDRLLLRVSES--KLPPLDIFVTTADPALEPPIITVNTVLSLLAL  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEA+KFAKLWVPFCKKYNV  RAPFRYF  D     
Sbjct  123   DYPANKLACYVSDDGCSPLTFYALVEATKFAKLWVPFCKKYNVQCRAPFRYF-CDEEMAN  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                PEF++EW K+ +EY  L GKIE A Q      L  +F  F+   P +HSTIIKVI E
Sbjct  182   HDLPEFKQEWFKIKEEYEQLSGKIENAAQNSIPCELVGEFDIFSQTKPRNHSTIIKVIRE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L+  VPH+IYISREKRPKH H+ KAGAMNVLTR+SG+MTNAPF+LNVDCD YVNN 
Sbjct  242   NKGGLSNVVPHIIYISREKRPKHPHHHKAGAMNVLTRISGLMTNAPFILNVDCDMYVNNS  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++ LHA+C LL +K E++  F Q PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  302   KIALHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQLVALPMYIGSGFAGLQGIIY  361

Query  1466  DGTGCFHRRKVIYGLSP-NDTVTAEK-----LTDHDLQKIYGKSKIFVtsatttlsgsls  1627
              GT CFHRRKVIYG+SP +D   A K       D +  + +G SK FV S T  L G   
Sbjct  362   AGTNCFHRRKVIYGVSPHHDIQNANKDHHGLANDKETMQKFGTSKGFVESVTHVLEGMTL  421

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                    S  ++AA +VA+C YE+ T WG  +GW YGS +ED+LTG+     GW++  C 
Sbjct  422   DFY---KSLDVKAARKVASCDYEYNTAWGKQVGWLYGSTSEDVLTGLKFHTKGWRSELCS  478

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
              +   F+GC+P   LG + Q KRW++G  +I  S  CPIF  LFG LQ R+CLAY+    
Sbjct  479   TDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSKHCPIFGTLFGKLQLRECLAYIWITN  538

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R + E+CYA LP YC+ITNS+FLP   E ++ IP ++F+IYN+  L+E+++   SIR
Sbjct  539   WALRSVPEICYALLPAYCIITNSNFLPNQQESSMWIPTTLFVIYNISNLFEHIKSGLSIR  598

Query  2168  AWWNNQRM  2191
              WWNNQRM
Sbjct  599   TWWNNQRM  606



>ref|XP_004151897.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
 gb|KGN63234.1| hypothetical protein Csa_2G416240 [Cucumis sativus]
Length=743

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/622 (51%), Positives = 405/622 (65%), Gaps = 41/622 (7%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE      +  R +++ I +LL+SL  YRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPLYEKTNIKRSTQRVLDITIFILLVSLDGYRVLLIYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +  KWN V   TYP+R L+       E PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIIIKWNPVHYETYPQRLLK----REVELPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP+NKL CYVSDD  S +T YAL EA KF K+WVPFCKKY + VRAPFRYF++    PP
Sbjct  121   DYPSNKLGCYVSDDGCSSLTLYALKEALKFGKIWVPFCKKYEIQVRAPFRYFSS----PP  176

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKF-----------ATFADLDPND  1075
                +S EFR +W+ +  EY  L   I+ A +     NKF           A F +L   +
Sbjct  177   HLHTSAEFRNDWQMVKVEYEKLEANIKEAEE-----NKFGLEEEVDGMDMADFCNLHTKN  231

Query  1076  HSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLN  1255
             H TIIK++ EN + L   +PHLIY+SREK  KH H +KAGAMNVLTRVSGV+TNAP++LN
Sbjct  232   HPTIIKMLWENKDDLD-ELPHLIYVSREKSFKHHHYYKAGAMNVLTRVSGVLTNAPYILN  290

Query  1256  VDCDFYVNNPEVVLHAMCFLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLG  1432
             VDCD ++NNP+VVLHAMC    ++D+  D G+VQ P  FYDGLKDDPY +Q  I+Y    
Sbjct  291   VDCDMFMNNPQVVLHAMCVFFNSEDDFEDIGYVQTPPCFYDGLKDDPYGNQLVIVYEYFT  350

Query  1433  RGNAAIQGSFYDGTGCFHRRKVIYGLSPN---DTVTAEKLTDHDLQKIYGKSKIFVtsat  1603
             RG   +QG  Y G+GCFHRRKV+YG  P+   ++V   K ++ ++ K +G SK F  SA 
Sbjct  351   RGIMGLQGPIYSGSGCFHRRKVLYGQFPHYTTNSVDGRKASEQEIIKSFGYSKAFAKSAI  410

Query  1604  ttlsgslssetFGVL------SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTG  1765
                  +     FG L      + +LEAA QVA CGYE GTTWG  IGW YGS  EDILT 
Sbjct  411   YAFEETT----FGYLPEGLFNNNNLEAAIQVAGCGYEIGTTWGSKIGWMYGSTCEDILTS  466

Query  1766  IGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGN  1945
             + I R GW++ +     P FLGC PS  + SL Q KRW +G  EILFS  CPIF  LF N
Sbjct  467   LVIHRKGWRSIYIALNPPAFLGCAPSQLVTSLTQQKRWVTGLLEILFSKHCPIFGTLFEN  526

Query  1946  LQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNL  2125
             LQ++QC AY+  + W +R I EL YA LPPYCLITN+ F P   E AI IP S+FI+YN 
Sbjct  527   LQWKQCAAYLWILTWGIRSILELSYALLPPYCLITNTSFFPTMEERAIFIPISLFIVYNF  586

Query  2126  YTLWEYMEEKESIRAWWNNQRM  2191
               L +Y E  +S+RAWWNNQRM
Sbjct  587   QQLLQYKETGQSVRAWWNNQRM  608



>ref|XP_008342030.1| PREDICTED: cellulose synthase-like protein H1 [Malus domestica]
Length=746

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/598 (54%), Positives = 402/598 (67%), Gaps = 18/598 (3%)
 Frame = +2

Query  407   ETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVS  586
             +T ++ NA+ + +E+ IL   + ++ YR+ +L  HG+   WLLA  CESWF F WVL + 
Sbjct  11    KTPLKINALQKTLEIAILFFFICVLXYRLLSLRDHGF--VWLLAFTCESWFAFNWVLTLI  68

Query  587   TKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPA  766
             T+W  VE  TYP   L+ V     E P VDMFVTTA+ +LEPPI+TVNTVLSLLA++YP 
Sbjct  69    TQWTPVEYKTYPHNLLQQVS----ELPPVDMFVTTADAKLEPPIITVNTVLSLLAVDYPT  124

Query  767   NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSP  946
             +KLACYVSDD  SP+  Y+LVEASKFAKLWVPFCKKY+V VRAPFRYF+ +      S  
Sbjct  125   HKLACYVSDDGCSPLXLYSLVEASKFAKLWVPFCKKYHVQVRAPFRYFSDNPILSSYSPS  184

Query  947   EFRREWKKMNDEYANLCGKIEYATQK--PSLFNK-FATFADLDPNDHSTIIKVICENDES  1117
              F +EW KM DEY  LC KIE A Q   P  F++    FA +D  +H TIIKVI E  E 
Sbjct  185   GFLQEWTKMKDEYEKLCQKIEDAVQNLAPLDFSRDNVDFAHIDSRNHPTIIKVIWETKER  244

Query  1118  LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
             ++ G+PHL+Y++REKRP H H++KAGAMN LTRVSGVMTNAPFMLNVDCD Y NNP++VL
Sbjct  245   ISNGLPHLVYVAREKRPNHSHHYKAGAMNALTRVSGVMTNAPFMLNVDCDMYANNPKIVL  304

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTG  1477
             HAMC LLG K E+   FVQFPQ FY+ LKDDP  S+       +  G A IQG FY GTG
Sbjct  305   HAMCLLLGFKQEKG-AFVQFPQMFYNILKDDPCESKVVEAVKKIWPGLAGIQGPFYAGTG  363

Query  1478  CFHRRKVIYGLSPNDT---VTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             CFHRRKV YG S  D    +T+E+L     +  +G S   + SAT  L      +    L
Sbjct  364   CFHRRKVFYGSSLTDNEGNLTSERLN----KGCFGNSPELIRSATQILLEENIDQP-DBL  418

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
             S +++AA  VA+  +E  T WG  +GW YGSVTED+LTG+ I   GWK+  C+PE PGFL
Sbjct  419   SCAVBAAYHVAHSEFEHDTLWGKKVGWVYGSVTEDVLTGMKIHARGWKSILCMPEPPGFL  478

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             G  PST    L Q KR  +G  EILFS  CPIFA L+  L+FRQCLAY+  ++W +  I 
Sbjct  479   GAAPSTTHVMLIQRKRGITGLLEILFSKNCPIFATLYAKLEFRQCLAYLWILIWGLHSIP  538

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             +LCYA LP YCLITNSHFLPK  E A++I A++F+I +L TL   ++   SIRAWWN 
Sbjct  539   DLCYALLPAYCLITNSHFLPKVQEPALIIFAAVFLIKHLNTLHSNLDSGRSIRAWWNQ  596



>ref|XP_006469655.1| PREDICTED: cellulose synthase-like protein B4-like isoform X1 
[Citrus sinensis]
Length=732

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/602 (53%), Positives = 407/602 (68%), Gaps = 17/602 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     N   RA++V+IL LLL L+ YR+  L +HG+   W LA +CES FTFIW+
Sbjct  9     LPLYEKVFHKNTYHRALDVIILFLLLCLLFYRLSTLKNHGF--AWFLAFLCESCFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+V+ KW  +   TYP+R  E ++    E P VDMFVTTA+ ELEPPI+TVNTVLSLLA+
Sbjct  67    LIVNCKWTPLTYKTYPQRLQERIQ----ELPPVDMFVTTADAELEPPIITVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP +KLACYVSDD+ SP+ FY+LVEASKFAKLWVPFCKKYNV +RAPFRYF        
Sbjct  123   DYPVHKLACYVSDDACSPLNFYSLVEASKFAKLWVPFCKKYNVQIRAPFRYFPDSEPSDS  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
              S  E  ++WK M  EY  L   IE+A ++ SLF+       F++ +  +H TI+KVI E
Sbjct  183   SSG-ELLQDWKNMKKEYDKLSQNIEHAAKRSSLFDLTGGMTVFSNTERMNHPTIVKVISE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L+  +PHL+YISREKRPKH H++KAGAMNVLTRVSG+MTNAPFMLNVDCD Y NNP
Sbjct  242   NKGGLSDEIPHLVYISREKRPKHPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMYANNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             E+VL AMC  LG+K+E +  F+Q PQ FYD  ++    ++Y      +G+G   IQG FY
Sbjct  302   EIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPENLCILNEY------IGKGIVGIQGPFY  355

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GTG FHRR V+YGL  +       + + +L K +G SK F+ SA  TL G     +  +
Sbjct  356   QGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSKEFIKSAAQTLEGKTGGYSSNI  415

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
              S SL+ A +VA+CGYE+G++WG  +G  YG+  ED LTG+ I   GW++G+C+P    F
Sbjct  416   -SRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAF  474

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
             LGC   +G   + Q KRWA+G  EILFS + PI A L G LQFRQCLAY+  + W +R I
Sbjct  475   LGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSI  534

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
              ELCY  LP YC+ITNS FLPK  E  ++IP ++F+IY LYTL EY++   SIR+WW N 
Sbjct  535   PELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNN  594

Query  2186  RM  2191
              M
Sbjct  595   CM  596



>ref|XP_008455914.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Cucumis 
melo]
Length=744

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/601 (52%), Positives = 396/601 (66%), Gaps = 11/601 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE       + R +++ I  LL+SL+ YR   L SH + Y   +A +CE WFTF W+L
Sbjct  8     PLYEKIEVKRPIQRLLDLTIFFLLISLLLYRFLILRSHAFTYLHTIAFLCELWFTFTWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             V++  WN +  TTYP+R L+ V+    E P VD+FVTTA+P LEPP++TVNTVLSLLA +
Sbjct  68    VINVTWNPIHYTTYPQRLLKRVD----ELPPVDVFVTTADPLLEPPLITVNTVLSLLAAD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPAN+LA YVSDD  SP+TFY+L+EA KFAK+WVPFCKKY V VRAPFRYF+ D +F  +
Sbjct  124   YPANRLAVYVSDDGCSPITFYSLIEALKFAKIWVPFCKKYEVEVRAPFRYFSGDLSF--D  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQ---KPSLFNKFATFADLDPNDHSTIIKVICEN  1108
              + EF+ EW +M DEY  L   IE A +    P L +  A F++++ N+H  IIKVI EN
Sbjct  182   GTEEFQCEWSRMKDEYEKLRRNIEEAAKNVVSPDLTSDLADFSNIESNNHPPIIKVIWEN  241

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E L  G+PHL+Y+SREKRP+H H++KAGAMNVL RVSG+MTNAP++LNVDCD YVNNP 
Sbjct  242   KEGLRDGLPHLVYVSREKRPQHSHHYKAGAMNVLARVSGLMTNAPYILNVDCDMYVNNPS  301

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             V+L  MC  L    +++  FVQFPQ FY+G KDDPY +Q+ ++     RG A IQG  Y 
Sbjct  302   VLLQGMCLFLDPTIDKEYAFVQFPQRFYNGPKDDPYGNQWIVMMEFTFRGMAGIQGPGYM  361

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             GTGC HRRKV+YG SP+      K  D +L K +G SK FV SA   L           L
Sbjct  362   GTGCIHRRKVLYGQSPDGANIFGKHYDDELHKTFGNSKDFVNSAAHALRSLTDYP--NSL  419

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
             S S+ +  +VA   YE  + WG   GW YGS+ ED+LTG  I + GWK+ +  P  P FL
Sbjct  420   SNSIISLKEVATSDYEINSCWGTKFGWLYGSLLEDVLTGSEIHKKGWKSAYLTPTPPAFL  479

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GC PS G   LN  KR  +G  EI FS KCP+F +LFG LQFRQ +  +   LW +R I 
Sbjct  480   GCAPSGGPIPLNHQKRAMTGLLEIFFSKKCPVFNSLFGKLQFRQRMVSVWISLWGIRSIP  539

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
             E+CYA LP +CLI NSHFLPK  E    IP  +F+ YNL  L +Y E  +S RAWWNN+R
Sbjct  540   EICYATLPAFCLIANSHFLPKVQEPVGCIPLLLFVFYNLQQLLQYWETGQSARAWWNNER  599

Query  2189  M  2191
             M
Sbjct  600   M  600



>ref|XP_004487429.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Cicer arietinum]
Length=747

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/613 (52%), Positives = 405/613 (66%), Gaps = 23/613 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++ + LLLL  L+ YR+ + ++H + Y   +A +CESWFT  W+
Sbjct  7     LPLYEKIWAKHTFSRIMDSLTLLLLFLLLGYRISSHNNHTFPY--FVAFLCESWFTITWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V     + P +D+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    TTMSTKWTPSHTKTFLDRLLLRVSES--KLPPLDIFVTTADPALEPPIITVNTVLSLLAL  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEA+KFAKLWVPFCKKYNV  RAPFRYF  D     
Sbjct  123   DYPANKLACYVSDDGCSPLTFYALVEATKFAKLWVPFCKKYNVQCRAPFRYF-CDEEMAN  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                PEF++EW K+ +EY  L GKIE A Q      L  +F  F+   P +HSTIIKVI E
Sbjct  182   HDLPEFKQEWFKIKEEYEQLSGKIENAAQNSIPCELVGEFDIFSQTKPRNHSTIIKVIRE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L+  VPH+IYISREKRPKH H+ KAGAMNVLTR+SG+MTNAPF+LNVDCD YVNN 
Sbjct  242   NKGGLSNVVPHIIYISREKRPKHPHHHKAGAMNVLTRISGLMTNAPFILNVDCDMYVNNS  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++ LHA+C LL +K E++  F Q PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  302   KIALHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQLVALPMYIGSGFAGLQGIIY  361

Query  1466  DGTGCFHRRKVIYGLSP-NDTVTAEK----------LTDHDLQKIYGKSKIFVtsatttl  1612
              GT CFHRRKVIYG+SP +D   A K          L+D +  + +G SK FV S T  L
Sbjct  362   AGTNCFHRRKVIYGVSPHHDIQNANKDHHGLANGILLSDKETMQKFGTSKGFVESVTHVL  421

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
              G          S  ++AA +VA+C YE+ T WG  +GW YGS +ED+LTG+     GW+
Sbjct  422   EGMTLDFY---KSLDVKAARKVASCDYEYNTAWGKQVGWLYGSTSEDVLTGLKFHTKGWR  478

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             +  C  +   F+GC+P   LG + Q KRW++G  +I  S  CPIF  LFG LQ R+CLAY
Sbjct  479   SELCSTDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSKHCPIFGTLFGKLQLRECLAY  538

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +    W +R + E+CYA LP YC+ITNS+FLP   E ++ IP ++F+IYN+  L+E+++ 
Sbjct  539   IWITNWALRSVPEICYALLPAYCIITNSNFLPN-QESSMWIPTTLFVIYNISNLFEHIKS  597

Query  2153  KESIRAWWNNQRM  2191
               SIR WWNNQRM
Sbjct  598   GLSIRTWWNNQRM  610



>ref|XP_003596942.1| Cellulose synthase-like protein H1 [Medicago truncatula]
 gb|AES67193.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=755

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/612 (52%), Positives = 410/612 (67%), Gaps = 22/612 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++   LLLL  L+AYRV + ++H +  +  +A +CESWFT  W+
Sbjct  9     LPLYEKIWVKHTFSRVMDSFTLLLLFLLLAYRVSSYNNHNF--SCFVAFLCESWFTITWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V +   E PA+DMFVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  67    TTMSTKWTPAHTKTFLDRLLLRVSDS--ELPALDMFVTTADPVLEPPIITVNTVLSLLAL  124

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S +TFYALVEA+KFA++WVPFCKKYNV  RAPFRYF  +     
Sbjct  125   DYPANKLACYVSDDGCSTLTFYALVEAAKFAEIWVPFCKKYNVQCRAPFRYFCDEAMANN  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                P+F+ +W KM +EY  L  KIE A QK     L  +FA F+     +H TII+VI E
Sbjct  185   NDLPQFKHDWLKMKEEYEQLSSKIENAAQKSIPCQLMGEFAVFSQTQARNHPTIIRVIRE  244

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + ++  +PH+IYISREKRPK  H+ KAGAMNVLTRVSG+MTNAPFMLN+DCD YVNN 
Sbjct  245   N-KGISDVMPHIIYISREKRPKQPHHHKAGAMNVLTRVSGLMTNAPFMLNLDCDMYVNNS  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C LL +K E++  F Q PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  304   KIVLHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQLVALPMYIGSGFAGLQGIIY  363

Query  1466  DGTGCFHRRKVIYGLS-PNDTVTAEK---------LTDHDLQKIYGKSKIFVtsatttls  1615
              GT CFHRRKV+YGLS PN+   A+K         L++ +  + +G SK FV SAT  L 
Sbjct  364   AGTNCFHRRKVMYGLSPPNEIQNAKKGQGFTNGTFLSEKETMQKFGTSKGFVESATHILE  423

Query  1616  gslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             G  S       S  LEAAS+VA+C YE+ T WG  +GW YGS +ED+LTG+     GW++
Sbjct  424   GITSDLH---KSLDLEAASKVASCDYEYNTAWGKQVGWLYGSTSEDVLTGLKFHTKGWRS  480

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
               C P+   F+GC+P   LG + Q KRW++G  +I  S  CPIF  LFG LQFR+CL+Y+
Sbjct  481   ELCSPDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSKHCPIFGTLFGKLQFRECLSYI  540

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
                 W +R I E+CYA LP YC+ITNS FLP   E+++ IP ++F+IYN+  L E+++  
Sbjct  541   WITNWALRSIPEICYALLPAYCIITNSSFLPN-KELSMWIPTTLFVIYNVSNLIEHVKSG  599

Query  2156  ESIRAWWNNQRM  2191
              SIR WWNNQRM
Sbjct  600   LSIRTWWNNQRM  611



>gb|KHN44862.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=748

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/605 (52%), Positives = 406/605 (67%), Gaps = 14/605 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              P YE         R ++  IL+LLL L++YR+++  S+ + + W LA +CESWFTF W+
Sbjct  8     LPFYEKIWFKRTFQRVMDTFILVLLLLLLSYRIFS--SNNFTFPWFLAFLCESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++ KW+   T T+P+R L+ V     E P VD+FVTTA+P LEPPI+T NTVLSLLAL
Sbjct  66    VILNAKWSPAVTITHPDRLLQRVP----ELPRVDLFVTTADPVLEPPIITANTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP TFYALVEASKFAKLW+PFCKKYNV VRAPFRYF+   T   
Sbjct  122   DYPANKLACYVSDDGCSPFTFYALVEASKFAKLWIPFCKKYNVQVRAPFRYFSNVATTKS  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
             + SP+F++EW +M D Y NL   IE  T+K     L  +FA F++ +  +H +IIKVI E
Sbjct  182   DDSPDFKQEWSQMKDMYDNLRQNIEDVTRKQIPLELDGEFAVFSNTEQINHPSIIKVILE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + L+ G+P+LIYISREK+P H HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  242   NKDVLSDGLPYLIYISREKKPNHSHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             + VLHAMC L+ +K  ++  FVQ  Q FYDG+KDDP+ +Q+   Y  + RG A +QG +Y
Sbjct  302   KFVLHAMCILMDSKSGKEVAFVQCFQQFYDGIKDDPFGNQWVAAYEYIIRGMAGLQGPYY  361

Query  1466  DGTGCFHRRKVIYGLSPNDTVTA---EKLTDHDLQKIYGKSKIFVtsatttlsgslsset  1636
              GT  FHRR  IYGL P++       EKL +  L + +G+SK FV SA   L G      
Sbjct  362   GGTNTFHRRNAIYGLYPHEMENGREDEKLGEKILIQQFGRSKEFVKSAAVALDGKAYLPK  421

Query  1637  FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPER  1816
                 S  +EAA QVA CGYE GT WG  IGW YGS++ED+ TG+ I R GW++  C P+ 
Sbjct  422   DISPSNFIEAAIQVARCGYECGTFWGKKIGWLYGSISEDVPTGLNIHRRGWRSECCTPDP  481

Query  1817  PGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPV  1996
               F GC P   + ++ Q KRWASG T + F    P+   LFG +QFR  L+Y     W  
Sbjct  482   IPFTGCAPRGFISTMVQQKRWASGLTVVFFGKHSPVMGMLFGKIQFRAGLSYFWLTNWGS  541

Query  1997  RPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
             R  F++CYA LP YC+ITN++  PKG    + IP ++ +IYNL+TL EY+    SIR WW
Sbjct  542   RGPFQVCYAALPAYCIITNTNIFPKGP--GLWIPIALLVIYNLHTLLEYLRIGLSIRYWW  599

Query  2177  NNQRM  2191
             NNQRM
Sbjct  600   NNQRM  604



>ref|XP_004487428.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Cicer arietinum]
Length=742

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/608 (52%), Positives = 403/608 (66%), Gaps = 18/608 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++ + LLLL  L+ YR+ + ++H + Y   +A +CESWFT  W+
Sbjct  7     LPLYEKIWAKHTFSRIMDSLTLLLLFLLLGYRISSHNNHTFPY--FVAFLCESWFTITWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V     + P +D+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    TTMSTKWTPSHTKTFLDRLLLRVSES--KLPPLDIFVTTADPALEPPIITVNTVLSLLAL  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEA+KFAKLWVPFCKKYNV  RAPFRYF  D     
Sbjct  123   DYPANKLACYVSDDGCSPLTFYALVEATKFAKLWVPFCKKYNVQCRAPFRYF-CDEEMAN  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                PEF++EW K+ +EY  L GKIE A Q      L  +F  F+   P +HSTIIKVI E
Sbjct  182   HDLPEFKQEWFKIKEEYEQLSGKIENAAQNSIPCELVGEFDIFSQTKPRNHSTIIKVIRE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L+  VPH+IYISREKRPKH H+ KAGAMNVLTR+SG+MTNAPF+LNVDCD YVNN 
Sbjct  242   NKGGLSNVVPHIIYISREKRPKHPHHHKAGAMNVLTRISGLMTNAPFILNVDCDMYVNNS  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++ LHA+C LL +K E++  F Q PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  302   KIALHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQLVALPMYIGSGFAGLQGIIY  361

Query  1466  DGTGCFHRRKVIYGLSP-NDTVTAEK-----LTDHDLQKIYGKSKIFVtsatttlsgsls  1627
              GT CFHRRKVIYG+SP +D   A K       D +  + +G SK FV S T  L G   
Sbjct  362   AGTNCFHRRKVIYGVSPHHDIQNANKDHHGLANDKETMQKFGTSKGFVESVTHVLEGMTL  421

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                    S  ++AA +VA+C YE+ T WG  +GW YGS +ED+LTG+     GW++  C 
Sbjct  422   DFY---KSLDVKAARKVASCDYEYNTAWGKQVGWLYGSTSEDVLTGLKFHTKGWRSELCS  478

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
              +   F+GC+P   LG + Q KRW++G  +I  S  CPIF  LFG LQ R+CLAY+    
Sbjct  479   TDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSKHCPIFGTLFGKLQLRECLAYIWITN  538

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R + E+CYA LP YC+ITNS+FLP   E ++ IP ++F+IYN+  L+E+++   SIR
Sbjct  539   WALRSVPEICYALLPAYCIITNSNFLP-NQESSMWIPTTLFVIYNISNLFEHIKSGLSIR  597

Query  2168  AWWNNQRM  2191
              WWNNQRM
Sbjct  598   TWWNNQRM  605



>ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=748

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/605 (52%), Positives = 405/605 (67%), Gaps = 14/605 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              P YE         R ++  IL+LLL L++YR+++  S+ + + W LA +CESWFTF W+
Sbjct  8     LPFYEKIWFKRTFQRVMDTFILVLLLLLLSYRIFS--SNNFTFPWFLAFLCESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++ KW+   T T+P+R L+ V     E P VD+FVTTA+P LEPPI+T NTVLSLLAL
Sbjct  66    VILNAKWSPAVTITHPDRLLQRVP----ELPRVDLFVTTADPVLEPPIITANTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP TFYALVEASKFAKLW+PFCKKYNV VRAPFRYF+   T   
Sbjct  122   DYPANKLACYVSDDGCSPFTFYALVEASKFAKLWIPFCKKYNVQVRAPFRYFSNVATTKS  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
             + SP+F++EW +M D Y NL   IE  T+K     L  +FA F++ +  +H +IIKVI E
Sbjct  182   DDSPDFKQEWSQMKDMYDNLRQNIEDVTRKQIPLELDGEFAVFSNTEQINHPSIIKVILE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + L+ G+P+LIYISREK+P H HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  242   NKDVLSDGLPYLIYISREKKPNHSHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             + VLHAMC L+ +K  ++  FVQ  Q FYDG+KDDP+ +Q+   Y  + RG A +QG +Y
Sbjct  302   KFVLHAMCILMDSKSGKEVAFVQCFQQFYDGIKDDPFGNQWVAAYEYIIRGMAGLQGPYY  361

Query  1466  DGTGCFHRRKVIYGLSPNDTVTA---EKLTDHDLQKIYGKSKIFVtsatttlsgslsset  1636
              GT  FHRR  IYGL P++       EKL +  L + +G SK FV SA   L G      
Sbjct  362   GGTNTFHRRNAIYGLYPHEMENGREDEKLGEKILIQQFGSSKEFVKSAAVALDGKAYLPK  421

Query  1637  FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPER  1816
                 S  +EAA QVA CGYE GT WG  IGW YGS++ED+ TG+ I R GW++  C P+ 
Sbjct  422   DISPSNFIEAAIQVARCGYECGTFWGKKIGWLYGSISEDVPTGLNIHRRGWRSECCTPDP  481

Query  1817  PGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPV  1996
               F GC P   + ++ Q KRWASG T + F    P+   LFG +QFR  L+Y     W  
Sbjct  482   IPFTGCAPRGFISTMVQQKRWASGLTVVFFGKHSPVMGMLFGKIQFRAGLSYFWLTNWGS  541

Query  1997  RPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
             R  F++CYA LP YC+ITN++  PKG    + IP ++ +IYNL+TL EY+    SIR WW
Sbjct  542   RGPFQVCYAALPAYCIITNTNIFPKGP--GLWIPIALLVIYNLHTLLEYLRIGLSIRYWW  599

Query  2177  NNQRM  2191
             NNQRM
Sbjct  600   NNQRM  604



>gb|KHN18003.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=731

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/584 (53%), Positives = 392/584 (67%), Gaps = 21/584 (4%)
 Frame = +2

Query  482   AYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCE  661
             +YRV+++ SH Y + W LA +CESWFT  W+  +STKW    TTT+ +R    V     E
Sbjct  14    SYRVYSI-SH-YSFPWFLATLCESWFTLTWLTTISTKWTPARTTTHLDRLFLRVG----E  67

Query  662   FPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASK  841
              P VD+FVTTA+P LEP I+T+NTVLSLLAL+YPANKLACYVSDD  SP+TFYALVEA+K
Sbjct  68    LPQVDVFVTTADPVLEPAIITINTVLSLLALDYPANKLACYVSDDGCSPLTFYALVEATK  127

Query  842   FAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESS-PEFRREWKKMNDEYANLCGKIEYAT  1018
             FAKLWVPFCKKYNV VRAPFRYF+ D T    +   EF +EW  M  EY  LC KI+ A+
Sbjct  128   FAKLWVPFCKKYNVQVRAPFRYFSEDATVDKNTDLQEFEQEWSLMKKEYEQLCRKIQNAS  187

Query  1019  QKPS---LFNKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFK  1189
             QK +   L  ++A F+  +  +H +IIKVI EN E L  GVPHLIYISREKRP+H H++K
Sbjct  188   QKSNPCPLVGEYAVFSKTELKNHPSIIKVIWENKEGLRDGVPHLIYISREKRPQHPHHYK  247

Query  1190  AGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTF  1369
             AGAMNVLTRVS +MTNAP++LNVDCD YVNNP++  HA+C  L +K E++  FVQ PQ F
Sbjct  248   AGAMNVLTRVSALMTNAPYILNVDCDMYVNNPKIAQHALCIFLDSKGEKEVAFVQCPQRF  307

Query  1370  YDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEK---  1540
             YD +KDD Y +Q   +   +G G A +QG  Y GT CFHRRKVIYGLSP+  +   K   
Sbjct  308   YDTVKDDAYGNQLVALPMYIGGGFAGLQGIIYAGTNCFHRRKVIYGLSPDYDIQNMKKDF  367

Query  1541  ------LTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL-SYSLEAASQVANCGYEF  1699
                    +     +I+G S+ FV SA   L     +    +  S  L+AA+QVA+C YE+
Sbjct  368   GFINGTKSQKKTMQIFGASRGFVESAKHALEEMTFTPNDKLFKSLELKAANQVASCDYEY  427

Query  1700  GTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRW  1879
              T WG  +GW YGS +ED+LTG+ +   GW++  C P+   F+GC+P   LG + Q KRW
Sbjct  428   STAWGKQVGWLYGSTSEDVLTGLVMHTKGWRSEVCSPDPMAFMGCSPQDNLGQMGQHKRW  487

Query  1880  ASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSH  2059
             +SG  +I  S  CPIF  LFG LQFR+CLAY+    W +R + E+CYA LP YC+ITNS 
Sbjct  488   SSGLFDIFLSSHCPIFGTLFGKLQFRECLAYVWITNWALRSVPEICYALLPAYCIITNSS  547

Query  2060  FLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             FLP   E  + IP S+ ++YN+ TL E++    S R WWNNQRM
Sbjct  548   FLP-NKEPGMWIPTSVCVMYNVATLLEHLISGLSARTWWNNQRM  590



>ref|XP_003540275.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Glycine max]
Length=750

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/610 (55%), Positives = 416/610 (68%), Gaps = 18/610 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHG-YYYTWLLALVCESWFTFIW  571
              PLY+     + +SR ++ + LLLLL L+ YR+ N+ SH  Y +  L+A +CESWFTF W
Sbjct  7     LPLYDKYWVKHTLSRVMDSLTLLLLLLLLGYRI-NIFSHSNYTFPCLVAFICESWFTFSW  65

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             +LV+STKW+   T TY  R L  V  G  E PAVD+FVTTA+P LEPPI+T+NTVLSLLA
Sbjct  66    ILVISTKWSPAYTKTYIHRLLLRVPEG--ELPAVDLFVTTADPVLEPPIITINTVLSLLA  123

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTF  928
             L+YP NKLACYVSDD  SP+TFYAL+EA +FAKLWVPFCKKYN+ +R PFRYF N   T 
Sbjct  124   LDYPHNKLACYVSDDGCSPLTFYALIEAFQFAKLWVPFCKKYNIQLRVPFRYFSNNTSTD  183

Query  929   PPESSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDHSTIIKVICE  1105
               E +PEF ++W KM +EY  L  KI  AT+    L  +FA F+D  P +H TIIKVI E
Sbjct  184   NNEDTPEFMQDWLKMKNEYERLTRKILNATKNSIPLVGEFAIFSDTQPRNHPTIIKVIWE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E L+  +PHLIY+SREK+ +H H +KAGAMNVLTRVSGVMTNAPF+LN+DCD +VNNP
Sbjct  244   NKEGLSDELPHLIYVSREKKQEHPHQYKAGAMNVLTRVSGVMTNAPFILNLDCDMHVNNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C LL +K E++  F Q  Q FYDGLKDDP  +Q    +  LG G A +QG FY
Sbjct  304   KIVLHALCILLDSKGEKEVAFAQCIQQFYDGLKDDPLGNQLVAAFRYLGGGLAGLQGIFY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDL--------QKIYGKSKIFVtsatttlsgs  1621
              GT C HRRKVIYGLSP   +   K  DH +        + I+G SK FV SAT  L G 
Sbjct  364   LGTNCMHRRKVIYGLSPYHGIQNGK-KDHGVSNGKFSEKKTIFGTSKGFVESATHALEGK  422

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
               +    +   SLEAAS+V++C YE+GT WG  +GW YGS +ED+LTG+ I   GW++  
Sbjct  423   TFTPNNNICK-SLEAASEVSSCEYEYGTAWGKQVGWMYGSTSEDLLTGLKIHTKGWRSEV  481

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C PE   F+GC+P   L  + Q KRW SG  +IL S  CPIF  LFG LQFRQCL Y+  
Sbjct  482   CSPELSPFMGCSPQDILVVIGQQKRWISGLLDILLSKHCPIFGTLFGKLQFRQCLGYLWI  541

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
               W +RP+ E+CYA LP YC+I NS FLPK  E+   IPA++ +IYN+ TL E ++   S
Sbjct  542   TTWSLRPVPEICYAALPAYCIINNSSFLPK--ELGQWIPATLLVIYNVSTLLENLKIGLS  599

Query  2162  IRAWWNNQRM  2191
             IR W NNQRM
Sbjct  600   IRTWCNNQRM  609



>ref|XP_010244467.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Nelumbo 
nucifera]
Length=749

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/609 (53%), Positives = 404/609 (66%), Gaps = 22/609 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL +   R N + R  +++I LLLLSL+ YR   L +HG    WLLA +CESWFTFIWV
Sbjct  7     LPLQQRIPRKNILQRVKDLIIFLLLLSLLLYRFLTLRNHGV--PWLLAFLCESWFTFIWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++ KWNQ E  TYPER L+    G    P VD+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    LNMNIKWNQFEYRTYPERLLQ---RGVELLPPVDIFVTTADPVLEPPIITVNTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACY+SDD ASP+TF+ALVEASKFAKLWVPFCKKY++ VRAP  YF+      P
Sbjct  122   DYPANKLACYISDDGASPLTFFALVEASKFAKLWVPFCKKYDIRVRAPSVYFSGK----P  177

Query  935   ESSP-----EFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTII  1090
             E+SP     +F  +WK+M  EY  L  +IE   + P    L  +FA F+ +D  +H +I+
Sbjct  178   EASPVDLSSDFGGDWKRMKIEYEQLKQRIEEVVESPIPCDLAGEFAAFSKIDRRNHPSIV  237

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             KVI EN  +L  G+PHL+Y+SREKRPKH H+ KAGAMNVLTRVSGVMTN+PFMLNVDCD 
Sbjct  238   KVIWENKGNLPDGLPHLVYVSREKRPKHPHHNKAGAMNVLTRVSGVMTNSPFMLNVDCDM  297

Query  1271  YVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAI  1450
             + N+P+ VLHA+C L G + E+++ +VQFPQ FY  LKDDP+ +Q  ++    GRG A I
Sbjct  298   FANDPQTVLHAVCLLFGFQQEKESAYVQFPQAFYGTLKDDPFGNQLVVLQEFAGRGIAGI  357

Query  1451  QGSFYDGTGCFHRRKVIYGLSPN--DTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgsl  1624
             QG  Y GTGCFHRRKVIYGLSP+  D     KL+   L   + KS   + +         
Sbjct  358   QGPLYAGTGCFHRRKVIYGLSPDEADINLGRKLSRLLLNVEFMKSASEILAGVKEKMDDP  417

Query  1625  ssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFC  1804
              +      S +LEAA QVA+CGYE  T WG  +GW YGS TED+LTG+ I   GW + + 
Sbjct  418   PALDD---STTLEAAIQVASCGYERDTYWGTKVGWVYGSTTEDVLTGLKIHSKGWNSVYM  474

Query  1805  VPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISI  1984
              P+ P FLG  PS G   + Q KRWA+G  E+LF+   PI       L FRQ LAY+   
Sbjct  475   TPDPPAFLGSAPSGGPACMTQQKRWATGLFEVLFNNYSPILPFRTTRLMFRQRLAYLYLN  534

Query  1985  LWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESI  2164
             +W +R + ELCYA LP Y +  N  FLP  +E A  +P ++FI +NLYTL E++    +I
Sbjct  535   VWSIRSVPELCYALLPSYAIFANKQFLPTVSEAAFFLPVALFITFNLYTLSEFLRCGLTI  594

Query  2165  RAWWNNQRM  2191
             RAWWNNQRM
Sbjct  595   RAWWNNQRM  603



>ref|XP_010244466.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nelumbo 
nucifera]
Length=760

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/617 (53%), Positives = 411/617 (67%), Gaps = 27/617 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL +   R N + R  +++I LLLLSL+ YR   L +HG    WLLA +CESWFTFIWV
Sbjct  7     LPLQQRIPRKNILQRVKDLIIFLLLLSLLLYRFLTLRNHGV--PWLLAFLCESWFTFIWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++ KWNQ E  TYPER L+    G    P VD+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    LNMNIKWNQFEYRTYPERLLQ---RGVELLPPVDIFVTTADPVLEPPIITVNTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACY+SDD ASP+TF+ALVEASKFAKLWVPFCKKY++ VRAP  YF+      P
Sbjct  122   DYPANKLACYISDDGASPLTFFALVEASKFAKLWVPFCKKYDIRVRAPSVYFSGK----P  177

Query  935   ESSP-----EFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTII  1090
             E+SP     +F  +WK+M  EY  L  +IE   + P    L  +FA F+ +D  +H +I+
Sbjct  178   EASPVDLSSDFGGDWKRMKIEYEQLKQRIEEVVESPIPCDLAGEFAAFSKIDRRNHPSIV  237

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             KVI EN  +L  G+PHL+Y+SREKRPKH H+ KAGAMNVLTRVSGVMTN+PFMLNVDCD 
Sbjct  238   KVIWENKGNLPDGLPHLVYVSREKRPKHPHHNKAGAMNVLTRVSGVMTNSPFMLNVDCDM  297

Query  1271  YVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAI  1450
             + N+P+ VLHA+C L G + E+++ +VQFPQ FY  LKDDP+ +Q  ++    GRG A I
Sbjct  298   FANDPQTVLHAVCLLFGFQQEKESAYVQFPQAFYGTLKDDPFGNQLVVLQEFAGRGIAGI  357

Query  1451  QGSFYDGTGCFHRRKVIYGLSPNDT-------VTAEKLTDHDLQKIYGKSKIFVtsattt  1609
             QG  Y GTGCFHRRKVIYGLSP++        ++   L +  L+  +G S  F+ SA+  
Sbjct  358   QGPLYAGTGCFHRRKVIYGLSPDEADINLGRKLSRLLLNEKSLKANFGNSVEFMKSASEI  417

Query  1610  lsgslssetFGVL---SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQR  1780
             L+G             S +LEAA QVA+CGYE  T WG  +GW YGS TED+LTG+ I  
Sbjct  418   LAGVKEKMDDPPALDDSTTLEAAIQVASCGYERDTYWGTKVGWVYGSTTEDVLTGLKIHS  477

Query  1781  MGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQ  1960
              GW + +  P+ P FLG  PS G   + Q KRWA+G  E+LF+   PI       L FRQ
Sbjct  478   KGWNSVYMTPDPPAFLGSAPSGGPACMTQQKRWATGLFEVLFNNYSPILPFRTTRLMFRQ  537

Query  1961  CLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWE  2140
              LAY+   +W +R + ELCYA LP Y +  N  FLP  +E A  +P ++FI +NLYTL E
Sbjct  538   RLAYLYLNVWSIRSVPELCYALLPSYAIFANKQFLPTVSEAAFFLPVALFITFNLYTLSE  597

Query  2141  YMEEKESIRAWWNNQRM  2191
             ++    +IRAWWNNQRM
Sbjct  598   FLRCGLTIRAWWNNQRM  614



>ref|XP_003540290.1| PREDICTED: cellulose synthase-like protein H1-like isoformX1 
[Glycine max]
 gb|KHN44859.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=746

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/604 (52%), Positives = 413/604 (68%), Gaps = 13/604 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E         R ++ +IL+LLL  ++YRV++  S+ + + W LA +CESWFTFIW+
Sbjct  8     LPLSEKIWFKRTFQRVIDTLILVLLLLNLSYRVFS--SNNFTFPWFLAFICESWFTFIWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+   T T+P R L+ V     E P VDMFVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  66    VILNTKWSPAVTITHPNRLLQRVP----ELPPVDMFVTTADPVLEPPIITINTVLSLLAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEASKFAK WVPFCKKYNV VRAPFRYF+       
Sbjct  122   DYPANKLACYVSDDGCSPLTFYALVEASKFAKFWVPFCKKYNVQVRAPFRYFSNVAISKS  181

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW +M D Y NL   +E  T K     L  ++A F++ +  +H TIIKVI E
Sbjct  182   EESLEFKQEWLQMKDMYHNLSQNLEEVTSKTIPFQLDGEYAVFSNTEQRNHPTIIKVIFE  241

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + L+  +PHLIYISREKRP++ HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD +VNNP
Sbjct  242   NMDGLSDQLPHLIYISREKRPQYPHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMFVNNP  301

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++V HAMC L+ +K  ++  FVQ  Q FYDG+KDDP+ +Q+  ++  + RG A +QG FY
Sbjct  302   KIVQHAMCILMDSKSGKEVAFVQCFQQFYDGIKDDPFGNQWVAVFEYIVRGMAGLQGPFY  361

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRRK IYG+ P++T +    KL +  L + +G  + FV SA   + GS  S   
Sbjct  362   CGTNTFHRRKAIYGVYPDETGSRRNGKLEEKILIQQFGSLEEFVKSAAHAMEGSAYSAND  421

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                S  +EAA QVA+CGYE GT WG  +GW YGS+TED+LTG+ ++R GW++  C P+  
Sbjct  422   ITPSSFIEAAIQVADCGYEDGTWWGKQMGWLYGSLTEDVLTGLSMKRRGWRSECCTPDPI  481

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRW +GHT I F    P+   LFG +QFR  L+Y       +R
Sbjct  482   AFTGCAPGGLLSTMLQQKRWFTGHTVIFFGKHSPLMCMLFGKIQFRAGLSYFWVSTLSLR  541

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
              +F +CY  L  YC+ITN++  PKG  + + IP ++F+IYN+YTL EY++   S+R WWN
Sbjct  542   GVFLVCYIALLAYCMITNTNIFPKG--LGLWIPITLFVIYNVYTLLEYVKIGLSMRQWWN  599

Query  2180  NQRM  2191
             NQRM
Sbjct  600   NQRM  603



>ref|XP_008781464.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Phoenix 
dactylifera]
Length=744

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/568 (54%), Positives = 401/568 (71%), Gaps = 11/568 (2%)
 Frame = +2

Query  503   HSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMF  682
             HSHG    WL+A +CESWFTFIWVL ++ KWN V+  TYPER L+     S + PAVDMF
Sbjct  43    HSHGS--IWLIAFLCESWFTFIWVLFMNAKWNPVKYKTYPERLLK----RSDDLPAVDMF  96

Query  683   VTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVP  862
             VTTA+P+LEPPI+T NTVLSLLA+EYPA+KLACYVSDD  SP+TFY+LVEASKFAKLWVP
Sbjct  97    VTTADPKLEPPIITANTVLSLLAVEYPAHKLACYVSDDGGSPITFYSLVEASKFAKLWVP  156

Query  863   FCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQ---KPSL  1033
             FCKKYNV VRAPF YF+++       S EF   W+ M ++Y  L  +I+ A +      +
Sbjct  157   FCKKYNVRVRAPFVYFSSEPQASQTLSQEFMDTWRYMKNKYEELSQRIDDAAKDYISHRM  216

Query  1034  FNKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLT  1213
              ++ A F++++  +H ++IKVI EN E L  G+PHL+Y++REKRPKH H++KAGAMNVL 
Sbjct  217   DDELADFSNIERGNHPSLIKVIWENKEGLEGGIPHLVYVAREKRPKHPHHYKAGAMNVLA  276

Query  1214  RVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDP  1393
             RVSGVMTNAPFMLNVDCD + NNPEV+LH MC LLG  +E  +GFVQ PQ FY  LKDDP
Sbjct  277   RVSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSSGFVQAPQQFYGALKDDP  336

Query  1394  YASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYG-LSPNDTVTAEKLTDHDLQKIY  1570
             + +Q  ++   +G G   +QG FY GTGCFHRRK+I     P      ++L+  +LQ+IY
Sbjct  337   FGNQLVVLQELIGGGIGGLQGPFYGGTGCFHRRKIICSPPRPAGVSKHDELSYKELQRIY  396

Query  1571  GKSKIFVtsatttls-gslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVT  1747
             G S+  + SA+   S     S +   LS S+EAA +VA+C YEF T WG+ IGW YGS+T
Sbjct  397   GDSRELIESASQITSGKIRESSSVDDLSSSVEAAKRVASCTYEFNTCWGNKIGWAYGSMT  456

Query  1748  EDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIF  1927
             ED+LTG+ I  MGWK+ + + + P FLG  P+ G  SL Q KRW++G  EIL S + PI 
Sbjct  457   EDVLTGLRIHSMGWKSVYLILDPPAFLGSAPTGGPASLTQYKRWSTGLLEILLSRRSPIL  516

Query  1928  AALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASI  2107
             A     L+FR  LAY++  +W +R I ELCYA LP YCLITN+ F+PK +E   VIP ++
Sbjct  517   ATFAKRLEFRMNLAYLLITVWALRSIGELCYALLPAYCLITNTSFMPKASEPVFVIPLAL  576

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             F+I N+++L EY++   S+RA+WNNQRM
Sbjct  577   FLICNMHSLMEYVQCGLSVRAYWNNQRM  604



>ref|XP_010035547.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW46970.1| hypothetical protein EUGRSUZ_K00778 [Eucalyptus grandis]
Length=667

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/523 (57%), Positives = 367/523 (70%), Gaps = 14/523 (3%)
 Frame = +2

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
             E P VD+FVTTA+P+LEPPI+TVNTVLSL+A++YPA+KLACYVSDD  SP+TFY+L+EA+
Sbjct  4     ELPPVDVFVTTADPQLEPPIITVNTVLSLMAVDYPAHKLACYVSDDGCSPLTFYSLMEAA  63

Query  839   KFAKLWVPFCKKYNVAVRAPFRYFNADHTF--PPESSPEFRREWKKMNDEYANLCGKIEY  1012
             KFAKLWVPFCKKYN+ +RAPFRYF  D T     + S EF++    M DEY  L  KIE 
Sbjct  64    KFAKLWVPFCKKYNIQLRAPFRYFAGDVTTLSGEDCSWEFQQARDTMKDEYEKLSRKIED  123

Query  1013  ATQKPSLFN---KFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHN  1183
             A+Q    F+   +FA F++ + ++H +IIK+I EN E     +PHLIYISREKRPK  H+
Sbjct  124   ASQGSVPFDLTGEFAAFSNTERSNHPSIIKIILENKEGHPDALPHLIYISREKRPKQPHH  183

Query  1184  FKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQ  1363
             +KAGAMNVLTRVSG+MTNAPFMLNVDCD + NNP++VLHA+C LLG K ERD  +VQ PQ
Sbjct  184   YKAGAMNVLTRVSGLMTNAPFMLNVDCDMHANNPQIVLHALCLLLGTKRERDCAYVQCPQ  243

Query  1364  TFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAE--  1537
              FYDGLKDDP+ +Q  +++  +GRG   IQG FY GTGCFHRRKVIYG  P+D  T    
Sbjct  244   IFYDGLKDDPFGNQMVVLFEYMGRGIVGIQGPFYSGTGCFHRRKVIYGSWPDDMKTENSG  303

Query  1538  -----KLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFG  1702
                  +LT  +L   +G SK F+   +   +   +S     LS SLE   QVA+C YE+ 
Sbjct  304   LTSNGELTKENLLNEFGSSKQFI--NSAAQALQGNSNHLEDLSSSLETVHQVASCTYEYD  361

Query  1703  TTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWA  1882
             T WG  IGW YGS TEDILTG+ IQ  GWK+ +C P  P FLGC PS G  S+ Q KRWA
Sbjct  362   TDWGQKIGWMYGSTTEDILTGLAIQTKGWKSVYCSPNPPAFLGCAPSGGPASMTQQKRWA  421

Query  1883  SGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHF  2062
             +G  E+L S K PI+  LF  L FRQCLAY+  ++  +R I E  YA +P YC++TNSHF
Sbjct  422   TGLLEVLVSKKNPIYGTLFVQLHFRQCLAYLWLLIRALRSIPEFLYALIPAYCIMTNSHF  481

Query  2063  LPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             LPKG E A VIPA+IF+IYNLY L EY     SI  WWNN RM
Sbjct  482   LPKGQEPASVIPAAIFVIYNLYCLHEYFMTNLSILEWWNNHRM  524



>ref|XP_004151937.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=743

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/613 (52%), Positives = 416/613 (68%), Gaps = 23/613 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              P YE         RA+++ I +LL+SL+AYRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPFYERTTIKRPTQRALDIAIFILLISLLAYRVLLMYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L + T+WN V+  TYP+R L+       EFPAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIITRWNPVDYKTYPQRLLK----REMEFPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKL CY+SDD  S +T +AL EA KFAK+W+PFCK+Y+V VRAPF YF+     PP
Sbjct  121   DYPANKLGCYISDDGCSALTLFALNEALKFAKIWIPFCKRYDVQVRAPFMYFST----PP  176

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK-----FATFADLDPNDHSTIIK  1093
                SS +F  +W+ +  EY  L GKI+ A +  + +N+      A F++++   H TIIK
Sbjct  177   HLHSSTQFLNDWETLKVEYEKLEGKIKEAEENRNGWNEEIGIDLAAFSNINTKHHPTIIK  236

Query  1094  VICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFY  1273
              + EN E ++  +PHLIYISREK  KH H++KAGAMNVLTRVSGV+TNAP++LNVDCD +
Sbjct  237   TLWENKE-VSDELPHLIYISREKSLKHHHHYKAGAMNVLTRVSGVLTNAPYILNVDCDMF  295

Query  1274  VNNPEVVLHAMCFLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAI  1450
              N+P+VVLHAMC  L +KD+  D G+VQ PQ FYDGLKDDP+ +Q  +++   GRG   +
Sbjct  296   ANDPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDPFGNQLVVVFEYFGRGIMGL  355

Query  1451  QGSFYDGTGCFHRRKVIYGLSPNDTV--TAEKLTDHDLQKIYGKSKIFVtsatttlsgsl  1624
             QG FY GTGCFHRRKV+Y   P+ T      K ++ +L K +G SK F  SAT       
Sbjct  356   QGPFYGGTGCFHRRKVLYAQFPHHTAYFLNGKASEQELIKTFGYSKTFTKSATYAFKDDQ  415

Query  1625  ssetF---GVL-SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
             ++  +   G+  + +L+AA+ VA CGYE  TTWG  IGW YGS +ED+LTG+ IQ  GW+
Sbjct  416   NTSGYPPKGLFNTNNLDAANHVAGCGYEISTTWGSKIGWIYGSTSEDVLTGLVIQTRGWR  475

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + F     P FLGC PS  + SLNQ KRWA+G  ++LF+  CPIF  LFG LQ+RQC AY
Sbjct  476   SIFLALNPPAFLGCAPSQLVASLNQQKRWATGFLQVLFNKHCPIFGTLFGKLQWRQCAAY  535

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +  + W +R I EL YA LP YCLITNS F P   E AI IP  +FIIYN   L +Y E 
Sbjct  536   LWMLTWGLRSIPELSYALLPAYCLITNSSFFPTMKERAIFIPIFLFIIYNFQQLLQYKET  595

Query  2153  KESIRAWWNNQRM  2191
              +S+RAWWNNQ+M
Sbjct  596   GQSLRAWWNNQKM  608



>ref|XP_004151936.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=746

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/612 (51%), Positives = 403/612 (66%), Gaps = 19/612 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         + ++V I +LL+SL AYRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPLYEKTNIKRPTQKVLDVAIFILLVSLDAYRVLLMYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +  KWN V   TYP R L+       E PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIILKWNPVHFETYPRRLLK----REMELPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKL CYVSDD  S +T YAL EA KF K+WVPFCKKY + VRAPFRYF+ D   PP
Sbjct  121   DYPANKLGCYVSDDGCSDLTLYALNEALKFGKIWVPFCKKYEIQVRAPFRYFSND-PMPP  179

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK------FATFADLDPNDHSTII  1090
                SS +F+ +W  + +EY  L GKI+ A +  S   +         F++L   +H TI+
Sbjct  180   HLPSSTQFQNDWVTVKEEYEKLEGKIKEAEESRSFVLEEEDGIDLTAFSNLHTKNHPTIV  239

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             K++ EN + ++  +PHLIY+SRE+  KH H++KAGAMNVLTRVSGV+TNAP++LNVDCD 
Sbjct  240   KILWEN-KKVSDELPHLIYVSRERSFKHHHHYKAGAMNVLTRVSGVLTNAPYILNVDCDM  298

Query  1271  YVNNPEVVLHAMCFLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAA  1447
             + N+P+VVLHAMC  L +KD+  D G+VQ PQ FYDGL+DDP+ +Q  +I+    RG   
Sbjct  299   FANDPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLEDDPFGNQLVVIFEYYARGVMG  358

Query  1448  IQGSFYDGTGCFHRRKVIYGLSPNDT---VTAEKLTDHDLQKIYGKSKIFVtsatttlsg  1618
             +QG  Y GTGCFHRRKV+YG  P+ +   +  +  ++ +L +++G SK F  SA      
Sbjct  359   LQGPVYSGTGCFHRRKVLYGQLPHHSTHFMDGKAYSEQELMEVFGYSKTFAKSAIYAFEE  418

Query  1619  slsset-FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             +          + +LEAA+QVA C YE  TTWG  IGW YGS TED+LTG+ IQ  GW++
Sbjct  419   TTHGYHPNSRFNDNLEAANQVAGCDYEINTTWGSKIGWIYGSTTEDVLTGLVIQSRGWRS  478

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
              +     P FLGC PS  + SL Q KRW SG  EILFS   PIF  LFG LQ++QC  Y+
Sbjct  479   IYIALNPPAFLGCAPSQLVASLTQQKRWVSGLLEILFSKHFPIFGTLFGKLQWKQCAVYI  538

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
               + W +R I EL YA LPPYCLI+NS F P   E AI IP  +FIIYN   L  Y E +
Sbjct  539   WLLTWGLRSIPELSYALLPPYCLISNSSFFPNMEERAIYIPIFLFIIYNFQQLLLYKETR  598

Query  2156  ESIRAWWNNQRM  2191
             +SIRAWWNNQRM
Sbjct  599   QSIRAWWNNQRM  610



>ref|XP_007217162.1| hypothetical protein PRUPE_ppa001889mg [Prunus persica]
 gb|EMJ18361.1| hypothetical protein PRUPE_ppa001889mg [Prunus persica]
Length=746

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/603 (54%), Positives = 400/603 (66%), Gaps = 19/603 (3%)
 Frame = +2

Query  395   FPLYE-TKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIW  571
              PL E T ++ N + RA E+ IL L + L+ YR+ +L  HG+   WLLA +CESWFTF W
Sbjct  7     LPLCEKTPLKINTLQRAQEIAILFLFICLLVYRLLSLTDHGF--VWLLAFLCESWFTFNW  64

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             VL +  +W  VE  TYP+  L+ V     E PAVDMFVTTA+ ELEPPI+TVNTVLSLLA
Sbjct  65    VLTLIIQWTPVEYKTYPQNLLQQVP----ELPAVDMFVTTADAELEPPIITVNTVLSLLA  120

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP  931
             ++YP++KLACYVSDD  SP+T Y+L EASKFA+ WVPFCKKYN+ VR PFRYF+ +   P
Sbjct  121   VDYPSHKLACYVSDDGCSPLTLYSLTEASKFAQFWVPFCKKYNIQVRPPFRYFSGNSKLP  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADL-DPNDHSTIIKVICEN  1108
              ++   F +EW KM DEY  LC KIE A Q  +  +    + D  D  +H TIIKVI EN
Sbjct  181   SDNPVGFLQEWTKMKDEYQKLCQKIEVAVQNLATLDFSGDYVDFADRRNHPTIIKVIWEN  240

Query  1109  DESLAV-GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
              E L+  GVPHL+Y++REKR    H+ KAGAMNVLTRVSGVMTNAPFMLNVDCD Y NN 
Sbjct  241   KERLSNNGVPHLVYVAREKRSDQSHHHKAGAMNVLTRVSGVMTNAPFMLNVDCDMYANNS  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHAMC LLG K E++  FVQ PQ FYD LKDDP+ +Q          G A +QG  Y
Sbjct  301   KIVLHAMCLLLGFKHEKEGAFVQCPQMFYDTLKDDPFGNQLTS-----WPGFAGMQGPLY  355

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQK-IYGKSKIFVtsatttlsgslssetFG  1642
              GTGCF RRKVIYG S  D+     L D  L K  +G S   + SAT T S  +      
Sbjct  356   AGTGCFQRRKVIYGFSLIDS--EGNLRDVALDKERFGNSTELIESATHTSSEKIDHPH--  411

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              LS ++EAA+QVA   YE  T WG  +GW YGSVTEDILTG+ I   GWK+  C+P+ PG
Sbjct  412   DLSSAVEAANQVAGSSYEHSTLWGTKVGWVYGSVTEDILTGMKIHARGWKSILCMPDPPG  471

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+G  PS+    L Q KRW +G  EILFS   PIFA L+  L+FRQCLAY   ++W +  
Sbjct  472   FMGSAPSSSHVMLTQRKRWVTGLLEILFSKNNPIFATLYAKLEFRQCLAYTTVLIWGLNS  531

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             I +LCY  LP YC+ITNSHFLPK  E A++   ++F++  LYTL  Y+    SI+ WWN+
Sbjct  532   IPDLCYTILPAYCIITNSHFLPKVKEPALIFFVAVFLMKILYTLRFYLGFGLSIKQWWNH  591

Query  2183  QRM  2191
              RM
Sbjct  592   VRM  594



>gb|EMT26547.1| Cellulose synthase-like protein H1 [Aegilops tauschii]
Length=717

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/565 (55%), Positives = 376/565 (67%), Gaps = 13/565 (2%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPE  703
             TWL ALVCE+WF F+W+L ++ KW+ V   TYP+     +E    E PAVDMFVTTA+P 
Sbjct  46    TWLAALVCEAWFAFVWILNMNGKWSPVRFDTYPDNLSHRME----ELPAVDMFVTTADPA  101

Query  704   LEPPILTVNTVLSLLALEYP-ANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             LEPP++TVNTVLSLLAL+YP   +LACYVSDD  SPVT YAL EA+KFA LWVPFCK+++
Sbjct  102   LEPPLITVNTVLSLLALDYPDVGRLACYVSDDGCSPVTCYALREAAKFAGLWVPFCKRHD  161

Query  881   VAVRAPFRYFN-ADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSL---FNKFA  1048
             V VRAPF YF+ A          EF   W  M  +Y  L  +IE A +   +    ++FA
Sbjct  162   VGVRAPFMYFSSAPEVGNGTVDHEFLESWALMKSQYEKLARRIENADEGTIMRDGGDEFA  221

Query  1049  TFADLDPNDHSTIIKVICENDESLA-VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSG  1225
              F D +  +H TI+KV+ +N +S A    PHL+Y+SREK P+H+HNFKAGAMNVLTRVS 
Sbjct  222   EFIDAERGNHPTIVKVLWDNSKSKAGEEFPHLVYLSREKSPRHRHNFKAGAMNVLTRVSA  281

Query  1226  VMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             VMTNAP MLNVDCD + NNP+V LHAMC LLG  DE  +GFVQ PQ FY GLKDDP+ +Q
Sbjct  282   VMTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDEIHSGFVQAPQKFYGGLKDDPFGNQ  341

Query  1406  YKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTD---HDLQKIYGK  1576
              ++I   +G G A IQG FY GTGCFHRRKVIYG+ P DTV  E        +LQ  +G 
Sbjct  342   MQVITKKIGGGLAGIQGMFYGGTGCFHRRKVIYGVPPPDTVKHEMKGSPSYKELQAKFGS  401

Query  1577  SKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDI  1756
             SK  + S+   +SG L +     LS  +E A QV +C YE GT WG  IGW YGS+TEDI
Sbjct  402   SKELIESSRNIISGDLLARPTVDLSSRVEMAKQVGDCNYEAGTCWGQEIGWVYGSMTEDI  461

Query  1757  LTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAAL  1936
             LTG+ I   GW +     E P FLGC P+ G  SL Q KRWA+G  EIL S   PI   +
Sbjct  462   LTGLRIHAAGWGSALLDTEPPAFLGCAPTGGPASLTQFKRWATGLLEILISQNSPILGTI  521

Query  1937  FGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFII  2116
             F  LQ RQCLAY+I   WPVR  FELCYA L P+CL+TN  FLP  ++    IPA++F+ 
Sbjct  522   FRRLQLRQCLAYLIVEAWPVRAPFELCYALLGPFCLLTNQSFLPTASDEGFRIPAALFLT  581

Query  2117  YNLYTLWEYMEEKESIRAWWNNQRM  2191
             Y++Y L EY E   S+RAWWNN RM
Sbjct  582   YHIYHLMEYKECGLSVRAWWNNHRM  606



>gb|KGN63228.1| hypothetical protein Csa_2G416190 [Cucumis sativus]
Length=743

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 393/600 (66%), Gaps = 11/600 (2%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             LYE       + R +++ I  LL+SL+ YR   L SH + Y   LA +CE WFTF W+L+
Sbjct  9     LYEKIEVKRPIQRLLDLTIFFLLISLLLYRFLILRSHAFTYLHTLAFLCELWFTFTWLLL  68

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             ++  WN +   TYP+R L+ V+    E P VD+FVTTA+P LEPP++TVNTVLSLLA +Y
Sbjct  69    INVTWNPIHYNTYPQRLLKRVD----ELPPVDVFVTTADPVLEPPLITVNTVLSLLAADY  124

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PAN+LA YVSDD  SP+TFY+L+EA  FAK+WVPFCKKY V VRAPFRYF+ D +F  + 
Sbjct  125   PANRLAVYVSDDGCSPITFYSLLEALAFAKIWVPFCKKYEVQVRAPFRYFSGDLSF--DG  182

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQ---KPSLFNKFATFADLDPNDHSTIIKVICEND  1111
             + EF+ EW++M DEY  L   +E A +    P +    A F++++ ++H  IIK I EN 
Sbjct  183   TEEFQCEWRRMKDEYEKLRRNVEEAAKNVVSPEIMRDLADFSNIESSNHPPIIKAIWENK  242

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
             E L  G+PHLIY+SREKRP+H H++KAGAMN L RVSG+MTNAP++LNVDCD YVNNP V
Sbjct  243   EGLRDGLPHLIYVSREKRPQHPHHYKAGAMNALARVSGLMTNAPYILNVDCDMYVNNPSV  302

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             +L  MC  L    +++  FVQFPQ FY+GLKDDPY +Q+ ++     RG A IQG  Y G
Sbjct  303   LLQGMCLFLDPTIDKEYAFVQFPQRFYNGLKDDPYGNQWIVMMEFTFRGMAGIQGPGYMG  362

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLS  1651
             TGC HRRKV+YG SP+      K  D +L K +G SK FV SA   L           LS
Sbjct  363   TGCIHRRKVLYGQSPDGANIFGKHYDSELHKTFGSSKDFVNSAAHALRNLADYP--NSLS  420

Query  1652  YSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLG  1831
              S+ +  +VA   YE  + WG   GW YGS+ ED+LTG  I + GWK+ +  P  P FLG
Sbjct  421   NSIISLKEVATSDYEITSCWGTKFGWLYGSLLEDVLTGSEIHKKGWKSAYLTPTPPAFLG  480

Query  1832  CTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFE  2011
             C PS G   LN  KR  +G  EI FS KCPIF +LFG LQFRQ +  +   LW +R I E
Sbjct  481   CAPSGGPIPLNHQKRAMTGLLEIFFSKKCPIFNSLFGKLQFRQRMVSVWMSLWGIRSIPE  540

Query  2012  LCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             +CYA LP +CLI NSHFLPK  E  + IP  +F+ YNL  L +Y E  +S RAWWNN+RM
Sbjct  541   ICYATLPAFCLIANSHFLPKIQEPVVCIPLLLFVFYNLQQLLQYWETGQSARAWWNNERM  600



>ref|XP_004158577.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=746

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/612 (51%), Positives = 402/612 (66%), Gaps = 19/612 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         + +++ I +LL+SL AYRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPLYEKTNIKRPTQKVLDIAIFILLVSLDAYRVLLMYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +  KWN V   TYP R L+       E PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIILKWNPVHFETYPRRLLK----REMELPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKL CYVSDD  S +T YAL EA KF K+WVPFCKKY + VRAPFRYF+ D   PP
Sbjct  121   DYPANKLGCYVSDDGCSDLTLYALNEALKFGKIWVPFCKKYEIQVRAPFRYFSND-PMPP  179

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK------FATFADLDPNDHSTII  1090
                SS +F+ +W  + +EY  L GKI+ A +  S   +       A F++L   +H TI+
Sbjct  180   HLPSSTQFQNDWDTVKEEYEKLEGKIKEAEESRSFVLEEEDGIDLAAFSNLHTKNHPTIV  239

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             K++ EN + ++  +PHLIY+SREK  KH H++KAGAMNVLTRVSGV+TNAP++LNVDCD 
Sbjct  240   KILWEN-KKVSDELPHLIYVSREKSFKHHHHYKAGAMNVLTRVSGVLTNAPYILNVDCDM  298

Query  1271  YVNNPEVVLHAMCFLLGAK-DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAA  1447
             + N+P+VVLHAMC  L +K D  D G+VQ PQ FYDGL+DDP+ +Q  +I+    RG   
Sbjct  299   FANDPQVVLHAMCVFLNSKYDLEDIGYVQTPQCFYDGLEDDPFGNQLVVIFEYYARGVMG  358

Query  1448  IQGSFYDGTGCFHRRKVIYGLSPNDT---VTAEKLTDHDLQKIYGKSKIFVtsatttlsg  1618
             +QG  Y GTGCFH RKV+YG  P+ +   +  +  ++ +L +++G SK F  SA      
Sbjct  359   LQGPVYSGTGCFHTRKVLYGQLPHHSTHFMDGKAYSEQELMEVFGYSKTFAKSAIYAFEE  418

Query  1619  slsset-FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             +          + +LEAA+QVA C YE  TTWG  IGW YGS TED+LTG+ IQ  GW++
Sbjct  419   TTHGYHPNSRFNDNLEAANQVAGCDYEINTTWGSKIGWIYGSTTEDVLTGLVIQSRGWRS  478

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
              +     P FLGC PS  + SL Q KRW SG  EILFS   PIF  LFG LQ++QC  Y+
Sbjct  479   IYIALNPPAFLGCAPSQLVASLTQQKRWVSGLLEILFSKHFPIFGTLFGKLQWKQCAVYI  538

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
               + W +R I EL YA LPPYCLI+NS F P   E AI IP  +FIIYN   L  Y E +
Sbjct  539   WLLTWGLRSIPELSYALLPPYCLISNSSFFPNMEERAIYIPIFLFIIYNFQQLLLYKETR  598

Query  2156  ESIRAWWNNQRM  2191
             +SIRAWWNNQRM
Sbjct  599   QSIRAWWNNQRM  610



>ref|XP_004151939.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=743

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 393/600 (66%), Gaps = 11/600 (2%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             LYE       + R +++ I  LL+SL+ YR   L SH + Y   LA +CE WFTF W+L+
Sbjct  9     LYEKIEVKRPIQRLLDLTIFFLLISLLLYRFLILRSHAFTYLHTLAFLCELWFTFTWLLL  68

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             ++  WN +   TYP+R L+ V+    E P VD+FVTTA+P LEPP++TVNTVLSLLA +Y
Sbjct  69    INVTWNPIHYNTYPQRLLKRVD----ELPPVDVFVTTADPVLEPPLITVNTVLSLLAADY  124

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PAN+LA YVSDD  SP+TFY+L+EA  FAK+WVPFCKKY V VRAPFRYF+ D +F  + 
Sbjct  125   PANRLAGYVSDDGCSPITFYSLLEALAFAKIWVPFCKKYEVQVRAPFRYFSGDLSF--DG  182

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQ---KPSLFNKFATFADLDPNDHSTIIKVICEND  1111
             + EF+ EW++M DEY  L   +E A +    P +    A F++++ ++H  IIK I EN 
Sbjct  183   TEEFQCEWRRMKDEYEKLRRNVEEAAKNVVSPEIMRDLADFSNIESSNHPPIIKAIWENK  242

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
             E L  G+PHLIY+SREKRP+H H++KAGAMN L RVSG+MTNAP++LNVDCD YVNNP V
Sbjct  243   EGLRDGLPHLIYVSREKRPQHPHHYKAGAMNALARVSGLMTNAPYILNVDCDMYVNNPSV  302

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             +L  MC  L    +++  FVQFPQ FY+GLKDDPY +Q+ ++     RG A IQG  Y G
Sbjct  303   LLQGMCLFLDPTIDKEYAFVQFPQRFYNGLKDDPYGNQWIVMMEFTFRGMAGIQGPGYMG  362

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLS  1651
             TGC HRRKV+YG SP+      K  D +L K +G SK FV SA   L           LS
Sbjct  363   TGCIHRRKVLYGQSPDGANIFGKHYDSELHKTFGSSKDFVNSAAHALRNLADYP--NSLS  420

Query  1652  YSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLG  1831
              S+ +  +VA   YE  + WG   GW YGS+ ED+LTG  I + GWK+ +  P  P FLG
Sbjct  421   NSIISLKEVATSDYEITSCWGTKFGWLYGSLLEDVLTGSEIHKKGWKSAYLTPTPPAFLG  480

Query  1832  CTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFE  2011
             C PS G   LN  KR  +G  EI FS KCPIF +LFG LQFRQ +  +   LW +R I E
Sbjct  481   CAPSGGPIPLNHQKRAMTGLLEIFFSKKCPIFNSLFGKLQFRQRMVSVWMSLWGIRSIPE  540

Query  2012  LCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             +CYA LP +CLI NSHFLPK  E  + IP  +F+ YNL  L +Y E  +S RAWWNN+RM
Sbjct  541   ICYATLPAFCLIANSHFLPKIQEPVVCIPLLLFVFYNLQQLLQYWETGQSARAWWNNERM  600



>gb|KHN18006.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=728

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/581 (55%), Positives = 398/581 (69%), Gaps = 18/581 (3%)
 Frame = +2

Query  482   AYRVWNLHSHG-YYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSC  658
              YR+ N+ SH  Y +  L+A +CESWFTF W+LV+STKW+   T TY  R L  V  G  
Sbjct  14    GYRI-NIFSHSNYTFPCLVAFICESWFTFSWILVISTKWSPAYTKTYIHRLLLRVPEG--  70

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
             E PAVD+FVTTA+P LEPPI+T+NTVLSLLAL+YP NKLACYVSDD  SP+TFYAL+EA 
Sbjct  71    ELPAVDLFVTTADPVLEPPIITINTVLSLLALDYPHNKLACYVSDDGCSPLTFYALIEAF  130

Query  839   KFAKLWVPFCKKYNVAVRAPFRYF-NADHTFPPESSPEFRREWKKMNDEYANLCGKIEYA  1015
             +FAKLWVPFCKKYN+ +R PFRYF N   T   E +PEF ++W KM +EY  L  KI  A
Sbjct  131   QFAKLWVPFCKKYNIQLRVPFRYFSNNTSTDNNEDTPEFMQDWLKMKNEYERLTRKILNA  190

Query  1016  TQKP-SLFNKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKA  1192
             T+    L  +FA F+D  P +H TIIKVI EN E L+  +PHLIY+SREK+ +H H +KA
Sbjct  191   TKNSIPLVGEFAIFSDTQPRNHPTIIKVIWENKEGLSDELPHLIYVSREKKQEHPHQYKA  250

Query  1193  GAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFY  1372
             GAMNVLTRVSGVMTNAPF+LN+DCD +VNNP++VLHA+C LL +K E++  F Q  Q FY
Sbjct  251   GAMNVLTRVSGVMTNAPFILNLDCDMHVNNPKIVLHALCILLDSKGEKEVAFAQCIQQFY  310

Query  1373  DGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDH  1552
             DGLKDDP  +Q    +  LG G A +QG FY GT C HRRKVIYGLSP   +   K  DH
Sbjct  311   DGLKDDPLGNQLVAAFRYLGGGLAGLQGIFYLGTNCMHRRKVIYGLSPYHGIQNGK-KDH  369

Query  1553  DL--------QKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTT  1708
              +        + I+G SK FV SAT  L G   +    +   SLEAAS+V++C YE+GT 
Sbjct  370   GVSNGKFSEKKTIFGTSKGFVESATHALEGKTFTPNNNICK-SLEAASEVSSCEYEYGTA  428

Query  1709  WGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASG  1888
             WG  +GW YGS +ED+LTG+ I   GW++  C PE   F+GC+P   L  + Q KRW SG
Sbjct  429   WGKQVGWMYGSTSEDLLTGLKIHTKGWRSEVCSPELSPFMGCSPQDILVVIGQQKRWISG  488

Query  1889  HTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLP  2068
               +IL S  CPIF  LFG LQFRQCL Y+    W +RP+ E+CYA LP YC+I NS FLP
Sbjct  489   LLDILLSKHCPIFGTLFGKLQFRQCLGYLWITTWSLRPVPEICYAALPAYCIINNSSFLP  548

Query  2069  KGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             K  E+   IPA++ +IYN+ TL E ++   SIR W NNQRM
Sbjct  549   K--ELGQWIPATLLVIYNVSTLLENLKIGLSIRTWCNNQRM  587



>gb|KGN63235.1| hypothetical protein Csa_2G416250 [Cucumis sativus]
Length=746

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/612 (51%), Positives = 402/612 (66%), Gaps = 19/612 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         + ++V I +LL+SL AYRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPLYEKTNIKRPTQKVLDVAIFILLVSLDAYRVLLMYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +  KWN V   TYP R L+       E PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIILKWNPVHFETYPRRLLK----REMELPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKL CYVSDD  S +T YAL EA KF K+WVPFCKKY + VRAPFRYF+ D   PP
Sbjct  121   DYPANKLGCYVSDDGCSDLTLYALNEALKFGKIWVPFCKKYEIQVRAPFRYFSND-PMPP  179

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK------FATFADLDPNDHSTII  1090
                SS +F+ +W  + +EY  L GKI+ A +  S   +         F++L   +H TI+
Sbjct  180   HLPSSTQFQNDWVTVKEEYEKLEGKIKEAEESRSFVLEEEDGIDLTAFSNLHTKNHPTIV  239

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             K++ EN + ++  +PHLIY+SRE+  KH H++KAGAMNVLTRVSGV+TNAP++LNVDCD 
Sbjct  240   KILWEN-KKVSDELPHLIYVSRERSFKHHHHYKAGAMNVLTRVSGVLTNAPYILNVDCDM  298

Query  1271  YVNNPEVVLHAMCFLLGAK-DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAA  1447
             + N+P+VVLHAMC  L +K D  D G+VQ PQ FYDGL+DDP+ +Q  +I+    RG   
Sbjct  299   FANDPQVVLHAMCVFLNSKYDLEDIGYVQTPQCFYDGLEDDPFGNQLVVIFEYYARGVMG  358

Query  1448  IQGSFYDGTGCFHRRKVIYGLSPNDT---VTAEKLTDHDLQKIYGKSKIFVtsatttlsg  1618
             +QG  Y GTGCFHRRKV+YG  P+ +   +  +  ++ +L +++G SK F  SA      
Sbjct  359   LQGPVYSGTGCFHRRKVLYGQLPHHSTHFMDGKAYSEQELMEVFGYSKTFAKSAIYAFEE  418

Query  1619  slsset-FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             +          + +LEAA+QVA C YE  TTWG  IGW YGS TED+LTG+ IQ  GW++
Sbjct  419   TTHGYHPNSRFNDNLEAANQVAGCDYEINTTWGSKIGWIYGSTTEDVLTGLVIQSRGWRS  478

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
              +     P FLGC PS  + SL Q KRW SG  EILFS   PIF  LFG LQ++QC  Y+
Sbjct  479   IYIALNPPAFLGCAPSQLVASLTQQKRWVSGLLEILFSKHFPIFGTLFGKLQWKQCAVYI  538

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
               + W +R I EL YA LPPYCLI+NS F P   E AI IP  +FIIYN   L  Y E +
Sbjct  539   WLLTWGLRSIPELSYALLPPYCLISNSSFFPNMEERAIYIPIFLFIIYNFQQLLLYKETR  598

Query  2156  ESIRAWWNNQRM  2191
             +SIRAWWNNQRM
Sbjct  599   QSIRAWWNNQRM  610



>ref|XP_008455906.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Cucumis 
melo]
Length=750

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/615 (52%), Positives = 419/615 (68%), Gaps = 25/615 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE  +      RA+++ I +LL+SL+AYRV  +++HG+ +   +A +CE WF+F+W 
Sbjct  13    LPLYEKLIIKRPTQRALDIAIFILLISLVAYRVLLMYNHGFSHLQTIAFLCEFWFSFVWF  72

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L + T+WN V+  TYP+R L+       E+PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  73    LAIVTRWNPVDFKTYPQRLLK----REVEYPAVDIFVTTADPMLEPPIITVNTVLSLMAL  128

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP+NKL+CYVSDD  SP+TFYAL EA  FAK+W+PFCKKY+V VRAPF YF+     PP
Sbjct  129   DYPSNKLSCYVSDDGCSPLTFYALNEALNFAKIWIPFCKKYDVQVRAPFMYFST----PP  184

Query  935   ---ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK-----FATFADLDPNDHSTII  1090
                 SS +F+ +WK +  EY  L  KI+ A +    +++      A F+++    H +II
Sbjct  185   HHLHSSTQFQYDWKTLKVEYEKLERKIKEAEENRIGWHEESGIDLAAFSNISTKHHPSII  244

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             K++ EN E ++  +PHLIY+SREK  KH H+ KAGAMNVLTRVSGV+TNAP++LNVDCD 
Sbjct  245   KILWENKE-VSDELPHLIYVSREKSFKHHHHCKAGAMNVLTRVSGVLTNAPYILNVDCDM  303

Query  1271  YVNNPEVVLHAMCFLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAA  1447
             +VNNP+VVLHAMC  L +KD+  D G+VQ PQ FYDGLKDDP+ +Q  +++    RG   
Sbjct  304   FVNNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDPFGNQLVVVFEYSARGIMG  363

Query  1448  IQGSFYDGTGCFHRRKVIYGLSPNDTV--TAEKLTDHDLQKIYGKSKIFVtsatttlsgs  1621
             +QG FY GTGCFHRRKV+Y   P+ T+     K ++ +L K +G SK F  SAT      
Sbjct  364   LQGPFYSGTGCFHRRKVLYAQFPHHTIYFLDGKASEQELIKTFGYSKTFAKSATYAFKDQ  423

Query  1622  lssetF----GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
              ++ +     G+L+ +LEAA+QVA CGYE  T+WG  IGW YGS +ED+LTG+ IQ  GW
Sbjct  424   NTNTSGYPPKGLLNNNLEAANQVAGCGYEISTSWGSEIGWMYGSTSEDVLTGLVIQTRGW  483

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK-CPIFAALFGNLQFRQCL  1966
             ++ F     P FLGC PS  + SL Q KRWASG  ++L + + CPIF  LFG LQ++QC 
Sbjct  484   RSIFLALNPPAFLGCAPSQLVASLTQQKRWASGFLQVLLNRRHCPIFGTLFGKLQWKQCA  543

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYM  2146
             AY+  + W +R I EL Y  LPPYCLITNS   P   E AI IP  +FIIYN   L +Y 
Sbjct  544   AYLWILTWGLRSIPELSYTLLPPYCLITNSSIFPTVKERAIFIPIFLFIIYNFQQLLQYK  603

Query  2147  EEKESIRAWWNNQRM  2191
             E  +SIRAWWNNQ+M
Sbjct  604   ETGQSIRAWWNNQKM  618



>ref|XP_004287961.1| PREDICTED: cellulose synthase-like protein H1-like [Fragaria 
vesca subsp. vesca]
Length=758

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/607 (52%), Positives = 408/607 (67%), Gaps = 16/607 (3%)
 Frame = +2

Query  395   FPLYE-TKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIW  571
              PL E T V+   + RA+E+VIL L   L+AYR+++L  HG    WLLA +CESWF F W
Sbjct  7     LPLCEKTSVKVPTLQRALEIVILFLFTCLLAYRLFSLTDHGI--PWLLAFLCESWFAFNW  64

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             VL   T+W  ++  TYP   L+ V     E PAVDMFV+TA+P LEPPI+TVNTVLSLLA
Sbjct  65    VLNFITQWTPMDYKTYPNNLLQQVP----ELPAVDMFVSTADPVLEPPIVTVNTVLSLLA  120

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP  931
             ++YPA+KLACYVSDD  SP+T ++L+EASKFA++WVPFCKKY++ VRAPFRYF    +  
Sbjct  121   VDYPAHKLACYVSDDGCSPLTLFSLIEASKFARIWVPFCKKYDIQVRAPFRYFCEGESTL  180

Query  932   PESS--PEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKV  1096
             P S   PEF  EW K+ DEY +LC KIE A        +   +ATF+    N+H T+IKV
Sbjct  181   PSSHFPPEFLLEWTKVKDEYESLCQKIEGAGDHSVPLDISGDYATFSHKQTNNHPTVIKV  240

Query  1097  ICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             I EN + L+ G+PHL+Y++REKRP + H++KAGAMNVLTRVSG+MTNAPFMLNVDCD Y 
Sbjct  241   IWENKQRLSDGLPHLVYVAREKRPNYPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMYA  300

Query  1277  NNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
             +N ++VLHAMC LLG K E+   FVQ PQ  YD LKDDP+ +   +       G A IQG
Sbjct  301   SNSKIVLHAMCLLLGFKHEKQGAFVQCPQICYDYLKDDPFGNSMSVTLKTFWPGIAGIQG  360

Query  1457  SFYDGTGCFHRRKVIYGLSPNDTV--TAEKLTDHDLQKIYGKSKIFVtsatttlsgslss  1630
               Y GTGCFHRRKVIYGLS  D+       L    L+  +G S   ++SAT  L+  +  
Sbjct  361   PLYAGTGCFHRRKVIYGLSLQDSTGHVQGNLDVEALKDRFGNSMELLSSATNILAEKVDH  420

Query  1631  etFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVP  1810
                  LS ++E A +VA CG+E  T+WG  +GW YGS+TED+LTG+ I   GWK+  C+ 
Sbjct  421   PR--DLSSAVEEACKVACCGFEHNTSWGKQVGWIYGSITEDLLTGMKIHARGWKSILCML  478

Query  1811  ERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILW  1990
             + PGF+G  P++    L Q KRW +G  E+LFS   PIF+ L   L+FR CLAY+  ++W
Sbjct  479   DPPGFVGSAPTSVPVMLTQRKRWITGLLEVLFSKNSPIFSTLNAKLEFRMCLAYIWILIW  538

Query  1991  PVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRA  2170
              +  I  LCY+ LP YC++TNSHFLPK  E A+++ A++F+  NLY L+ Y+E   SI A
Sbjct  539   GLHSIPALCYSLLPAYCIMTNSHFLPKIGEPALLMFAALFLGNNLYNLYFYLESGLSITA  598

Query  2171  WWNNQRM  2191
             WWN QRM
Sbjct  599   WWNYQRM  605



>ref|XP_003579750.1| PREDICTED: cellulose synthase-like protein H1 [Brachypodium distachyon]
Length=754

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/568 (54%), Positives = 374/568 (66%), Gaps = 10/568 (2%)
 Frame = +2

Query  506   SHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFV  685
             S  + + WL ALVCE+WFTF+W+L ++ KW+ V   T+PE  LE       E PAVDMFV
Sbjct  45    STTWQWPWLAALVCEAWFTFVWLLTINGKWSPVRFDTFPEHLLE----ADDELPAVDMFV  100

Query  686   TTANPELEPPILTVNTVLSLLALEYP-ANKLACYVSDDSASPVTFYALVEASKFAKLWVP  862
             TTA+P LEPP++TVNTVLSLLA++YP A KLACYVSDD  SPVT YAL E + FA LWVP
Sbjct  101   TTADPALEPPVITVNTVLSLLAVDYPDARKLACYVSDDGCSPVTCYALSEVAAFAALWVP  160

Query  863   FCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN-  1039
             FCK++ V VRAPF YF++          +F   W  M  EY  L  +IE A +   L + 
Sbjct  161   FCKRHAVGVRAPFMYFSSAPDEAGSHGADFLESWASMKSEYDKLASRIENADEGSILQDA  220

Query  1040  KFATFADLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTR  1216
             +FA F   +  +H TIIKV+ +N +S    G PHL+Y+SREK P+H HNFKAGAMNVLTR
Sbjct  221   EFAEFVGSERRNHPTIIKVLWDNSKSKTGEGFPHLVYVSREKSPRHYHNFKAGAMNVLTR  280

Query  1217  VSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPY  1396
             VS VMTNAP MLNVDCD + NNP V LHAMC LLG  DE D+GFVQ PQ FY  L+DDP+
Sbjct  281   VSAVMTNAPIMLNVDCDMFANNPGVALHAMCLLLGFDDETDSGFVQAPQKFYGSLRDDPF  340

Query  1397  ASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTV---TAEKLTDHDLQKI  1567
              +Q ++++  LG G A IQG FY GTGCFHRRKVIYG  P DTV   T    +  +LQ  
Sbjct  341   GNQMEVLFQKLGGGVAGIQGMFYGGTGCFHRRKVIYGTPPPDTVKHGTTGSPSYKELQMK  400

Query  1568  YGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVT  1747
             +G SK  + S+ + +SG + + T   +S  +E A QV  C YE GT WG  +GW YGS+T
Sbjct  401   FGNSKELIDSSRSIISGDVLARTTANMSSRIEMAKQVGACNYEAGTCWGQEVGWVYGSMT  460

Query  1748  EDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIF  1927
             EDILTG  I   GWK+       P FLGC P+ G  SL Q KRWA+G  EIL S   PI 
Sbjct  461   EDILTGQRIHTTGWKSVLMDTNPPAFLGCAPTGGPASLTQFKRWATGVLEILISKNSPIL  520

Query  1928  AALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASI  2107
               +FG LQ RQCLAY+I  +WPVR  FELCYA L P+CL+ N  FLPK ++    IP ++
Sbjct  521   GTIFGRLQLRQCLAYLIVDVWPVRAPFELCYALLGPFCLLANQSFLPKASDEGFYIPVAL  580

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             F+ + +Y L EY +   S RAWWNN RM
Sbjct  581   FLTFQVYYLMEYKDCGLSARAWWNNHRM  608



>ref|XP_007149991.1| hypothetical protein PHAVU_005G116700g [Phaseolus vulgaris]
 gb|ESW21985.1| hypothetical protein PHAVU_005G116700g [Phaseolus vulgaris]
Length=750

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/612 (51%), Positives = 411/612 (67%), Gaps = 20/612 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLY+     +  SRAV+ +I  LLL L+ YRV++ H   Y + W +A +CESWFT  W+
Sbjct  7     LPLYQKVWLKHTFSRAVDSLIFFLLLMLLGYRVFSYHH--YSFPWFVAFLCESWFTITWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW   +T T+    L+ V     E P VD+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    TTISTKWTPAQTITHLNHLLQRVG----ELPQVDVFVTTADPVLEPPIITVNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+ ++ALVEA+KFAKLWVPFCKKYNV VRAPFRYF+ + T   
Sbjct  121   DYPANKLACYVSDDGCSPLIYHALVEATKFAKLWVPFCKKYNVQVRAPFRYFSEEATVEK  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPS---LFNKFATFADLDPNDHSTIIKVICE  1105
                PEF++EW KM +EY  L  KI+ A+Q+ +   L  ++  F+     DH +IIKV+ E
Sbjct  181   SDFPEFQQEWLKMKEEYEELSCKIQNASQELNACPLVGEYEVFSKTQMRDHPSIIKVLWE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E L+ GVP++IYISREKRP+H H++KAGAMNVLTR+SG+MTNAP++LNVDCD YVNNP
Sbjct  241   NKEGLSDGVPNIIYISREKRPQHPHHYKAGAMNVLTRISGLMTNAPYILNVDCDMYVNNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++  HA+C LL  K E++  FVQ PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  301   KIAQHALCILLDPKGEKEVAFVQCPQRFYDTVKDDAYGNQLVALPMYIGGGFAGLQGIIY  360

Query  1466  DGTGCFHRRKVIYGLSPN-DTVTAEK--------LTDHDLQKIYGKSKIFVtsatttlsg  1618
              GT CFHRRKV+YGLSP+ D  TA+K        L++    +I+G SK FV SA   L  
Sbjct  361   AGTNCFHRRKVLYGLSPDHDIQTAKKDFGFIDGTLSEKKTVQIFGASKGFVESANHALEE  420

Query  1619  slssetFGVL-SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
                +    +  S   EAA+Q++ C YE  T WG  +GW YGS +ED+LTG+ + R GW++
Sbjct  421   MAFTPNHNLFKSLDREAANQISTCDYENSTEWGKQVGWLYGSTSEDVLTGLLMHRKGWRS  480

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
               C P+   F+GC+P   LG + Q KRW+SG  +I  S  CPIF  LFG LQFR+CLAY+
Sbjct  481   EVCSPDPMAFMGCSPQDNLGQMAQHKRWSSGLFDIFLSSHCPIFGTLFGKLQFRECLAYI  540

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
                 W +R + E+ YA LP YC+ITNS FLP   E+ +  P S+F++YN+ TL E++   
Sbjct  541   WLTNWALRSVPEISYALLPAYCIITNSSFLPN-KELGMWFPVSVFVVYNVGTLSEHLMSG  599

Query  2156  ESIRAWWNNQRM  2191
              S R WWNNQRM
Sbjct  600   LSARTWWNNQRM  611



>ref|XP_003596945.1| Cellulose synthase-like protein H1 [Medicago truncatula]
 gb|AES67196.1| cellulose synthase-like protein [Medicago truncatula]
Length=781

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/605 (52%), Positives = 413/605 (68%), Gaps = 17/605 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLY+  +     SR ++   LL LL L+ YR+  L+ + Y + WL+A +CESWFTFIWV
Sbjct  7     LPLYDKFLLKYTFSRVMDSFTLLFLLLLLGYRI--LYINNYPFPWLVAFLCESWFTFIWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             + +STKW    T T+ +R L        E PA+D+FVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  65    VTMSTKWTPAYTITHLDRLLL----REHELPALDLFVTTADPGLEPPIITVNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+TFYALVEASKFAKLWVPFCKKYNV VRAPFRYF  ++    
Sbjct  121   DYPANKLACYVSDDGCSPLTFYALVEASKFAKLWVPFCKKYNVQVRAPFRYFCDENAVSN  180

Query  935   -ESSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDHSTIIKVICEN  1108
              E SPEF +EW +M +EY  L  KIE A+Q P  L  +FA F+  +  +HSTIIKVI EN
Sbjct  181   IEESPEFYQEWLRMKEEYGYLKSKIENASQNPLPLVGEFAIFSSTNHKNHSTIIKVIWEN  240

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E+L   +PH+IYISREK+  H H +KAGAMNVLTRVSG+MTNAPF+LN+DCD +VNNP+
Sbjct  241   KENLLDALPHIIYISREKKLDHPHQYKAGAMNVLTRVSGMMTNAPFILNLDCDMHVNNPK  300

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             + LHA+C LL +K E++  FVQ PQ FYDGLKDDP+ +Q   ++  LG G   +QG  Y 
Sbjct  301   IALHALCILLDSKGEKEVAFVQCPQQFYDGLKDDPFGNQLVALFVYLGGGFGGLQGMLYA  360

Query  1469  GTGCFHRRKVIYGLSPN-DTVTAEKLTD---HDLQKIYGKSKIFVtsatttlsgslsset  1636
             GT CFHRRKVIYGLSP+ D +   K  D   ++++ ++G SK F+  + T      +   
Sbjct  361   GTNCFHRRKVIYGLSPDHDDIQNRKKGDDVVNEMEVVFGTSKRFI-ESATHALEGKTFTR  419

Query  1637  FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPER  1816
                L  +LE A +VA+C YE+GT WG  +GW YGS +ED+LTG+ I   GW++  C P+ 
Sbjct  420   IDNLCNTLETAKKVASCTYEYGTAWGKQVGWIYGSTSEDVLTGLDIHTRGWRSEMCSPDP  479

Query  1817  PGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPV  1996
               F+GC+P   + S+ Q KRWASG  +IL S   P    L+G LQFR+ L Y   + W +
Sbjct  480   LAFMGCSPQDNIVSMIQQKRWASGLFDILLSKHNPFLGFLYGKLQFREALGYFWILSWAL  539

Query  1997  RPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
             R + E+CYA LP YC++TNS+FLP+     + I A++F+ YN+ T+ E ++   SIR WW
Sbjct  540   RSVPEICYAALPAYCILTNSNFLPE----KLWIHAALFVTYNISTISESLKTGLSIRTWW  595

Query  2177  NNQRM  2191
             NNQ+M
Sbjct  596   NNQKM  600



>ref|XP_004487424.1| PREDICTED: cellulose synthase-like protein B4-like isoform X2 
[Cicer arietinum]
Length=747

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/605 (51%), Positives = 408/605 (67%), Gaps = 14/605 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         RA+++ ILLLL SL+++R  ++++  +   W LA  CESWFT+ W+
Sbjct  7     LPLYEKIWVKRTFQRAIDIFILLLLFSLLSFRFLSINT--FTLPWFLAFSCESWFTYTWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+   T TYP+R L+ V     E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  65    VILNTKWSPALTKTYPQRLLQRVP----ELPRVDLFVTTADPVLEPPIITLNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP+NKLACYVSDD  SP TFYALVE SKFAK WVPFCKKYN+ VRAP RYF     F  
Sbjct  121   DYPSNKLACYVSDDGCSPFTFYALVEGSKFAKHWVPFCKKYNIQVRAPLRYFCEVTNFES  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW  M D Y NL   IE  T+    F    +F  F++ +  +H +I+KVI E
Sbjct  181   EDSSEFKQEWFLMKDMYDNLSRNIEDVTRNLIPFPLEGEFEVFSNTEKINHPSIVKVILE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
               + L+ G+PHLIYISREKRPK+QHN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  241   TKDELSNGLPHLIYISREKRPKYQHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +++ HAMC L+ +K  +D  FVQ  Q FYDG+KDDP+ +Q+   +  + RG A +QG +Y
Sbjct  301   KIIQHAMCILMDSKSGKDVAFVQCFQQFYDGIKDDPFGNQWVAAFEYIIRGMAGLQGPYY  360

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++    +  KLT+  L + +G SK FV SAT     S  S   
Sbjct  361   GGTNTFHRRNAIYGLYPDEVQYGKKGKLTEKKLIQQFGSSKEFVKSATHAFERSDYSTNN  420

Query  1640  GV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPER  1816
             G+ LS  +E A QV++CGY+ GT+WG  +GW YGS++ED+ TG+ + R GW++  C P +
Sbjct  421   GISLSNFIEEAIQVSDCGYDNGTSWGKKMGWLYGSISEDVPTGLNMHRKGWRSECCTPVQ  480

Query  1817  PGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPV  1996
               F GC P   L ++ Q KRWASG T + F    P+   LFG +Q R  L+Y     W +
Sbjct  481   TAFKGCAPVGLLTTMIQQKRWASGLTVVFFGRHSPVMGTLFGKIQIRAGLSYCWLTNWGL  540

Query  1997  RPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
             R +FE+CYA L  YC+ITNS+  PKG  + + IP ++F+IYNL+TL EY+    S+R WW
Sbjct  541   RSVFEVCYAALVAYCIITNSNIFPKG--LGLWIPFTLFVIYNLHTLQEYLSTGLSLRHWW  598

Query  2177  NNQRM  2191
             NNQRM
Sbjct  599   NNQRM  603



>ref|XP_004487423.1| PREDICTED: cellulose synthase-like protein B4-like isoform X1 
[Cicer arietinum]
Length=748

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/606 (51%), Positives = 408/606 (67%), Gaps = 15/606 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         RA+++ ILLLL SL+++R  ++++  +   W LA  CESWFT+ W+
Sbjct  7     LPLYEKIWVKRTFQRAIDIFILLLLFSLLSFRFLSINT--FTLPWFLAFSCESWFTYTWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+   T TYP+R L+ V     E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  65    VILNTKWSPALTKTYPQRLLQRVP----ELPRVDLFVTTADPVLEPPIITLNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP+NKLACYVSDD  SP TFYALVE SKFAK WVPFCKKYN+ VRAP RYF     F  
Sbjct  121   DYPSNKLACYVSDDGCSPFTFYALVEGSKFAKHWVPFCKKYNIQVRAPLRYFCEVTNFES  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW  M D Y NL   IE  T+    F    +F  F++ +  +H +I+KVI E
Sbjct  181   EDSSEFKQEWFLMKDMYDNLSRNIEDVTRNLIPFPLEGEFEVFSNTEKINHPSIVKVILE  240

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
               + L+ G+PHLIYISREKRPK+QHN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  241   TKDELSNGLPHLIYISREKRPKYQHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  300

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +++ HAMC L+ +K  +D  FVQ  Q FYDG+KDDP+ +Q+   +  + RG A +QG +Y
Sbjct  301   KIIQHAMCILMDSKSGKDVAFVQCFQQFYDGIKDDPFGNQWVAAFEYIIRGMAGLQGPYY  360

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE---KLTDHDLQKIYGKSKIFVtsatttlsgslsset  1636
              GT  FHRR  IYGL P++    +   KLT+  L + +G SK FV SAT     S  S  
Sbjct  361   GGTNTFHRRNAIYGLYPDEVQYGKKVGKLTEKKLIQQFGSSKEFVKSATHAFERSDYSTN  420

Query  1637  FGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPE  1813
              G+ LS  +E A QV++CGY+ GT+WG  +GW YGS++ED+ TG+ + R GW++  C P 
Sbjct  421   NGISLSNFIEEAIQVSDCGYDNGTSWGKKMGWLYGSISEDVPTGLNMHRKGWRSECCTPV  480

Query  1814  RPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWP  1993
             +  F GC P   L ++ Q KRWASG T + F    P+   LFG +Q R  L+Y     W 
Sbjct  481   QTAFKGCAPVGLLTTMIQQKRWASGLTVVFFGRHSPVMGTLFGKIQIRAGLSYCWLTNWG  540

Query  1994  VRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
             +R +FE+CYA L  YC+ITNS+  PKG  + + IP ++F+IYNL+TL EY+    S+R W
Sbjct  541   LRSVFEVCYAALVAYCIITNSNIFPKG--LGLWIPFTLFVIYNLHTLQEYLSTGLSLRHW  598

Query  2174  WNNQRM  2191
             WNNQRM
Sbjct  599   WNNQRM  604



>ref|XP_008455907.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Cucumis 
melo]
Length=746

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/616 (52%), Positives = 413/616 (67%), Gaps = 23/616 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         R +++ I +LL+SL AYRV  +++HG+ Y  ++A +CE WF+FIW 
Sbjct  5     LPLYEKTNIKRPTQRVLDITIFILLVSLNAYRVLLIYNHGFSYLQIIAFLCEFWFSFIWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +  KWN V   TYP+R LE       E+PAVD+F+TTA+  LEPPI+TVNTVLSL+AL
Sbjct  65    LTIIIKWNPVHYETYPQRLLE----REMEYPAVDIFITTADTVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKL CYVSDD  S +T YAL EA KF K+WVPFCKKY + VRAPFRYF+ D + PP
Sbjct  121   DYPANKLGCYVSDDGCSALTLYALKEALKFGKIWVPFCKKYEIQVRAPFRYFSND-SMPP  179

Query  935   E--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK------FATFADL-DPNDHSTI  1087
                SS +F  +W  +  EY  L GKI+ A +  S   +       A F++L   N+H TI
Sbjct  180   HLPSSTQFLNDWYTVKVEYEKLEGKIKEAEESRSFGLEEEDGIDLAAFSNLHTKNNHPTI  239

Query  1088  IKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCD  1267
             +K++ EN E ++  +PHLIY+SREK  KH H+ KAGAMNVLTRVSGV+TNAP++LNVDCD
Sbjct  240   VKILWENKE-VSDELPHLIYVSREKSFKHHHHCKAGAMNVLTRVSGVLTNAPYILNVDCD  298

Query  1268  FYVNNPEVVLHAMCFLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNA  1444
              +VNNP+VVLHAMC  L +KD+  D G+VQ PQ FYDGLKDDP+ +Q  +++    RG  
Sbjct  299   MFVNNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDPFGNQLVVVFEYSARGIM  358

Query  1445  AIQGSFYDGTGCFHRRKVIYGLSPNDTV--TAEKLTDHDLQKIYGKSKIFVtsatttlsg  1618
              +QG FY GTGCFHRRKV+Y   P+ T+     K ++ +L K +G SK F  SAT     
Sbjct  359   GLQGPFYSGTGCFHRRKVLYAQFPHHTIYFLDGKASEQELIKTFGYSKTFAKSATYAFKD  418

Query  1619  slssetF----GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
               ++ +     G+L+ +LEAA+QVA CGYE  T+WG  IGW YGS +ED+LTG+ IQ  G
Sbjct  419   QNTNTSGYPPKGLLNNNLEAANQVAGCGYEISTSWGSEIGWMYGSTSEDVLTGLVIQTRG  478

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK-CPIFAALFGNLQFRQC  1963
             W++ F     P FLGC PS  + SL Q KRWASG  ++L + + CPIF  LFG LQ++QC
Sbjct  479   WRSIFLALNPPAFLGCAPSQLVASLTQQKRWASGFLQVLLNRRHCPIFGTLFGKLQWKQC  538

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEY  2143
              AY+  + W +R I EL Y  LPPYCLITNS   P   E AI IP  +FIIYN   L +Y
Sbjct  539   AAYLWILTWGLRSIPELSYTLLPPYCLITNSSIFPTVKERAIFIPIFLFIIYNFQQLLQY  598

Query  2144  MEEKESIRAWWNNQRM  2191
              E  +SIRAWWNNQ+M
Sbjct  599   KETGQSIRAWWNNQKM  614



>ref|XP_006594901.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Glycine max]
Length=748

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/604 (52%), Positives = 406/604 (67%), Gaps = 11/604 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         R ++ +IL+LLL L++YR+++  S+ + + W LA +CESWFTF W+
Sbjct  8     LPLYEKIWVKRKFQRVIDTLILVLLLLLLSYRLFS--SNNFTFPWFLAFICESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+   T T+P R L  V     EFP VD+ VTTA+  LEPPI+TVNTVLSLLAL
Sbjct  66    VILNTKWSPAVTITHPNRLLLRVPES--EFPPVDLLVTTADHVLEPPIITVNTVLSLLAL  123

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP NKLACYVSDD  SP+TFYALVEASKFAK WVPFCKK  V VRAPFRYF+   T   
Sbjct  124   DYPTNKLACYVSDDGCSPLTFYALVEASKFAKFWVPFCKKNCVQVRAPFRYFSDIATNKS  183

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW +M D Y NLC KIE  T K     L  +FA F++ D  +H TIIKVI E
Sbjct  184   EDSLEFKQEWLQMKDMYDNLCQKIEEVTGKTIPFQLDGEFAVFSNTDQRNHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L  G+PHLIYISREKRP++ HN+KAGAMNVLTRVSG+MTNAPF+LNVDCD +VNNP
Sbjct  244   NMGDLLDGLPHLIYISREKRPQYHHNYKAGAMNVLTRVSGLMTNAPFILNVDCDMFVNNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C L+ ++  ++  FVQ  Q FYDG+KDDP+ +Q+ I +  +  G A +QG FY
Sbjct  304   KIVLHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPFGNQWMITFKNIIMGMAGLQGPFY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++  +    KL    L + +G SK F+ S+   L GS  S   
Sbjct  364   GGTNAFHRRNAIYGLYPDEIESERKGKLEGKILIEKFGSSKEFIKSSAQALGGSAFSAND  423

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                   +EAA+QV+NC YE+ T WG  +GW YGS++ED+ TG+ IQR GW++  C P+  
Sbjct  424   ITTFNFIEAATQVSNCEYEYDTCWGKQMGWLYGSISEDVPTGLNIQRKGWRSECCTPDPI  483

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRWASG T + F    PI   LFG  QFR  L++     W +R
Sbjct  484   AFTGCAPGGILSTMLQQKRWASGLTVVFFGKHSPITGMLFGKTQFRAGLSFFWLTNWGLR  543

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
              +F +CY  L  +C+ITN++  PKG  + + IP ++F+IYN++TL EY+    SIR WWN
Sbjct  544   GLFLVCYIALLAFCIITNTNIFPKG--LGLWIPIALFVIYNVHTLLEYLTIGLSIRHWWN  601

Query  2180  NQRM  2191
             NQRM
Sbjct  602   NQRM  605



>gb|KHN36521.1| Cellulose synthase-like protein B3 [Glycine soja]
Length=748

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/604 (51%), Positives = 407/604 (67%), Gaps = 11/604 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         R ++ +IL+LLL L++YR+++  S+ + + W LA +CESWFTF W+
Sbjct  8     LPLYEKIWVKRKFQRVIDTLILVLLLLLLSYRLFS--SNNFTFPWFLAFICESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+   T T+P R L  V     EFP VD+ VTTA+  LEPPI+TVNTVLSLLAL
Sbjct  66    VILNTKWSPAVTITHPNRLLLRVPES--EFPPVDLLVTTADHVLEPPIITVNTVLSLLAL  123

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP NKLACYVSDD  SP+TFYAL+EASKFAK WVPFCKK  V VRAPFRYF+   T   
Sbjct  124   DYPTNKLACYVSDDGCSPLTFYALMEASKFAKFWVPFCKKNCVQVRAPFRYFSDIATNKS  183

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW +M D Y NLC KIE  T K     L  +FA F++ D  +H TIIKVI E
Sbjct  184   EDSLEFKQEWLQMKDMYDNLCQKIEEVTGKTIPFQLDGEFAVFSNTDQRNHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L  G+PHLIYISREKRP++ HN+KAGAMNVLTRVSG+MTNAPF+LNVDCD +VNNP
Sbjct  244   NMGDLLDGLPHLIYISREKRPQYHHNYKAGAMNVLTRVSGLMTNAPFILNVDCDMFVNNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C L+ ++  ++  FVQ  Q FYDG+KDDP+ +Q+ I +  +  G A +QG FY
Sbjct  304   KIVLHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPFGNQWMITFKNIIMGMAGLQGPFY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++  +    KL +  L + +G SK F+ S+   L GS  S   
Sbjct  364   GGTNAFHRRNAIYGLYPDEIESERKGKLEEKILIEKFGSSKEFIKSSAQALGGSAFSAND  423

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                   +EAA+QV+NC YE+ T WG  +GW YGS++ED+ TG+ IQR GW++  C P+  
Sbjct  424   ITTFNFIEAATQVSNCEYEYDTCWGKQMGWLYGSISEDVPTGLNIQRKGWRSECCTPDPI  483

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRWASG T + F    PI   LFG  QFR  L++     W +R
Sbjct  484   AFTGCAPGGILSTMLQQKRWASGLTVVFFGKHSPITGMLFGKTQFRAGLSFFWLTNWGLR  543

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
              +F +CY  L  +C+ITN++  PKG  + + IP ++F+IYN++TL EY+    SIR WWN
Sbjct  544   GLFLVCYIALLAFCIITNTNIFPKG--LGLWIPIALFVIYNVHTLLEYLTIGLSIRHWWN  601

Query  2180  NQRM  2191
             NQRM
Sbjct  602   NQRM  605



>gb|AES67197.2| cellulose synthase H1-like protein [Medicago truncatula]
Length=750

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/604 (51%), Positives = 415/604 (69%), Gaps = 13/604 (2%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYT-WLLALVCESWFTFIWVL  577
             LYE       + RA++++ILLLL SL+ YR++ + S+  +   W LA  CESWFT+ W++
Sbjct  9     LYEKIWIKRTLQRAIDLLILLLLFSLLCYRIFFIISNKTFTIPWFLAFSCESWFTYTWII  68

Query  578   VVSTKWNQVETTTYPERFLEWV-ENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++TKW+   T TYP R L+ + EN   E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  69    LLNTKWSPAVTKTYPNRLLQRLPEN---ELPCVDLFVTTADPVLEPPIITLNTVLSLLAL  125

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S  TFY L+EASKFAK WVPFCKKYN+ VRAPFRYF +  T   
Sbjct  126   DYPANKLACYVSDDGCSVFTFYGLLEASKFAKFWVPFCKKYNIQVRAPFRYF-SQVTNSD  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
             + S EF++EW KM D Y NL  KIE  T+  + F    ++A F + +  +H +I+KVI E
Sbjct  185   DDSAEFKQEWLKMKDMYDNLSHKIEDVTRNSTSFQFEGEYAVFLNTEKRNHPSIVKVILE  244

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N +SL+ G+PHLIYISREKRPK++HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  245   NYDSLSDGLPHLIYISREKRPKYEHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  304

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +++ HAMC L+ +K+ +D  FVQ  Q FYDG+KDDP+ +Q+   +  + +G   +QG FY
Sbjct  305   KIIQHAMCILMDSKNGKDVAFVQCFQQFYDGIKDDPFGNQWVASFEYIIKGMGGLQGPFY  364

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++       K+T+  L + +G SK FV S T    GS +S   
Sbjct  365   GGTNTFHRRNAIYGLYPDEIQYGRKGKITEKMLIQQFGSSKEFVKSVTHAFEGSGNSIDG  424

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                S  L+ A QV++CGYE+GT+WG  + W YGS++ED+ TG+ +QR GW++  C PE  
Sbjct  425   ISPSNLLDKAIQVSDCGYEYGTSWGKQMCWLYGSISEDVPTGLNMQRKGWRSECCTPEPT  484

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F+GC P   L ++ Q KRW+SG T + FS   P+   LFG +QFR  L+Y     W +R
Sbjct  485   AFMGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMCTLFGKIQFRAGLSYCWLTNWGLR  544

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
              +FE+ YA L  YC+ITN+   PKG  + + IP ++F+IY ++TL EY+ +  S+R WWN
Sbjct  545   SVFEVSYAALVAYCIITNTSIFPKG--LGLWIPLTLFVIYTIHTLQEYLSKGLSLRFWWN  602

Query  2180  NQRM  2191
             NQRM
Sbjct  603   NQRM  606



>ref|XP_004506255.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Cicer arietinum]
Length=714

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/601 (51%), Positives = 393/601 (65%), Gaps = 40/601 (7%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +   R ++  IL+LLL L+ YR+ +++++ ++  W +AL+CE WFT  WV
Sbjct  7     LPLYEKYWYKHNYKRVLDSFILILLLLLLGYRIISINNYSFH--WFVALICELWFTLSWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +ST+WN     TYP   L+ V+    E P VD+FVTTA+ ELEPPI+T+NTVLSLLAL
Sbjct  65    FTISTQWNPALIKTYPHLLLQSVQ----ELPPVDLFVTTADDELEPPIITMNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP++KLACYVSDD  SP+ FYAL E+SKFAK WVPFCKKY + VRAPFRYF  D     
Sbjct  121   DYPSHKLACYVSDDGCSPLIFYALQESSKFAKHWVPFCKKYKIQVRAPFRYFCDDEC--T  178

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK-PSLF-NKFATFADLDPNDHSTIIKVICEN  1108
              ++ EF  EW +M   Y NL  KIE   +  PSL   +F  F++    +H TIIKVI EN
Sbjct  179   TNNEEFNHEWLRMKRMYENLSHKIEVDPKSIPSLLEGEFDVFSNTQRTNHPTIIKVIWEN  238

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E +  G+PHLIYISREKRPK  H+FKAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP 
Sbjct  239   KEMVEDGLPHLIYISREKRPKQPHHFKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNPN  298

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             +V HAMC LL +K E++  F Q PQ FY  LKDDP+ +Q  I+   LG G A +QG FY 
Sbjct  299   IVQHAMCILLDSKGEKEVAFAQCPQQFYATLKDDPFGNQMTILLKYLGAGLAGLQGIFYG  358

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             GT CFHRRKVIYGLSP+D       + +D+                             +
Sbjct  359   GTNCFHRRKVIYGLSPDDVENGRIYSPNDIN----------------------------V  390

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
             + ++E A+QVA  GYE+GT WG  +GW YGS+TED+LTG+ I + GW++  C P+   F 
Sbjct  391   TKAVEEATQVACYGYEYGTGWGKQVGWIYGSITEDVLTGLTIHKKGWRSELCTPDPVAFR  450

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GC P  G  S+ Q KRWA+G  EI FS  CPIF  +FG L FRQ LAYM  + W   P+ 
Sbjct  451   GCAPIGGPTSMAQHKRWATGMLEIFFSKHCPIFGTIFGKLSFRQFLAYMWIMNWGFNPVA  510

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
              +CY+ L PYC+ITNS+FLPK  +  I IP ++ + Y +YTL EY+    +IRAWWNNQR
Sbjct  511   LVCYSCLLPYCIITNSNFLPK--DWGICIPIALIVTYMVYTLVEYLISGMTIRAWWNNQR  568

Query  2189  M  2191
             M
Sbjct  569   M  569



>ref|XP_004506254.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Cicer arietinum]
Length=715

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/601 (52%), Positives = 395/601 (66%), Gaps = 39/601 (6%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +   R ++  IL+LLL L+ YR+ +++++ ++  W +AL+CE WFT  WV
Sbjct  7     LPLYEKYWYKHNYKRVLDSFILILLLLLLGYRIISINNYSFH--WFVALICELWFTLSWV  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +ST+WN     TYP   L+ V+    E P VD+FVTTA+ ELEPPI+T+NTVLSLLAL
Sbjct  65    FTISTQWNPALIKTYPHLLLQSVQ----ELPPVDLFVTTADDELEPPIITMNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP++KLACYVSDD  SP+ FYAL E+SKFAK WVPFCKKY + VRAPFRYF  D     
Sbjct  121   DYPSHKLACYVSDDGCSPLIFYALQESSKFAKHWVPFCKKYKIQVRAPFRYFCDDEC--T  178

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQK-PSLF-NKFATFADLDPNDHSTIIKVICEN  1108
              ++ EF  EW +M   Y NL  KIE   +  PSL   +F  F++    +H TIIKVI EN
Sbjct  179   TNNEEFNHEWLRMKRMYENLSHKIEVDPKSIPSLLEGEFDVFSNTQRTNHPTIIKVIWEN  238

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E +  G+PHLIYISREKRPK  H+FKAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP 
Sbjct  239   KEMVEDGLPHLIYISREKRPKQPHHFKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNPN  298

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             +V HAMC LL +K E++  F Q PQ FY  LKDDP+ +Q  I+   LG G A +QG FY 
Sbjct  299   IVQHAMCILLDSKGEKEVAFAQCPQQFYATLKDDPFGNQMTILLKYLGAGLAGLQGIFYG  358

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             GT CFHRRKVIYGLSP+D          +  +IY  + I V                   
Sbjct  359   GTNCFHRRKVIYGLSPDDV--------ENEGRIYSPNDINV-------------------  391

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFL  1828
             + ++E A+QVA  GYE+GT WG  +GW YGS+TED+LTG+ I + GW++  C P+   F 
Sbjct  392   TKAVEEATQVACYGYEYGTGWGKQVGWIYGSITEDVLTGLTIHKKGWRSELCTPDPVAFR  451

Query  1829  GCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIF  2008
             GC P  G  S+ Q KRWA+G  EI FS  CPIF  +FG L FRQ LAYM  + W   P+ 
Sbjct  452   GCAPIGGPTSMAQHKRWATGMLEIFFSKHCPIFGTIFGKLSFRQFLAYMWIMNWGFNPVA  511

Query  2009  ELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQR  2188
              +CY+ L PYC+ITNS+FLPK  +  I IP ++ + Y +YTL EY+    +IRAWWNNQR
Sbjct  512   LVCYSCLLPYCIITNSNFLPK--DWGICIPIALIVTYMVYTLVEYLISGMTIRAWWNNQR  569

Query  2189  M  2191
             M
Sbjct  570   M  570



>gb|ADO34997.1| cellulose synthase-like protein H1 [Avena sativa]
Length=758

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/578 (53%), Positives = 379/578 (66%), Gaps = 18/578 (3%)
 Frame = +2

Query  494   WNLHSHGYYYTWL--LALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFP  667
             W  H+     TWL  LALVCE+WFTF+W+L ++ KW+ V   TYPE   +       E P
Sbjct  41    WEEHASTSTSTWLPALALVCEAWFTFVWLLNMNCKWSPVRFDTYPENLPDE------ELP  94

Query  668   AVDMFVTTANPELEPPILTVNTVLSLLALEYP--ANKLACYVSDDSASPVTFYALVEASK  841
             AVDMFVTTA+P LEPP++TVNTVLSLLA++YP    KLACYVSDD  SPVT YAL EA++
Sbjct  95    AVDMFVTTADPALEPPVITVNTVLSLLAVDYPDAGGKLACYVSDDGCSPVTCYALREAAE  154

Query  842   FAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSP--EFRREWKKMNDEYANLCGKIEYA  1015
             FA LWVPFCK++ V VRAPF YF++  T     +   EF   W  +  EY  L  +IE A
Sbjct  155   FAALWVPFCKRHGVGVRAPFMYFSSAPTEVATGAAGHEFSENWAFIKSEYEKLVTRIEKA  214

Query  1016  TQKPSLFN-KFATFADLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFK  1189
              +   L + +FA F D +  +H TI+KV+ +N +S    G PHL+Y+SREK P+H HNFK
Sbjct  215   DEGSILRDGEFAEFIDAERRNHPTIVKVLWDNSKSKTGEGFPHLVYVSREKSPEHYHNFK  274

Query  1190  AGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLG-AKDERDTGFVQFPQT  1366
             AGAMNVLTRVSGVM+NAP MLNVDCD + NNP+VVLHAMC LLG   DE  +GFVQ PQ 
Sbjct  275   AGAMNVLTRVSGVMSNAPIMLNVDCDMFANNPQVVLHAMCLLLGFGGDETQSGFVQAPQK  334

Query  1367  FYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLT  1546
             FY  LKDDP+ +Q +++Y  +G G A IQG FY GTGCFHRRKVIYG+ P D V  E+  
Sbjct  335   FYGALKDDPFGNQLEVLYKKVGGGVAGIQGIFYGGTGCFHRRKVIYGVPPPDVVKHERAG  394

Query  1547  D---HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGH  1717
                  +LQ  +G SK  + S+   +SG + +     +S  +E A  V  C YE GT WG 
Sbjct  395   SPSFKELQIKFGSSKELIESSRDIISGDVLARPAVDMSSRVEVAKLVGACSYEAGTCWGQ  454

Query  1718  NIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTE  1897
              IGW YGS+TEDILTG  I   GWK+       P FLGC P+ G  SL Q KRWA+G  E
Sbjct  455   EIGWVYGSMTEDILTGQRIHATGWKSALLDTTPPAFLGCAPTGGPASLTQFKRWATGLLE  514

Query  1898  ILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGN  2077
             IL S   PI  A+F  LQ RQCLAY+I  +W VR  FELCYA L P+CL+TN  FLPK +
Sbjct  515   ILISGNSPILGAIFRRLQLRQCLAYLIIDVWLVRAPFELCYALLGPFCLLTNQSFLPKVS  574

Query  2078  EVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             +    IP ++F+ YN+Y L EY +   S RAWWNN RM
Sbjct  575   DEGFRIPLALFLAYNMYNLMEYKDCGLSARAWWNNHRM  612



>gb|ACN67534.1| cellulose synthase-like protein H1 [Hordeum vulgare subsp. vulgare]
Length=751

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/580 (53%), Positives = 383/580 (66%), Gaps = 15/580 (3%)
 Frame = +2

Query  479   IAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSC  658
             +A R  +L   G   TWL ALVCE+WF F+W+L ++ KW+ V   TYP+     +E    
Sbjct  33    VARRAASLRERGG--TWLAALVCEAWFAFVWILNMNGKWSPVRFDTYPDNLANRME----  86

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYP-ANKLACYVSDDSASPVTFYALVEA  835
             E PAVDMFVTTA+P LEPP++TVNTVLSLLAL+YP   KLACYVSDD  SPVT YAL EA
Sbjct  87    ELPAVDMFVTTADPALEPPLITVNTVLSLLALDYPDVGKLACYVSDDGCSPVTCYALREA  146

Query  836   SKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSP-EFRREWKKMNDEYANLCGKIEY  1012
             +KFA LWVPFCK+++VAVRAPF YF++       ++  EF   W  M  EY  L  +IE 
Sbjct  147   AKFAGLWVPFCKRHDVAVRAPFMYFSSTPEVGTGTADHEFLESWALMKSEYERLASRIEN  206

Query  1013  ATQKPSLFN---KFATFADLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQH  1180
             A +   + +   +FA F D +  +H TI+KV+ +N +S +  G PHL+Y+SREK P+H+H
Sbjct  207   ADEGSIMRDSGDEFAEFIDAERGNHPTIVKVLWDNSKSKVGEGFPHLVYLSREKSPRHRH  266

Query  1181  NFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFP  1360
             NF+AGAMNVLTRVS VMTNAP MLNVDCD + NNP+V LHAMC LLG  DE  +GFVQ P
Sbjct  267   NFQAGAMNVLTRVSAVMTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDEIHSGFVQVP  326

Query  1361  QTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEK  1540
             Q FY GLKDDP+ +Q ++I   +G G A IQG FY GTGCFHRRKVIYG+ P DT+  E 
Sbjct  327   QKFYGGLKDDPFGNQMQVITKKIGGGIAGIQGMFYGGTGCFHRRKVIYGMPPPDTLKHET  386

Query  1541  LTD---HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTW  1711
                    +LQ  +G SK+ + S+   +SG L +     +S  +E A QV +C YE GT W
Sbjct  387   RGSPSYKELQVRFGSSKVLIESSRNIISGDLLARPTVDVSSRIEMAKQVGDCNYEAGTCW  446

Query  1712  GHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGH  1891
             G  IGW YGS+TEDILTG  I   GWK+       P FLGC P+ G  SL Q KRWA+G 
Sbjct  447   GKEIGWVYGSMTEDILTGQRIHAAGWKSALLDTNPPAFLGCAPTGGPASLTQFKRWATGV  506

Query  1892  TEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK  2071
              EIL S   PI   +F  LQ RQCL Y+I   WPVR  FELCYA L P+CL+TN  FLP 
Sbjct  507   LEILISRNSPILGTIFQRLQLRQCLGYLIVEAWPVRAPFELCYALLGPFCLLTNQSFLPT  566

Query  2072  GNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
              ++    IP ++F+ Y++Y L EY E   S RAWWNN RM
Sbjct  567   ASDEGFRIPVALFLSYHIYHLMEYKECGLSARAWWNNHRM  606



>ref|XP_003596946.1| Cellulose synthase-like protein H1 [Medicago truncatula]
Length=795

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/624 (50%), Positives = 415/624 (67%), Gaps = 33/624 (5%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYT-WLLALVCESWFTFIWVL  577
             LYE       + RA++++ILLLL SL+ YR++ + S+  +   W LA  CESWFT+ W++
Sbjct  9     LYEKIWIKRTLQRAIDLLILLLLFSLLCYRIFFIISNKTFTIPWFLAFSCESWFTYTWII  68

Query  578   VVSTKWNQVETTTYPERFLEWV-ENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++TKW+   T TYP R L+ + EN   E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  69    LLNTKWSPAVTKTYPNRLLQRLPEN---ELPCVDLFVTTADPVLEPPIITLNTVLSLLAL  125

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S  TFY L+EASKFAK WVPFCKKYN+ VRAPFRYF +  T   
Sbjct  126   DYPANKLACYVSDDGCSVFTFYGLLEASKFAKFWVPFCKKYNIQVRAPFRYF-SQVTNSD  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIK----  1093
             + S EF++EW KM D Y NL  KIE  T+  + F    ++A F + +  +H +I+K    
Sbjct  185   DDSAEFKQEWLKMKDMYDNLSHKIEDVTRNSTSFQFEGEYAVFLNTEKRNHPSIVKDQVL  244

Query  1094  ----------------VICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSG  1225
                             VI EN +SL+ G+PHLIYISREKRPK++HN+KAGAMNVLTRVSG
Sbjct  245   MLEIEQTKKTNITRWQVILENYDSLSDGLPHLIYISREKRPKYEHNYKAGAMNVLTRVSG  304

Query  1226  VMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             +MTNAPFMLNVDCD  VNNP+++ HAMC L+ +K+ +D  FVQ  Q FYDG+KDDP+ +Q
Sbjct  305   LMTNAPFMLNVDCDMVVNNPKIIQHAMCILMDSKNGKDVAFVQCFQQFYDGIKDDPFGNQ  364

Query  1406  YKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKS  1579
             +   +  + +G   +QG FY GT  FHRR  IYGL P++       K+T+  L + +G S
Sbjct  365   WVASFEYIIKGMGGLQGPFYGGTNTFHRRNAIYGLYPDEIQYGRKGKITEKMLIQQFGSS  424

Query  1580  KIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDIL  1759
             K FV S T    GS +S      S  L+ A QV++CGYE+GT+WG  + W YGS++ED+ 
Sbjct  425   KEFVKSVTHAFEGSGNSIDGISPSNLLDKAIQVSDCGYEYGTSWGKQMCWLYGSISEDVP  484

Query  1760  TGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALF  1939
             TG+ +QR GW++  C PE   F+GC P   L ++ Q KRW+SG T + FS   P+   LF
Sbjct  485   TGLNMQRKGWRSECCTPEPTAFMGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMCTLF  544

Query  1940  GNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIY  2119
             G +QFR  L+Y     W +R +FE+ YA L  YC+ITN+   PKG  + + IP ++F+IY
Sbjct  545   GKIQFRAGLSYCWLTNWGLRSVFEVSYAALVAYCIITNTSIFPKG--LGLWIPLTLFVIY  602

Query  2120  NLYTLWEYMEEKESIRAWWNNQRM  2191
              ++TL EY+ +  S+R WWNNQRM
Sbjct  603   TIHTLQEYLSKGLSLRFWWNNQRM  626



>ref|XP_009781148.1| PREDICTED: cellulose synthase-like protein B6 isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/449 (62%), Positives = 341/449 (76%), Gaps = 11/449 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE K R N +SR +E+ IL LL SL+AYR+ +L +HG   ++ LAL+CESWFTF+W+
Sbjct  8     LPLYEIKYRKNVISRGIELFILFLLFSLLAYRLLSLKNHGLNLSFFLALICESWFTFLWI  67

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+VSTKWNQVE  TYP R L+W    + EFPAVDMF+TTA+P LEPP++TVNT+LSLLA+
Sbjct  68    LIVSTKWNQVEPKTYPLRLLKW----TSEFPAVDMFITTADPVLEPPLITVNTMLSLLAV  123

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACY+SDD ASP+T+Y+LVEA+KFAKLWVPFCKKYN+A+RAPFRYFNA+ + P 
Sbjct  124   DYPANKLACYISDDGASPITYYSLVEAAKFAKLWVPFCKKYNIALRAPFRYFNANLSPPQ  183

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPS----LFNKFATFADLDPNDHSTIIKVIC  1102
             +SS  F  +WK+M DEY  LC KIE A+ + S        F  F+ ++  +H TIIKVI 
Sbjct  184   DSSQGFLEDWKRMKDEYKQLCEKIEDASTQDSEACDFAGDFGVFSKIERKNHPTIIKVIL  243

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E +A G+PHL+YISREKRPKH H+FKAGAMNVLTRVSG+MTNAPFMLNVDCD + NN
Sbjct  244   ENKEGIADGLPHLVYISREKRPKHPHHFKAGAMNVLTRVSGLMTNAPFMLNVDCDMFANN  303

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+VV HAMC+ LGAKDE+D GFVQFPQ FYDGLKDDPY +Q+K+++   GRG A IQG F
Sbjct  304   PQVVQHAMCYFLGAKDEKDCGFVQFPQYFYDGLKDDPYGNQFKLLHEYFGRGIAGIQGPF  363

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIF---Vtsatttlsgslsse  1633
             Y GTGCFHRRK+IYGLSPND +   +L D  LQK YGKS+     V    +  S  +   
Sbjct  364   YQGTGCFHRRKIIYGLSPNDKINTGELRDEYLQKTYGKSQKLLASVAQTLSAGSNIIEQL  423

Query  1634  tFGVLSYSLEAASQVANCGYEFGTTWGHN  1720
                 LS ++E A Q+ +CGYEFGT WG  
Sbjct  424   NSDSLSSTIEEAQQIGSCGYEFGTAWGQK  452



>ref|XP_007049097.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
 gb|EOX93254.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
Length=581

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/563 (53%), Positives = 379/563 (67%), Gaps = 12/563 (2%)
 Frame = +2

Query  395   FPLYE-TKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIW  571
              PLYE    +   + R ++V +  LLLSL+AYR+ +L + G+  TWLLA +CESWF F+W
Sbjct  7     LPLYERVSCKGIMIRRTLDVTVFCLLLSLLAYRLRSLSNQGF--TWLLAFLCESWFAFLW  64

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             +L +ST+WN VE  TYPE  L      S E P +DMFVTTA+P LEPP++TVNTVLSLLA
Sbjct  65    LLNLSTRWNPVEYKTYPENLLL----RSLELPPIDMFVTTADPVLEPPLVTVNTVLSLLA  120

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP  931
             ++YPA KLACYVSDD  SP+TFY+LVEASKFAKLWVPFCKKY++ +RAPF+YF+A    P
Sbjct  121   VDYPAEKLACYVSDDGCSPLTFYSLVEASKFAKLWVPFCKKYSIQIRAPFQYFSAKSLPP  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSL---FNKFATFADLDPNDHSTIIKVIC  1102
              +    F  EWKKM DEY +LC KIE A  K +L     ++A F +++ ++H +I+KVI 
Sbjct  181   VDGLSGFELEWKKMKDEYEHLCRKIEDAVHKLTLGPHSTEYAVFKNIERDNHPSIVKVIF  240

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E  +  +PHL+Y+SREKRP H H+FKAGAMNVLTRVSGVMTNAPFMLNVDCD + +N
Sbjct  241   ENKEDHSSCLPHLVYVSREKRPNHPHHFKAGAMNVLTRVSGVMTNAPFMLNVDCDMFASN  300

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+++LHA+C L+G  DE++  FVQ PQ FYD LKDDP+ ++  + +     G A IQG  
Sbjct  301   PKIILHAVCLLVGVDDEQECAFVQCPQIFYDALKDDPFGNRMTVPFTIFVGGMAGIQGPP  360

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGCFHRRK IYGL PN     +      L++ +GKS  F  S    L GS       
Sbjct  361   YAGTGCFHRRKAIYGLPPNHDFDIKDCK--ILEERFGKSTEFSESVAEILFGSGEKHFPC  418

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              +S    +A +VANC YE  T WG  +G  YGSVTED+LTG+ I  MGWK+   +P  P 
Sbjct  419   DISSITGSACRVANCSYENNTCWGIEVGLTYGSVTEDVLTGLRIHTMGWKSVLLMPSPPA  478

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+GC P  G  S+ QMKRW +G  E+LFS   PI +A    L FRQ LAY+  ++W  R 
Sbjct  479   FMGCAPPGGPVSMTQMKRWGTGLLEVLFSKHSPILSAFSTKLHFRQALAYLQIVMWASRS  538

Query  2003  IFELCYAFLPPYCLITNSHFLPK  2071
             I + CY  L  YC+ T+S FLPK
Sbjct  539   IPQFCYNMLSAYCITTDSQFLPK  561



>ref|XP_008669411.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Zea 
mays]
Length=781

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/583 (50%), Positives = 370/583 (63%), Gaps = 27/583 (5%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + W+ AL+CE+WFT +W+L ++ KWN V   T+PER   +        PAVDMFVTTA+P
Sbjct  56    WCWVAALICEAWFTVVWLLNMNAKWNPVRFVTHPERLAGYWAGDDELLPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             +LEP ++TVNTVLSLLAL+YPA KL+CYVSDD  S VT YAL EA++FAKLWVPF +K+ 
Sbjct  116   KLEPAVVTVNTVLSLLALDYPAGKLSCYVSDDGCSAVTCYALREAAEFAKLWVPFTRKHG  175

Query  881   VAVRAPFRYFNADHTFPPESSPE----------FRREWKKMNDEYANLCGKIEYATQKPS  1030
               VRAPF YF++                     F R W  M +EY  L  +IE A +K S
Sbjct  176   AKVRAPFAYFSSSSGGGAAERGGGGGAADADAEFLRAWTSMKNEYEELVRRIESAEEK-S  234

Query  1031  LFNK----FATFADLDPNDHSTIIKVICENDES--------LAVGVPHLIYISREKRPKH  1174
             L  +    FA F   D  +H TIIKV+ +ND S           GVP LIY+SREK    
Sbjct  235   LVRRGDGAFAEFVGADRGNHPTIIKVLWDNDSSKSESDEQAAGDGVPSLIYVSREKSRTQ  294

Query  1175  QHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQ  1354
              H+FKAGAMNVLTRVS V+TNAP MLNVDCD + NNP+  LHAMC LLG  DE  +GFVQ
Sbjct  295   PHHFKAGAMNVLTRVSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQ  354

Query  1355  FPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTA  1534
              PQ FY GL DDP+ +Q ++I+  +G G A +QG FY GTGCFHRRKV+YG+ P     A
Sbjct  355   APQRFYGGLADDPFGNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGA  414

Query  1535  EKLTD----HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFG  1702
              K  D     +LQK +G SK  + SA + ++   +      L+  +E A QV+ C YE G
Sbjct  415   TKAADSPSYKELQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETG  474

Query  1703  TTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWA  1882
             T+WG  +GW YGS+TED+LTG  I   GW++    P+ P FLG  P+ G  SL Q KRWA
Sbjct  475   TSWGQEVGWVYGSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWA  534

Query  1883  SGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHF  2062
             +G  EI+ S   P   +    L+FRQCLAY++  +WPVR  FELCYA L PYCLI N  F
Sbjct  535   TGLLEIVLSRHNPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSF  594

Query  2063  LPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             LPK +E   V+P ++F+ YN Y L EY++ + S RAWWNNQRM
Sbjct  595   LPKASEPGFVVPLALFLAYNAYNLGEYVDCRLSARAWWNNQRM  637



>gb|KEH39000.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=595

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/579 (52%), Positives = 387/579 (67%), Gaps = 23/579 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++   LLLL  L+AYRV + ++H +  +  +A +CESWFT  W+
Sbjct  9     LPLYEKIWVKHTFSRVMDSFTLLLLFLLLAYRVSSYNNHNF--SCFVAFLCESWFTITWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V +   E PA+DMFVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  67    TTMSTKWTPAHTKTFLDRLLLRVSDS--ELPALDMFVTTADPVLEPPIITVNTVLSLLAL  124

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S +TFYALVEA+KFA++WVPFCKKYNV  RAPFRYF  +     
Sbjct  125   DYPANKLACYVSDDGCSTLTFYALVEAAKFAEIWVPFCKKYNVQCRAPFRYFCDEAMANN  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                P+F+ +W KM +EY  L  KIE A QK     L  +FA F+     +H TII+VI E
Sbjct  185   NDLPQFKHDWLKMKEEYEQLSSKIENAAQKSIPCQLMGEFAVFSQTQARNHPTIIRVIRE  244

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + ++  +PH+IYISREKRPK  H+ KAGAMNVLTRVSG+MTNAPFMLN+DCD YVNN 
Sbjct  245   N-KGISDVMPHIIYISREKRPKQPHHHKAGAMNVLTRVSGLMTNAPFMLNLDCDMYVNNS  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C LL +K E++  F Q PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  304   KIVLHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQLVALPMYIGSGFAGLQGIIY  363

Query  1466  DGTGCFHRRKVIYGLS-PNDTVTAEK---------LTDHDLQKIYGKSKIFVtsatttls  1615
              GT CFHRRKV+YGLS PN+   A+K         L++ +  + +G SK FV SAT  L 
Sbjct  364   AGTNCFHRRKVMYGLSPPNEIQNAKKGQGFTNGTFLSEKETMQKFGTSKGFVESATHILE  423

Query  1616  gslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             G  S       S  LEAAS+VA+C YE+ T WG  +GW YGS +ED+LTG+     GW++
Sbjct  424   GITSDLH---KSLDLEAASKVASCDYEYNTAWGKQVGWLYGSTSEDVLTGLKFHTKGWRS  480

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
               C P+   F+GC+P   LG + Q KRW++G  +I  S  CPIF  LFG LQFR+CL+Y+
Sbjct  481   ELCSPDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSKHCPIFGTLFGKLQFRECLSYI  540

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIV  2092
                 W +R I E+CYA LP YC+ITNS FLP  N+V+I+
Sbjct  541   WITNWALRSIPEICYALLPAYCIITNSSFLP--NKVSII  577



>ref|XP_008669412.1| PREDICTED: cellulose synthase-like protein H1 isoform X3 [Zea 
mays]
Length=780

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/582 (50%), Positives = 369/582 (63%), Gaps = 26/582 (4%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + W+ AL+CE+WFT +W+L ++ KWN V   T+PER   +        PAVDMFVTTA+P
Sbjct  56    WCWVAALICEAWFTVVWLLNMNAKWNPVRFVTHPERLAGYWAGDDELLPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             +LEP ++TVNTVLSLLAL+YPA KL+CYVSDD  S VT YAL EA++FAKLWVPF +K+ 
Sbjct  116   KLEPAVVTVNTVLSLLALDYPAGKLSCYVSDDGCSAVTCYALREAAEFAKLWVPFTRKHG  175

Query  881   VAVRAPFRYFNADHTFPPESSPE----------FRREWKKMNDEYANLCGKIEYATQKPS  1030
               VRAPF YF++                     F R W  M +EY  L  +IE A +K S
Sbjct  176   AKVRAPFAYFSSSSGGGAAERGGGGGAADADAEFLRAWTSMKNEYEELVRRIESAEEK-S  234

Query  1031  LFNK----FATFADLDPNDHSTIIKVICENDES--------LAVGVPHLIYISREKRPKH  1174
             L  +    FA F   D  +H TIIKV+ +ND S           GVP LIY+SREK    
Sbjct  235   LVRRGDGAFAEFVGADRGNHPTIIKVLWDNDSSKSESDEQAAGDGVPSLIYVSREKSRTQ  294

Query  1175  QHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQ  1354
              H+FKAGAMNVLTRVS V+TNAP MLNVDCD + NNP+  LHAMC LLG  DE  +GFVQ
Sbjct  295   PHHFKAGAMNVLTRVSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQ  354

Query  1355  FPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTA  1534
              PQ FY GL DDP+ +Q ++I+  +G G A +QG FY GTGCFHRRKV+YG+ P     A
Sbjct  355   APQRFYGGLADDPFGNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGA  414

Query  1535  EKLTD---HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGT  1705
              K       +LQK +G SK  + SA + ++   +      L+  +E A QV+ C YE GT
Sbjct  415   TKADSPSYKELQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGT  474

Query  1706  TWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWAS  1885
             +WG  +GW YGS+TED+LTG  I   GW++    P+ P FLG  P+ G  SL Q KRWA+
Sbjct  475   SWGQEVGWVYGSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWAT  534

Query  1886  GHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFL  2065
             G  EI+ S   P   +    L+FRQCLAY++  +WPVR  FELCYA L PYCLI N  FL
Sbjct  535   GLLEIVLSRHNPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFL  594

Query  2066  PKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             PK +E   V+P ++F+ YN Y L EY++ + S RAWWNNQRM
Sbjct  595   PKASEPGFVVPLALFLAYNAYNLGEYVDCRLSARAWWNNQRM  636



>ref|XP_008455908.1| PREDICTED: cellulose synthase-like protein H1 isoform X3 [Cucumis 
melo]
Length=586

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/579 (51%), Positives = 394/579 (68%), Gaps = 25/579 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE  +      RA+++ I +LL+SL+AYRV  +++HG+ +   +A +CE WF+F+W 
Sbjct  13    LPLYEKLIIKRPTQRALDIAIFILLISLVAYRVLLMYNHGFSHLQTIAFLCEFWFSFVWF  72

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L + T+WN V+  TYP+R L+       E+PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  73    LAIVTRWNPVDFKTYPQRLLK----REVEYPAVDIFVTTADPMLEPPIITVNTVLSLMAL  128

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP+NKL+CYVSDD  SP+TFYAL EA  FAK+W+PFCKKY+V VRAPF YF+     PP
Sbjct  129   DYPSNKLSCYVSDDGCSPLTFYALNEALNFAKIWIPFCKKYDVQVRAPFMYFST----PP  184

Query  935   ---ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK-----FATFADLDPNDHSTII  1090
                 SS +F+ +WK +  EY  L  KI+ A +    +++      A F+++    H +II
Sbjct  185   HHLHSSTQFQYDWKTLKVEYEKLERKIKEAEENRIGWHEESGIDLAAFSNISTKHHPSII  244

Query  1091  KVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDF  1270
             K++ EN E ++  +PHLIY+SREK  KH H+ KAGAMNVLTRVSGV+TNAP++LNVDCD 
Sbjct  245   KILWENKE-VSDELPHLIYVSREKSFKHHHHCKAGAMNVLTRVSGVLTNAPYILNVDCDM  303

Query  1271  YVNNPEVVLHAMCFLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAA  1447
             +VNNP+VVLHAMC  L +KD+  D G+VQ PQ FYDGLKDDP+ +Q  +++    RG   
Sbjct  304   FVNNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDPFGNQLVVVFEYSARGIMG  363

Query  1448  IQGSFYDGTGCFHRRKVIYGLSPNDTV--TAEKLTDHDLQKIYGKSKIFVtsatttlsgs  1621
             +QG FY GTGCFHRRKV+Y   P+ T+     K ++ +L K +G SK F  SAT      
Sbjct  364   LQGPFYSGTGCFHRRKVLYAQFPHHTIYFLDGKASEQELIKTFGYSKTFAKSATYAFKDQ  423

Query  1622  lssetF----GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
              ++ +     G+L+ +LEAA+QVA CGYE  T+WG  IGW YGS +ED+LTG+ IQ  GW
Sbjct  424   NTNTSGYPPKGLLNNNLEAANQVAGCGYEISTSWGSEIGWMYGSTSEDVLTGLVIQTRGW  483

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK-CPIFAALFGNLQFRQCL  1966
             ++ F     P FLGC PS  + SL Q KRWASG  ++L + + CPIF  LFG LQ++QC 
Sbjct  484   RSIFLALNPPAFLGCAPSQLVASLTQQKRWASGFLQVLLNRRHCPIFGTLFGKLQWKQCA  543

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEV  2083
             AY+  + W +R I EL Y  LPPYCLITNS   P  + +
Sbjct  544   AYLWILTWGLRSIPELSYTLLPPYCLITNSSIFPTIDSI  582



>ref|XP_008669410.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Zea 
mays]
Length=784

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/586 (50%), Positives = 370/586 (63%), Gaps = 30/586 (5%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + W+ AL+CE+WFT +W+L ++ KWN V   T+PER   +        PAVDMFVTTA+P
Sbjct  56    WCWVAALICEAWFTVVWLLNMNAKWNPVRFVTHPERLAGYWAGDDELLPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             +LEP ++TVNTVLSLLAL+YPA KL+CYVSDD  S VT YAL EA++FAKLWVPF +K+ 
Sbjct  116   KLEPAVVTVNTVLSLLALDYPAGKLSCYVSDDGCSAVTCYALREAAEFAKLWVPFTRKHG  175

Query  881   VAVRAPFRYFNADHTFPPESSPE----------FRREWKKMNDEYANLCGKIEYATQKPS  1030
               VRAPF YF++                     F R W  M +EY  L  +IE A +K S
Sbjct  176   AKVRAPFAYFSSSSGGGAAERGGGGGAADADAEFLRAWTSMKNEYEELVRRIESAEEK-S  234

Query  1031  LFNK----FATFADLDPNDHSTIIKVICENDES--------LAVGVPHLIYISREKRPKH  1174
             L  +    FA F   D  +H TIIKV+ +ND S           GVP LIY+SREK    
Sbjct  235   LVRRGDGAFAEFVGADRGNHPTIIKVLWDNDSSKSESDEQAAGDGVPSLIYVSREKSRTQ  294

Query  1175  QHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQ  1354
              H+FKAGAMNVLTRVS V+TNAP MLNVDCD + NNP+  LHAMC LLG  DE  +GFVQ
Sbjct  295   PHHFKAGAMNVLTRVSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQ  354

Query  1355  FPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTA  1534
              PQ FY GL DDP+ +Q ++I+  +G G A +QG FY GTGCFHRRKV+YG+ P     A
Sbjct  355   APQRFYGGLADDPFGNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGA  414

Query  1535  EKL-------TDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGY  1693
              K        +  +LQK +G SK  + SA + ++   +      L+  +E A QV+ C Y
Sbjct  415   TKALAAADSPSYKELQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSY  474

Query  1694  EFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMK  1873
             E GT+WG  +GW YGS+TED+LTG  I   GW++    P+ P FLG  P+ G  SL Q K
Sbjct  475   ETGTSWGQEVGWVYGSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYK  534

Query  1874  RWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITN  2053
             RWA+G  EI+ S   P   +    L+FRQCLAY++  +WPVR  FELCYA L PYCLI N
Sbjct  535   RWATGLLEIVLSRHNPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIAN  594

Query  2054  SHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
               FLPK +E   V+P ++F+ YN Y L EY++ + S RAWWNNQRM
Sbjct  595   RSFLPKASEPGFVVPLALFLAYNAYNLGEYVDCRLSARAWWNNQRM  640



>ref|XP_006847115.1| hypothetical protein AMTR_s00017p00225060 [Amborella trichopoda]
 gb|ERN08696.1| hypothetical protein AMTR_s00017p00225060 [Amborella trichopoda]
Length=763

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/577 (50%), Positives = 378/577 (66%), Gaps = 20/577 (3%)
 Frame = +2

Query  518   YYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTAN  697
             Y+ W LAL CE+ FT++W+L ++  WN V   TYPER L        E PA+D+FVTTA+
Sbjct  51    YWFWALALACETCFTWLWLLSINGNWNPVLFKTYPER-LPLRFKSELELPAIDVFVTTAD  109

Query  698   PELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKY  877
             P +EPPI+ +NTVLS+LA++YP +K A YVSDD+ S +TFY+L  AS+FA+ WVPFCKK+
Sbjct  110   PFMEPPIIVINTVLSILAVDYPTSKFAVYVSDDACSIITFYSLSMASEFARTWVPFCKKH  169

Query  878   NVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKF----  1045
             NV+VRAPF YF+ +       SPEF  EWK +  +Y  LC ++  A      ++++    
Sbjct  170   NVSVRAPFMYFSDNTAASDSFSPEFLSEWKMVKSQYEELCRRVSEAVSGSCKYHQYMRSE  229

Query  1046  --ATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRV  1219
               A F+ ++  DH +++KVI EN E  + GV HLIYI REKR KH+H+FKAGAMN L RV
Sbjct  230   DLAFFSRIERGDHPSVVKVIVENGEKGSEGVGHLIYIGREKRRKHRHHFKAGAMNTLFRV  289

Query  1220  SGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYA  1399
             SGVMTNAPF +NVDCD +VNNP     A+C L G + ERD GFVQFPQ FY GLKDDP+ 
Sbjct  290   SGVMTNAPFTMNVDCDMFVNNPRCFYEALCLLFGFESERDAGFVQFPQVFYGGLKDDPFG  349

Query  1400  SQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAE-KLTDH--------  1552
             +Q K++YH LGRG A +QG  Y GTGCFHRRK IYG  P +    + +LT +        
Sbjct  350   NQLKVLYHTLGRGFAGLQGMLYSGTGCFHRRKAIYGAQPPELPNGKGQLTKYMNGSDEAK  409

Query  1553  --DLQKIYGKSKIFVtsatttlsgslssetFG--VLSYSLEAASQVANCGYEFGTTWGHN  1720
               +L+ I+G S+ F+ S    LS      ++    L+ +LEAA +VA C YE  T WG  
Sbjct  410   MEELESIFGHSEEFLKSVVCILSEDGYLGSYNPVSLASTLEAAHEVARCTYENHTQWGDK  469

Query  1721  IGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEI  1900
             +G  YGS TED+L+G+ +  MGWK+  C PE PGFLGC PS+G  SL Q KRWA+G  E+
Sbjct  470   VGLVYGSTTEDVLSGLRLHSMGWKSASCTPEPPGFLGCAPSSGPESLTQSKRWATGILEV  529

Query  1901  LFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNE  2080
             L     P+ A +   LQFRQC AY+   +W +  + ELCYA LP  C++T   FLPK  +
Sbjct  530   LVGSHSPLLAVVTKKLQFRQCWAYITITVWALCSLPELCYATLPAICILTGRSFLPKVTQ  589

Query  2081  VAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
                + P S+FI++NLY++ EY + K S+R WWNNQRM
Sbjct  590   SDALFPISLFILFNLYSIIEYWQIKLSLREWWNNQRM  626



>gb|KDO54721.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=595

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/599 (51%), Positives = 385/599 (64%), Gaps = 53/599 (9%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     N   RA++V+IL LLL L+ YR+  L +HG+   W LA +CES FTFIW+
Sbjct  9     LPLYEKVFHKNTYHRALDVIILFLLLCLLFYRLSTLKNHGF--AWFLAFLCESCFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+V+ KW  +   TYP+R  E ++    E P VDMFVTTA+ ELEPPI+TVNTVLSLLA+
Sbjct  67    LIVNCKWTPLTYKTYPQRLQERIQ----ELPPVDMFVTTADAELEPPIITVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP +KLACYVSDD+ SP+ FY+LVEASKFAKLWVPFCKKYNV +RAPFRYF        
Sbjct  123   DYPVHKLACYVSDDACSPLNFYSLVEASKFAKLWVPFCKKYNVQIRAPFRYFPDSEPSDS  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDE  1114
              S  E  ++WK M                                       KVI EN  
Sbjct  183   SSG-ELLQDWKNM---------------------------------------KVISENKG  202

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
              L+  +PHL+YISREKRPKH H++KAGAMNVLTRVSG+MTNAPFMLNVDCD Y NNPE+V
Sbjct  203   GLSDEIPHLVYISREKRPKHPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMYANNPEIV  262

Query  1295  LHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
             L AMC  LG+K+E +  F+Q PQ FYD  ++    ++Y      +G+G   IQG FY GT
Sbjct  263   LQAMCLHLGSKNENEFAFIQSPQYFYDRPENLCILNEY------IGKGIVGIQGPFYQGT  316

Query  1475  GCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSY  1654
             G FHRR V+YGL  +       + + +L K +G SK F+ SA  TL G     +  + S 
Sbjct  317   GTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSKEFIKSAAQTLEGKTGGYSSNI-SR  375

Query  1655  SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGC  1834
             SL+ A +VA+CGYE+G++WG  +G  YG+  ED LTG+ I   GW++G+C+P    FLGC
Sbjct  376   SLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGC  435

Query  1835  TPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFEL  2014
                +G   + Q KRWA+G  EILFS + PI A L G LQFRQCLAY+  + W +R I EL
Sbjct  436   ASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPEL  495

Query  2015  CYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             CY  LP YC+ITNS FLPK  E  ++IP ++F+IY LYTL EY++   SIR+WW N  M
Sbjct  496   CYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNNCM  554



>gb|AAL38531.1|AF435646_1 CSLH1 [Oryza sativa]
Length=743

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/559 (53%), Positives = 372/559 (67%), Gaps = 13/559 (2%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFTF+W+L V+ KW+ V   T+PE   E ++    E PAVDMFVTTA+P LEPP
Sbjct  46    ALACEAWFTFMWLLNVNAKWSPVRFDTFPENLAERID----ELPAVDMFVTTADPVLEPP  101

Query  716   ILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAV  889
             ++TVNTVLSLLAL+YPA   KLACYVSDD  SP+T YAL EA++FA+ WVPFC+++ VAV
Sbjct  102   LVTVNTVLSLLALDYPAAGEKLACYVSDDGCSPLTCYALREAARFARTWVPFCRRHGVAV  161

Query  890   RAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFA  1057
             RAPFRYF++   F P    +F  +W  M  EY  L  +IE A + PSL      +FA F 
Sbjct  162   RAPFRYFSSTPEFGPADG-KFLEDWTFMKSEYEKLVHRIEDADE-PSLLRHGGGEFAEFL  219

Query  1058  DLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
             D++  +H TIIKV+ +N+ S    G P LIY+SREK P   H++KAGAMN LTRVS +MT
Sbjct  220   DVERGNHPTIIKVLWDNNRSRTGDGFPRLIYVSREKSPNLHHHYKAGAMNALTRVSALMT  279

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             NAPFMLN+DCD +VNNP VVLHAMC LLG  DE    FVQ PQ FY  LKDDP+ +Q ++
Sbjct  280   NAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPFGNQLEV  339

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVt  1594
                 +GRG A +QG FY GTGCFHRRKVIYG+      T    ++ +L   +G S  F  
Sbjct  340   SLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGSSNNFKE  399

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             SA   + G+LS+E    +S  ++ A +VA C YE GT WG  +GW YGS+TED+LTG  I
Sbjct  400   SARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRI  459

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++     E P F+GC P+ G   L Q+KRWASG  EIL S   PI    F +LQF
Sbjct  460   HAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQF  519

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
             RQCLAY+ S +WPVR  FELCYA L PYCL++N  FLPK +E    I  ++FI YN Y  
Sbjct  520   RQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIAYNTYMF  579

Query  2135  WEYMEEKESIRAWWNNQRM  2191
              E++E  +S RA WNN RM
Sbjct  580   MEFIECGQSARACWNNHRM  598



>ref|NP_001064384.1| Os10g0341700 [Oryza sativa Japonica Group]
 sp|Q339N5.2|CSLH1_ORYSJ RecName: Full=Cellulose synthase-like protein H1; AltName: Full=OsCslH1 
[Oryza sativa Japonica Group]
 tpg|DAA01747.1| TPA_exp: cellulose synthase-like H1 [Oryza sativa]
 gb|ABB47242.2| Cellulose synthase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26298.1| Os10g0341700 [Oryza sativa Japonica Group]
 dbj|BAG91240.1| unnamed protein product [Oryza sativa Japonica Group]
Length=750

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/559 (53%), Positives = 372/559 (67%), Gaps = 13/559 (2%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFTF+W+L V+ KW+ V   T+PE   E ++    E PAVDMFVTTA+P LEPP
Sbjct  53    ALACEAWFTFMWLLNVNAKWSPVRFDTFPENLAERID----ELPAVDMFVTTADPVLEPP  108

Query  716   ILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAV  889
             ++TVNTVLSLLAL+YPA   KLACYVSDD  SP+T YAL EA++FA+ WVPFC+++ VAV
Sbjct  109   LVTVNTVLSLLALDYPAAGEKLACYVSDDGCSPLTCYALREAARFARTWVPFCRRHGVAV  168

Query  890   RAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFA  1057
             RAPFRYF++   F P    +F  +W  M  EY  L  +IE A + PSL      +FA F 
Sbjct  169   RAPFRYFSSTPEFGPADG-KFLEDWTFMKSEYEKLVHRIEDADE-PSLLRHGGGEFAEFL  226

Query  1058  DLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
             D++  +H TIIKV+ +N+ S    G P LIY+SREK P   H++KAGAMN LTRVS +MT
Sbjct  227   DVERGNHPTIIKVLWDNNRSRTGDGFPRLIYVSREKSPNLHHHYKAGAMNALTRVSALMT  286

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             NAPFMLN+DCD +VNNP VVLHAMC LLG  DE    FVQ PQ FY  LKDDP+ +Q ++
Sbjct  287   NAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPFGNQLEV  346

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVt  1594
                 +GRG A +QG FY GTGCFHRRKVIYG+      T    ++ +L   +G S  F  
Sbjct  347   SLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGSSNNFKE  406

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             SA   + G+LS+E    +S  ++ A +VA C YE GT WG  +GW YGS+TED+LTG  I
Sbjct  407   SARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRI  466

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++     E P F+GC P+ G   L Q+KRWASG  EIL S   PI    F +LQF
Sbjct  467   HAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQF  526

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
             RQCLAY+ S +WPVR  FELCYA L PYCL++N  FLPK +E    I  ++FI YN Y  
Sbjct  527   RQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIAYNTYMF  586

Query  2135  WEYMEEKESIRAWWNNQRM  2191
              E++E  +S RA WNN RM
Sbjct  587   MEFIECGQSARACWNNHRM  605



>gb|AES67199.2| cellulose synthase H1-like protein [Medicago truncatula]
Length=740

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/604 (50%), Positives = 402/604 (67%), Gaps = 19/604 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         RA++++ILLLL SL+ YR+    +  +   W LA  CESWFT+ W+
Sbjct  7     LPLYEKIWIKRTFQRAIDILILLLLFSLLCYRI----NVTFTIPWFLAFSCESWFTYTWI  62

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+     TYP R L+ V     E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  63    ILLNTKWSPAVNKTYPNRLLQRVH----ELPRVDLFVTTADPVLEPPIITLNTVLSLLAL  118

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S  TFY L+EASKFAK WVPFCKKYNV VRAPFRYF +  T   
Sbjct  119   DYPANKLACYVSDDGCSVFTFYGLLEASKFAKFWVPFCKKYNVQVRAPFRYF-SQVTNSD  177

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
             + S EF++EW KM D Y NL  KIE  T+  + F    +FA F++ +  +H +IIKVI +
Sbjct  178   DDSAEFKQEWLKMKDMYDNLSHKIEDVTRNSASFQFEGEFAVFSNTEKRNHPSIIKVILD  237

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
                 L+ G+PHLIYISREKRPK++HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  238   G---LSDGLPHLIYISREKRPKYEHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  294

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +++ HA+C L+ +K  +D  FVQ  Q FYDG+KDDP+ +Q+   +  +  G A +QG +Y
Sbjct  295   KIMQHAICILVDSKSGKDVAFVQCFQKFYDGIKDDPFGNQWVAAFEYMIGGMAGLQGPYY  354

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              G+  FHRR  IYG  PN+       KL ++ L + +G SK FV SAT  + G+  S   
Sbjct  355   GGSNTFHRRYAIYGFYPNEIQHGNKAKLAENILIQQFGSSKKFVKSATQVMEGNDYSTHG  414

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                S  +E A +V++C YE+GT WG  +GW YGS++ED+ TG+ +QR GW++  C PE  
Sbjct  415   NSPSNFIEEAIKVSDCEYEYGTCWGKQMGWLYGSISEDVPTGLNMQRKGWRSECCTPEPT  474

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRW+SG T + FS   P+   LFG +QFR  L+Y     W +R
Sbjct  475   AFTGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMGTLFGKIQFRAGLSYCWLTNWGLR  534

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
              +FE+ YA L  YC+ITN+   P+G    + IP ++F+IY ++TL EY  +  S+R WWN
Sbjct  535   SVFEVSYAALVAYCIITNTSIFPEG--AGLWIPLTLFVIYTMHTLQEYKLKGFSLRYWWN  592

Query  2180  NQRM  2191
             NQRM
Sbjct  593   NQRM  596



>gb|KGN63226.1| hypothetical protein Csa_2G416170 [Cucumis sativus]
Length=746

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/602 (49%), Positives = 393/602 (65%), Gaps = 11/602 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL+E     N + R +++ I  LL+SL+ YR++ L SHG+   + +A + E WFTF W+L
Sbjct  10    PLFERVRIENGLKRFIDITIFFLLVSLLGYRLFLLSSHGFSCLFAIAFLSELWFTFNWLL  69

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              ++  W+ V   TYP+R L+ VE    E P VD+FVTTA+P LEPPI+T+NTVLS+LA+E
Sbjct  70    TLNCNWSPVRYQTYPQRLLKRVE----EVPPVDIFVTTADPMLEPPIITINTVLSVLAME  125

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPA+KLACYVSDD+ SP+TFY+L +A  FAK+W+PFCKKY V VRAPFRYF+       E
Sbjct  126   YPADKLACYVSDDACSPLTFYSLCQALNFAKIWLPFCKKYKVQVRAPFRYFSTTRLSSNE  185

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPS----LFNKFATFADLDPNDHSTIIKVICE  1105
             S+ +F  +W K+ DEY  L  KIE A +  +    L  + A F++  P +H  I+KVI E
Sbjct  186   ST-QFHHDWTKIKDEYEELRQKIEEAAKTITYGCELKGELADFSNAKPKNHPPIVKVIWE  244

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E +   +P LIY+SREK P+  H++KAGAMNVLTRVSGVMTNAP+MLN+DCD +VNNP
Sbjct  245   NKEGVRDELPALIYVSREKNPQIPHHYKAGAMNVLTRVSGVMTNAPYMLNLDCDMFVNNP  304

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +V+L AMC LL    +++  FVQFPQTFY+GLKDDP+ +Q+ +    L  G A +QG  Y
Sbjct  305   DVLLQAMCLLLHPTIDKEYAFVQFPQTFYNGLKDDPFGNQWIVTMQILIHGQAGVQGPMY  364

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GTGC HRRKV+YG SP +     K  +  L K +G SK FV SA  +L           
Sbjct  365   MGTGCIHRRKVLYGQSPKEANVDAKYNEEKLYKTFGNSKDFVKSAIRSLRSFADDS--NC  422

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             LS S+++  +VA   YE    WG  +GW+YGS+ ED+LTG+ I + GWK+ +  P  P F
Sbjct  423   LSSSIKSTYEVATADYEHNNAWGSEVGWKYGSIVEDVLTGMEIHKKGWKSAYITPTPPAF  482

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
             LGC P  G   L+  KR  +G  EIL S   PI  AL   LQFRQ L YM + L     I
Sbjct  483   LGCAPLGGPVPLSHHKRAMTGLLEILISKNSPILTALSDKLQFRQRLMYMWAYLIGFGAI  542

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             +E+CYA LP +CLI+NSHFLPK  E  I +P  +F++  L  L ++ +  +S+RAWWNN 
Sbjct  543   WEICYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLLKLRMLLDFFKTGQSVRAWWNNL  602

Query  2186  RM  2191
             RM
Sbjct  603   RM  604



>ref|XP_004975623.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Setaria italica]
Length=813

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/608 (50%), Positives = 385/608 (63%), Gaps = 54/608 (9%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + WL ALVCE+WFT +W+L V+ KWN V   T+PER     E    E PAVDMFVTTA+P
Sbjct  59    WCWLAALVCEAWFTVVWLLNVNCKWNPVRFDTHPERLAGRTEE---ELPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
              LEPP +TVNTVLSLLAL+YPA KLACYVSDD  SPVT +AL EA++FA+LWVPFC+K+ 
Sbjct  116   RLEPPAVTVNTVLSLLALDYPAGKLACYVSDDGCSPVTCFALREAAEFARLWVPFCRKHG  175

Query  881   VAVRAPFRYFNADHTFPP-------ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF-  1036
             V VRAPF YF++  +  P        +  +F+R+W  M  EY  L  +IE A ++  L  
Sbjct  176   VGVRAPFVYFSSSSSGGPPERGGGGAADDKFQRDWTAMKSEYEKLASRIENADEESLLRR  235

Query  1037  --NKFATFADLDPNDHSTIIKV-----ICENDESLAV-----------------------  1126
                +FA F   D  DH TIIKV      C   E L                         
Sbjct  236   GDGEFAEFVGADRRDHPTIIKVETMSCTCCTIEQLRCRRSMSDPATFSCRGCVQVLWDNG  295

Query  1127  ------GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
                   G+P LIYISREK P+H H+FKAGAMNVLTRVS V+TNAP MLN+DCD + NNP+
Sbjct  296   KAGDGHGIPSLIYISREKGPRHPHHFKAGAMNVLTRVSAVVTNAPIMLNMDCDMFANNPQ  355

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             V LHAMC LLG  DE  +GFVQ PQ FY  LKDDP+ +Q ++++  +G G A +QG FY 
Sbjct  356   VALHAMCLLLGFDDELQSGFVQAPQKFYGTLKDDPFGNQMEVLFEKIGFGIAGLQGMFYG  415

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKL------TDHDLQKIYGKSKIFVtsatttlsgslss  1630
             GTGCFHRRKVIYG+ P  T   +        +  +LQK++G S+  + SA + +SG L +
Sbjct  416   GTGCFHRRKVIYGVPPESTADVQPTRMRGSPSYKELQKMFGSSRELIESARSAISGELFA  475

Query  1631  etFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                 V L+  ++ A +V+ C YE GT WG  +GW YGS+TEDILTG  I   GW++ F  
Sbjct  476   AAPMVDLASRIDVAKEVSACSYEAGTCWGQEVGWVYGSMTEDILTGQRIHAAGWRSAFLT  535

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
              + P FLG  P+ G  SL Q KRWA+G  EI+ S   PI A    +L+FRQCLAY++  +
Sbjct  536   TDPPAFLGGAPTGGPASLTQYKRWATGLLEIILSRNNPILACTSKHLEFRQCLAYLVFYV  595

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             WPVR  FELCYA L PYCL+ N  FLPK +E   VIP ++F+  N++++ EYME ++S R
Sbjct  596   WPVRAPFELCYALLGPYCLLANKSFLPKASEPWFVIPLALFLTQNVHSVAEYMECRQSAR  655

Query  2168  AWWNNQRM  2191
             AWWNN RM
Sbjct  656   AWWNNHRM  663



>ref|XP_007149989.1| hypothetical protein PHAVU_005G116500g [Phaseolus vulgaris]
 gb|ESW21983.1| hypothetical protein PHAVU_005G116500g [Phaseolus vulgaris]
Length=1374

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/610 (52%), Positives = 414/610 (68%), Gaps = 21/610 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLY+     +  SR ++ + LLLLL L+ YR++   S  Y +   +A++CESWFT  W+
Sbjct  635   LPLYDKFWVKHTFSRTMDSLTLLLLLLLLGYRIFCHDS--YTFPCFVAVICESWFTCFWI  692

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
              ++STKW+   T T+ +R L  V     E PAVD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  693   FIISTKWSPAFTKTHIDRLLLRVPEA--ELPAVDLFVTTADPVLEPPIITINTVLSLLAL  750

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  SP+ FYAL+EASKFAKLWVPFCK YN+ +R PFRYF + +T PP
Sbjct  751   DYPANKLACYVSDDGCSPLNFYALLEASKFAKLWVPFCKNYNIQLRVPFRYF-SHNTNPP  809

Query  935   --ESSPEFRREWKKMNDEYANLCGKI-EYATQKPSLFNKFATFADLDPNDHSTIIKVICE  1105
               E S +F ++W ++  EY +LC KI   AT    L  +FA F++    +H TIIKVICE
Sbjct  810   NTEHSQQFIQDWLRLKKEYESLCSKIMNAATNSIPLIGEFAIFSNTQLRNHPTIIKVICE  869

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + L+  +PHL+Y+SREK+ +H H++KAGAMNVLTRVSGVMTNAPF+LNVDCD YV+NP
Sbjct  870   N-KGLSDELPHLVYVSREKKKQHPHHYKAGAMNVLTRVSGVMTNAPFILNVDCDMYVHNP  928

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C LL +K E++  F Q  Q FYD LKDDP+ +Q    +  LG G A +QG FY
Sbjct  929   KIVLHALCILLDSKGEKEVAFSQCIQQFYDALKDDPFGNQLVATFLYLGGGLAGLQGIFY  988

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDL--------QKIYGKSKIFVtsatttlsgs  1621
              GT C HRRKVIYGLSP+  +   K  DHD+        ++I+G SK FV SAT  L G 
Sbjct  989   IGTNCLHRRKVIYGLSPDHHIQNGK-KDHDITNGKFSEKKRIFGSSKGFVESATDALEGK  1047

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
               +    +  Y +EAA +VA+C YE+ T WG  +GW YGS +ED LTG+ I   GW++  
Sbjct  1048  TLASNNNIWKY-VEAAKEVASCEYEYDTAWGKEVGWMYGSTSEDALTGLKIHTKGWRSEV  1106

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
             C P+   F+GC+P   +  + Q +RW SG  EIL S  CPIF  LFG LQFRQCL Y+  
Sbjct  1107  CSPDLIAFMGCSPQDIITVMVQQRRWVSGLLEILLSNHCPIFGTLFGKLQFRQCLGYLWV  1166

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
               W +R + E+CY+ LP YC+I NS FLPK  E+   IP ++F+IYN+ T+ EY+    S
Sbjct  1167  TTWGLRSVPEICYSLLPAYCIINNSTFLPK--ELGQGIPTTLFVIYNISTVVEYLGTGLS  1224

Query  2162  IRAWWNNQRM  2191
             IR WWN+QRM
Sbjct  1225  IRTWWNSQRM  1234


 Score =   392 bits (1008),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 210/439 (48%), Positives = 275/439 (63%), Gaps = 14/439 (3%)
 Frame = +2

Query  902   RYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDH  1078
             +  NAD   P            +   EY +LC KI  A Q    L  +FA F++    +H
Sbjct  67    KKINADRPIPLRGFQLVLSLRTRARKEYESLCSKIMNAAQNSIPLIGEFAIFSNTQLRNH  126

Query  1079  STIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNV  1258
              TIIKVICEN + L+  +PHL+Y+SREK+ +H H++KAGAMNVLTRVSGVMTNAPF+LNV
Sbjct  127   PTIIKVICEN-KGLSDELPHLVYVSREKKKQHPHHYKAGAMNVLTRVSGVMTNAPFILNV  185

Query  1259  DCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRG  1438
             DCD YV+NP++VLHA+C L  +K E++  F Q  Q FYD LKDDP+ +Q    +  LG G
Sbjct  186   DCDMYVHNPKIVLHALCILPDSKGEKEVAFSQCIQQFYDALKDDPFGNQLVATFFYLGGG  245

Query  1439  NAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDL--------QKIYGKSKIFVt  1594
              A +QG FY GT C HRRKVIYGLSP+  +   K  DHD+        ++I+G SK FV 
Sbjct  246   LAGLQGIFYIGTNCLHRRKVIYGLSPDHHIQNGK-KDHDITNGKFSKKKRIFGSSKGFVG  304

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             S T  L G   +    +  Y +EAA +V +C YE+ T WG  +GW YG+ +ED LTG+ I
Sbjct  305   STTDALEGKTLASNNNIWKY-VEAAKEVVSCEYEYDTAWGKEVGWMYGTTSEDALTGLKI  363

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW+   C P+   F+GC+P   +  + Q +RW SG  EIL S  CPIF  LFG LQF
Sbjct  364   HTKGWRFEVCSPDLIAFMGCSPKDIITVMVQQRRWVSGLLEILLSNHCPIFGTLFGKLQF  423

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
             RQCL Y+    W +R + E+CY+ LP YC+I NS FLPK  ++   IP ++F+IYN+ T 
Sbjct  424   RQCLGYLWVTTWGLRCVPEICYSLLPAYCIINNSTFLPK--DLGQWIPTTLFVIYNISTF  481

Query  2135  WEYMEEKESIRAWWNNQRM  2191
              EY+    SIR WWN+QRM
Sbjct  482   VEYLGTGLSIRTWWNSQRM  500



>ref|XP_007149984.1| hypothetical protein PHAVU_005G116200g [Phaseolus vulgaris]
 gb|ESW21978.1| hypothetical protein PHAVU_005G116200g [Phaseolus vulgaris]
Length=743

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/568 (50%), Positives = 373/568 (66%), Gaps = 12/568 (2%)
 Frame = +2

Query  506   SHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFV  685
             S+ + +   LA +CESWFTF W++++++KW+   T T+P+R L+    G  E P VD+FV
Sbjct  43    SNTFTFPCFLAFICESWFTFTWIVILNSKWSPAITVTHPDRLLK----GVSELPRVDLFV  98

Query  686   TTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPF  865
             TTA+P LEPPI+T NTVLSLLAL+YP NKLACYVSDD +SP+TFYALVEASKFAK WVPF
Sbjct  99    TTADPVLEPPIITANTVLSLLALDYPTNKLACYVSDDGSSPLTFYALVEASKFAKFWVPF  158

Query  866   CKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLF  1036
             CKKY +  RAPFRYF++  T   E SPEF++EW +M D Y N   KI+  T+K     L 
Sbjct  159   CKKYKIQQRAPFRYFSSVVTTKSEQSPEFKQEWSRMKDMYDNFSRKIQEVTRKQIPLQLD  218

Query  1037  NKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTR  1216
              + A F++ D  +H TIIKVI EN + L+ G+PHLIYISREK+    HN+KAGAMNVLTR
Sbjct  219   GELAVFSNTDRRNHPTIIKVILENKDDLSDGLPHLIYISREKKQHQTHNYKAGAMNVLTR  278

Query  1217  VSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPY  1396
             VSG+MTNAPFMLNVDCD  VNNP++VLHA+C L+ +K  ++  FVQ  Q FYDG+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMVVNNPKIVLHALCILMDSKSGKEVAFVQCFQQFYDGIKDDPF  338

Query  1397  ASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHD---LQKI  1567
              +Q+   +  + RG   +QG  Y GT  FHRR VIYGL P++     K    +   L + 
Sbjct  339   GNQWVTAFEYIIRGMTGLQGPHYSGTNAFHRRNVIYGLYPDEIEIGRKGKLGEKILLMQK  398

Query  1568  YGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVT  1747
              G SK FV SA   L    +      LS  +EAA QVA C YE GT WG  +GW YGS+T
Sbjct  399   LGSSKEFVKSADQALDWKTNFPNDTNLSDFIEAAIQVAGCEYECGTCWGQEVGWVYGSIT  458

Query  1748  EDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIF  1927
             ED+ TG+ I R GW++  C P+   F GC P   L ++ Q KRWASG T + F     + 
Sbjct  459   EDVPTGLNIHRRGWRSESCTPDPIAFTGCAPRGLLTTMIQQKRWASGLTVVFFGKHSSLV  518

Query  1928  AALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASI  2107
               LFG +QFR  ++Y     W +R  F +CY  +  YC+I N+   P+G  + + I  S+
Sbjct  519   GMLFGKIQFRTGVSYFWLTNWGLRAAFLVCYVAVIAYCMIANTSIFPQG--LGLWIAISL  576

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             F+IYN++TL E++    SI  WWN+QRM
Sbjct  577   FVIYNIHTLLEHLTLGLSITYWWNSQRM  604



>ref|XP_006469656.1| PREDICTED: cellulose synthase-like protein B4-like isoform X2 
[Citrus sinensis]
Length=690

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/599 (51%), Positives = 385/599 (64%), Gaps = 53/599 (9%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     N   RA++V+IL LLL L+ YR+  L +HG+   W LA +CES FTFIW+
Sbjct  9     LPLYEKVFHKNTYHRALDVIILFLLLCLLFYRLSTLKNHGF--AWFLAFLCESCFTFIWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+V+ KW  +   TYP+R  E ++    E P VDMFVTTA+ ELEPPI+TVNTVLSLLA+
Sbjct  67    LIVNCKWTPLTYKTYPQRLQERIQ----ELPPVDMFVTTADAELEPPIITVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP +KLACYVSDD+ SP+ FY+LVEASKFAKLWVPFCKKYNV +RAPFRYF        
Sbjct  123   DYPVHKLACYVSDDACSPLNFYSLVEASKFAKLWVPFCKKYNVQIRAPFRYFPDSEPSDS  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDE  1114
              S  E  ++WK M                                       KVI EN  
Sbjct  183   SSG-ELLQDWKNM---------------------------------------KVISENKG  202

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
              L+  +PHL+YISREKRPKH H++KAGAMNVLTRVSG+MTNAPFMLNVDCD Y NNPE+V
Sbjct  203   GLSDEIPHLVYISREKRPKHPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMYANNPEIV  262

Query  1295  LHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
             L AMC  LG+K+E +  F+Q PQ FYD  ++    ++Y      +G+G   IQG FY GT
Sbjct  263   LQAMCLHLGSKNENEFAFIQSPQYFYDRPENLCILNEY------IGKGIVGIQGPFYQGT  316

Query  1475  GCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSY  1654
             G FHRR V+YGL  +       + + +L K +G SK F+ SA  TL G     +  + S 
Sbjct  317   GTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSKEFIKSAAQTLEGKTGGYSSNI-SR  375

Query  1655  SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGC  1834
             SL+ A +VA+CGYE+G++WG  +G  YG+  ED LTG+ I   GW++G+C+P    FLGC
Sbjct  376   SLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGC  435

Query  1835  TPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFEL  2014
                +G   + Q KRWA+G  EILFS + PI A L G LQFRQCLAY+  + W +R I EL
Sbjct  436   ASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPEL  495

Query  2015  CYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             CY  LP YC+ITNS FLPK  E  ++IP ++F+IY LYTL EY++   SIR+WW N  M
Sbjct  496   CYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNNCM  554



>ref|XP_008455913.1| PREDICTED: cellulose synthase-like protein H1 [Cucumis melo]
Length=746

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/603 (50%), Positives = 390/603 (65%), Gaps = 11/603 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLY+     N + R +++ I  LL+SL+ YR+  L SHG+   + LA + E WFTF W+
Sbjct  9     LPLYKRVRIENGLKRFIDITIFFLLISLLGYRLSLLSSHGFSCLFALAFLSELWFTFSWL  68

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++  W      TYP+R L+ VE    E P VD+FVTTA+P LEPPI+T+NTVLS+LA+
Sbjct  69    LTLNLNWTPSHYQTYPQRLLKRVEE---EVPPVDIFVTTADPVLEPPIITINTVLSVLAM  125

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             EYPA+K+ACYVSDD+ SP+TFY+L EA  FAK+W+PFC KY V VRAPFRYF+  H    
Sbjct  126   EYPASKVACYVSDDACSPLTFYSLCEALNFAKIWLPFCNKYKVQVRAPFRYFST-HLSSN  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPS----LFNKFATFADLDPNDHSTIIKVIC  1102
             ES+ +F  +W K+ D Y  L  KIE A +  +    L  + A F++  PN+HS IIKVI 
Sbjct  185   EST-QFHHDWTKIKDGYEELRQKIEEAAKTITCGGELTGQLADFSNAKPNNHSPIIKVIW  243

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN E +   +P LIY+SR K P+  H++KAGAMNVLTRVSGVMTNAP+MLN+DCD +VNN
Sbjct  244   ENKEGVRDELPTLIYVSRGKNPQIPHHYKAGAMNVLTRVSGVMTNAPYMLNLDCDMFVNN  303

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+++L AMC  L    +++  F+QFPQ FY+GLKDDP+ +Q+ +I   L  G   IQG  
Sbjct  304   PDILLQAMCLFLDPTIDKEYAFIQFPQIFYNGLKDDPFGNQWIVIMQILIYGQTGIQGPM  363

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             Y GTGC HRRKV+YG SP +    EK  +  L K +G SK FV SA  +L          
Sbjct  364   YMGTGCIHRRKVLYGRSPTEDNINEKYDEEKLYKRFGNSKEFVRSAIRSLRSFADHS--N  421

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              LS S+++  +VA   YE    WG  +GW+YGS+ ED+LTG+ I + GWK+ +  P  P 
Sbjct  422   CLSNSIKSTYEVATANYEHNNAWGSEVGWKYGSIVEDVLTGMEIHKKGWKSAYITPTPPA  481

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             FLGC PS G   LN  KR  +G  EIL S   PI  AL   LQFRQ L YM + L     
Sbjct  482   FLGCAPSGGPVPLNHHKRAITGLLEILISKNSPILTALSDKLQFRQRLVYMWAYLMGFGA  541

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             I+E+CYA LP +CLI+NSHFLPK  E  I +P  +F++  L  L +Y E  +S+RAWWNN
Sbjct  542   IWEICYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLLKLRMLLDYFETGQSVRAWWNN  601

Query  2183  QRM  2191
              RM
Sbjct  602   LRM  604



>gb|EAY78097.1| hypothetical protein OsI_33141 [Oryza sativa Indica Group]
Length=750

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/559 (53%), Positives = 371/559 (66%), Gaps = 13/559 (2%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFTF+W+L V+ KW+ V   T+PE   E ++    E PAVDMFVTTA+P LEPP
Sbjct  53    ALACEAWFTFMWLLNVNAKWSPVRFDTFPENLAERID----ELPAVDMFVTTADPVLEPP  108

Query  716   ILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAV  889
             ++TVNTVLSLLAL+YPA   KLACYVSDD  SP+T YAL EA++FA+ WVPFC+++ VAV
Sbjct  109   LVTVNTVLSLLALDYPAAGEKLACYVSDDGCSPLTCYALREAARFARTWVPFCRRHGVAV  168

Query  890   RAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFA  1057
             RAPFRYF++   F P    +F  +W  M  EY  L  +IE A + PSL      +FA F 
Sbjct  169   RAPFRYFSSTPEFGPADG-KFLEDWTFMKSEYEKLVHRIEDADE-PSLLRHGGGEFAEFL  226

Query  1058  DLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
             D++  +H TIIKV+ +N+ S    G P LIY+SREK P   H++KAGAMN LTRVS +MT
Sbjct  227   DVERGNHPTIIKVLWDNNRSRTGDGFPRLIYVSREKSPNLHHHYKAGAMNALTRVSALMT  286

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             NAPFMLN+DCD +VNNP VVLHAMC LLG  DE    FVQ PQ FY  LKDDP+ +Q ++
Sbjct  287   NAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPFGNQLEV  346

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVt  1594
                 +GRG A +QG FY GTGCFHRRKVIYG+      T    ++ +L   +G S     
Sbjct  347   SLMKVGRGVAGLQGIFYFGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGSSNNLKE  406

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             SA   + G+LS+E    +S  ++ A +VA C YE GT WG  +GW YGS+TED+LTG  I
Sbjct  407   SARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRI  466

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++     E P F+GC P+ G   L Q+KRWASG  EIL S   PI    F +LQF
Sbjct  467   HAAGWRSTLMEIEPPVFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQF  526

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
             RQCLAY+ S +WPVR  FELCYA L PYCL++N  FLPK +E    I  ++FI YN Y  
Sbjct  527   RQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIAYNTYMF  586

Query  2135  WEYMEEKESIRAWWNNQRM  2191
              E++E  +S RA WNN RM
Sbjct  587   MEFIECGQSARACWNNHRM  605



>ref|XP_004975624.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Setaria italica]
Length=811

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/606 (50%), Positives = 387/606 (64%), Gaps = 52/606 (9%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + WL ALVCE+WFT +W+L V+ KWN V   T+PER     E    E PAVDMFVTTA+P
Sbjct  59    WCWLAALVCEAWFTVVWLLNVNCKWNPVRFDTHPERLAGRTEE---ELPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
              LEPP +TVNTVLSLLAL+YPA KLACYVSDD  SPVT +AL EA++FA+LWVPFC+K+ 
Sbjct  116   RLEPPAVTVNTVLSLLALDYPAGKLACYVSDDGCSPVTCFALREAAEFARLWVPFCRKHG  175

Query  881   VAVRAPFRYFNADHTFPP-------ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF-  1036
             V VRAPF YF++  +  P        +  +F+R+W  M  EY  L  +IE A ++  L  
Sbjct  176   VGVRAPFVYFSSSSSGGPPERGGGGAADDKFQRDWTAMKSEYEKLASRIENADEESLLRR  235

Query  1037  --NKFATFADLDPNDHSTIIKVICENDESL-AVGVPHLIYISREKRPKHQHNFKAGAMNV  1207
                +FA F   D  DH TIIKV+ +N ++    G+P LIYISREK P+H H+FKAGAMNV
Sbjct  236   GDGEFAEFVGADRRDHPTIIKVLWDNGKAGDGHGIPSLIYISREKGPRHPHHFKAGAMNV  295

Query  1208  LTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKD  1387
             LTRVS V+TNAP MLN+DCD + NNP+V LHAMC LLG  DE  +GFVQ PQ FY  LKD
Sbjct  296   LTRVSAVVTNAPIMLNMDCDMFANNPQVALHAMCLLLGFDDELQSGFVQAPQKFYGTLKD  355

Query  1388  DPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKL------TD  1549
             DP+ +Q ++++  +G G A +QG FY GTGCFHRRKVIYG+ P  T   +        + 
Sbjct  356   DPFGNQMEVLFEKIGFGIAGLQGMFYGGTGCFHRRKVIYGVPPESTADVQPTRMRGSPSY  415

Query  1550  HDLQKIYGKSKIFVtsatttlsgslssetFGV-LSYSLEAASQVANCGYEFGTTWGHNIG  1726
              +LQK++G S+  + SA + +SG L +    V L+  ++ A +V+ C YE GT WG  +G
Sbjct  416   KELQKMFGSSRELIESARSAISGELFAAAPMVDLASRIDVAKEVSACSYEAGTCWGQEVG  475

Query  1727  WRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILF  1906
             W YGS+TEDILTG  I   GW++ F   + P FLG  P+ G  SL Q KRWA+G  EI+ 
Sbjct  476   WVYGSMTEDILTGQRIHAAGWRSAFLTTDPPAFLGGAPTGGPASLTQYKRWATGLLEIIL  535

Query  1907  SMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK-----  2071
             S   PI A    +L+FRQCLAY++  +WPVR  FELCYA L PYCL+ N  FLPK     
Sbjct  536   SRNNPILACTSKHLEFRQCLAYLVFYVWPVRAPFELCYALLGPYCLLANKSFLPKVTFCH  595

Query  2072  --------------------------GNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAW  2173
                                        +E   VIP ++F+  N++++ EYME ++S RAW
Sbjct  596   QFIIYSSVTSFFSHCSCELSCFSFLQASEPWFVIPLALFLTQNVHSVAEYMECRQSARAW  655

Query  2174  WNNQRM  2191
             WNN RM
Sbjct  656   WNNHRM  661



>ref|XP_004953418.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Setaria italica]
Length=754

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/564 (52%), Positives = 373/564 (66%), Gaps = 19/564 (3%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFT +W+L ++ KWN V   TY  R  E  +    E PAVD+FVTTA+PELEPP
Sbjct  55    ALACEAWFTLLWLLNMNCKWNPVRFETYTGRLSERGD----ELPAVDVFVTTADPELEPP  110

Query  716   ILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRA  895
             ++TVNTVLSLLAL+YPA KLACYVSDD  SP+T YAL EA+ FA+ WVPFC+++ V VRA
Sbjct  111   VVTVNTVLSLLALDYPAGKLACYVSDDGCSPLTCYALREAAAFARQWVPFCRRHGVGVRA  170

Query  896   PFRYFNADHTFPPE---SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF--NKFATFAD  1060
             PF YF++    PPE   +  EF REW  M +EY  L G+IE A +   L   N+ A F  
Sbjct  171   PFAYFSSG---PPEDRMADKEFFREWTFMKNEYEKLVGRIENAEENSLLQSDNELADFVG  227

Query  1061  LDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTN  1237
              D  +H TIIK++ +N +S    G P LIY+SREK PK  H+FKAGAMNVLTRVS V+TN
Sbjct  228   ADRRNHPTIIKILWDNSKSKTGEGFPSLIYVSREKSPKFHHHFKAGAMNVLTRVSAVLTN  287

Query  1238  APFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKII  1417
             AP MLNVDCD + NNP+V+LHAMC LLG  DE  +GFVQ PQ FY+ L+DDP+ +Q +++
Sbjct  288   APIMLNVDCDMFANNPQVILHAMCLLLGFDDEVHSGFVQAPQIFYNALQDDPFGNQTEVM  347

Query  1418  YHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTV------TAEKLTDHDLQKIYGKS  1579
             Y  LG G A +QG +Y+GTGCFHRRKVIY + P+ +       T    +  +L+   G  
Sbjct  348   YKKLGYGFAGLQGIYYNGTGCFHRRKVIYSMPPDCSTHVKPRRTKGSPSWEELRVKLGSQ  407

Query  1580  KIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDIL  1759
             K  + SA + +SG + +     LS  ++ A++V+ C YE  T WG  IGW YGS TEDIL
Sbjct  408   KELIESARSIISGDMLAVPIVGLSSRIKVANEVSACSYEASTGWGQEIGWVYGSTTEDIL  467

Query  1760  TGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALF  1939
             TG  I   GWK+       P FLG  P+ G  SL Q KRWA+G  EIL S   PI  ++ 
Sbjct  468   TGQRIHAAGWKSALMNTNPPAFLGSAPTGGPASLTQYKRWATGLFEILVSRNNPILLSIC  527

Query  1940  GNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIY  2119
               L FRQCLAY++  +WP+R  FELCY+ L PYCL+TN  FLPK +E    I  ++F+ Y
Sbjct  528   KRLHFRQCLAYLVIDVWPLRAPFELCYSLLGPYCLLTNHSFLPKSSEPGFSITLALFLTY  587

Query  2120  NLYTLWEYMEEKESIRAWWNNQRM  2191
             N+Y   EYM+ + S RAWWNNQRM
Sbjct  588   NIYNFMEYMDCQLSARAWWNNQRM  611



>gb|AAN01252.1| Unknown protein similar to putative cellulose synthase [Oryza 
sativa Japonica Group]
Length=913

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/559 (53%), Positives = 373/559 (67%), Gaps = 13/559 (2%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFTF+W+L V+ KW+ V   T+PE   E ++    E PAVDMFVTTA+P LEPP
Sbjct  53    ALACEAWFTFMWLLNVNAKWSPVRFDTFPENLAERID----ELPAVDMFVTTADPVLEPP  108

Query  716   ILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAV  889
             ++TVNTVLSLLAL+YPA   KLACYVSDD  SP+T YAL EA++FA+ WVPFC+++ VAV
Sbjct  109   LVTVNTVLSLLALDYPAAGEKLACYVSDDGCSPLTCYALREAARFARTWVPFCRRHGVAV  168

Query  890   RAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFA  1057
             RAPFRYF++   F P +  +F  +W  M  EY  L  +IE A + PSL      +FA F 
Sbjct  169   RAPFRYFSSTPEFGP-ADGKFLEDWTFMKSEYEKLVHRIEDADE-PSLLRHGGGEFAEFL  226

Query  1058  DLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
             D++  +H TIIKV+ +N+ S    G P LIY+SREK P   H++KAGAMN LTRVS +MT
Sbjct  227   DVERGNHPTIIKVLWDNNRSRTGDGFPRLIYVSREKSPNLHHHYKAGAMNALTRVSALMT  286

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             NAPFMLN+DCD +VNNP VVLHAMC LLG  DE    FVQ PQ FY  LKDDP+ +Q ++
Sbjct  287   NAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPFGNQLEV  346

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVt  1594
                 +GRG A +QG FY GTGCFHRRKVIYG+      T    ++ +L   +G S  F  
Sbjct  347   SLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGSSNNFKE  406

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             SA   + G+LS+E    +S  ++ A +VA C YE GT WG  +GW YGS+TED+LTG  I
Sbjct  407   SARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRI  466

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++     E P F+GC P+ G   L Q+KRWASG  EIL S   PI    F +LQF
Sbjct  467   HAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQF  526

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
             RQCLAY+ S +WPVR  FELCYA L PYCL++N  FLPK +E    I  ++FI YN Y  
Sbjct  527   RQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIAYNTYMF  586

Query  2135  WEYMEEKESIRAWWNNQRM  2191
              E++E  +S RA WNN RM
Sbjct  587   MEFIECGQSARACWNNHRM  605



>ref|XP_003596948.1| Cellulose synthase-like protein H1 [Medicago truncatula]
Length=751

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/613 (50%), Positives = 401/613 (65%), Gaps = 26/613 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         RA++++ILLLL SL+ YR+    +  +   W LA  CESWFT+ W+
Sbjct  7     LPLYEKIWIKRTFQRAIDILILLLLFSLLCYRI----NVTFTIPWFLAFSCESWFTYTWI  62

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+     TYP R L+ V     E P VD+FVTTA+P LEPPI+T+NTVLSLLAL
Sbjct  63    ILLNTKWSPAVNKTYPNRLLQRVH----ELPRVDLFVTTADPVLEPPIITLNTVLSLLAL  118

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S  TFY L+EASKFAK WVPFCKKYNV VRAPFRYF +  T   
Sbjct  119   DYPANKLACYVSDDGCSVFTFYGLLEASKFAKFWVPFCKKYNVQVRAPFRYF-SQVTNSD  177

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
             + S EF++EW KM D Y NL  KIE  T+  + F    +FA F++ +  +H +IIKVI +
Sbjct  178   DDSAEFKQEWLKMKDMYDNLSHKIEDVTRNSASFQFEGEFAVFSNTEKRNHPSIIKVILD  237

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
                 L+ G+PHLIYISREKRPK++HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP
Sbjct  238   G---LSDGLPHLIYISREKRPKYEHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNP  294

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             +++ HA+C L+ +K  +D  FVQ  Q FYDG+KDDP+ +Q+   +  +  G A +QG +Y
Sbjct  295   KIMQHAICILVDSKSGKDVAFVQCFQKFYDGIKDDPFGNQWVAAFEYMIGGMAGLQGPYY  354

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              G+  FHRR  IYG  PN+       KL ++ L + +G SK FV SAT  + G+  S   
Sbjct  355   GGSNTFHRRYAIYGFYPNEIQHGNKAKLAENILIQQFGSSKKFVKSATQVMEGNDYSTHG  414

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                S  +E A +V++C YE+GT WG  +GW YGS++ED+ TG+ +QR GW++  C PE  
Sbjct  415   NSPSNFIEEAIKVSDCEYEYGTCWGKQMGWLYGSISEDVPTGLNMQRKGWRSECCTPEPT  474

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              F GC P   L ++ Q KRW+SG T + FS   P+   LFG +QFR  L+Y     W +R
Sbjct  475   AFTGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMGTLFGKIQFRAGLSYCWLTNWGLR  534

Query  2000  PIFELCYAFLPPYCLITN---------SHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
              +FE+ YA L  YC+ITN         SH +       + IP ++F+IY ++TL EY  +
Sbjct  535   SVFEVSYAALVAYCIITNTSIFPEVRYSHSISTAKGAGLWIPLTLFVIYTMHTLQEYKLK  594

Query  2153  KESIRAWWNNQRM  2191
               S+R WWNNQRM
Sbjct  595   GFSLRYWWNNQRM  607



>gb|KDO39591.1| hypothetical protein CISIN_1g006357mg [Citrus sinensis]
Length=648

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/516 (57%), Positives = 355/516 (69%), Gaps = 18/516 (3%)
 Frame = +2

Query  677   MFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLW  856
             MFVTTA+ ELEPPI+TVNTVLSLLA++YPA+KLACY+SDD+ SP+ FY+LVEASKFAKLW
Sbjct  1     MFVTTADVELEPPIMTVNTVLSLLAVDYPAHKLACYISDDACSPLIFYSLVEASKFAKLW  60

Query  857   VPFCKKYNVAVRAPFRYFNADHTFPPE-SSPEFRREWKKMNDEYANLCGKIEYATQKPSL  1033
             VPFCKKYNV VRAPFRYF  +   PP  SS EF+++WK M +EY  L   IE A +K  L
Sbjct  61    VPFCKKYNVQVRAPFRYFLGESAKPPSTSSREFQQDWKMMKEEYEQLNRNIEQAAKKSFL  120

Query  1034  FN---KFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMN  1204
             F+   + A F+D +  DH  I+KVI EN E L+ G+PHLIYISREKRPKH H++KAGAMN
Sbjct  121   FDMTGEMAVFSDTERRDHPAIVKVIWENKEDLSNGLPHLIYISREKRPKHPHHYKAGAMN  180

Query  1205  VLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLK  1384
             VLTRVSG+MTNAPFMLNVDCD Y NNPE+VL AMC LLG+K E D  FVQ PQ FYD   
Sbjct  181   VLTRVSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLLLGSK-EGDCAFVQSPQYFYDSPA  239

Query  1385  DDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDH----  1552
             D        I++  LG+G   IQG FY GTG FHRRKVIYGL P++     K  +     
Sbjct  240   DS-----LAILHESLGKGIVGIQGPFYAGTGTFHRRKVIYGLWPDEIENQGKCINSVNGQ  294

Query  1553  ---DLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNI  1723
                +L +  G SK F+ SA   L G  +  +   LS SL+AA+QVA CGYE+G++WG  +
Sbjct  295   VGGELLQKSGNSKEFIKSAVDALEGKNTGFSSN-LSDSLKAANQVAGCGYEYGSSWGKKV  353

Query  1724  GWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEIL  1903
             GW YGS TEDILTG+ I   GWKT +C P+   FLGC PS    ++ Q KRWA G  EIL
Sbjct  354   GWLYGSATEDILTGLMIHAKGWKTSYCSPDPHAFLGCGPSDLPAAMRQQKRWAMGLLEIL  413

Query  1904  FSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEV  2083
              S   PI A L G LQFRQCL Y+  ++W +R I ELCY  LP YC+ITN+ FLPK  E 
Sbjct  414   LSEHSPILATLTGKLQFRQCLGYLWLLIWGLRSIPELCYVALPAYCIITNTSFLPKVQEP  473

Query  2084  AIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
              I I  +IF+IY LYTL EY+     I +W+ N  M
Sbjct  474   GICIAVAIFVIYKLYTLSEYIHGGFPIYSWFVNNSM  509



>gb|KEH39004.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=573

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/563 (51%), Positives = 384/563 (68%), Gaps = 9/563 (2%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYT-WLLALVCESWFTFIWVL  577
             LYE       + RA++++ILLLL SL+ YR++ + S+  +   W LA  CESWFT+ W++
Sbjct  9     LYEKIWIKRTLQRAIDLLILLLLFSLLCYRIFFIISNKTFTIPWFLAFSCESWFTYTWII  68

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +++TKW+   T TYP R L+ +     E P VD+FVTTA+P LEPPI+T+NTVLSLLAL+
Sbjct  69    LLNTKWSPAVTKTYPNRLLQRLPEN--ELPCVDLFVTTADPVLEPPIITLNTVLSLLALD  126

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  S  TFY L+EASKFAK WVPFCKKYN+ VRAPFRYF +  T   +
Sbjct  127   YPANKLACYVSDDGCSVFTFYGLLEASKFAKFWVPFCKKYNIQVRAPFRYF-SQVTNSDD  185

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
              S EF++EW KM D Y NL  KIE  T+  + F    ++A F + +  +H +I+KVI EN
Sbjct  186   DSAEFKQEWLKMKDMYDNLSHKIEDVTRNSTSFQFEGEYAVFLNTEKRNHPSIVKVILEN  245

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              +SL+ G+PHLIYISREKRPK++HN+KAGAMNVLTRVSG+MTNAPFMLNVDCD  VNNP+
Sbjct  246   YDSLSDGLPHLIYISREKRPKYEHNYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNPK  305

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             ++ HAMC L+ +K+ +D  FVQ  Q FYDG+KDDP+ +Q+   +  + +G   +QG FY 
Sbjct  306   IIQHAMCILMDSKNGKDVAFVQCFQQFYDGIKDDPFGNQWVASFEYIIKGMGGLQGPFYG  365

Query  1469  GTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
             GT  FHRR  IYGL P++       K+T+  L + +G SK FV S T    GS +S    
Sbjct  366   GTNTFHRRNAIYGLYPDEIQYGRKGKITEKMLIQQFGSSKEFVKSVTHAFEGSGNSIDGI  425

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
               S  L+ A QV++CGYE+GT+WG  + W YGS++ED+ TG+ +QR GW++  C PE   
Sbjct  426   SPSNLLDKAIQVSDCGYEYGTSWGKQMCWLYGSISEDVPTGLNMQRKGWRSECCTPEPTA  485

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+GC P   L ++ Q KRW+SG T + FS   P+   LFG +QFR  L+Y     W +R 
Sbjct  486   FMGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMCTLFGKIQFRAGLSYCWLTNWGLRS  545

Query  2003  IFELCYAFLPPYCLITNSHFLPK  2071
             +FE+ YA L  YC+ITN+   PK
Sbjct  546   VFEVSYAALVAYCIITNTSIFPK  568



>ref|XP_006653400.1| PREDICTED: cellulose synthase-like protein H2-like [Oryza brachyantha]
Length=777

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/566 (50%), Positives = 367/566 (65%), Gaps = 18/566 (3%)
 Frame = +2

Query  527   WLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPEL  706
             W +A VCE+WFT + +L ++ KW+ V   TYP+   + ++    E PAVDM VTTA+P L
Sbjct  63    WRVAFVCEAWFTVLCLLNLNAKWSPVRFVTYPDNLDDRMD----ELPAVDMLVTTADPVL  118

Query  707   EPPILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             EPP++TVNTVLSLLAL+YPA   +LACYVSDD  SP T YAL EA+ FA  WVPFC++Y 
Sbjct  119   EPPLVTVNTVLSLLALDYPAAGERLACYVSDDGCSPATCYALREAASFATAWVPFCRRYG  178

Query  881   VAVRAPFRYFNADHTFPPESSP---EFRREWKKMNDEYANLCGKIEYATQKPSLFN----  1039
             VAVRAPF YF++    PPE  P   +F  +W  M DEY  L  +I+   ++  L      
Sbjct  179   VAVRAPFLYFSST---PPELGPLDHKFLEDWTLMKDEYEKLARRIKETDERSLLLQHGGG  235

Query  1040  KFATFADLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTR  1216
             +FA F +++  +H TIIKV+ +N +S +  G PHL+Y+SREKRP H+H++KAGAMNVL R
Sbjct  236   EFAEFLNVERTNHPTIIKVLWDNSKSRIGEGFPHLVYVSREKRPMHRHHYKAGAMNVLMR  295

Query  1217  VSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPY  1396
             VS VMTNAP +LN DCD + NNP+ +LHAMC LLG  DE ++GFVQ PQ FYD LKDDP+
Sbjct  296   VSAVMTNAPIVLNTDCDMFANNPKALLHAMCLLLGFHDEINSGFVQVPQRFYDALKDDPF  355

Query  1397  ASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGK  1576
              +  +  +  L RG   +QG FY GTGCFHRRK IYG+ PN   ++      ++Q  +G 
Sbjct  356   GNHLECFFKRLVRGIQGLQGPFYAGTGCFHRRKAIYGVPPNCNNSSGSSCHKEVQTKFGN  415

Query  1577  SK-IFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTED  1753
             S+ +  ++         S++    +S  ++AA +V+ C YE GT WG  +GW YGS+TED
Sbjct  416   SEELKESTKPIISGDLSSTKPMADVSGRVDAAKEVSACNYEVGTCWGQEVGWVYGSLTED  475

Query  1754  ILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAA  1933
             ILTG  I   GW++     E P F+G  P  G  SL Q KRWA+G  EI+ S   P+F+A
Sbjct  476   ILTGQRIHTKGWRSTLMETEPPAFMGSAPVGGPASLTQFKRWATGLFEIIVSRNNPVFSA  535

Query  1934  LFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFI  2113
             +F  LQ RQCL Y+I   WPVR  FELCY  L PYCL+TN  FLPK +E    IP ++F+
Sbjct  536   MFERLQLRQCLGYLIVYGWPVRAPFELCYGLLGPYCLLTNQSFLPKASEDGFSIPFALFL  595

Query  2114  IYNLYTLWEYMEEKESIRAWWNNQRM  2191
              YN Y+  EY     S RAWWNN RM
Sbjct  596   SYNAYSFMEYKACGLSARAWWNNHRM  621



>ref|XP_004975622.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Setaria italica]
Length=844

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/639 (47%), Positives = 385/639 (60%), Gaps = 85/639 (13%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + WL ALVCE+WFT +W+L V+ KWN V   T+PER     E    E PAVDMFVTTA+P
Sbjct  59    WCWLAALVCEAWFTVVWLLNVNCKWNPVRFDTHPERLAGRTEE---ELPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
              LEPP +TVNTVLSLLAL+YPA KLACYVSDD  SPVT +AL EA++FA+LWVPFC+K+ 
Sbjct  116   RLEPPAVTVNTVLSLLALDYPAGKLACYVSDDGCSPVTCFALREAAEFARLWVPFCRKHG  175

Query  881   VAVRAPFRYFNADHTFPP-------ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF-  1036
             V VRAPF YF++  +  P        +  +F+R+W  M  EY  L  +IE A ++  L  
Sbjct  176   VGVRAPFVYFSSSSSGGPPERGGGGAADDKFQRDWTAMKSEYEKLASRIENADEESLLRR  235

Query  1037  --NKFATFADLDPNDHSTIIKV-----ICENDESLAV-----------------------  1126
                +FA F   D  DH TIIKV      C   E L                         
Sbjct  236   GDGEFAEFVGADRRDHPTIIKVETMSCTCCTIEQLRCRRSMSDPATFSCRGCVQVLWDNG  295

Query  1127  ------GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
                   G+P LIYISREK P+H H+FKAGAMNVLTRVS V+TNAP MLN+DCD + NNP+
Sbjct  296   KAGDGHGIPSLIYISREKGPRHPHHFKAGAMNVLTRVSAVVTNAPIMLNMDCDMFANNPQ  355

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             V LHAMC LLG  DE  +GFVQ PQ FY  LKDDP+ +Q ++++  +G G A +QG FY 
Sbjct  356   VALHAMCLLLGFDDELQSGFVQAPQKFYGTLKDDPFGNQMEVLFEKIGFGIAGLQGMFYG  415

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKL------TDHDLQKIYGKSKIFVtsatttlsgslss  1630
             GTGCFHRRKVIYG+ P  T   +        +  +LQK++G S+  + SA + +SG L +
Sbjct  416   GTGCFHRRKVIYGVPPESTADVQPTRMRGSPSYKELQKMFGSSRELIESARSAISGELFA  475

Query  1631  etFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
                 V L+  ++ A +V+ C YE GT WG  +GW YGS+TEDILTG  I   GW++ F  
Sbjct  476   AAPMVDLASRIDVAKEVSACSYEAGTCWGQEVGWVYGSMTEDILTGQRIHAAGWRSAFLT  535

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
              + P FLG  P+ G  SL Q KRWA+G  EI+ S   PI A    +L+FRQCLAY++  +
Sbjct  536   TDPPAFLGGAPTGGPASLTQYKRWATGLLEIILSRNNPILACTSKHLEFRQCLAYLVFYV  595

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPK-------------------------------G  2074
             WPVR  FELCYA L PYCL+ N  FLPK                                
Sbjct  596   WPVRAPFELCYALLGPYCLLANKSFLPKVTFCHQFIIYSSVTSFFSHCSCELSCFSFLQA  655

Query  2075  NEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             +E   VIP ++F+  N++++ EYME ++S RAWWNN RM
Sbjct  656   SEPWFVIPLALFLTQNVHSVAEYMECRQSARAWWNNHRM  694



>ref|XP_004165439.1| PREDICTED: cellulose synthase-like protein H1-like, partial [Cucumis 
sativus]
Length=651

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/530 (53%), Positives = 352/530 (66%), Gaps = 37/530 (7%)
 Frame = +2

Query  671   VDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAK  850
             VD+FVTTA+P LEPPI+TVNTVLSL+AL+YP+NKL CYVSDD  S +T YAL EA KF K
Sbjct  1     VDIFVTTADPVLEPPIITVNTVLSLMALDYPSNKLGCYVSDDGCSSLTLYALKEALKFGK  60

Query  851   LWVPFCKKYNVAVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEYATQK  1024
             +WVPFCKKY + VRAPFRYF++    PP   +S EFR +W+ +  EY  L   I+ A + 
Sbjct  61    IWVPFCKKYEIQVRAPFRYFSS----PPHLHTSAEFRNDWQMVKVEYEKLEANIKEAEE-  115

Query  1025  PSLFNKF-----------ATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPK  1171
                 NKF           A F +L   +H TIIK++ EN + L   +PHLIY+SREK  K
Sbjct  116   ----NKFGLEEEVDGMDMADFCNLHTKNHPTIIKMLWENKDDLD-ELPHLIYVSREKSFK  170

Query  1172  HQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDE-RDTGF  1348
             H H +KAGAMNVLTRVSGV+TNAP++LNVDCD ++NNP+VVLHAMC    ++D+  D G+
Sbjct  171   HHHYYKAGAMNVLTRVSGVLTNAPYILNVDCDMFMNNPQVVLHAMCVFFNSEDDFEDIGY  230

Query  1349  VQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN---  1519
             VQ P  FYDG+KDDPY +Q  I+Y    RG   +QG  Y G+GCFHRRKV+YG  P+   
Sbjct  231   VQTPPCFYDGIKDDPYGNQLVIVYEYFTRGIMGLQGPIYSGSGCFHRRKVLYGQFPHYTT  290

Query  1520  DTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL------SYSLEAASQVA  1681
             ++V   K ++ ++ K +G SK F  SA      +     FG L      + +LEAA QVA
Sbjct  291   NSVDGRKASEQEIIKSFGYSKSFAKSAIYAFEETT----FGYLPEGLFNNNNLEAAIQVA  346

Query  1682  NCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSL  1861
              CGYE GTTWG  IGW YGS  EDILT + I R GW++ +     P FLGC PS  + SL
Sbjct  347   GCGYEIGTTWGSKIGWMYGSTCEDILTSLVIHRKGWRSIYIALNPPAFLGCAPSQLVTSL  406

Query  1862  NQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYC  2041
              Q KRW +G  EILFS  CPIF  LF NLQ++QC AY+  + W +R I EL YA LPPYC
Sbjct  407   TQQKRWVTGLLEILFSKHCPIFGTLFENLQWKQCAAYLWILTWGIRSILELSYALLPPYC  466

Query  2042  LITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             LITN+ F P   E AI IP S+FI+YN   L +Y E  +S+RAWWNNQRM
Sbjct  467   LITNTSFFPTMEERAIFIPISLFIVYNFQQLLQYKETGQSVRAWWNNQRM  516



>ref|XP_006653401.1| PREDICTED: putative cellulose synthase-like protein H3-like [Oryza 
brachyantha]
Length=769

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/596 (49%), Positives = 378/596 (63%), Gaps = 19/596 (3%)
 Frame = +2

Query  446   EVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPE  625
             + V+L L ++L+A RV  L   G    W +AL CE+WF F+W+L ++ KWN V   TYPE
Sbjct  28    DFVVLFLFVALLARRVAGLDGGGA--AWRVALACEAWFAFVWLLNMNAKWNPVRFDTYPE  85

Query  626   RFLEWVENGSC-EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPA--NKLACYVSDD  796
                   E GS  E  AVDMFVTTA+P LEPP++TVNTVLSLLA++YPA   KLACYV DD
Sbjct  86    NL---AERGSIDELLAVDMFVTTADPVLEPPMVTVNTVLSLLAVDYPAADEKLACYVHDD  142

Query  797   SASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMN  976
             + SP+T YAL EA+ FA+LWVPFC+++ VAVRAPFRYF++          EF  +W  + 
Sbjct  143   ACSPLTCYALREAASFARLWVPFCRRHGVAVRAPFRYFSSTPELGTAGGNEFLDDWAFIK  202

Query  977   DEYANLCGKIEYATQKPSLFNK----FATFADLDPNDHSTIIKVICENDESLA-VGVPHL  1141
              EY  L  ++E A +   L       FA F D++  +H  I+K++ +N +S A    PHL
Sbjct  203   REYEKLVRRVEDADESTLLRQGDGEFFAEFMDVERTNHPAIVKILWDNSKSRAGERFPHL  262

Query  1142  IYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLG  1321
             IY+SREK P H H +KAGAMNVL RVS VMTNAP  LNVDCD + NNP+VVLHAMC LLG
Sbjct  263   IYVSREKSPSHHHYYKAGAMNVLARVSAVMTNAPITLNVDCDMFANNPQVVLHAMCVLLG  322

Query  1322  AKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVI  1501
               DE  +GFVQ P+  Y  LKDDP+ +Q ++IY  LG G A I  +FY+G+GCFHRRK I
Sbjct  323   FDDEIYSGFVQAPRKLYGTLKDDPFGTQQEVIYKTLGSGMAGIWCTFYNGSGCFHRRKAI  382

Query  1502  YGLSPNDTV------TAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLE  1663
             YG +PN ++      T + L   + +  +G S+    S T+ LSG+L  E    +S  +E
Sbjct  383   YGATPNSSIGARREGTTDSLPPKEFENKFGSSEELKESITSILSGNLPVEPIVDISCRVE  442

Query  1664  AASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPS  1843
             AA +VA C YE GT WG  +GW YGS+TEDILTG  I   GW++     E P F+   P 
Sbjct  443   AAKEVATCKYESGTRWGREVGWVYGSMTEDILTGQRIHAAGWRSVLLETEPPAFMCAAPI  502

Query  1844  TGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYA  2023
              G   L Q KRWA+G  EI+ S   PI   +F  L+ RQCL+Y+    WPVR   ELCYA
Sbjct  503   GGPACLTQFKRWATGLFEIIISRNNPILMTVFRRLRLRQCLSYLSIYAWPVRGFIELCYA  562

Query  2024  FLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
              LPPYC++TN  FLPK  +    IP ++F+ YN Y+  EY +   S+ AWWNN +M
Sbjct  563   LLPPYCILTNQSFLPKAPQDVFGIPLALFLTYNTYSYMEYKKCGLSVHAWWNNHKM  618



>ref|XP_004953420.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Setaria italica]
Length=685

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/549 (52%), Positives = 361/549 (66%), Gaps = 19/549 (3%)
 Frame = +2

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             ++ KWN V   TY  R  E  +    E PAVD+FVTTA+PELEPP++TVNTVLSLLAL+Y
Sbjct  1     MNCKWNPVRFETYTGRLSERGD----ELPAVDVFVTTADPELEPPVVTVNTVLSLLALDY  56

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE-  937
             PA KLACYVSDD  SP+T YAL EA+ FA+ WVPFC+++ V VRAPF YF++    PPE 
Sbjct  57    PAGKLACYVSDDGCSPLTCYALREAAAFARQWVPFCRRHGVGVRAPFAYFSSG---PPED  113

Query  938   --SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF--NKFATFADLDPNDHSTIIKVICE  1105
               +  EF REW  M +EY  L G+IE A +   L   N+ A F   D  +H TIIK++ +
Sbjct  114   RMADKEFFREWTFMKNEYEKLVGRIENAEENSLLQSDNELADFVGADRRNHPTIIKILWD  173

Query  1106  NDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             N +S    G P LIY+SREK PK  H+FKAGAMNVLTRVS V+TNAP MLNVDCD + NN
Sbjct  174   NSKSKTGEGFPSLIYVSREKSPKFHHHFKAGAMNVLTRVSAVLTNAPIMLNVDCDMFANN  233

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P+V+LHAMC LLG  DE  +GFVQ PQ FY+ L+DDP+ +Q +++Y  LG G A +QG +
Sbjct  234   PQVILHAMCLLLGFDDEVHSGFVQAPQIFYNALQDDPFGNQTEVMYKKLGYGFAGLQGIY  293

Query  1463  YDGTGCFHRRKVIYGLSPNDTV------TAEKLTDHDLQKIYGKSKIFVtsatttlsgsl  1624
             Y+GTGCFHRRKVIY + P+ +       T    +  +L+   G  K  + SA + +SG +
Sbjct  294   YNGTGCFHRRKVIYSMPPDCSTHVKPRRTKGSPSWEELRVKLGSQKELIESARSIISGDM  353

Query  1625  ssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFC  1804
              +     LS  ++ A++V+ C YE  T WG  IGW YGS TEDILTG  I   GWK+   
Sbjct  354   LAVPIVGLSSRIKVANEVSACSYEASTGWGQEIGWVYGSTTEDILTGQRIHAAGWKSALM  413

Query  1805  VPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISI  1984
                 P FLG  P+ G  SL Q KRWA+G  EIL S   PI  ++   L FRQCLAY++  
Sbjct  414   NTNPPAFLGSAPTGGPASLTQYKRWATGLFEILVSRNNPILLSICKRLHFRQCLAYLVID  473

Query  1985  LWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESI  2164
             +WP+R  FELCY+ L PYCL+TN  FLPK +E    I  ++F+ YN+Y   EYM+ + S 
Sbjct  474   VWPLRAPFELCYSLLGPYCLLTNHSFLPKSSEPGFSITLALFLTYNIYNFMEYMDCQLSA  533

Query  2165  RAWWNNQRM  2191
             RAWWNNQRM
Sbjct  534   RAWWNNQRM  542



>emb|CDM80574.1| unnamed protein product [Triticum aestivum]
Length=619

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/563 (50%), Positives = 356/563 (63%), Gaps = 16/563 (3%)
 Frame = +2

Query  539   LVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPI  718
             LVCE+WFTF+W+L ++ KWN V   TYPE   + ++    E PAVDM VTTA+PELEPP+
Sbjct  50    LVCEAWFTFVWILNMNIKWNPVRFHTYPENLSQRMD----ELPAVDMLVTTADPELEPPL  105

Query  719   LTVNTVLSLLALEYP-ANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRA  895
             +TVNTVLSLLA++YP  +KLACYVSDD  SPVT YAL EA+ FA+LWVPFCK++ V VRA
Sbjct  106   MTVNTVLSLLAVDYPDVDKLACYVSDDGCSPVTCYALREAAGFARLWVPFCKRHGVGVRA  165

Query  896   PFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADL  1063
             PF YF +    P  +  +F  +W  +  EY  L   IE A +   L +    +F  F   
Sbjct  166   PFIYFASSRPEPDLAGDKFSDDWIFIKSEYDKLVSLIESADEASLLRHDHAGEFTEFKGA  225

Query  1064  DPNDHSTIIKVICENDESLAVG--VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTN  1237
             +  DH  I+KV+ +N +S   G   P+L+Y+SREK  KH H++KAGAMNVL RVS VMTN
Sbjct  226   ECGDHPAIVKVLWDNSKSSGTGEGFPNLVYVSREKSRKHDHHYKAGAMNVLARVSAVMTN  285

Query  1238  APFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKII  1417
             AP +LNVDCD +VNNP+VVLHA C LLG  DE  +GFVQ PQ FY  LKDDP+ +Q +++
Sbjct  286   APIILNVDCDMFVNNPQVVLHATCLLLGFDDETCSGFVQVPQRFYGKLKDDPFGNQMEVL  345

Query  1418  YHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND--TVTAEK---LTDHDLQKIYGKSK  1582
                L  G A +QG FY GTGCFHRRK+IYG++P     +  E+   L+  DL   +G S 
Sbjct  346   REKLFGGLAGLQGIFYLGTGCFHRRKIIYGVAPASFAAIKHEREGSLSYEDLLTKFGASM  405

Query  1583  IFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILT  1762
               V S+    S  +  +    ++  ++ A QV+ C YE GT WG  IGW YGS+ EDILT
Sbjct  406   ELVESSRNIYSVEIPPKPMIDITSRIQVAKQVSTCNYETGTHWGEEIGWSYGSMAEDILT  465

Query  1763  GIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFG  1942
             G  I   GWKT       P FLGC P+ G  SL Q KRWA+G  EIL     PI A  F 
Sbjct  466   GQRIHSAGWKTTLLDTNPPAFLGCAPTGGPASLTQYKRWATGVLEILLGQNNPIIATTFK  525

Query  1943  NLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
              LQFRQCLAY++  +W +R  FELCYA L P+CL  N  FL K +     I  ++F+ YN
Sbjct  526   RLQFRQCLAYLVLYIWSMRAPFELCYALLGPFCLFRNHSFLLKASNHGFSIQLALFLSYN  585

Query  2123  LYTLWEYMEEKESIRAWWNNQRM  2191
             +Y   EY E   S R WWNN RM
Sbjct  586   IYNFVEYKECGLSARTWWNNMRM  608



>gb|ABB47241.1| Cellulose synthase family protein, expressed [Oryza sativa Japonica 
Group]
Length=572

 Score =   540 bits (1392),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 280/519 (54%), Positives = 349/519 (67%), Gaps = 13/519 (3%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFTF+W+L V+ KW+ V   T+PE   E ++    E PAVDMFVTTA+P LEPP
Sbjct  53    ALACEAWFTFMWLLNVNAKWSPVRFDTFPENLAERID----ELPAVDMFVTTADPVLEPP  108

Query  716   ILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAV  889
             ++TVNTVLSLLAL+YPA   KLACYVSDD  SP+T YAL EA++FA+ WVPFC+++ VAV
Sbjct  109   LVTVNTVLSLLALDYPAAGEKLACYVSDDGCSPLTCYALREAARFARTWVPFCRRHGVAV  168

Query  890   RAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFA  1057
             RAPFRYF++   F P    +F  +W  M  EY  L  +IE A + PSL      +FA F 
Sbjct  169   RAPFRYFSSTPEFGPADG-KFLEDWTFMKSEYEKLVHRIEDADE-PSLLRHGGGEFAEFL  226

Query  1058  DLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
             D++  +H TIIKV+ +N+ S    G P LIY+SREK P   H++KAGAMN LTRVS +MT
Sbjct  227   DVERGNHPTIIKVLWDNNRSRTGDGFPRLIYVSREKSPNLHHHYKAGAMNALTRVSALMT  286

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             NAPFMLN+DCD +VNNP VVLHAMC LLG  DE    FVQ PQ FY  LKDDP+ +Q ++
Sbjct  287   NAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPFGNQLEV  346

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVt  1594
                 +GRG A +QG FY GTGCFHRRKVIYG+      T    ++ +L   +G S  F  
Sbjct  347   SLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGSSNNFKE  406

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             SA   + G+LS+E    +S  ++ A +VA C YE GT WG  +GW YGS+TED+LTG  I
Sbjct  407   SARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRI  466

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++     E P F+GC P+ G   L Q+KRWASG  EIL S   PI    F +LQF
Sbjct  467   HAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQF  526

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK  2071
             RQCLAY+ S +WPVR  FELCYA L PYCL++N  FLPK
Sbjct  527   RQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPK  565



>gb|ABB47240.2| Cellulose synthase family protein, expressed [Oryza sativa Japonica 
Group]
Length=570

 Score =   540 bits (1390),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 280/519 (54%), Positives = 349/519 (67%), Gaps = 13/519 (3%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFTF+W+L V+ KW+ V   T+PE   E ++    E PAVDMFVTTA+P LEPP
Sbjct  53    ALACEAWFTFMWLLNVNAKWSPVRFDTFPENLAERID----ELPAVDMFVTTADPVLEPP  108

Query  716   ILTVNTVLSLLALEYPA--NKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAV  889
             ++TVNTVLSLLAL+YPA   KLACYVSDD  SP+T YAL EA++FA+ WVPFC+++ VAV
Sbjct  109   LVTVNTVLSLLALDYPAAGEKLACYVSDDGCSPLTCYALREAARFARTWVPFCRRHGVAV  168

Query  890   RAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFA  1057
             RAPFRYF++   F P    +F  +W  M  EY  L  +IE A + PSL      +FA F 
Sbjct  169   RAPFRYFSSTPEFGPADG-KFLEDWTFMKSEYEKLVHRIEDADE-PSLLRHGGGEFAEFL  226

Query  1058  DLDPNDHSTIIKVICENDES-LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
             D++  +H TIIKV+ +N+ S    G P LIY+SREK P   H++KAGAMN LTRVS +MT
Sbjct  227   DVERGNHPTIIKVLWDNNRSRTGDGFPRLIYVSREKSPNLHHHYKAGAMNALTRVSALMT  286

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             NAPFMLN+DCD +VNNP VVLHAMC LLG  DE    FVQ PQ FY  LKDDP+ +Q ++
Sbjct  287   NAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPFGNQLEV  346

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVt  1594
                 +GRG A +QG FY GTGCFHRRKVIYG+      T    ++ +L   +G S  F  
Sbjct  347   SLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGSSNNFKE  406

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             SA   + G+LS+E    +S  ++ A +VA C YE GT WG  +GW YGS+TED+LTG  I
Sbjct  407   SARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRI  466

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++     E P F+GC P+ G   L Q+KRWASG  EIL S   PI    F +LQF
Sbjct  467   HAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQF  526

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK  2071
             RQCLAY+ S +WPVR  FELCYA L PYCL++N  FLPK
Sbjct  527   RQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPK  565



>emb|CAH66410.1| OSIGBa0093L02.6 [Oryza sativa Indica Group]
Length=798

 Score =   545 bits (1405),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 285/578 (49%), Positives = 362/578 (63%), Gaps = 25/578 (4%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSC------EFPAVDMFV  685
              W +ALVCE+WF  +  L VS KW+ V   T PE  +      S       E PAVDM V
Sbjct  78    VWRVALVCEAWFAALCALNVSAKWSPVRFVTRPENLVAEGRTPSTTAAEYGELPAVDMLV  137

Query  686   TTANPELEPPILTVNTVLSLLALEYP--ANKLACYVSDDSASPVTFYALVEASKFAKLWV  859
             TTA+P LEPP++TVNTVLSLLAL+YP    +LACYVSDD  SP+T +AL EA+ FA  WV
Sbjct  138   TTADPALEPPLVTVNTVLSLLALDYPRAGERLACYVSDDGCSPLTCHALREAAGFAAAWV  197

Query  860   PFCKKYNVAVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEYATQKPSL  1033
             PFC++Y VAVRAPFRYF++  +      +  +F  +W  M DEY  L  +I+   ++  L
Sbjct  198   PFCRRYGVAVRAPFRYFSSSSSPESGGPADRKFLDDWTFMKDEYDKLVRRIKNTDERSLL  257

Query  1034  FNK----FATFADLDPNDHSTIIKVICENDESLA-VGVPHLIYISREKRPKHQHNFKAGA  1198
              +     FA F +++  +H TI+KV+ +N +S A  G PHLIY+SREK P H H++KAGA
Sbjct  258   RHGGGEFFAEFLNVERRNHPTIVKVLWDNSKSRAGEGFPHLIYVSREKSPTHHHHYKAGA  317

Query  1199  MNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDG  1378
             MNVLTRVS VMTNAP MLN+DCD + NNP+ VLHAMC LLG  DE  +GFVQ PQ FYD 
Sbjct  318   MNVLTRVSAVMTNAPIMLNMDCDMFANNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDA  377

Query  1379  LKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN-------DTVTAE  1537
             LKDDP+ +Q +  +     G   +QG+FY GTGCFHRRK +YG+ PN       DT+ + 
Sbjct  378   LKDDPFGNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSS  437

Query  1538  KLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGH  1717
                  +L   +G S+    SA   +    S     + S  +E A  V+ C Y+ GT WG 
Sbjct  438   SY--KELHTRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQ  494

Query  1718  NIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTE  1897
              +GW YGS+TEDILTG  I  MGW++   V E P F+G  P  G   L Q KRWA+G +E
Sbjct  495   EVGWVYGSLTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSE  554

Query  1898  ILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGN  2077
             I+ S   PI A +F  L+FRQCLAY+I + WP+R  FELCY  L PYC++TN  FLPK +
Sbjct  555   IIISRNNPILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKAS  614

Query  2078  EVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             E    IP ++FI YN Y   EYM    S RAWWNN RM
Sbjct  615   EDGFNIPLALFISYNTYNFMEYMVCGLSARAWWNNHRM  652



>ref|XP_006447594.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
 gb|ESR60834.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
Length=636

 Score =   538 bits (1387),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 349/508 (69%), Gaps = 11/508 (2%)
 Frame = +2

Query  677   MFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLW  856
             MFVTTA+ ELEPPI+TVNTVLSLLA++YP +KLACYVSDD+ SP+ FY+LVEASKFAKLW
Sbjct  1     MFVTTADAELEPPIITVNTVLSLLAVDYPVHKLACYVSDDACSPLNFYSLVEASKFAKLW  60

Query  857   VPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF  1036
             VPFCKKYNV +RAPFRYF         S  E  ++WK M  EY  L   IE+A ++ SLF
Sbjct  61    VPFCKKYNVQIRAPFRYFPDSEPSDSSSG-ELLQDWKNMKKEYDKLSQNIEHAAKRSSLF  119

Query  1037  N---KFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNV  1207
             +       F++ +  +H TI+KVI EN   L+  +PHL+YISREKRPKH H++KAGAMNV
Sbjct  120   DLTGGMTVFSNTERMNHPTIVKVISENKGGLSDEIPHLVYISREKRPKHPHHYKAGAMNV  179

Query  1208  LTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKD  1387
             LTRVSG+MTNAPFMLNVDCD Y NNPE+VL AMC  LG+K+E +  F+Q PQ FYD  ++
Sbjct  180   LTRVSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPEN  239

Query  1388  DPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKI  1567
                 ++Y      +G+G   IQG FY GTG FHRR V+YGL  +       + + +L K 
Sbjct  240   LCILNEY------IGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKK  293

Query  1568  YGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVT  1747
             +G SK F+ SA  TL G     +  + S SL+ A +VA+CGYE+G++WG  +G  YG+  
Sbjct  294   FGNSKEFIKSAAQTLEGKTGGYSSNI-SRSLDEAHRVADCGYEYGSSWGDEVGCLYGATA  352

Query  1748  EDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIF  1927
             ED LTG+ I   GW++G+C+P    FLGC   +G   + Q KRWA+G  EILFS + PI 
Sbjct  353   EDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPIL  412

Query  1928  AALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASI  2107
             A L G LQFRQCLAY+  + W +R I ELCY  LP YC+ITNS FLPK  E  ++IP ++
Sbjct  413   ATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLAL  472

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             F+IY LYTL EY++   SIR+WW N  M
Sbjct  473   FLIYKLYTLLEYIQAGLSIRSWWVNNCM  500



>ref|XP_010522355.1| PREDICTED: cellulose synthase-like protein B4 isoform X1 [Tarenaya 
hassleriana]
Length=753

 Score =   541 bits (1394),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 287/608 (47%), Positives = 383/608 (63%), Gaps = 30/608 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     + + R V++ IL LL SL+ YR+  ++ + Y   W++A +CES F F+W+
Sbjct  8     LPLYEKVSHKSFILRTVDLTILGLLFSLLVYRI--IYINQYDNVWIVAFLCESCFCFVWL  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             LV   KW+  +  TYP+R  E V     E P VDMFVTTA+P +EPPI+TVNTVLSLLA+
Sbjct  66    LVTIIKWSPADYKTYPDRLHERVR----ELPPVDMFVTTADPVMEPPIITVNTVLSLLAV  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YPANKLACYVSDD  SP+ +++L EAS+FAK+WVPFCKK+NV +RAPFRYF+     P 
Sbjct  122   NYPANKLACYVSDDGCSPIIYFSLREASRFAKIWVPFCKKHNVQIRAPFRYFSNPPIHPE  181

Query  935   ES-SPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
              S S +F  +WK M  EY  L  K+E   +     +    FA FA+++P DH+TIIKVI 
Sbjct  182   GSDSGQFEEDWKNMKVEYEKLSRKLEVVAENSYWLDADEDFAAFANINPRDHATIIKVIR  241

Query  1103  ENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             EN+  +     VPHL+Y+SREK P H H++KAGAMNVL RVSG+MTNAP+MLNVDCD YV
Sbjct  242   ENNGGVGEDTEVPHLVYVSREKSPMHPHHYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYV  301

Query  1277  NNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
             NNP+V+   MC  LG+K + +  FVQ PQ FYD   D+    Q  I     GRG   I G
Sbjct  302   NNPDVLRQGMCLFLGSKTQNEYAFVQSPQLFYDTFGDEIVVLQTYI-----GRGMVGIDG  356

Query  1457  SFYDGTGCFHRRKVIYGLSP---------NDTVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
               Y G+G  HRR++IYGLSP         +     E L +  L++ YG  K  V SA   
Sbjct  357   PIYAGSGGIHRRRIIYGLSPHHLDDDGNLSSIAKVELLGEGKLEREYGDCKEMVKSAVEA  416

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L G  + +    L+ SLEAA +V  C YE+ T WG  IGW YGS TED  T + I   GW
Sbjct  417   LRGKSTPQ--NDLTISLEAAHRVGACDYEYTTNWGKTIGWLYGSTTEDANTSVSIHSKGW  474

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
             K+ +  P+ P FLGC P+ G   + Q +RWA+G  E+LF+ + P+   L+  L FR  L 
Sbjct  475   KSLYNSPDPPAFLGCMPAGGPAVMGQQRRWATGLLEVLFNKQSPVIGMLYRKLGFRTGLC  534

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y+   +W +R I ELCY+ LP YC++ NS FLPKG  ++IV+  ++ ++++LY LWEY+ 
Sbjct  535   YLYLFIWGIRSIPELCYSLLPAYCILHNSAFLPKGPCLSIVV--ALVVMHSLYNLWEYIN  592

Query  2150  EKESIRAW  2173
                 I++W
Sbjct  593   LGLPIQSW  600



>ref|XP_006592369.1| PREDICTED: uncharacterized LOC100500469 isoform X2 [Glycine max]
Length=707

 Score =   539 bits (1388),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 287/602 (48%), Positives = 378/602 (63%), Gaps = 50/602 (8%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +   R  E ++ +LLL L+ YRV ++++  Y + W +A +CESWFT  W 
Sbjct  7     LPLYEKFWYKHNYKRVTESLLSVLLLWLLGYRVISINN--YSFPWFVAFLCESWFTISWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L ++T+W+   T TYP+R L+ V+    E P VD+FVTTA+PELEPPI+TVNTVLSLLAL
Sbjct  65    LALTTQWSPAVTKTYPDRLLQSVQ----ELPPVDLFVTTADPELEPPIITVNTVLSLLAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YPA+KLACYVSDD  SP+TFYAL EASKFAK WVPFCKKY V VRAP RYF +      
Sbjct  121   DYPAHKLACYVSDDGCSPLTFYALQEASKFAKFWVPFCKKYEVQVRAPLRYFFDKPEVST  180

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYA--TQKPSLFNKFATFADLDPNDHSTIIKVICE  1105
               ++P+F++EW KM D Y  L  KI+    T+      +FATF++ +  +H +II+    
Sbjct  181   ANNTPKFKQEWLKMKDMYDQLSRKIDLDSFTKSNPCLGEFATFSNTERTNHPSIIQ----  236

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
                                                TRVSG++TNAPFMLNVDCD  V+NP
Sbjct  237   -----------------------------------TRVSGLITNAPFMLNVDCDMIVSNP  261

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+  LL  K E++  FVQ PQ FY  LKDDP+ +Q  I++  L  G A +QG FY
Sbjct  262   KIVLHALSILLDPKGEKEVAFVQCPQQFYATLKDDPFGNQMTILFKNLAPGLAGLQGPFY  321

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              GT CFHRRKVIYG SP++      ++D + ++ +G SK F+ SA   L G + S     
Sbjct  322   GGTNCFHRRKVIYGRSPDNIEKGSGISDEEFKEKFGASKDFLKSAAFALKGRIYSPNDIN  381

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             +S  ++ ASQVA CGYE+GT WG  +GW YGS+TED+LTG+ I   GW++  C P    F
Sbjct  382   ISNVVDVASQVAGCGYEYGTGWGKQVGWIYGSITEDVLTGLTIHEKGWRSELCTPSPIPF  441

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
              G  P  G  S+ Q KRWA+G  EI     CPI ++LF  L  RQCLAYM  I W ++P+
Sbjct  442   TGFAPGGGPTSMAQQKRWATGMLEIFICKHCPIISSLFRKLTLRQCLAYMWIINWGLQPV  501

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             FE+CYA L  YC+ITNS+FLP+  ++ I IP + F IY +YT+ EY+    S+R WWNNQ
Sbjct  502   FEVCYACLLAYCIITNSNFLPQ--DLGIRIPIAFFAIYKVYTVCEYLAAGLSVREWWNNQ  559

Query  2186  RM  2191
             RM
Sbjct  560   RM  561



>ref|XP_006846949.1| hypothetical protein AMTR_s00017p00025710 [Amborella trichopoda]
 gb|ERN08530.1| hypothetical protein AMTR_s00017p00025710 [Amborella trichopoda]
Length=683

 Score =   534 bits (1376),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 269/552 (49%), Positives = 356/552 (64%), Gaps = 22/552 (4%)
 Frame = +2

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             ++ +W+ V+  TYP + L+ ++  S E PAVDMFVTTA+   EPPILTVNTVLSLLA++Y
Sbjct  1     MNQRWSMVQYRTYPNKLLKRLKTES-ELPAVDMFVTTADALKEPPILTVNTVLSLLAVDY  59

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PANKLACYVSDD ASP+TFYAL EA ++AK WVPFCKK+ V+VRAPF YF+         
Sbjct  60    PANKLACYVSDDGASPLTFYALTEAVEYAKRWVPFCKKHGVSVRAPFMYFSQTSHICNSF  119

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQK-----PSLFNKFATFADLDPNDHSTIIKVICE  1105
             S EF  EWKKM  EY  L  +I  A        P++  +FA F+ ++  DH +I+KVI E
Sbjct  120   SSEFLTEWKKMKSEYDELSKRINEAVSSKSVPYPNINEEFAAFSRMENRDHPSIVKVIVE  179

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N E    G+PH+IY+SREKRPKH H++KAGAMNVLTRVS VMTNAP ++NVDCD +VNNP
Sbjct  180   NRERSIGGLPHVIYVSREKRPKHPHHYKAGAMNVLTRVSAVMTNAPIIMNVDCDMFVNNP  239

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
                  AMC LLG K ER++ FVQFPQ FY GLKDDP+ +Q K+++  +  G +AIQG  Y
Sbjct  240   TCFYEAMCLLLGFKSERESAFVQFPQVFYGGLKDDPFGNQLKVLFSVVLAGISAIQGPCY  299

Query  1466  DGTGCFHRRKVIYGLSPNDTV--------TAEKLTDHDLQKIYGKSKIFVtsatttlsgs  1621
              GTGCFHRRK IYG    D+          + +    +L   +G  K  + S  +     
Sbjct  300   AGTGCFHRRKTIYGFPAEDSKGNFLEFFNGSNEANMEELINRFGHCKELLRSILSIHLNK  359

Query  1622  lssetFGVLSY--SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
                     LS+  ++EAA  VA C YE  T WG  +GW YGS TED+L  + +   GW++
Sbjct  360   AG----DTLSFESAVEAAHIVAGCKYENNTYWGDQVGWVYGSSTEDLLLSLKLFSTGWRS  415

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
              +C P+ P FLGC PS+G  +L Q +RWA+G  E+      P+ + +   L+ RQCLA++
Sbjct  416   VYCTPQPPAFLGCAPSSGPETLLQQRRWAAGQLELFVGRHSPLLSTITKKLEIRQCLAFL  475

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
                +W +RPI E+ Y+ LP   L+TN+HF+PK  E  ++IP S+F+++N + L EY    
Sbjct  476   --SIWALRPIPEIFYSILPALSLLTNTHFMPKFPEPIVLIPISLFVLFNFFGLMEYWRCN  533

Query  2156  ESIRAWWNNQRM  2191
              S R WWNNQRM
Sbjct  534   LSTREWWNNQRM  545



>ref|XP_010089468.1| Cellulose synthase-like protein H1 [Morus notabilis]
 gb|EXB37861.1| Cellulose synthase-like protein H1 [Morus notabilis]
Length=753

 Score =   532 bits (1371),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 290/601 (48%), Positives = 392/601 (65%), Gaps = 18/601 (3%)
 Frame = +2

Query  416   VRNNAVSRAVEVVIlllllslIAYRVWNLH-SHGYYYTWLLALVCESWFTFIWVLVVSTK  592
             ++ N ++RA+++ ILLLL+S++ YR+ + + +HG+  TW+LA VCE WF   + L ++T 
Sbjct  15    IKVNKLNRAIDLTILLLLISILVYRLLSFNKNHGF--TWVLAFVCEFWFALEFSLSLTTF  72

Query  593   WNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANK  772
             W   E  TYPE  L+     + E PAVD+FVTTA+  LE PI+TVNTVLSL+A++YPA+K
Sbjct  73    WTPAEFKTYPEILLQ---RDAAELPAVDLFVTTADVVLESPIVTVNTVLSLMAVDYPAHK  129

Query  773   LACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFN----ADHTFPPES  940
             LACYVSDD  SP+  Y+L+EA KFA+LWVPFCKKY+V VRAPFRYF+       +   + 
Sbjct  130   LACYVSDDGCSPIILYSLIEAFKFARLWVPFCKKYDVQVRAPFRYFSRDDSFPPSDDDKK  189

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQ---KPSLFNKFATFADLDPNDHSTIIKVICEND  1111
             SPEF  EW++M +EY  L  KIE AT+   K     ++A FA+ + +DH  IIKVI EN 
Sbjct  190   SPEFHPEWRRMKEEYEKLRQKIEEATKGTLKIVCSGEYAAFANTNKSDHPNIIKVIWENK  249

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
             E +  GVPHLIY+ REK P   H++KAGAMNVLTRVSGVMTNAPF+LNVDCD +VNNP++
Sbjct  250   ERVPEGVPHLIYVCREKSPNCPHHYKAGAMNVLTRVSGVMTNAPFLLNVDCDMFVNNPKI  309

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             V  AM   LG K + +  FVQFPQ  Y+ LKDDP+ +Q    +  +G G A IQG  Y G
Sbjct  310   VHQAMSSFLGLKPQ-ECAFVQFPQVIYNQLKDDPFGTQMVAAFEVIGHGMAGIQGPLYAG  368

Query  1472  TGCFHRRKVIYGLSPNDTVTAEKLTDHD--LQKIYGKSKIFVtsatttlsgslssetFGV  1645
             T CFHRRK+IYG S ++     K  D    L++ +G S  F+ S T  L   +S      
Sbjct  369   TNCFHRRKLIYGFSLDNADFQGKEDDEKVLLKESFGNSIEFINSVTQILKDDISPVQ--D  426

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
             +S + + +SQ   C YE  T WG  +GW YGS+TED+LTG+ I   G ++  C+P  PGF
Sbjct  427   ISIAAQLSSQATRCDYEHDTVWGTKVGWGYGSITEDVLTGMRIHGEGLRSVSCMPSPPGF  486

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
             LG  P++G   L Q KRWA+G  + +FS   PI   L   L+FRQ LAY   +  P+  +
Sbjct  487   LGTAPTSGPACLIQRKRWATGLLQAMFSKNSPIVTTLNAKLEFRQSLAYTWVLTSPLGAM  546

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
             F++ Y+ L  YC+ITN++FLPK +E A++I  + F+  NL  L  ++    S+RAWWNN 
Sbjct  547   FDMFYSLLAAYCIITNANFLPKAHEPAMLILVARFLFQNLQQLCFFLRCGFSVRAWWNNV  606

Query  2186  R  2188
             R
Sbjct  607   R  607



>tpg|DAA37782.1| TPA: hypothetical protein ZEAMMB73_545753, partial [Zea mays]
Length=828

 Score =   535 bits (1378),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 274/546 (50%), Positives = 344/546 (63%), Gaps = 26/546 (5%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + W+ AL+CE+WFT +W+L ++ KWN V   T+PER   +        PAVDMFVTTA+P
Sbjct  56    WCWVAALICEAWFTVVWLLNMNAKWNPVRFVTHPERLAGYWAGDDELLPAVDMFVTTADP  115

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             +LEP ++TVNTVLSLLAL+YPA KL+CYVSDD  S VT YAL EA++FAKLWVPF +K+ 
Sbjct  116   KLEPAVVTVNTVLSLLALDYPAGKLSCYVSDDGCSAVTCYALREAAEFAKLWVPFTRKHG  175

Query  881   VAVRAPFRYFNADHTFPPESSPE----------FRREWKKMNDEYANLCGKIEYATQKPS  1030
               VRAPF YF++                     F R W  M +EY  L  +IE A +K S
Sbjct  176   AKVRAPFAYFSSSSGGGAAERGGGGGAADADAEFLRAWTSMKNEYEELVRRIESAEEK-S  234

Query  1031  LFNK----FATFADLDPNDHSTIIKVICENDESLAV--------GVPHLIYISREKRPKH  1174
             L  +    FA F   D  +H TIIKV+ +ND S +         GVP LIY+SREK    
Sbjct  235   LVRRGDGAFAEFVGADRGNHPTIIKVLWDNDSSKSESDEQAAGDGVPSLIYVSREKSRTQ  294

Query  1175  QHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQ  1354
              H+FKAGAMNVLTRVS V+TNAP MLNVDCD + NNP+  LHAMC LLG  DE  +GFVQ
Sbjct  295   PHHFKAGAMNVLTRVSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQ  354

Query  1355  FPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTA  1534
              PQ FY GL DDP+ +Q ++I+  +G G A +QG FY GTGCFHRRKV+YG+ P     A
Sbjct  355   APQRFYGGLADDPFGNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGA  414

Query  1535  EKLTD---HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGT  1705
              K       +LQK +G SK  + SA + ++   +      L+  +E A QV+ C YE GT
Sbjct  415   TKADSPSYKELQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGT  474

Query  1706  TWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWAS  1885
             +WG  +GW YGS+TED+LTG  I   GW++    P+ P FLG  P+ G  SL Q KRWA+
Sbjct  475   SWGQEVGWVYGSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWAT  534

Query  1886  GHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFL  2065
             G  EI+ S   P   +    L+FRQCLAY++  +WPVR  FELCYA L PYCLI N  FL
Sbjct  535   GLLEIVLSRHNPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFL  594

Query  2066  PKGNEV  2083
             PK N V
Sbjct  595   PKVNLV  600



>ref|XP_010469575.1| PREDICTED: cellulose synthase-like protein B3 [Camelina sativa]
Length=756

 Score =   530 bits (1366),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 292/612 (48%), Positives = 379/612 (62%), Gaps = 32/612 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   R V++ IL LL SL+ +RV  +        W +A +CES+FTF+W++
Sbjct  10    PLCEKISYKNYFLRTVDLTILGLLFSLLLHRVLLMKQRDN--VWAVAFLCESFFTFVWLI  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KWN  E   YP+R  E V+    + P+VDMF+TTA+P  EPPIL VNTVLSLL ++
Sbjct  68    ITCIKWNPAEYKPYPDRLDERVQ----DLPSVDMFLTTADPVREPPILVVNTVLSLLGVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF    T    
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYFLNRPTV--T  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
              S EF ++W  M  EY  LC K+E AT      +    F  F++  PNDHS I+KV+ EN
Sbjct  182   ESSEFSKDWDMMKREYEKLCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSNIVKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRPK+ HN+KAGAMNVL RVSG+MTNAP+MLNVDCD YVN 
Sbjct  242   KGGVGDEKEVPHFVYISREKRPKYFHNYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYVNE  301

Query  1283  PEVVLHAMCFLLGAK--DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     +  +  FVQ+PQ FYD   D     +  ++   LGRG A IQG
Sbjct  302   ADVVRQAMCIFLQNSILNSNNCAFVQYPQDFYDSNAD-----ELAVLQSYLGRGIAGIQG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
             S   G+GCF  R+V+YG+S +D           T   L + +L + +G SK  VTS    
Sbjct  357   SLCAGSGCFLSRRVMYGISLDDLEDDGSLSSVATRNYLAEKNLAREFGNSKEMVTSVVNA  416

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L    + +    L+ SLEAA +V +C YE  T+WG  IGW YGS TED+ T +GI   GW
Sbjct  417   LQRKPNPQH-SSLTDSLEAAEEVGHCHYENQTSWGKTIGWLYGSTTEDVHTSLGIHSRGW  475

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              + F  P+ P FLG  PS G  ++ Q +RWA+G  EILFS + P+    FG L+FRQ LA
Sbjct  476   TSSFISPDPPAFLGAMPSGGPEAMLQQRRWAAGMLEILFSKRSPLIGVFFGKLRFRQSLA  535

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y+ +  W +R I EL Y  LP YCL+ NS   PKG  + I+I  ++  I+ LYTLWE+M 
Sbjct  536   YLYAFTWGLRSIPELLYCLLPAYCLLHNSALFPKGVYLGIII--TLVGIHCLYTLWEFMS  593

Query  2150  EKESIRAWWNNQ  2185
                S+++W+ +Q
Sbjct  594   LGFSVQSWFVSQ  605



>ref|XP_006594902.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Glycine max]
Length=557

 Score =   521 bits (1342),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 275/521 (53%), Positives = 352/521 (68%), Gaps = 9/521 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE         R ++ +IL+LLL L++YR+++  S+ + + W LA +CESWFTF W+
Sbjct  8     LPLYEKIWVKRKFQRVIDTLILVLLLLLLSYRLFS--SNNFTFPWFLAFICESWFTFTWI  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++++TKW+   T T+P R L  V     EFP VD+ VTTA+  LEPPI+TVNTVLSLLAL
Sbjct  66    VILNTKWSPAVTITHPNRLLLRVPES--EFPPVDLLVTTADHVLEPPIITVNTVLSLLAL  123

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP NKLACYVSDD  SP+TFYALVEASKFAK WVPFCKK  V VRAPFRYF+   T   
Sbjct  124   DYPTNKLACYVSDDGCSPLTFYALVEASKFAKFWVPFCKKNCVQVRAPFRYFSDIATNKS  183

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
             E S EF++EW +M D Y NLC KIE  T K     L  +FA F++ D  +H TIIKVI E
Sbjct  184   EDSLEFKQEWLQMKDMYDNLCQKIEEVTGKTIPFQLDGEFAVFSNTDQRNHPTIIKVILE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N   L  G+PHLIYISREKRP++ HN+KAGAMNVLTRVSG+MTNAPF+LNVDCD +VNNP
Sbjct  244   NMGDLLDGLPHLIYISREKRPQYHHNYKAGAMNVLTRVSGLMTNAPFILNVDCDMFVNNP  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C L+ ++  ++  FVQ  Q FYDG+KDDP+ +Q+ I +  +  G A +QG FY
Sbjct  304   KIVLHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPFGNQWMITFKNIIMGMAGLQGPFY  363

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAE--KLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              GT  FHRR  IYGL P++  +    KL    L + +G SK F+ S+   L GS  S   
Sbjct  364   GGTNAFHRRNAIYGLYPDEIESERKGKLEGKILIEKFGSSKEFIKSSAQALGGSAFSAND  423

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
                   +EAA+QV+NC YE+ T WG  +GW YGS++ED+ TG+ IQR GW++  C P+  
Sbjct  424   ITTFNFIEAATQVSNCEYEYDTCWGKQMGWLYGSISEDVPTGLNIQRKGWRSECCTPDPI  483

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFG  1942
              F GC P   L ++ Q KRWASG T + F    PI   LFG
Sbjct  484   AFTGCAPGGILSTMLQQKRWASGLTVVFFGKHSPITGMLFG  524



>gb|KCW46973.1| hypothetical protein EUGRSUZ_K00781 [Eucalyptus grandis]
Length=479

 Score =   518 bits (1334),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 268/477 (56%), Positives = 334/477 (70%), Gaps = 14/477 (3%)
 Frame = +2

Query  677   MFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLW  856
             MFVTTA+P+LEPPI+TVNTVLSL+A++YPA+KLACYVSDD  SP+TFY+L+EA+KFAKLW
Sbjct  1     MFVTTADPQLEPPIITVNTVLSLMAVDYPAHKLACYVSDDGCSPLTFYSLMEAAKFAKLW  60

Query  857   VPFCKKYNVAVRAPFRYF--NADHTFPPESSPEFRREWKKMNDEYANLCGKIEYAT--QK  1024
             VPFCKKYN+ +RAPFRYF  N+  +   + S EF++    M DEY  L  KIE A+    
Sbjct  61    VPFCKKYNIQLRAPFRYFARNSTTSSGEDCSLEFQQARDTMKDEYEKLRRKIEDASLGSV  120

Query  1025  PS-LFNKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAM  1201
             PS L  +F  F++ +  +H TIIK++ EN       +PHLIYISREK+PKH H++KAGAM
Sbjct  121   PSNLSGEFVAFSNTERKNHPTIIKIMLENKGGSPDELPHLIYISREKQPKHPHHYKAGAM  180

Query  1202  NVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGL  1381
             NVLTRVSG+MTNAP MLNVDCD Y NNP++VLHA+C LLG K ERD  FVQ  Q FYDG 
Sbjct  181   NVLTRVSGLMTNAPLMLNVDCDMYANNPQIVLHALCLLLGTKYERDCAFVQCLQYFYDGA  240

Query  1382  KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEK--LTDHD  1555
             KDDP+ +Q  +    LG+G   IQG +Y+GTGCFHRRKVIYG  P D  T +K  +++ +
Sbjct  241   KDDPFGNQLVVRNEYLGQGIVGIQGPYYEGTGCFHRRKVIYGSWPEDMKTEKKSLISNGE  300

Query  1556  LQKI-----YGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHN  1720
             L K+     +G SK F+ S    L G+  +     L  SLEAA QV++C YE+ T  G  
Sbjct  301   LTKVESLNGFGISKQFINSVAHALQGNSDNPK--DLWSSLEAAYQVSSCTYEYNTDRGKE  358

Query  1721  IGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEI  1900
             IGW YGS TEDILTG+ I   GW++  C+P  P FLGC PS G  S+ Q KRWA+G  EI
Sbjct  359   IGWMYGSTTEDILTGLAIHTKGWRSLCCLPNPPAFLGCAPSGGPASMTQQKRWATGLLEI  418

Query  1901  LFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK  2071
             L S + PI+  LF NL FRQCLAY+  +   +R I E  YA LP YC++TNSHFLPK
Sbjct  419   LVSKRSPIYGTLFMNLHFRQCLAYLWLLTRALRSIPEFLYALLPAYCIMTNSHFLPK  475



>ref|XP_002447843.1| hypothetical protein SORBIDRAFT_06g016760 [Sorghum bicolor]
 gb|EES12171.1| hypothetical protein SORBIDRAFT_06g016760 [Sorghum bicolor]
Length=756

 Score =   528 bits (1359),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 282/578 (49%), Positives = 362/578 (63%), Gaps = 47/578 (8%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + W+ AL+CE+WFT +W+L ++ KWN V   T+PER  E  +    E PAVDMFVTTA+P
Sbjct  57    WCWVAALICEAWFTVVWLLNMNAKWNPVRFDTHPERLAERTD----ELPAVDMFVTTADP  112

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             +LEPP++TVNTVLSLLAL+YPA KL+CYVSDD  S VT YAL EA++FAKLWVPFCKK+ 
Sbjct  113   KLEPPLVTVNTVLSLLALDYPAGKLSCYVSDDGCSAVTCYALREAAEFAKLWVPFCKKHG  172

Query  881   VAVRAPFRYFN---ADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---  1042
             V VRAPF YF+          +   EF R W  M +EY  L  +IE A ++ SL  +   
Sbjct  173   VKVRAPFVYFSERGGAAADDDDDVVEFLRAWTSMKNEYEELVRRIENA-EEYSLVRRADG  231

Query  1043  -FATFADLDPNDHSTIIKVI--CENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLT  1213
              FA F   D  +H TIIKV+    N ++   G+P L+Y+SREK P   H+FKAGAMNVLT
Sbjct  232   EFAEFVGADRRNHPTIIKVLWDSSNQDAAGDGIPSLVYVSREKSPTQNHHFKAGAMNVLT  291

Query  1214  RVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDP  1393
             RVSGV+TNAP MLNVDCD + NNP+V LHAMC LLG  D+  +GFVQ PQ FY  LKDDP
Sbjct  292   RVSGVVTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDDVHSGFVQAPQKFYGALKDDP  351

Query  1394  YASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSP-NDTVTAEKLTD----HDL  1558
             + +Q ++I                     F   KV+YG+ P N   T   + D     +L
Sbjct  352   FGNQLQVI---------------------FEVTKVMYGVPPDNAAATTTSMKDSPSYKEL  390

Query  1559  QKIYGKSKIFVtsatttlsgslssetFGV-----LSYSLEAASQVANCGYEFGTTWGHNI  1723
             Q  +G+S   + SA + +SG +            L+  +EAA QV+ C YE GT+WG  +
Sbjct  391   QNRFGRSNELIESARSIISGDMFRIRTPTVVVPDLTSRIEAAKQVSACSYETGTSWGQEV  450

Query  1724  GWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEIL  1903
             GW YGS+TED+LTG  I   GW++    P+ P FLG  P+ G  SL Q KRWA+G  EIL
Sbjct  451   GWVYGSMTEDVLTGQRIHAAGWRSAILNPDPPAFLGGAPTGGPASLTQYKRWATGLLEIL  510

Query  1904  FSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK--GN  2077
              S   PI  + F  L FRQC+AY++  +WPVR  FE+CYA L PYC+I N  FLPK   +
Sbjct  511   LSRHNPILLSAFKRLDFRQCVAYLVIDVWPVRAPFEVCYALLGPYCIIANHSFLPKVTAS  570

Query  2078  EVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             E   +I   +F+ YN+Y L EY + + S+RAWWNN RM
Sbjct  571   EPGFLILLVLFLGYNVYNLGEYKDCRLSVRAWWNNHRM  608



>ref|XP_010556995.1| PREDICTED: cellulose synthase-like protein B3 isoform X1 [Tarenaya 
hassleriana]
Length=751

 Score =   527 bits (1357),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 291/605 (48%), Positives = 379/605 (63%), Gaps = 28/605 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     + + RAV+V IL LL +L+AYR+  L+ +     W  A +CES+F FIW 
Sbjct  8     LPLYEKVSHKSLILRAVDVTILGLLFALLAYRI--LYMNQKDSVWTAAFLCESFFCFIWS  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             LV   KW+ V+  TYP+R  E V    CE P VDMFVTTA+P +EPP++TVNTVLSLLA+
Sbjct  66    LVTIVKWSPVDYKTYPDRLHERV----CELPPVDMFVTTADPVMEPPVITVNTVLSLLAV  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YPA KLACYVSDD  SP TF++L  AS+FAK+WVPFCKKYNV VRAPFRYF      P 
Sbjct  122   NYPAEKLACYVSDDGGSPATFFSLKLASRFAKIWVPFCKKYNVQVRAPFRYFLNPPVAPE  181

Query  935   ES-SPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVI  1099
              S S  F  +W  M  EY  L  K+E   + P   +      A F+++ P DH TI+KVI
Sbjct  182   GSDSVRFMEDWDTMKVEYEKLSRKLEMVAENPHGLDDADEDLAAFSNVYPRDHPTIVKVI  241

Query  1100  CENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
              EN+      VPHL+YISREKRPKH H++KAGAMNVL RVSGVMTNAP+MLNVDCD YVN
Sbjct  242   WENNSESE--VPHLVYISREKRPKHSHHYKAGAMNVLARVSGVMTNAPYMLNVDCDMYVN  299

Query  1280  NPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
             NP+V+  AMC  LG+       FVQ PQ FYD   DD       +    +GRG A I   
Sbjct  300   NPDVIRQAMCLFLGSASRNQFAFVQSPQLFYDSFGDD-----LVLFLTYIGRGMAGIGTP  354

Query  1460  FYDGTGCFHRRKVIYGLSPND-----TVTAEKLTDH-DLQKIYGKSKIFVtsatttlsgs  1621
              Y G+G   RR VIYGLSP+D     ++++ KL +  +L++ YG  +  VTSA   L G 
Sbjct  355   LYAGSGGILRRNVIYGLSPHDLQDDGSLSSGKLLEEGNLKREYGNCEEMVTSAADALQGK  414

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              + +    L+ SLEAA +VA+C YE  T WG   GW Y S  EDI T + I   GWK+ +
Sbjct  415   SNPK--NGLTSSLEAAHRVADCDYEHCTNWGKTFGWIYDSTAEDINTSVNIHAKGWKSYY  472

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
               PE P FLGC P  G  ++ Q +RWA+G  E+LF+ + P+   L+  L FR   +Y+  
Sbjct  473   NSPEPPAFLGCMPPGGPAAMGQQRRWATGLLEVLFNKESPVIGMLWRELGFRSGCSYLYI  532

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
               W ++ I ELCY  LP YC++ +S FLPKG  ++IV+  ++ +++ LY+LWE++    S
Sbjct  533   CTWGLKSIPELCYCLLPAYCILHDSAFLPKGPCLSIVM--ALVVMHCLYSLWEFINLGLS  590

Query  2162  IRAWW  2176
             I+ W+
Sbjct  591   IQRWF  595



>ref|XP_010522356.1| PREDICTED: cellulose synthase-like protein B4 isoform X2 [Tarenaya 
hassleriana]
Length=630

 Score =   521 bits (1343),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 277/575 (48%), Positives = 361/575 (63%), Gaps = 28/575 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     + + R V++ IL LL SL+ YR+  ++ + Y   W++A +CES F F+W+
Sbjct  8     LPLYEKVSHKSFILRTVDLTILGLLFSLLVYRI--IYINQYDNVWIVAFLCESCFCFVWL  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             LV   KW+  +  TYP+R  E V     E P VDMFVTTA+P +EPPI+TVNTVLSLLA+
Sbjct  66    LVTIIKWSPADYKTYPDRLHERVR----ELPPVDMFVTTADPVMEPPIITVNTVLSLLAV  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YPANKLACYVSDD  SP+ +++L EAS+FAK+WVPFCKK+NV +RAPFRYF+     P 
Sbjct  122   NYPANKLACYVSDDGCSPIIYFSLREASRFAKIWVPFCKKHNVQIRAPFRYFSNPPIHPE  181

Query  935   ES-SPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVIC  1102
              S S +F  +WK M  EY  L  K+E   +     +    FA FA+++P DH+TIIKVI 
Sbjct  182   GSDSGQFEEDWKNMKVEYEKLSRKLEVVAENSYWLDADEDFAAFANINPRDHATIIKVIR  241

Query  1103  ENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             EN+  +     VPHL+Y+SREK P H H++KAGAMNVL RVSG+MTNAP+MLNVDCD YV
Sbjct  242   ENNGGVGEDTEVPHLVYVSREKSPMHPHHYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYV  301

Query  1277  NNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
             NNP+V+   MC  LG+K + +  FVQ PQ FYD   D+    Q  I     GRG   I G
Sbjct  302   NNPDVLRQGMCLFLGSKTQNEYAFVQSPQLFYDTFGDEIVVLQTYI-----GRGMVGIDG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPN---------DTVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
               Y G+G  HRR++IYGLSP+              E L +  L++ YG  K  V SA   
Sbjct  357   PIYAGSGGIHRRRIIYGLSPHHLDDDGNLSSIAKVELLGEGKLEREYGDCKEMVKSAVEA  416

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L G  + +    L+ SLEAA +V  C YE+ T WG  IGW YGS TED  T + I   GW
Sbjct  417   LRGKSTPQ--NDLTISLEAAHRVGACDYEYTTNWGKTIGWLYGSTTEDANTSVSIHSKGW  474

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
             K+ +  P+ P FLGC P+ G   + Q +RWA+G  E+LF+ + P+   L+  L FR  L 
Sbjct  475   KSLYNSPDPPAFLGCMPAGGPAVMGQQRRWATGLLEVLFNKQSPVIGMLYRKLGFRTGLC  534

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKG  2074
             Y+   +W +R I ELCY+ LP YC++ NS FLPKG
Sbjct  535   YLYLFIWGIRSIPELCYSLLPAYCILHNSAFLPKG  569



>ref|XP_004151940.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=701

 Score =   524 bits (1350),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 280/598 (47%), Positives = 371/598 (62%), Gaps = 48/598 (8%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL+E     N + R +++ I  LL+SL+ YR++ L SHG+   + +A + E WFTF W+L
Sbjct  10    PLFERVRIENGLKRFIDITIFFLLVSLLGYRLFLLSSHGFSCLFAIAFLSELWFTFNWLL  69

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              ++  W+ V   TYP+R L+ VE    E P VD+FVTTA+P LEPPI+T+NTVLS+LA+E
Sbjct  70    TLNCNWSPVRYQTYPQRLLKRVE----EVPPVDIFVTTADPMLEPPIITINTVLSVLAME  125

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPA+KLACYVSDD+ SP+TFY+L +A  FAK+W+PFCKKY V VRAPFRYF+        
Sbjct  126   YPADKLACYVSDDACSPLTFYSLCQALNFAKIWLPFCKKYKVQVRAPFRYFSTT------  179

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDES  1117
                  R E +++N           Y +                       + VI EN E 
Sbjct  180   -----RNEVERIN----------LYVSHP---------------------VVVIWENKEG  203

Query  1118  LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
             +   +P LIY+SREK P+  H++KAGAMNVLTRVSGVMTNAP+MLN+DCD +VNNP+V+L
Sbjct  204   VRDELPALIYVSREKNPQIPHHYKAGAMNVLTRVSGVMTNAPYMLNLDCDMFVNNPDVLL  263

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTG  1477
              AMC LL    +++  FVQFPQTFY+GLKDDP+ +Q+ +    L  G A +QG  Y GTG
Sbjct  264   QAMCLLLHPTIDKEYAFVQFPQTFYNGLKDDPFGNQWIVTMQILIHGQAGVQGPMYMGTG  323

Query  1478  CFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYS  1657
             C HRRKV+YG SP +     K  +  L K +G SK FV SA  +L           LS S
Sbjct  324   CIHRRKVLYGQSPKEANVDAKYNEEKLYKTFGNSKDFVKSAIRSLRSFADDS--NCLSSS  381

Query  1658  LEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCT  1837
             +++  +VA   YE    WG  +GW+YGS+ ED+LTG+ I + GWK+ +  P  P FLGC 
Sbjct  382   IKSTYEVATADYEHNNAWGSEVGWKYGSIVEDVLTGMEIHKKGWKSAYITPTPPAFLGCA  441

Query  1838  PSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELC  2017
             P  G   L+  KR  +G  EIL S   PI  AL   LQFRQ L YM + L     I+E+C
Sbjct  442   PLGGPVPLSHHKRAMTGLLEILISKNSPILTALSDKLQFRQRLMYMWAYLIGFGAIWEIC  501

Query  2018  YAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             YA LP +CLI+NSHFLPK  E  I +P  +F++  L  L ++ +  +S+RAWWNN RM
Sbjct  502   YATLPAFCLISNSHFLPKVQEPVICVPLLLFVLLKLRMLLDFFKTGQSVRAWWNNLRM  559



>ref|XP_010510001.1| PREDICTED: cellulose synthase-like protein B3 [Camelina sativa]
Length=766

 Score =   526 bits (1354),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 287/616 (47%), Positives = 382/616 (62%), Gaps = 33/616 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL SL+ +R+  +         ++A +CES+FTF+W++
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLFSLLLHRILLMKQSDN--VCVVAFLCESFFTFVWLI  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   YP+R  E V     + P+VDMF+TTA+P  EPPIL VNTVLSLLA+ 
Sbjct  68    ITFIKWSPAEYKPYPDRLDERVH----DLPSVDMFLTTADPVKEPPILVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF  +     E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYF-LNRPAATE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W  M  EY  LC K+E AT      +    F  F++  PNDHSTI+KV+ EN
Sbjct  183   SS-EFSKDWDMMKREYEKLCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSTIVKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRPK+ HN+KAGAMNVL RVSG+MTNAP+MLNVDCD YVN 
Sbjct  242   KGGVGDEKEVPHFVYISREKRPKYFHNYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYVNE  301

Query  1283  PEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     +  +  FVQ+PQ FYD   D     +  ++   +GRG A IQG
Sbjct  302   ADVVRQAMCIFLQNSISNSNNCAFVQYPQDFYDSNAD-----ELAVLQSYIGRGVAGIQG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPND----------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             S Y G+GC H R+V+YG+S +D            T   L + +L + +G SK  VTS   
Sbjct  357   SIYAGSGCLHTRRVMYGISLDDLEDDGRSLSSVATRNYLAEENLAREFGNSKEMVTSVVN  416

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
              L    + +   +  + LEAA +V +C YE  T+WG  IGW YGS TED+ T +GI   G
Sbjct  417   ALQRKSNPQHSSLTDF-LEAAQEVGHCDYENQTSWGKTIGWLYGSTTEDVHTSLGIHSRG  475

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W + +  P+ P FLG  PS G  ++ Q +RWA+G  E+LF+ + P+    FG L+FRQ L
Sbjct  476   WTSSYISPDPPAFLGVMPSGGPEAMVQQRRWAAGLLEVLFNKRSPLIGVFFGKLRFRQSL  535

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYM  2146
             AY+  + W +R I EL Y  LP YCL+  S   PKG  + I++  ++  ++ LYTLWE+M
Sbjct  536   AYLYILTWGLRSIPELFYCLLPAYCLLHTSALFPKGVYLGIIV--TLVGMHCLYTLWEFM  593

Query  2147  EEKESIRAWWNNQRMW  2194
                 SI++W+ +Q  W
Sbjct  594   SLGFSIQSWFVSQSFW  609



>ref|XP_002447842.1| hypothetical protein SORBIDRAFT_06g016750 [Sorghum bicolor]
 gb|EES12170.1| hypothetical protein SORBIDRAFT_06g016750 [Sorghum bicolor]
Length=819

 Score =   527 bits (1358),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 283/614 (46%), Positives = 367/614 (60%), Gaps = 61/614 (10%)
 Frame = +2

Query  521   YTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANP  700
             + W+ AL+CE+WFT +W++ ++ KWN V   T+PER        + E PAVDMFVTTA+P
Sbjct  57    WCWVAALICEAWFTVVWLINMNAKWNPVRFDTHPERL---AGRSADELPAVDMFVTTADP  113

Query  701   ELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYN  880
             +LEPP++TVNTVLSL+AL+YPA KL CYVSDD  S VT YAL EA++FAKLWVPFCKK+ 
Sbjct  114   KLEPPVVTVNTVLSLMALDYPAGKLTCYVSDDGCSAVTCYALREAAEFAKLWVPFCKKHG  173

Query  881   VAVRAPFRYFNADHTFP-----PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK-  1042
             V VRAPF YF+   T        +   EF R W  M +EY  L  +IE A ++ SL  + 
Sbjct  174   VGVRAPFVYFSGGGTAERGGATTDDVAEFMRAWTSMKNEYEELVHRIENAEEE-SLVRRG  232

Query  1043  ---FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLT  1213
                FA F   D  +H TIIKV+ +N ++   G+P LIY+SREK P   H+FKAGAMNVLT
Sbjct  233   DGEFAEFVGADRRNHPTIIKVLSDNQDAAGDGIPSLIYVSREKSPTQPHHFKAGAMNVLT  292

Query  1214  RVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDP  1393
             RVSGV+TNAP +LNVDCD + NNP+V LHAMC L+G  D+  +GFVQ PQ FY  LKDDP
Sbjct  293   RVSGVVTNAPIVLNVDCDMFANNPQVALHAMCLLMGFDDDVHSGFVQVPQKFYGALKDDP  352

Query  1394  YASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTD-----HDL  1558
             + +Q ++++  +G G A +QG +Y GTGCFHRRKV+YG+ P    T+           +L
Sbjct  353   FGNQMQVMFEKIGYGVAGLQGIYYCGTGCFHRRKVMYGVPPYHATTSSSSMKDSPSYKEL  412

Query  1559  QKIYGKSKIFVtsatttlsg---slssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGW  1729
             Q  +G+S   + SA + +SG      +     L+  +EAA QV+ C YE GT+WG   G 
Sbjct  413   QNRFGRSNELIESARSIISGDMFKAPTTLVADLTSRIEAAKQVSACRYETGTSWGQEAGC  472

Query  1730  RYGSVTE-------------DILTGI---------------------------GIQRMGW  1789
              +G                 D+LT                             G  +   
Sbjct  473   WHGHEGRAIGGEEKRALPPPDVLTNTATTTASHLVNLPRHAGSSHQGSGSGYPGPDQHCA  532

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              T     + P FLG  P+ G  SL Q KRWA+G  EIL S   P   + F  L FRQC+A
Sbjct  533   STPPAGGDPPAFLGGAPTGGPASLTQYKRWATGLLEILLSRHNPCLVSAFKRLDFRQCVA  592

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y++  +WPVR  FELCYA L PYCLI N  FLPK +E + +IP ++F+ YN Y L EY +
Sbjct  593   YLVIDVWPVRAPFELCYALLGPYCLIANHSFLPKASEPSFLIPLALFLGYNAYNLGEYKD  652

Query  2150  EKESIRAWWNNQRM  2191
              + S RAWWNN RM
Sbjct  653   CRLSARAWWNNHRM  666



>ref|XP_010413984.1| PREDICTED: cellulose synthase-like protein B3 isoform X1 [Camelina 
sativa]
Length=765

 Score =   524 bits (1350),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 289/615 (47%), Positives = 381/615 (62%), Gaps = 30/615 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL SL+ +R   L        W++A +CES+FTF+W+L
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLFSLLLHRYRILLVKQSDNVWVVAFLCESFFTFVWLL  69

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E  +YP+R  E V     + P+VDMF+TTA+P  EPPIL VNTVLSLLA+ 
Sbjct  70    ITCIKWSPAEYKSYPDRLDERVH----DLPSVDMFLTTADPVREPPILVVNTVLSLLAVN  125

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKK NV VRAPFRYF  +H    E
Sbjct  126   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKNNVRVRAPFRYF-LNHPAATE  184

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W  +  EY  LC K+E  T    L +    F  F++   NDHSTI+KV+ EN
Sbjct  185   SS-EFSKDWDMVKWEYEKLCRKVEDVTGDSHLLDADDDFKAFSNAKRNDHSTIVKVVWEN  243

Query  1109  DESLAVG--VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + HN+KAGAMN L RVSG+MTNAP+MLNVDCD YVN 
Sbjct  244   KAGVGDKEEVPHFVYISREKRPNYLHNYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYVNE  303

Query  1283  PEVVLHAMCFLLGAK--DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     + +   FVQFPQ FYD   D     +  ++   +GRG A IQG
Sbjct  304   ADVVRQAMCIFLQNSILNSKSCAFVQFPQDFYDSNAD-----ELTVLQSYVGRGIAGIQG  358

Query  1457  SFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
               Y G+GCFH R+V+YG+S +D           T   L + +L + +G SK  VTS    
Sbjct  359   PTYAGSGCFHTRRVMYGISLDDLGDDGSLSSVATRNYLAEGNLAREFGNSKEMVTSVVNA  418

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L    + +    L+ SLEAA +V +C YE  T+WG  IGW YGS TED+ TG+GI   GW
Sbjct  419   LQRKPNPQH-SSLTDSLEAAQEVGHCHYENQTSWGKTIGWLYGSTTEDVHTGLGIHSRGW  477

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              + +  P+ P FLG  P  G  ++ Q +RWA+G  EILF+ + P+    F  L+FRQ LA
Sbjct  478   TSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILFNKRSPLIGTFFRKLRFRQSLA  537

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y+  + W +R I EL Y  LP YCL+ N+   PKG  + I++  ++  I+ LYTLWE+M 
Sbjct  538   YLYILTWGLRSIPELFYCLLPAYCLLHNTALFPKGVYLGIIV--TLVGIHCLYTLWEFMS  595

Query  2150  EKESIRAWWNNQRMW  2194
                S+++W+ +Q  W
Sbjct  596   LGFSVQSWFISQSFW  610



>ref|XP_010413985.1| PREDICTED: cellulose synthase-like protein B3 isoform X2 [Camelina 
sativa]
Length=759

 Score =   524 bits (1349),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 288/609 (47%), Positives = 380/609 (62%), Gaps = 24/609 (4%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL SL+ +R   L        W++A +CES+FTF+W+L
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLFSLLLHRYRILLVKQSDNVWVVAFLCESFFTFVWLL  69

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E  +YP+R  E V     + P+VDMF+TTA+P  EPPIL VNTVLSLLA+ 
Sbjct  70    ITCIKWSPAEYKSYPDRLDERVH----DLPSVDMFLTTADPVREPPILVVNTVLSLLAVN  125

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKK NV VRAPFRYF  +H    E
Sbjct  126   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKNNVRVRAPFRYF-LNHPAATE  184

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W  +  EY  LC K+E  T    L +    F  F++   NDHSTI+KV+ EN
Sbjct  185   SS-EFSKDWDMVKWEYEKLCRKVEDVTGDSHLLDADDDFKAFSNAKRNDHSTIVKVVWEN  243

Query  1109  DESLAVG--VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + HN+KAGAMN L RVSG+MTNAP+MLNVDCD YVN 
Sbjct  244   KAGVGDKEEVPHFVYISREKRPNYLHNYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYVNE  303

Query  1283  PEVVLHAMCFLLGAK--DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     + +   FVQFPQ FYD   D     +  ++   +GRG A IQG
Sbjct  304   ADVVRQAMCIFLQNSILNSKSCAFVQFPQDFYDSNAD-----ELTVLQSYVGRGIAGIQG  358

Query  1457  SFYDGTGCFHRRKVIYGLSPNDTVTAEKLTD---HDLQKIYGKSKIFVtsatttlsgsls  1627
               Y G+GCFH R+V+YG+S +D      L+     +L + +G SK  VTS    L    +
Sbjct  359   PTYAGSGCFHTRRVMYGISLDDLGDDGSLSSVATRNLAREFGNSKEMVTSVVNALQRKPN  418

Query  1628  setFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCV  1807
              +    L+ SLEAA +V +C YE  T+WG  IGW YGS TED+ TG+GI   GW + +  
Sbjct  419   PQH-SSLTDSLEAAQEVGHCHYENQTSWGKTIGWLYGSTTEDVHTGLGIHSRGWTSSYIS  477

Query  1808  PERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISIL  1987
             P+ P FLG  P  G  ++ Q +RWA+G  EILF+ + P+    F  L+FRQ LAY+  + 
Sbjct  478   PDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILFNKRSPLIGTFFRKLRFRQSLAYLYILT  537

Query  1988  WPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIR  2167
             W +R I EL Y  LP YCL+ N+   PKG  + I++  ++  I+ LYTLWE+M    S++
Sbjct  538   WGLRSIPELFYCLLPAYCLLHNTALFPKGVYLGIIV--TLVGIHCLYTLWEFMSLGFSVQ  595

Query  2168  AWWNNQRMW  2194
             +W+ +Q  W
Sbjct  596   SWFISQSFW  604



>gb|KGN63232.1| hypothetical protein Csa_2G416220 [Cucumis sativus]
Length=491

 Score =   514 bits (1323),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 264/492 (54%), Positives = 339/492 (69%), Gaps = 19/492 (4%)
 Frame = +2

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
             EFPAVD+FVTTA+P LEPPI+TVNTVLSL+AL+YPANKL CY+SDD  S +T +AL EA 
Sbjct  2     EFPAVDIFVTTADPVLEPPIITVNTVLSLMALDYPANKLGCYISDDGCSALTLFALNEAL  61

Query  839   KFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEY  1012
             KFAK+W+PFCK+Y+V VRAPF YF+     PP   SS +F  +W+ +  EY  L GKI+ 
Sbjct  62    KFAKIWIPFCKRYDVQVRAPFMYFST----PPHLHSSTQFLNDWETLKVEYEKLEGKIKE  117

Query  1013  ATQKPSLFNK-----FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQ  1177
             A +  + +N+      A F++++   H TIIK + EN E ++  +PHLIYISREK  KH 
Sbjct  118   AEENRNGWNEEIGIDLAAFSNINTKHHPTIIKTLWENKE-VSDELPHLIYISREKSLKHH  176

Query  1178  HNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAK-DERDTGFVQ  1354
             H++KAGAMNVLTRVSGV+TNAP++LNVDCD +VNNP+VVLHAMC  L +K D  D G+VQ
Sbjct  177   HHYKAGAMNVLTRVSGVLTNAPYILNVDCDMFVNNPQVVLHAMCVFLNSKYDLEDIGYVQ  236

Query  1355  FPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTV--  1528
              PQ FYDGLKDDP+ +Q  +++   GRG   +QG FY GTGCFHRRKV+Y   P+ T   
Sbjct  237   TPQCFYDGLKDDPFGNQLVVVFEYFGRGIMGLQGPFYGGTGCFHRRKVLYAQFPHHTAYF  296

Query  1529  TAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF---GVL-SYSLEAASQVANCGYE  1696
                K ++ +L K +G SK F  SAT       ++  +   G+  + +L+AA+ VA CGYE
Sbjct  297   LNGKASEQELIKTFGYSKTFTKSATYAFKDDQNTSGYPPKGLFNTNNLDAANHVAGCGYE  356

Query  1697  FGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKR  1876
               TTWG  IGW YGS +ED+LTG+ IQ  GW++ F     P FLGC PS  + SLNQ KR
Sbjct  357   ISTTWGSKIGWIYGSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLNQQKR  416

Query  1877  WASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNS  2056
             WA+G  ++LF+  CPIF  LFG LQ+RQC AY+  + W +R I EL YA LP YCLITNS
Sbjct  417   WATGFLQVLFNKHCPIFGTLFGKLQWRQCAAYLWMLTWGLRSIPELSYALLPAYCLITNS  476

Query  2057  HFLPKGNEVAIV  2092
              F P  + + I 
Sbjct  477   SFFPTVSTIHIT  488



>ref|NP_180821.1| cellulose synthase-like protein B2 [Arabidopsis thaliana]
 sp|O80899.1|CSLB2_ARATH RecName: Full=Cellulose synthase-like protein B2; Short=AtCslB2 
[Arabidopsis thaliana]
 gb|AAC25944.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AEC08706.1| cellulose synthase-like protein B2 [Arabidopsis thaliana]
Length=757

 Score =   521 bits (1343),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 289/615 (47%), Positives = 384/615 (62%), Gaps = 35/615 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE     + + RAV++ IL LL SL+ +R+  +  +G    WL+A +CES F+F+W+L
Sbjct  10    PLYENISYKSYILRAVDLTILGLLFSLLLHRILYMSQNGI--IWLVAFLCESCFSFVWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
                TKW+  ET  YP+R  E V     + P+VDMFV TA+P  EPPI+ VNTVLSLLA+ 
Sbjct  68    STCTKWSPAETKPYPDRLDERVY----DLPSVDMFVPTADPVREPPIMVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN+ VRAPFRYF   + F   
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNLKVRAPFRYFL--NPFAAT  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEN  1108
                EF R+W+    EY  LC K+E AT    L    N+   F++  PNDHSTIIKV+ EN
Sbjct  182   EGSEFSRDWEMTKREYEKLCRKVEDATGDSHLLGTDNELEAFSNTKPNDHSTIIKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH++YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y N 
Sbjct  242   KGGVGDEKEVPHIVYISREKRPNYLHHYKAGAMNFLARVSGLMTNAPYMLNVDCDMYANE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL  ++++    FVQFPQ FYD         +  +I   +GRG A IQG 
Sbjct  302   ADVVRQAMCIFLQKSQNQNHCAFVQFPQEFYDS-----NTIKLTVIKSYMGRGIAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
                G+GCFH R+V+YGLSP++           T E L +  L   +G SK  VTS    L
Sbjct  357   INVGSGCFHSRRVMYGLSPDELEDNGSLSSVATRELLAEDSLSSGFGNSKEMVTSVVEAL  416

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 + +   +L+ S+EAA +V +C YE  T+WG  IGW Y S++ED+ T IGI   GW 
Sbjct  417   QRKPNPQ--NILTNSIEAAQEVGHCDYESQTSWGKTIGWLYDSMSEDMNTSIGIHSRGWT  474

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  P+ P FLG  P  GL ++ Q +RWA+G  E+LF+ + P+       L+FRQ +AY
Sbjct  475   SSYIAPDPPAFLGSMPPGGLEAMIQQRRWATGSIEVLFNKQSPLLGLFCRKLRFRQRVAY  534

Query  1973  M-ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             + +SI   VR I EL Y  LP YCL+ NS   PKG  + + I   +  ++ LYTLWE+M 
Sbjct  535   LCVSIC--VRSIPELIYCLLPAYCLLHNSALFPKG--LCLGITMLLAGMHCLYTLWEFMC  590

Query  2150  EKESIRAWWNNQRMW  2194
                SI++W+ +Q  W
Sbjct  591   LGHSIQSWYVSQSFW  605



>gb|ABR17468.1| unknown [Picea sitchensis]
Length=785

 Score =   521 bits (1342),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 271/633 (43%), Positives = 379/633 (60%), Gaps = 44/633 (7%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE  V    + RA   +  +L LS + YR+ N     Y   W+LA  CE WF F W+L
Sbjct  23    PLYEKIVEKPKLYRAYAFLHFVLTLSFLGYRLLNPLDESYR-IWILAFACEIWFAFQWIL  81

Query  578   VVSTKWNQVETTTYPERFLE-WVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               + +W  V+  TYPERF + +    S + P VD+ +TTA+P  EP I+T NTVLS+LA+
Sbjct  82    EWNMRWLFVDYKTYPERFAQRYSGESSSKLPPVDIIITTADPFKEPAIITANTVLSVLAI  141

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFN---ADHT  925
             +YP  K ACY+SDD AS +TFY+LVE  +FAK WVPFC+K+++  RAPF YF+   A H+
Sbjct  142   DYPVQKFACYISDDGASTITFYSLVETLRFAKRWVPFCRKFDIETRAPFMYFSKQSAQHS  201

Query  926   FPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSL---------FNKFATFADLDPNDH  1078
                +S P F REW++M DEY  L  +I+ A+Q   +          + FA  +  D  +H
Sbjct  202   --KKSDPNFLREWQEMKDEYEGLKRRIQKASQTQDVPLDSICQDGVDGFAHRSS-DIRNH  258

Query  1079  STIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNV  1258
             ST+IKVI EN  +    +PH++Y++REKRPK  H++KAGAMNV+ RVSGVMTN+PF+LN+
Sbjct  259   STVIKVIYENSGAERDILPHVVYVAREKRPKVDHHYKAGAMNVMARVSGVMTNSPFILNL  318

Query  1259  DCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRG  1438
             DCD +VNN + + HAMCF L  K ERD GFVQFPQ FY  +KDDP+ +Q KI    L RG
Sbjct  319   DCDMFVNNSKAIQHAMCFFLDCKSERDCGFVQFPQLFYRSIKDDPFGNQMKIFLSTLARG  378

Query  1439  NAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsattt---  1609
                +QG  Y GTGCFHRRK +YG  P     A++  + D+++ +  +K++ +   ++   
Sbjct  379   MNGLQGPVYCGTGCFHRRKALYGAPP----AADQYNNKDVREFHNHAKVYHSLKASSWSL  434

Query  1610  ----------------lsgslssetFGVL---SYSLEAASQVANCGYEFGTTWGHNIGWR  1732
                                ++ +  FGVL   S +++ A  VA+C YE  T WG  +GW 
Sbjct  435   GALSSIFGSSSALAASAQTTMRNTQFGVLSSPSSTIDEALNVASCRYETNTAWGKEVGWM  494

Query  1733  YGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSM  1912
             YGS  ED++TG  +  +GW + FCVPE+P F+G  P+ G   L QMKRW +G  EI  S 
Sbjct  495   YGSTVEDVMTGFKVHCLGWHSVFCVPEQPAFMGTAPANGPDCLVQMKRWVTGLLEIFLSK  554

Query  1913  KCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIV  2092
              CP F  +  N+  RQ + Y    LW +  +    YA LP +CL++   FLP  ++ +  
Sbjct  555   LCP-FLGIHRNIMVRQRMMYAYFTLWGILSVATFFYAILPAFCLLSGKSFLPGISKPSFA  613

Query  2093  IPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             I  ++F+    + LWE++    SIR WWNNQRM
Sbjct  614   IAVTLFVSIYGFKLWEFLRIGGSIREWWNNQRM  646



>ref|XP_002879394.1| hypothetical protein ARALYDRAFT_902308 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55653.1| hypothetical protein ARALYDRAFT_902308 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score =   517 bits (1332),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 286/614 (47%), Positives = 381/614 (62%), Gaps = 32/614 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL SL+ YR+  ++ +     W++A +CES+F+FIW+L
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLFSLLLYRILLMNQNNT--VWVVAFLCESFFSFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+     +YPER  E V     + P+VDMFVTTA+P  EPPIL  NT+LSLLAL 
Sbjct  68    ITCIKWSPAAYKSYPERLDERVH----DLPSVDMFVTTADPVREPPILVANTLLSLLALN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF  +   P E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVKVRAPFRYF-LNPPVPTE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W+    EY  L  K+E AT         + F  F++  PNDHSTI+KV+ EN
Sbjct  183   SS-EFSKDWEMTKREYEKLSRKVEDATGDSHWLDAEDDFEAFSNTKPNDHSTIVKVVWEN  241

Query  1109  DESLAV--GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y N 
Sbjct  242   KGGVGEENEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYANE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL  + + +   FVQ+PQ FYD   D     +  ++   LG+G A IQG 
Sbjct  302   ADVVRQAMCIFLQKSVNSKHCAFVQYPQDFYDSNAD-----ELTVLQSYLGQGIAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPND--------TVTAEK-LTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GCFH R+V+YGLS +D        +V A K L + +L++ +G SK  V S    L
Sbjct  357   IYAGSGCFHTRRVMYGLSIDDLEEDGSLSSVAARKYLAEENLEREFGNSKEMVKSVVEAL  416

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 + +    L+ SLEAA +V +C YE+ T WG  IGW Y S  ED  T IGI   GW 
Sbjct  417   QRKPNPQ--NTLANSLEAAQEVGHCHYEYQTIWGKTIGWLYESTAEDANTSIGIHSRGWT  474

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  PE P FLG  P  G  ++ Q +RWA+G  E+LF+ + P+       ++FRQ LAY
Sbjct  475   SSYISPEPPAFLGAMPPGGPEAMLQQRRWATGLLEVLFNKQSPLIGMFCRKIRFRQTLAY  534

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +    W +R I EL Y  LP YCL+ NS   PKG  + I++  ++  ++ LYTLWE+M  
Sbjct  535   LYIFTWGLRSIPELFYCLLPAYCLLHNSALFPKGVYLGIIV--TLVGMHCLYTLWEFMSL  592

Query  2153  KESIRAWWNNQRMW  2194
               S+++W+ +Q  W
Sbjct  593   GFSVQSWFVSQSFW  606



>ref|XP_010469576.1| PREDICTED: cellulose synthase-like protein B3 [Camelina sativa]
Length=766

 Score =   517 bits (1332),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 283/600 (47%), Positives = 373/600 (62%), Gaps = 33/600 (6%)
 Frame = +2

Query  437   RAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTT  616
             RAV++ IL LL SL+ +R+  +        W+ A +CES+FT +W+++   KW+  E   
Sbjct  23    RAVDLTILGLLFSLLLHRILLMKQSDN--AWVAAFLCESFFTSVWLIITCIKWSPAEYKP  80

Query  617   YPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDD  796
             YP+R  E V     + P+VDMF+TTA+P  EPPIL VNTVLSLLA+ YPANKLACYVSDD
Sbjct  81    YPDRLDERVH----DLPSVDMFLTTADPVREPPILVVNTVLSLLAVNYPANKLACYVSDD  136

Query  797   SASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMN  976
               SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF  +H    ESS EF ++W  M 
Sbjct  137   GCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYF-LNHPVATESS-EFSKDWDMMK  194

Query  977   DEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICENDESLA--VGVPHL  1141
              EY  LC K+E AT      +    F  F +  PNDHSTI+KV+ EN   +   + VPH 
Sbjct  195   REYEKLCRKLEGATGDSHWLDADDDFEAFTNTKPNDHSTIVKVVWENKGGVGDEIEVPHF  254

Query  1142  IYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLL-  1318
             +YISREKRP + HN+KAGAMN L RVSG+MTNAP+MLNVDCD YVN  +VV  AMC  L 
Sbjct  255   VYISREKRPNYFHNYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQ  314

Query  1319  -GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRK  1495
                 +  +  FVQ+PQ FYD   D        ++   +GRG A IQGS Y G+GCFH R+
Sbjct  315   NSISNSNNCAFVQYPQGFYDSNADG-----LAVLQSYIGRGIAGIQGSIYAGSGCFHTRR  369

Query  1496  VIYGLSPND----------TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
             V+YG+S +D            T   L + +L + +G SK  VTS    L   L+ +   +
Sbjct  370   VMYGISFDDLEDDGRSLSSVATRNYLAEENLAREFGSSKEMVTSVVNALQRKLNPQHSSL  429

Query  1646  LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGF  1825
               + LEAA +V +C YE  T+WG  IGW YGS TED+ T +GI   GW + F  P+ P F
Sbjct  430   TDF-LEAAQKVGHCHYENQTSWGKTIGWLYGSTTEDVHTSLGIHSRGWTSSFISPDPPAF  488

Query  1826  LGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPI  2005
             LG  P  G  ++ Q +RWA+G  E+LF+ + P+    FG L+FRQ LAY+  + W +R I
Sbjct  489   LGAMPPGGPEAMVQQRRWAAGMLEVLFNKRSPLIGVFFGKLRFRQSLAYLYILTWGLRSI  548

Query  2006  FELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
              EL Y  LP YCL+ NS   PKG  + I+    +  ++ LYTLWE+M    S+++W+  Q
Sbjct  549   PELFYCLLPAYCLLYNSALFPKGVYLGIIF--MLLGMHCLYTLWEFMNLGFSVQSWFVCQ  606



>ref|XP_002868214.1| hypothetical protein ARALYDRAFT_329979 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44473.1| hypothetical protein ARALYDRAFT_329979 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   517 bits (1331),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 289/615 (47%), Positives = 378/615 (61%), Gaps = 34/615 (6%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E     +   R V++ IL LL SL+ YR+  +H       WL+A +CES F+FIW+
Sbjct  9     LPLCERISHKSYFLRIVDLTILGLLFSLLLYRI--MHMSENDNIWLVAFLCESCFSFIWL  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++   KW+  E   YP R  E V     +FP+VDMFV TA+P  EPPI+ VNTVLSLLA+
Sbjct  67    IITCIKWSPAEDKPYPNRLDERVH----DFPSVDMFVPTADPVREPPIIVVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YP NKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF        
Sbjct  123   NYPTNKLACYVSDDGCSPLTYFSLTEASKFAKIWVPFCKKYNVRVRAPFRYFLNPLVATD  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICE  1105
             +S   F ++WK    EY  LC KIE AT      +    F  F++  PNDHSTI+KV+ E
Sbjct  183   DSV--FSKDWKMTKREYEKLCRKIEDATGDSHWLDADGDFEAFSNTKPNDHSTIVKVVWE  240

Query  1106  NDESLAVG--VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
             N   +     VPHL+YISREKRP + H++K GAMN L RVSG+MTNAP+MLNVDCD Y N
Sbjct  241   NKGGVGDDKEVPHLVYISREKRPNYLHHYKTGAMNFLLRVSGLMTNAPYMLNVDCDMYAN  300

Query  1280  NPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              P+VV  AMC FL  +K+     FVQFPQ FYD      Y +++ ++   LGRG A IQG
Sbjct  301   EPDVVRQAMCVFLENSKNSNHCAFVQFPQEFYDS-----YTNEFAVLQSYLGRGVAGIQG  355

Query  1457  SFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
               Y G+GCFH R+V+YGLS +D           T E L +  L + YG SK  V S    
Sbjct  356   PIYCGSGCFHTRRVMYGLSSDDLEDNGSLSSVATWEFLDEDSLVRKYGSSKEMVKSVVGA  415

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L      +    L+Y +EAA +V +C YE+ T+WG N+GW Y SV EDI T IGI   GW
Sbjct  416   LQLKSYPQK--SLTYFIEAAQEVGHCHYEYQTSWG-NLGWLYDSVAEDINTSIGIHLRGW  472

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              + F  P+ P FLG TPS GL ++ Q +RWA+G  E+LF+ + P+     G ++FRQ LA
Sbjct  473   TSSFVSPDPPAFLGSTPSVGLEAIVQQRRWATGAIEVLFNKQSPLIGMFRGKIKFRQRLA  532

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y   +L  +  I EL Y  LP YCL+ NS   PKG    + + A++  ++ LY+LW++M 
Sbjct  533   YFW-VLICLSSIPELIYFLLPAYCLLHNSALFPKGP--CLCLTATLVGMHCLYSLWQFMN  589

Query  2150  EKESIRAWWNNQRMW  2194
                S+++W+  Q +W
Sbjct  590   LGFSVQSWYVAQSIW  604



>ref|XP_010556996.1| PREDICTED: cellulose synthase-like protein B3 isoform X2 [Tarenaya 
hassleriana]
Length=568

 Score =   509 bits (1312),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 282/576 (49%), Positives = 359/576 (62%), Gaps = 26/576 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     + + RAV+V IL LL +L+AYR+  L+ +     W  A +CES+F FIW 
Sbjct  8     LPLYEKVSHKSLILRAVDVTILGLLFALLAYRI--LYMNQKDSVWTAAFLCESFFCFIWS  65

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             LV   KW+ V+  TYP+R  E V    CE P VDMFVTTA+P +EPP++TVNTVLSLLA+
Sbjct  66    LVTIVKWSPVDYKTYPDRLHERV----CELPPVDMFVTTADPVMEPPVITVNTVLSLLAV  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YPA KLACYVSDD  SP TF++L  AS+FAK+WVPFCKKYNV VRAPFRYF      P 
Sbjct  122   NYPAEKLACYVSDDGGSPATFFSLKLASRFAKIWVPFCKKYNVQVRAPFRYFLNPPVAPE  181

Query  935   ES-SPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVI  1099
              S S  F  +W  M  EY  L  K+E   + P   +      A F+++ P DH TI+KVI
Sbjct  182   GSDSVRFMEDWDTMKVEYEKLSRKLEMVAENPHGLDDADEDLAAFSNVYPRDHPTIVKVI  241

Query  1100  CENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
              EN+      VPHL+YISREKRPKH H++KAGAMNVL RVSGVMTNAP+MLNVDCD YVN
Sbjct  242   WENNSESE--VPHLVYISREKRPKHSHHYKAGAMNVLARVSGVMTNAPYMLNVDCDMYVN  299

Query  1280  NPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
             NP+V+  AMC  LG+       FVQ PQ FYD   DD       +    +GRG A I   
Sbjct  300   NPDVIRQAMCLFLGSASRNQFAFVQSPQLFYDSFGDD-----LVLFLTYIGRGMAGIGTP  354

Query  1460  FYDGTGCFHRRKVIYGLSPND-----TVTAEKLTDH-DLQKIYGKSKIFVtsatttlsgs  1621
              Y G+G   RR VIYGLSP+D     ++++ KL +  +L++ YG  +  VTSA   L G 
Sbjct  355   LYAGSGGILRRNVIYGLSPHDLQDDGSLSSGKLLEEGNLKREYGNCEEMVTSAADALQGK  414

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              + +    L+ SLEAA +VA+C YE  T WG   GW Y S  EDI T + I   GWK+ +
Sbjct  415   SNPK--NGLTSSLEAAHRVADCDYEHCTNWGKTFGWIYDSTAEDINTSVNIHAKGWKSYY  472

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
               PE P FLGC P  G  ++ Q +RWA+G  E+LF+ + P+   L+  L FR   +Y+  
Sbjct  473   NSPEPPAFLGCMPPGGPAAMGQQRRWATGLLEVLFNKESPVIGMLWRELGFRSGCSYLYI  532

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAI  2089
               W ++ I ELCY  LP YC++ +S FLPKG  ++I
Sbjct  533   CTWGLKSIPELCYCLLPAYCILHDSAFLPKGPCLSI  568



>ref|XP_004144597.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=737

 Score =   515 bits (1327),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 281/605 (46%), Positives = 376/605 (62%), Gaps = 21/605 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
             FPLY+       + R+VE++IL+L +SL+ YR+  L SH      LLA   E  FTF W 
Sbjct  5     FPLYQKLAIKKPIQRSVELLILILAISLLLYRLLYLQSHALLS--LLAFFSELCFTFDWF  62

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +   WN V+  TYP+ F +       E PAVD+ VTTA+ +LEP ++  NTVLSLLA+
Sbjct  63    LYLLLNWNPVDYKTYPQHFKQ-----VHEVPAVDVLVTTADWKLEPSVMVANTVLSLLAV  117

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPA KL CY+SDD  SPV  YALVEAS FA++WVPFCKKYNV VRAPFRYF+     P 
Sbjct  118   DYPAGKLTCYISDDGGSPVLLYALVEASNFARIWVPFCKKYNVQVRAPFRYFSGKS--PS  175

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---FATFADLDPNDHSTIIKVICE  1105
              +  EF++E K+M DEY  L  KIE A + P ++     +  F + D  +H TIIK++ E
Sbjct  176   AAGHEFQQEEKRMKDEYERLREKIEAAEENPMVYETSKYYEAFRNTDKKNHPTIIKILLE  235

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N  + + G+P+L+Y++REKRP   H++KAGA+NVLTRVSGVMTNAPF++N+DCD YVNNP
Sbjct  236   NKGNDSNGIPNLVYVAREKRPNQPHHYKAGALNVLTRVSGVMTNAPFIVNIDCDMYVNNP  295

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
              VV+ AMC LLGA +E+++ FVQFPQ FY+  KDDP+  Q   ++  L RG A IQG  Y
Sbjct  296   NVVVEAMCILLGA-EEQESIFVQFPQIFYNQPKDDPFGCQLNTLFQTLLRGMAGIQGPLY  354

Query  1466  DGTGCFHRRKVIYGL--SPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              G  CFHRRK IY L  SPN T   E+      +     ++I         + +      
Sbjct  355   SGCNCFHRRKTIYTLNSSPNKTGKIEENYGESEELTKSANEILRGVQANGRTHTTID---  411

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
               LS S+++A QVA+  YE  T WG  +GW Y S+TEDILTGI I   GWK+    P  P
Sbjct  412   --LSTSIQSAYQVASADYENNTAWGLKVGWLYESMTEDILTGIKIHSKGWKSVLLQPNPP  469

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              FLG  P+ G  +L Q KRW +G  EI+     P+ A     L  RQCLAY   ++  + 
Sbjct  470   AFLGLAPTGGPDALTQRKRWVTGSLEIMVRKNTPLLAFFLTRLTLRQCLAYTYFLIRGLY  529

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP-ASIFIIYNLYTLWEYMEEKESIRAWW  2176
              I +L YA LP Y ++TNSHFLP   + A++     +FI+Y+ +++  Y++   S+RAWW
Sbjct  530   AIPQLVYAILPAYAILTNSHFLPSVQDTALLATFVPMFILYHSHSICVYLQCGLSVRAWW  589

Query  2177  NNQRM  2191
             NN +M
Sbjct  590   NNVKM  594



>ref|XP_002529324.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33041.1| conserved hypothetical protein [Ricinus communis]
Length=576

 Score =   508 bits (1307),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 258/472 (55%), Positives = 328/472 (69%), Gaps = 19/472 (4%)
 Frame = +2

Query  725   VNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFR  904
             +NTVLSLLA++YP +KLACYVSDD  SP+T+Y+LVE SKFA+LWVPFCKKYN+ VRAPFR
Sbjct  1     MNTVLSLLAVDYPVHKLACYVSDDGCSPLTYYSLVETSKFAQLWVPFCKKYNIQVRAPFR  60

Query  905   YFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPND  1075
             YF+ +      +S EF++EWK + D Y      I+ A  K    +L +  A F+++D  +
Sbjct  61    YFSNESMISARNSLEFQQEWKMLKDGYEEFSHNIQSAAGKSVPWNLNDDLAVFSNIDRRN  120

Query  1076  HSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLN  1255
             H TIIKVI E  E ++ G+PHL+YISREKR  H H++KAGAMNVLTRVSG+MTNAPFMLN
Sbjct  121   HPTIIKVIWEKKEGISDGLPHLVYISREKRLTHAHHYKAGAMNVLTRVSGLMTNAPFMLN  180

Query  1256  VDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGR  1435
             VDCD YVNNP+VV HAMCFLLG+ ++ +  FVQFPQ FYD LKDDP+    + I    GR
Sbjct  181   VDCDMYVNNPQVVRHAMCFLLGSLNKEEFAFVQFPQMFYD-LKDDPFGHTLQYI----GR  235

Query  1436  GNAAIQGSFYDGTGCFHRRKVIYGLSPNDT---------VTAEKLTDHDLQKIYGKSKIF  1588
             G A +QG FY GTGCFHRRKVIYGL P+D          V+A  L D++L  I+G S  F
Sbjct  236   GIAGLQGYFYGGTGCFHRRKVIYGLCPDDLGTQAKALTPVSACNLGDNELLNIFGNSMEF  295

Query  1589  VtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGI  1768
             + SA   L G  S++    LS  +EAA QVA   YE+ T WG  +GW+YGS TED+LTG+
Sbjct  296   IKSADQALQGKTSTQR--NLSNLVEAAYQVAGYSYEYRTAWGTEVGWQYGSTTEDMLTGL  353

Query  1769  GIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNL  1948
              I   GW++ +C P+ P FLGC+PS    S+ Q KRWA+G  EIL    CPI A +   L
Sbjct  354   NIHSRGWRSAYCTPDLPAFLGCSPSCVPVSMTQQKRWATGMLEILVGKNCPIVATITAKL  413

Query  1949  QFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPAS  2104
             QFRQCLAY+  ++W +R I ELCY  LP YC+I+ S+FLPK +E A+++  S
Sbjct  414   QFRQCLAYLYLLVWGLRSIPELCYMVLPAYCIISKSNFLPKLHEPAMILGIS  465



>ref|XP_006293730.1| hypothetical protein CARUB_v10022692mg [Capsella rubella]
 gb|EOA26628.1| hypothetical protein CARUB_v10022692mg [Capsella rubella]
Length=763

 Score =   514 bits (1324),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 285/614 (46%), Positives = 380/614 (62%), Gaps = 34/614 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL SL+ +R+  +  +     W++A  CES F+F+W++
Sbjct  10    PLCERISYTNYFLRAVDLTILGLLFSLLLHRILLMRQNDT--AWVVAFFCESCFSFVWLV  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW   E   YPER  E +     + P+VDMFVTTA+P  EPPIL VNTVLSLLA+ 
Sbjct  68    ITFVKWTPAEYKPYPERLDERIH----DLPSVDMFVTTADPVREPPILVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EA+KFAK+WVPFCKK++V VRAPFRYF  +H    E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEATKFAKIWVPFCKKHSVRVRAPFRYF-LNHPTATE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFADLDPNDHSTIIKVICE  1105
             SS EF ++W+ M  EY  LC K+E AT     F    + F  F++  PNDHS I+KV+ E
Sbjct  183   SS-EFSKDWEMMKSEYEKLCRKVEDATGDSHWFHADDDDFEAFSNTKPNDHSAIVKVVWE  241

Query  1106  NDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
             N   +     VPH++YISREKRP + HN+KAGAMNVL RVSG+MTNAP+MLNVDCD YVN
Sbjct  242   NKGGVGDEKEVPHIVYISREKRPNYFHNYKAGAMNVLIRVSGMMTNAPYMLNVDCDMYVN  301

Query  1280  NPEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
               +VV  AMC  L     +  D  FVQ+PQ FYD   D     +  ++   +GRG A IQ
Sbjct  302   EADVVRQAMCIFLQKSTMNSNDCAFVQYPQDFYDSNVD-----ELIVLQAYMGRGIAGIQ  356

Query  1454  GSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             GS   G+GCF  R+V+YG+S +D           T + L +  L + +G SK  V S   
Sbjct  357   GSLCAGSGCFQSRRVMYGISLDDLGADGKLSSVATRDYLAEDLLAREFGNSKEMVASVVN  416

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
              L   L+ +    L+ S+EAA +V +C +E  T+WG  +GW YGS TED+ T +GI   G
Sbjct  417   ALQRKLNPQH-SSLTVSIEAAQEVGHCDHENQTSWGKTVGWLYGSTTEDVHTSVGIHSRG  475

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK-CPIFAALFGNLQFRQC  1963
             W + +  P+ P FLG  P  G   + Q +RWA+G  EILF+ +  P    +F  L FRQC
Sbjct  476   WTSSYISPDPPAFLGAMPPGGPEVMLQQRRWAAGMLEILFNKRTTPFVGMIFRKLTFRQC  535

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEY  2143
             LAY+ +  W +R I EL Y  LP YCL+ NS   PKG  + ++I  +I  I+ LYTLWE+
Sbjct  536   LAYLWAFTWGLRSIPELFYCLLPAYCLLHNSALFPKGVYLGVII--TIVGIHCLYTLWEF  593

Query  2144  MEEKESIRAWWNNQ  2185
             M    S+++W+ +Q
Sbjct  594   MSLGFSVQSWFISQ  607



>ref|XP_006410386.1| hypothetical protein EUTSA_v10016289mg [Eutrema salsugineum]
 gb|ESQ51839.1| hypothetical protein EUTSA_v10016289mg [Eutrema salsugineum]
Length=761

 Score =   514 bits (1323),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 267/572 (47%), Positives = 356/572 (62%), Gaps = 30/572 (5%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPE  703
              W++A +CES F+FIW+L+   KW   E   +P+R  E +     + P+VDMFVTTA+P 
Sbjct  50    VWVVAFLCESCFSFIWLLITCIKWCPAEHKPFPDRLDERIH----DLPSVDMFVTTADPV  105

Query  704   LEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNV  883
              EPPIL VNTVLSLLA+ YPANKLACYVSDD  S +T+++L EA KFAK+WVPFCKKYNV
Sbjct  106   REPPILVVNTVLSLLAVNYPANKLACYVSDDGCSSLTYFSLKEAYKFAKIWVPFCKKYNV  165

Query  884   AVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATF  1054
              VRAPFRYF   +        EF REW+    EY     ++E A+         + F  F
Sbjct  166   KVRAPFRYFL--NPLGSSEDSEFSREWEMTKREYEKFIQRVEDASGDSYWLDADDDFEAF  223

Query  1055  ADLDPNDHSTIIKVICENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGV  1228
             +++ PNDHSTI+KVI EN   +     VPH++YISREKRP + H++KAGAMN L RVSG+
Sbjct  224   SNVKPNDHSTIVKVISENKRGVGDEKEVPHIVYISREKRPNYLHHYKAGAMNFLVRVSGL  283

Query  1229  MTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             MTNAP+MLNVDCD Y N  +VV  AMC FL G+ ++    FVQFPQ FYD       A +
Sbjct  284   MTNAPYMLNVDCDMYANEADVVRQAMCVFLEGSMNQDHCAFVQFPQDFYDS-----NAGE  338

Query  1406  YKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDT---------VTAEKLTDHDL  1558
               ++   L RG A IQG  Y G+GCFH R+V+YGLSPND           T + L +  L
Sbjct  339   LVVLQTYLVRGIAGIQGPIYAGSGCFHTRRVMYGLSPNDLEDNISLSSFATRKFLAEESL  398

Query  1559  QKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYG  1738
              +++G SK  VTS    L    + +    L+ SLE A  V +C YE+ T+WG  IGW Y 
Sbjct  399   ARVFGNSKEMVTSVVDALQRKSNPQ--NSLTNSLEVAKAVGHCNYEYQTSWGKTIGWLYD  456

Query  1739  SVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKC  1918
             S +ED+ T IGI   GW + + +PE P FLGC P  G  ++ Q +RWA+G  E+LF+ + 
Sbjct  457   STSEDVNTSIGIHSRGWTSSYLLPEPPAFLGCMPPGGPEAMLQQRRWATGLLEVLFNKQS  516

Query  1919  PIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP  2098
             P+       ++FRQ LAY+  + W +R I EL Y  LP YCL+ NS   PKG  + I++ 
Sbjct  517   PLIGMFCKKIRFRQSLAYLYILTWGLRSIPELVYCLLPAYCLLHNSSLFPKGVCLGIIV-  575

Query  2099  ASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
              ++  ++ LYTLWE+M    S+++W+ +Q  W
Sbjct  576   -TLVGMHCLYTLWEFMSLGFSVQSWYVSQSFW  606



>ref|XP_010451508.1| PREDICTED: cellulose synthase-like protein B6 [Camelina sativa]
Length=756

 Score =   513 bits (1320),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 291/613 (47%), Positives = 381/613 (62%), Gaps = 35/613 (6%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             L E     + V R V++ IL LL SL+ YR+  LH       WL+A +CES F+FIW+++
Sbjct  11    LSEKISHKSYVLRIVDLTILGLLFSLLLYRI--LHMSQNDNVWLVAFLCESIFSFIWLII  68

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
                KW+  E   YP R  E V     + P+VDMFV TA+P  EPPI+ VNTVLSLLAL Y
Sbjct  69    TCIKWSPAEDKPYPNRLDERVH----DLPSVDMFVPTADPVREPPIIVVNTVLSLLALNY  124

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PANKLACYVSDD  SP TF++L EASKFA++WVPFCKKYNV VRAPFRYF        +S
Sbjct  125   PANKLACYVSDDGCSPHTFFSLREASKFAQIWVPFCKKYNVRVRAPFRYFLNPLVVTDDS  184

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEND  1111
                F ++W+    EY  LC KIE AT+ P      + F  F++  PNDHSTI+KV+ EN 
Sbjct  185   V--FIKDWEMTKREYEKLCRKIENATEDPHCLDADDDFEAFSNTKPNDHSTIVKVVWENK  242

Query  1112  ESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
               +     VPHL+YISREKRP   H++K GAMN L RVSG+MTNAP+MLNVDCD Y N  
Sbjct  243   AGVGDEKEVPHLVYISREKRPNCLHHYKTGAMNFLLRVSGLMTNAPYMLNVDCDMYANEA  302

Query  1286  EVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             +VV  AMC FL  AK+  +  FVQFPQ FYD      YAS++ ++   LGRG   IQG  
Sbjct  303   DVVRQAMCVFLQNAKNSNNCAFVQFPQEFYDS-----YASEFSVLQSYLGRGVGGIQGPI  357

Query  1463  YDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttls  1615
             Y G+GCFH R+V+YGLS +D           T+E L +  L + YG SK  + S T  L 
Sbjct  358   YCGSGCFHIRRVMYGLSTDDLKDNGSLSSLATSEFLAEESLVRKYGTSKELLKSVTDALQ  417

Query  1616  gslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
                + +    L+  +EAA +V +C YE+ T+WG N+GW YGSV +DI T I I   GW +
Sbjct  418   RKSNPQ--SSLTNFIEAAQEVGHCHYEYNTSWG-NLGWLYGSVGDDIKTSIEIHMKGWTS  474

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
              F  P+ P FLG TPS GL ++ Q +RWA+G TE+LFS + P+       + FRQ LAY 
Sbjct  475   SFISPDPPAFLGSTPSVGLETIVQQRRWATGATEVLFSKQSPLI-GFRRKIIFRQRLAYF  533

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
               IL  +R   EL Y  LP YCL+ NS   PKG  + I++  ++  ++ L +LW++M+  
Sbjct  534   W-ILMCIRSTPELIYCLLPAYCLLHNSTLFPKGPCLGIIV--TLVGMHCLNSLWQFMKLG  590

Query  2156  ESIRAWWNNQRMW  2194
              S+++W+ +Q +W
Sbjct  591   FSVQSWYVSQSLW  603



>gb|KFK31116.1| hypothetical protein AALP_AA6G070100 [Arabis alpina]
Length=627

 Score =   508 bits (1308),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 282/598 (47%), Positives = 366/598 (61%), Gaps = 32/598 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     + V RAV++ IL L  SL+ YR+  LH       WL+A +CES F+F+W++
Sbjct  10    PLCEKISYKSYVLRAVDLTILGLFFSLLVYRI--LHMSQNDTVWLVAFLCESLFSFVWLI  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   YP+R    ++    + P+VDMFV TA+P  EPPI+ VNTVLSLLA+ 
Sbjct  68    ITCIKWSPAEYKPYPDR----LDERDLDLPSVDMFVPTADPVREPPIIIVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T++ L EASKF+K+WVPFCKKYNV VRAPFRYF    T    
Sbjct  124   YPANKLACYVSDDGCSPLTYFCLKEASKFSKIWVPFCKKYNVKVRAPFRYFLNPMT--SL  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
               PEF  EW     EY  L  K+E AT      N    F  F++  PNDHS+I+KVI EN
Sbjct  182   EDPEFATEWGMTKREYEKLALKVEDATGDSHCLNADDDFEAFSNTKPNDHSSIVKVIWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD YVN 
Sbjct  242   KGGVGDEKEVPHFVYISREKRPNYLHHYKAGAMNFLIRVSGLMTNAPYMLNVDCDMYVNE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
               VV  AMC FL G+ ++   GFVQFPQ FYD   D     +  ++   LGRG A IQG 
Sbjct  302   ANVVRQAMCIFLQGSMNQNHCGFVQFPQFFYDSNAD-----ELTVLQSYLGRGIAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
                G+GCFH R+V+YGLS +D           T E L + DL + +G SK  V S    L
Sbjct  357   VCAGSGCFHTRRVMYGLSLDDLEDNGSLSSVATREFLAEEDLVRKFGNSKEMVNSVVVAL  416

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 + +T  +L+ SL+AA +V +C YE+ T+WG  IGW Y S +ED+ T IGI   GW 
Sbjct  417   QRKSNPQT--ILTNSLDAAKEVGHCPYEYQTSWGKTIGWLYDSTSEDVHTSIGIHSRGWT  474

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  P  P FLGC P  G  ++ Q +RWA+G  EILF+ + P+       ++FRQ LAY
Sbjct  475   SSYISPNPPSFLGCMPPGGPEAMLQQRRWATGLLEILFNKQSPLIGMFHRKIRFRQRLAY  534

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYM  2146
             +   +W +R I EL Y  LP YCL  NS   PKG  + I++  ++  ++ LYT WE+M
Sbjct  535   LNLSVWGLRSIPELFYCLLPAYCLFHNSPLFPKGPCLGIIV--TLVGMHCLYTQWEFM  590



>ref|XP_004171456.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=737

 Score =   511 bits (1315),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 279/605 (46%), Positives = 373/605 (62%), Gaps = 21/605 (3%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
             FPLY+       + R+VE++IL+L +SL+  R+  L SH      LLA   E  FTF W 
Sbjct  5     FPLYQKLAIKKPIQRSVELLILILAISLLLCRLLYLQSHALLS--LLAFFSELCFTFDWF  62

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +   WN V+  TYP+ F +       E PAVD+ VTTA+ +LEP ++  NTVLSLLA+
Sbjct  63    LYLLLNWNPVDYKTYPQHFKQ-----VHEVPAVDVLVTTADWKLEPSVMVANTVLSLLAV  117

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPA KL CY+SDD  SPV  YALVEAS FA++WVPFCKKYNV VRAPFRYF+     P 
Sbjct  118   DYPAGKLTCYISDDGGSPVLLYALVEASNFARIWVPFCKKYNVQVRAPFRYFSGKS--PS  175

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---FATFADLDPNDHSTIIKVICE  1105
                 EF++E K+M DEY  L  KIE A + P ++     +  F + D  +H TIIK++ E
Sbjct  176   AGGHEFQQEEKRMKDEYERLREKIEAAEENPMVYETSKYYEAFRNTDKKNHPTIIKILLE  235

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N  + + G+P+L+Y++REKRP   H +KAGA+NVLTRVSGVMTNAPF++N+DCD YVNNP
Sbjct  236   NKGNDSNGIPNLVYVAREKRPNQPHYYKAGALNVLTRVSGVMTNAPFIVNIDCDMYVNNP  295

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
              VV+ AMC LLGA +E+++ FVQFPQ FY+  KDDP+  Q   ++  L RG A IQG  Y
Sbjct  296   NVVVEAMCILLGA-EEQESIFVQFPQIFYNQPKDDPFGCQLNTLFQTLLRGMAGIQGPLY  354

Query  1466  DGTGCFHRRKVIYGL--SPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
              G  CFHRR+ IY L  SPN T   E+      +     ++I         + +      
Sbjct  355   CGCNCFHRRRTIYTLNSSPNKTGKIEENYGESEELTKSANEILRGVQANGRTHTTID---  411

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
               LS S+++A QVA+  YE  T WG  +GW Y S+TEDILTGI I   GWK+    P  P
Sbjct  412   --LSTSIQSAYQVASADYENNTAWGLKVGWLYESMTEDILTGIKIHSKGWKSVLLQPNPP  469

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              FLG  P+ G  +L Q KRW +G  EI+     P+ A     L  RQCLAY   ++  + 
Sbjct  470   AFLGLAPTGGPDALTQRKRWVTGSLEIMVRKNTPLLAFFLTRLTLRQCLAYTYFLIRGLY  529

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP-ASIFIIYNLYTLWEYMEEKESIRAWW  2176
              I +L YA LP Y ++TNSHFLP   + A++     +FI+Y+ +++  Y++   S+RAWW
Sbjct  530   AIPQLVYAILPAYAILTNSHFLPSVQDTALLATFVPMFILYHSHSICVYLQCGLSVRAWW  589

Query  2177  NNQRM  2191
             NN +M
Sbjct  590   NNVKM  594



>ref|XP_002879395.1| hypothetical protein ARALYDRAFT_482180 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55654.1| hypothetical protein ARALYDRAFT_482180 [Arabidopsis lyrata subsp. 
lyrata]
Length=758

 Score =   511 bits (1316),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 282/616 (46%), Positives = 381/616 (62%), Gaps = 39/616 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E    N+ + RAV++ IL LL SL+ YR+  LH +     W++A +CES F+F+W+L
Sbjct  10    PLCERISHNSYLLRAVDLTILGLLFSLLLYRI--LHVNQNDTVWVVAFLCESCFSFVWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  +  TYP+R  E V     + P+VDMFVTTA+P  EPPI+ VNTVLSLLA+ 
Sbjct  68    ITCIKWSPADYKTYPDRLDERVH----DLPSVDMFVTTADPVREPPIIVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPF YF      PP 
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVNVRAPFMYF----LNPPT  179

Query  938   S--SPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVIC  1102
             +  S EF ++W+    EY  L  K+E AT +       + F  F++   NDHSTI+KV+ 
Sbjct  180   ATESSEFSKDWEMTKREYEKLSQKLEDATGRSHWLDPEDDFEAFSNTISNDHSTIVKVVW  239

Query  1103  ENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             EN   +     VPH++YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y 
Sbjct  240   ENKGGVGDEKEVPHVVYISREKRPNYFHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYA  299

Query  1277  NNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
             N  +VV  AMC FL  + +     FVQ+PQ FYD   D     +  ++   LGRG A IQ
Sbjct  300   NEADVVRQAMCIFLQKSMNSNHCAFVQYPQDFYDSNAD-----ELTVLQLYLGRGIAGIQ  354

Query  1454  GSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             G  Y G+GCFH R+V+YGLS +D           T + L +  L + +GKSK  V S   
Sbjct  355   GPLYGGSGCFHTRRVMYGLSLDDLEDDGSLSSIATRKYLAEESLAREFGKSKEMVKSVVD  414

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGH---NIGWRYGSVTEDILTGIGIQ  1777
              L           L  SLEAA +V +C YE+ T+WG+   NIGW Y S  ED+ T IGI 
Sbjct  415   ALQRKSYLH--NTLKDSLEAAQEVGHCHYEYQTSWGNTVINIGWLYDSTAEDVNTSIGIH  472

Query  1778  RMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFR  1957
               GW + + +P+ P FLGC P  G  ++ Q +RWA+G  E+LF+ + P+       ++FR
Sbjct  473   SRGWTSSYILPDPPAFLGCMPQGGPEAMVQQRRWATGLLEVLFNKQSPLIGMFRRKIRFR  532

Query  1958  QCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLW  2137
             Q +AY+    W +R I EL Y  LP YC++ NS   PKG  + I++  ++  ++ LYTLW
Sbjct  533   QSMAYLYVFSWGLRSIPELFYCLLPAYCVLHNSALFPKGVYLGIIV--TLVGMHCLYTLW  590

Query  2138  EYMEEKESIRAWWNNQ  2185
             E+M    S+++W+ +Q
Sbjct  591   EFMSLGFSVQSWYVSQ  606



>ref|XP_008455453.1| PREDICTED: cellulose synthase-like protein B4 [Cucumis melo]
Length=742

 Score =   509 bits (1312),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 272/568 (48%), Positives = 357/568 (63%), Gaps = 22/568 (4%)
 Frame = +2

Query  506   SHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFV  685
             SHG    WLLA   E  FTF W L +   W+ V+  TYP+ F +       E P VD+ V
Sbjct  42    SHGLL--WLLAFFSELCFTFDWFLYILLNWSPVDYKTYPQHFKQ-----VPEVPPVDVLV  94

Query  686   TTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPF  865
             TTA+ +LEP I+ VNTVLSLLA++YPA KL+CYVSDD  SPV  YALVEAS FAK+WVPF
Sbjct  95    TTADWKLEPSIMVVNTVLSLLAVDYPAGKLSCYVSDDGGSPVLLYALVEASNFAKIWVPF  154

Query  866   CKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK-  1042
             CKKY+V VRAPFRYF++    P     EFR+E K+M DEY  LC +IE A + P ++   
Sbjct  155   CKKYHVQVRAPFRYFSSKS--PSADGHEFRQEEKRMKDEYERLCERIEAAEENPMVYETS  212

Query  1043  --FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTR  1216
               +  F + D  +H TIIK++ EN  + + G+ +L+Y++REKRP   H +KAGA+NVLTR
Sbjct  213   KYYEAFKNTDKKNHPTIIKILLENKGNDSNGISNLVYVAREKRPNQPHYYKAGALNVLTR  272

Query  1217  VSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPY  1396
             VSGVMTNAPF++N+DCD YVNNP VV+ AMC LLGA +E+++ FVQFPQ FY+  KDDP+
Sbjct  273   VSGVMTNAPFIVNIDCDMYVNNPNVVVEAMCILLGA-EEQESIFVQFPQIFYNLPKDDPF  331

Query  1397  ASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGK  1576
               Q   ++  L RG A IQG  + G  CFHRRK IY L+ +   T +      +++ +G+
Sbjct  332   GCQLITLFQTLLRGMAGIQGPLFGGCNCFHRRKTIYTLNSSQNKTGK------IEENFGE  385

Query  1577  SKIFVtsatttlsgslssetFGV--LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTE  1750
             S+    SA   L G   +       LS S+++A QVA+  YE  T WG  +GW YGS+TE
Sbjct  386   SEELTKSANEILRGVQFNGPPQTINLSTSIQSAYQVASADYENNTAWGLKVGWLYGSMTE  445

Query  1751  DILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFA  1930
             DILTGI I   GWK+    P  P FLG  P+ G  +L Q KRW +G  EIL     P+ A
Sbjct  446   DILTGIKIHSKGWKSVLLQPNPPAFLGLAPTGGPDALTQRKRWVTGSLEILVCKTSPLLA  505

Query  1931  ALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP-ASI  2107
                  L  RQCLAY   +   +  I EL Y  LP Y ++TNSHFLP   + A++     I
Sbjct  506   FFLTRLTLRQCLAYTYFLTRSLYAIPELVYVILPAYAILTNSHFLPSVQDTALLATFVPI  565

Query  2108  FIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             FI+Y+  ++  Y++   S+RAWWNN +M
Sbjct  566   FILYHSLSVCVYLQCGLSVRAWWNNVKM  593



>ref|NP_850190.1| cellulose synthase-like protein B3 [Arabidopsis thaliana]
 sp|Q8RX83.1|CSLB3_ARATH RecName: Full=Cellulose synthase-like protein B3; Short=AtCslB3 
[Arabidopsis thaliana]
 gb|AAL90907.1| At2g32530/T26B15.9 [Arabidopsis thaliana]
 gb|AAN72301.1| At2g32530/T26B15.9 [Arabidopsis thaliana]
 gb|AEC08697.1| cellulose synthase-like protein B3 [Arabidopsis thaliana]
 gb|AHL38821.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=755

 Score =   510 bits (1313),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 279/616 (45%), Positives = 377/616 (61%), Gaps = 36/616 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   R V++ IL  L SL+ YR+  ++ +     W++A +CES+F+FIW+L
Sbjct  10    PLCEKISYKNYFLRVVDLTILGFLFSLLLYRILLMNQNNS--VWVVAFLCESFFSFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             + S KW+     +YPER  E V     + P+VDMFVTTA+P  EPPIL  NT+LSLLA+ 
Sbjct  68    ITSIKWSPASYKSYPERLDERVH----DLPSVDMFVTTADPVREPPILVANTLLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN+ VRAPFRYF      PP 
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNIKVRAPFRYF----LNPPA  179

Query  938   S--SPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVIC  1102
             +  S EF ++W+    EY  L  ++E AT         + F  F++  PNDHSTI+KV+ 
Sbjct  180   ATESSEFSKDWEITKREYEKLSRRVEDATGDSHWLDAEDDFEDFSNTKPNDHSTIVKVVW  239

Query  1103  ENDESLAV--GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             EN   + V   VPH +YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y 
Sbjct  240   ENKGGVGVENEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYA  299

Query  1277  NNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
             N  +VV  AMC FL  + +     FVQFPQ FYD   D     +  ++   LGRG A IQ
Sbjct  300   NEADVVRQAMCIFLQKSMNSNHCAFVQFPQEFYDSNAD-----ELTVLQSYLGRGIAGIQ  354

Query  1454  GSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             G  Y G+GCFH R+V+YGLS +D           T + L + +L + +G S   VTS   
Sbjct  355   GPTYAGSGCFHTRRVMYGLSIDDLEDDGSLSSLATRKYLAEENLAREFGNSNEMVTSVVE  414

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
              L    + +    L+ SLEAA +V +C +E+ T+WG  IGW Y S  ED  T IGI   G
Sbjct  415   ALQRKPNPQ--NTLANSLEAAQEVGHCHFEYQTSWGKTIGWLYESTAEDANTSIGIHSRG  472

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W + +  P+ P FLG  P  G  ++ Q +RWA+G  E+LF+ + P+       ++FRQ L
Sbjct  473   WTSSYISPKPPAFLGAMPPGGPEAMLQQRRWATGLLEVLFNKQSPLIGMFCRKIRFRQSL  532

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYM  2146
             AY+    W +R I EL Y  LP YCL+ N+   PKG  + IV+  ++  ++ LY+LWE+M
Sbjct  533   AYLYIFTWGLRSIPELIYCLLPAYCLLHNAALFPKGVYLGIVV--TLVGMHCLYSLWEFM  590

Query  2147  EEKESIRAWWNNQRMW  2194
                 S+++W+ +Q  W
Sbjct  591   SLGFSVQSWFASQSFW  606



>ref|XP_010510006.1| PREDICTED: cellulose synthase-like protein B3 isoform X3 [Camelina 
sativa]
Length=572

 Score =   503 bits (1294),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 278/576 (48%), Positives = 359/576 (62%), Gaps = 31/576 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL+SL+ +R+  +        W++A +CES+FTFIW+L
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLISLLLHRILLMKQSDN--VWVVAFLCESFFTFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   Y +R  E V     + P+VDMF+TTA+P  EPPIL VNT+LSLLA+ 
Sbjct  68    ITCIKWSPAEYKPYADRLDERVH----DLPSVDMFLTTADPVREPPILVVNTLLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF  +H    E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYF-LNHPAATE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W  M  EY  LC K+E AT      +    F  F++  PNDHSTI+KV+ EN
Sbjct  183   SS-EFSKDWDMMKREYEKLCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSTIVKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + HN+KAGAMNVL RVSG+MTNAP+MLNVDCD YVN 
Sbjct  242   KGGMGDEKEVPHFVYISREKRPNYFHNYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYVNE  301

Query  1283  PEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     +  +  FVQ+PQ FYD   D     +  ++   +GRG A IQG
Sbjct  302   ADVVRQAMCIFLQNSISNSNNCAFVQYPQDFYDSNAD-----ELVVLQSYIGRGIAGIQG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPND----------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             S Y G+GCFH R+V+YG+S +D            T   L + +L + +G SK  VTS   
Sbjct  357   STYAGSGCFHTRRVMYGISLDDLEDDGRSLSSVATRSYLAEENLAREFGNSKEMVTSVVN  416

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
              L    + +    L+ SLEAA +V +C YE  T+WG  IGW YGS TED+ TG+GI   G
Sbjct  417   ALQRKPNPQ-HSSLTDSLEAAQEVGHCHYENQTSWGKTIGWLYGSTTEDVHTGLGIHSRG  475

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W + +  P+ P FLG  P  G  ++ Q +RWA+G  EILF+ + P+    F  L+FRQ L
Sbjct  476   WTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILFNKRSPLIGVFFRKLRFRQSL  535

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKG  2074
             AY+  + W +R I EL Y  LP YCL+ NS   PK 
Sbjct  536   AYLYILTWGLRSIPELFYCLLPAYCLLHNSALFPKS  571



>sp|O23386.2|CSLB6_ARATH RecName: Full=Cellulose synthase-like protein B6; Short=AtCslB6 
[Arabidopsis thaliana]
Length=757

 Score =   508 bits (1308),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 283/615 (46%), Positives = 379/615 (62%), Gaps = 35/615 (6%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E     + + R V++ IL+LL SL+ YR+  LH       WL+A +CES F+F+W+
Sbjct  9     LPLCERISHKSYILRIVDLTILVLLFSLLWYRI--LHMCENNTIWLVAFLCESCFSFMWL  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             ++   KW+  E   YP R  E V     + P+VDMFV TA+P  EPPI+ VNTVLSLLA+
Sbjct  67    IITCIKWSPAEDKPYPNRLDERVH----DLPSVDMFVPTADPVREPPIIVVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YPANKLACYVSDD  SP+T+++L EASKF K+W PFCKKYNV VRAPFRYF        
Sbjct  123   NYPANKLACYVSDDGCSPLTYFSLKEASKFVKIWAPFCKKYNVRVRAPFRYFLNPLVATD  182

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICE  1105
             +S   F ++WK M  EY  LC K+E AT         + F  F++  PNDHSTI+KV+ E
Sbjct  183   DSV--FSKDWKMMKREYVKLCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSTIVKVVWE  240

Query  1106  NDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
             N   +     VPHL+YISREKRP + H++K GAMN L RVSG+MTNAP+MLNVDCD Y N
Sbjct  241   NKGGVGDEKEVPHLVYISREKRPNYLHHYKTGAMNFLLRVSGLMTNAPYMLNVDCDMYAN  300

Query  1280  NPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              P+VV  AMC FL  +K+     FVQFPQ FYD      Y ++  ++ H + RG A IQG
Sbjct  301   EPDVVRQAMCVFLQNSKNSNHCAFVQFPQNFYDS-----YTNELVVLQHYMKRGVAGIQG  355

Query  1457  SFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
               Y G+GCFH R+V+YGLS +D           + E L++  L + YG SK  V S    
Sbjct  356   PIYIGSGCFHTRRVMYGLSSDDLEDDGSLSSVASREFLSEDSLVRKYGSSKELVKSVVDA  415

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L    + +    L+  +EAA +V +C YE+ T+WG N+GW Y SV ED  T IGI   GW
Sbjct  416   LQRKSNPQK--SLANLVEAAQEVGHCHYEYQTSWG-NLGWLYDSVAEDTNTSIGIHLRGW  472

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              + F  P+ P FLG TPS G  ++ Q +RWA+G  E+LF+ + P+       ++FRQ LA
Sbjct  473   TSSFISPDPPAFLGSTPSVGPEAIVQHRRWATGSIEVLFNKQSPLI-GFRRKIKFRQRLA  531

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y   +L  +R I EL Y  LP YCL+ NS   PKG  + I++  ++  ++ LYTLW++M 
Sbjct  532   YFW-VLMCIRSIPELVYCLLPAYCLLNNSALFPKGPCLGIIV--TLVGMHCLYTLWQFMI  588

Query  2150  EKESIRAWWNNQRMW  2194
                S+++W+ +Q +W
Sbjct  589   LGFSVKSWYVSQSLW  603



>ref|XP_004953419.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Setaria italica]
Length=714

 Score =   506 bits (1303),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 270/563 (48%), Positives = 344/563 (61%), Gaps = 57/563 (10%)
 Frame = +2

Query  536   ALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPP  715
             AL CE+WFT +W+L ++ KWN V   TY  R  E  +    E PAVD+FVTTA+PELEPP
Sbjct  55    ALACEAWFTLLWLLNMNCKWNPVRFETYTGRLSERGD----ELPAVDVFVTTADPELEPP  110

Query  716   ILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRA  895
             ++TVNTVLSLLAL+YPA KLACYVSDD  SP+T YAL EA+ FA+ WVPFC+++ V VRA
Sbjct  111   VVTVNTVLSLLALDYPAGKLACYVSDDGCSPLTCYALREAAAFARQWVPFCRRHGVGVRA  170

Query  896   PFRYFNADHTFPPE---SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF--NKFATFAD  1060
             PF YF++    PPE   +  EF REW  M +EY  L G+IE A +   L   N+ A F  
Sbjct  171   PFAYFSSG---PPEDRMADKEFFREWTFMKNEYEKLVGRIENAEENSLLQSDNELADFVG  227

Query  1061  LDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNA  1240
              D  +H TIIK                                       TRVS V+TNA
Sbjct  228   ADRRNHPTIIK---------------------------------------TRVSAVLTNA  248

Query  1241  PFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIY  1420
             P MLNVDCD + NNP+V+LHAMC LLG  DE  +GFVQ PQ FY+ L+DDP+ +Q +++Y
Sbjct  249   PIMLNVDCDMFANNPQVILHAMCLLLGFDDEVHSGFVQAPQIFYNALQDDPFGNQTEVMY  308

Query  1421  HCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTV------TAEKLTDHDLQKIYGKSK  1582
               LG G A +QG +Y+GTGCFHRRKVIY + P+ +       T    +  +L+   G  K
Sbjct  309   KKLGYGFAGLQGIYYNGTGCFHRRKVIYSMPPDCSTHVKPRRTKGSPSWEELRVKLGSQK  368

Query  1583  IFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILT  1762
               + SA + +SG + +     LS  ++ A++V+ C YE  T WG  IGW YGS TEDILT
Sbjct  369   ELIESARSIISGDMLAVPIVGLSSRIKVANEVSACSYEASTGWGQEIGWVYGSTTEDILT  428

Query  1763  GIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFG  1942
             G  I   GWK+       P FLG  P+ G  SL Q KRWA+G  EIL S   PI  ++  
Sbjct  429   GQRIHAAGWKSALMNTNPPAFLGSAPTGGPASLTQYKRWATGLFEILVSRNNPILLSICK  488

Query  1943  NLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
              L FRQCLAY++  +WP+R  FELCY+ L PYCL+TN  FLPK +E    I  ++F+ YN
Sbjct  489   RLHFRQCLAYLVIDVWPLRAPFELCYSLLGPYCLLTNHSFLPKSSEPGFSITLALFLTYN  548

Query  2123  LYTLWEYMEEKESIRAWWNNQRM  2191
             +Y   EYM+ + S RAWWNNQRM
Sbjct  549   IYNFMEYMDCQLSARAWWNNQRM  571



>ref|XP_010510005.1| PREDICTED: cellulose synthase-like protein B3 isoform X2 [Camelina 
sativa]
Length=665

 Score =   504 bits (1298),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 282/588 (48%), Positives = 364/588 (62%), Gaps = 35/588 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL+SL+ +R+  +        W++A +CES+FTFIW+L
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLISLLLHRILLMKQSDN--VWVVAFLCESFFTFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   Y +R  E V     + P+VDMF+TTA+P  EPPIL VNT+LSLLA+ 
Sbjct  68    ITCIKWSPAEYKPYADRLDERVH----DLPSVDMFLTTADPVREPPILVVNTLLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF  +H    E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYF-LNHPAATE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W  M  EY  LC K+E AT      +    F  F++  PNDHSTI+KV+ EN
Sbjct  183   SS-EFSKDWDMMKREYEKLCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSTIVKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + HN+KAGAMNVL RVSG+MTNAP+MLNVDCD YVN 
Sbjct  242   KGGMGDEKEVPHFVYISREKRPNYFHNYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYVNE  301

Query  1283  PEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     +  +  FVQ+PQ FYD   D     +  ++   +GRG A IQG
Sbjct  302   ADVVRQAMCIFLQNSISNSNNCAFVQYPQDFYDSNAD-----ELVVLQSYIGRGIAGIQG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPND----------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             S Y G+GCFH R+V+YG+S +D            T   L + +L + +G SK  VTS   
Sbjct  357   STYAGSGCFHTRRVMYGISLDDLEDDGRSLSSVATRSYLAEENLAREFGNSKEMVTSVVN  416

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
              L    + +    L+ SLEAA +V +C YE  T+WG  IGW YGS TED+ TG+GI   G
Sbjct  417   ALQRKPNPQ-HSSLTDSLEAAQEVGHCHYENQTSWGKTIGWLYGSTTEDVHTGLGIHSRG  475

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W + +  P+ P FLG  P  G  ++ Q +RWA+G  EILF+ + P+    F  L+FRQ L
Sbjct  476   WTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILFNKRSPLIGVFFRKLRFRQSL  535

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIF  2110
             AY+  + W +R I EL Y  LP YCL+ NS   PK     IV   S+F
Sbjct  536   AYLYILTWGLRSIPELFYCLLPAYCLLHNSALFPK----QIVSRVSLF  579



>emb|CDY52052.1| BnaCnng21680D [Brassica napus]
Length=751

 Score =   507 bits (1305),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 277/593 (47%), Positives = 365/593 (62%), Gaps = 24/593 (4%)
 Frame = +2

Query  437   RAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTT  616
             RAV++ +L LL SL+ YR+  LH       W++A +CES+FTFIW+L+   KW   E   
Sbjct  23    RAVDLTMLGLLFSLLLYRI--LHMSQNDNVWVVAFLCESFFTFIWLLITCIKWTPAEHKP  80

Query  617   YPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDD  796
             YP+R  E V     E P+VDMFVTTA+P  EPPIL VNTVLSLLA+ YPANKLACYVSDD
Sbjct  81    YPDRLDERVH----ELPSVDMFVTTADPVREPPILVVNTVLSLLAVNYPANKLACYVSDD  136

Query  797   SASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMN  976
               S  T+++L EAS FAK+WVPFCKKYNV VRAPFRYF   ++   +   EF R+W+   
Sbjct  137   GCSLFTYFSLKEASNFAKIWVPFCKKYNVRVRAPFRYFL--NSLDAKEDSEFSRDWEMTK  194

Query  977   DEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDESLA--VGVPHLIYI  1150
              EY  L GK+E AT+     + F  F++  PNDHSTI+KV+ EN   +     VPH +Y+
Sbjct  195   REYEKLSGKVEDATRDWDADDDFEAFSNTKPNDHSTIVKVVWENKGGVGDEKEVPHFVYV  254

Query  1151  SREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAK  1327
             SREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y N  +VV  AMC F+ G+ 
Sbjct  255   SREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFMEGSM  314

Query  1328  DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYG  1507
             +     FVQFPQ FYD   D     +  ++   +GRG A IQG  Y G+GCF  R+V+YG
Sbjct  315   NPNHCAFVQFPQKFYDSNSD-----EIVVLQSYVGRGFAGIQGPVYAGSGCFLTRRVMYG  369

Query  1508  LSPNDTVTAEKLTD----HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQ  1675
             LS +D      L+       L++ +GKSK  V S    L    + +    L  S EAA  
Sbjct  370   LSVDDLEEDRNLSSLLAAERLERDFGKSKEMVKSVVDALQRKSNPQ--DTLINSSEAAQA  427

Query  1676  VANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLG  1855
             V +C YE+ T+WG  +GW Y S TED  T IGI   GW + +  PE P FL C P  G  
Sbjct  428   VGHCHYEYQTSWGKTVGWLYDSTTEDAHTSIGIHSRGWTSSYISPEPPAFLRCMPPGGPE  487

Query  1856  SLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPP  2035
             ++ Q +RWA+G  EILF+ + P+  +    ++FRQ LAY+    W +R I EL Y  LP 
Sbjct  488   AMLQQRRWATGLLEILFTKQNPLNGSSCKKIRFRQSLAYLYIFTWGLRSIPELFYCLLPA  547

Query  2036  YCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
             YC++  S   PKG  + IV+  ++  ++ LYTLWE+     S+ +W+ +Q  W
Sbjct  548   YCVLHGSALFPKGVCIGIVV--TLVGMHCLYTLWEFTSLGFSVHSWYASQSFW  598



>ref|XP_010510003.1| PREDICTED: cellulose synthase-like protein B3 isoform X1 [Camelina 
sativa]
Length=668

 Score =   504 bits (1298),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 282/588 (48%), Positives = 364/588 (62%), Gaps = 35/588 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL+SL+ +R+  +        W++A +CES+FTFIW+L
Sbjct  10    PLCEKISYKNYFLRAVDLTILGLLISLLLHRILLMKQSDN--VWVVAFLCESFFTFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   Y +R  E V     + P+VDMF+TTA+P  EPPIL VNT+LSLLA+ 
Sbjct  68    ITCIKWSPAEYKPYADRLDERVH----DLPSVDMFLTTADPVREPPILVVNTLLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF  +H    E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYF-LNHPAATE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
             SS EF ++W  M  EY  LC K+E AT      +    F  F++  PNDHSTI+KV+ EN
Sbjct  183   SS-EFSKDWDMMKREYEKLCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSTIVKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + HN+KAGAMNVL RVSG+MTNAP+MLNVDCD YVN 
Sbjct  242   KGGMGDEKEVPHFVYISREKRPNYFHNYKAGAMNVLVRVSGLMTNAPYMLNVDCDMYVNE  301

Query  1283  PEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
              +VV  AMC  L     +  +  FVQ+PQ FYD   D     +  ++   +GRG A IQG
Sbjct  302   ADVVRQAMCIFLQNSISNSNNCAFVQYPQDFYDSNAD-----ELVVLQSYIGRGIAGIQG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPND----------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             S Y G+GCFH R+V+YG+S +D            T   L + +L + +G SK  VTS   
Sbjct  357   STYAGSGCFHTRRVMYGISLDDLEDDGRSLSSVATRSYLAEENLAREFGNSKEMVTSVVN  416

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
              L    + +    L+ SLEAA +V +C YE  T+WG  IGW YGS TED+ TG+GI   G
Sbjct  417   ALQRKPNPQ-HSSLTDSLEAAQEVGHCHYENQTSWGKTIGWLYGSTTEDVHTGLGIHSRG  475

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W + +  P+ P FLG  P  G  ++ Q +RWA+G  EILF+ + P+    F  L+FRQ L
Sbjct  476   WTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILFNKRSPLIGVFFRKLRFRQSL  535

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIF  2110
             AY+  + W +R I EL Y  LP YCL+ NS   PK     IV   S+F
Sbjct  536   AYLYILTWGLRSIPELFYCLLPAYCLLHNSALFPK----QIVSRVSLF  579



>ref|XP_009107681.1| PREDICTED: cellulose synthase-like protein B6 [Brassica rapa]
Length=758

 Score =   506 bits (1302),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 285/613 (46%), Positives = 378/613 (62%), Gaps = 32/613 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     +   R V++ IL LL SL+ YR+  LH       WL+A +CES FTFIW++
Sbjct  10    PLCEKISHTSFFLRVVDLTILGLLFSLLLYRI--LHMRENDNVWLVAFLCESGFTFIWLI  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   YP R  E +    C+ P+VDMFV TANP  EPPI+  NTVLSLLAL 
Sbjct  68    ITCIKWSPAEDKPYPNRLDERI----CDLPSVDMFVPTANPVREPPIIVANTVLSLLALN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L E  KFAK+WVPFCKKYNV VRAPFRYF        +
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKETFKFAKIWVPFCKKYNVRVRAPFRYFLNPLVAAYD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEN  1108
             S  EFR++WK    EY  L  K+E +T    L    ++  TF++  PN+HSTI+KV+ EN
Sbjct  184   S--EFRKDWKMTKREYEKLRRKVEDSTGDSFLLDGDDELETFSNAKPNNHSTIVKVVWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPHL+YISREKRP + H++K+GAMN L RVSG+MTNAP+MLNVDCD Y N 
Sbjct  242   KGGVGDEKEVPHLVYISREKRPDYVHHYKSGAMNFLLRVSGLMTNAPYMLNVDCDMYANE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL  +K      FVQFPQ FYD   D     +  ++   LGRG A IQG 
Sbjct  302   ADVVRQAMCVFLQKSKSPDRCAFVQFPQEFYDSNSD-----ELAVVQSYLGRGVAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPND-------TVTAEKLTDHD-LQKIYGKSKIFVtsatttls  1615
              Y G+GCFH R+V+YGLSP++       + +A K  D D L + +G SK  V S    L 
Sbjct  357   LYCGSGCFHTRRVMYGLSPDNLENNGDLSSSATKFLDEDSLARKFGSSKELVISIVEALQ  416

Query  1616  gslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             G  + +T   L+  +EAA  V +C YE  T WG  +G  Y SV ED+ T IGI   GW +
Sbjct  417   GKSNPKT--SLTDFIEAAQMVGHCHYEHQTNWGKTLGCLYDSVAEDMNTSIGIHLRGWSS  474

Query  1796  GFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM  1975
              +  P+ P FLG TPS G  ++ Q +RW +G  E+LF+ + P+       ++FRQ LAY+
Sbjct  475   SYICPDPPAFLGSTPSVGFEAIVQQRRWGTGAIEVLFNKQSPLRGMFSSKIRFRQRLAYL  534

Query  1976  ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEK  2155
               +L  +R I EL Y  LP YCL+ N+   PKG  +AI +  +I +++ LYTLW+++   
Sbjct  535   W-VLMCLRSIPELFYCLLPAYCLLRNTALYPKGPCLAITV--TIVVMHCLYTLWQFINNG  591

Query  2156  ESIRAWWNNQRMW  2194
              S+R+W+ +Q +W
Sbjct  592   FSVRSWYVSQSLW  604



>ref|NP_180813.1| cellulose synthase-like protein B4 [Arabidopsis thaliana]
 sp|O80891.1|CSLB4_ARATH RecName: Full=Cellulose synthase-like protein B4; Short=AtCslB4 
[Arabidopsis thaliana]
 gb|AAC25936.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AEC08698.1| cellulose synthase-like protein B4 [Arabidopsis thaliana]
 gb|AHL38820.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=755

 Score =   506 bits (1302),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 271/570 (48%), Positives = 351/570 (62%), Gaps = 34/570 (6%)
 Frame = +2

Query  527   WLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPEL  706
             W++A +CE+ FTF+W+L+ + KW+  +  TYPER  E V     E P VDMFVTTA+P  
Sbjct  51    WIVAFLCETCFTFVWLLITNIKWSPADYKTYPERLDERVH----ELPPVDMFVTTADPVR  106

Query  707   EPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVA  886
             EPP++ VNTVLSLLA+ YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV 
Sbjct  107   EPPLIVVNTVLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVR  166

Query  887   VRAPFRYFNADHTFPPESS--PEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFAT  1051
             VRAPF YF       PE++   EF ++W+    EY  L  K+E AT      +    F  
Sbjct  167   VRAPFMYFRNS----PEAAEGSEFSKDWEMTKREYEKLSQKVEDATGSSHWLDAEDDFEA  222

Query  1052  FADLDPNDHSTIIKVICENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSG  1225
             F +   NDHSTI+KV+ EN   +     VPH++YISREKRP H H++KAGAMN L RVSG
Sbjct  223   FLNTKSNDHSTIVKVVWENKGGVGDEKEVPHVVYISREKRPNHFHHYKAGAMNFLVRVSG  282

Query  1226  VMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYAS  1402
             +MTNAP+MLNVDCD YVN  +VV  AMC FL  + D     FVQ+PQ FYD         
Sbjct  283   LMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQKSMDSNHCAFVQYPQDFYDS-----NVG  337

Query  1403  QYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHD  1555
             +  ++   LGRG A IQG  Y G+GCFH R+V+YGLS +D           T + L +  
Sbjct  338   ELTVLQLYLGRGIAGIQGPQYAGSGCFHTRRVMYGLSLDDLGDDGSLSSIATRKYLAEES  397

Query  1556  LQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRY  1735
             L + +G SK  V S    L      +    L  SLE A ++ +C YE+ T+WG NIGW Y
Sbjct  398   LTREFGNSKEMVKSVVDALQRKPFPQK--NLKDSLETAQEMGHCHYEYQTSWGKNIGWLY  455

Query  1736  GSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK  1915
              S TED+ T IGI   GW + +  P+ P FLGC P  G   + Q +RWA+G  EILF+ +
Sbjct  456   DSTTEDVNTSIGIHSRGWTSSYIFPDPPAFLGCMPQGGPEVMVQQRRWATGLLEILFNKQ  515

Query  1916  CPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVI  2095
              P+       ++FRQ LAY+    W +R I EL Y  LP YCL+ NS   PKG  + I+I
Sbjct  516   SPLIGMFCRKIRFRQSLAYLYVFSWGLRSIPELFYCLLPAYCLLHNSALFPKGVYLGIII  575

Query  2096  PASIFIIYNLYTLWEYMEEKESIRAWWNNQ  2185
               ++  I+ LYTLWE+M    SI++W+  Q
Sbjct  576   --TLVGIHCLYTLWEFMNLGFSIQSWYVTQ  603



>gb|AAC25935.1| putative cellulose synthase [Arabidopsis thaliana]
Length=712

 Score =   504 bits (1297),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 266/573 (46%), Positives = 357/573 (62%), Gaps = 34/573 (6%)
 Frame = +2

Query  527   WLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPEL  706
             W++A +CES+F+FIW+L+ S KW+     +YPER  E V     + P+VDMFVTTA+P  
Sbjct  8     WVVAFLCESFFSFIWLLITSIKWSPASYKSYPERLDERVH----DLPSVDMFVTTADPVR  63

Query  707   EPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVA  886
             EPPIL  NT+LSLLA+ YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN+ 
Sbjct  64    EPPILVANTLLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNIK  123

Query  887   VRAPFRYFNADHTFPPES--SPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFAT  1051
             VRAPFRYF      PP +  S EF ++W+    EY  L  ++E AT         + F  
Sbjct  124   VRAPFRYF----LNPPAATESSEFSKDWEITKREYEKLSRRVEDATGDSHWLDAEDDFED  179

Query  1052  FADLDPNDHSTIIKVICENDESLAV--GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSG  1225
             F++  PNDHSTI+KV+ EN   + V   VPH +YISREKRP + H++KAGAMN L RVSG
Sbjct  180   FSNTKPNDHSTIVKVVWENKGGVGVENEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSG  239

Query  1226  VMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYAS  1402
             +MTNAP+MLNVDCD Y N  +VV  AMC FL  + +     FVQFPQ FYD   D     
Sbjct  240   LMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSMNSNHCAFVQFPQEFYDSNAD-----  294

Query  1403  QYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHD  1555
             +  ++   LGRG A IQG  Y G+GCFH R+V+YGLS +D           T + L + +
Sbjct  295   ELTVLQSYLGRGIAGIQGPTYAGSGCFHTRRVMYGLSIDDLEDDGSLSSLATRKYLAEEN  354

Query  1556  LQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRY  1735
             L + +G S   VTS    L    + +    L+ SLEAA +V +C +E+ T+WG  IGW Y
Sbjct  355   LAREFGNSNEMVTSVVEALQRKPNPQ--NTLANSLEAAQEVGHCHFEYQTSWGKTIGWLY  412

Query  1736  GSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK  1915
              S  ED  T IGI   GW + +  P+ P FLG  P  G  ++ Q +RWA+G  E+LF+ +
Sbjct  413   ESTAEDANTSIGIHSRGWTSSYISPKPPAFLGAMPPGGPEAMLQQRRWATGLLEVLFNKQ  472

Query  1916  CPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVI  2095
              P+       ++FRQ LAY+    W +R I EL Y  LP YCL+ N+   PKG  + IV+
Sbjct  473   SPLIGMFCRKIRFRQSLAYLYIFTWGLRSIPELIYCLLPAYCLLHNAALFPKGVYLGIVV  532

Query  2096  PASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
               ++  ++ LY+LWE+M    S+++W+ +Q  W
Sbjct  533   --TLVGMHCLYSLWEFMSLGFSVQSWFASQSFW  563



>ref|XP_004144501.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=743

 Score =   504 bits (1297),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 282/605 (47%), Positives = 378/605 (62%), Gaps = 22/605 (4%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
             FPLY+       + R+VE++IL+L +SL+ YR+  L SH      LLA   E  FTF W 
Sbjct  5     FPLYQKLAIKKPIQRSVELLILILAISLLLYRLLYLQSHALLS--LLAFFSELCFTFDWF  62

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +   WN V+  TYP+ F +       E PAVD+ VTTA+ +LEP ++  NTVLSLLA+
Sbjct  63    LYLLLNWNPVDYKTYPQHFKQ-----VHEVPAVDVLVTTADWKLEPSVMVANTVLSLLAV  117

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPA KL CY+SDD  SPV  YALVEAS FA++WVPFCKKYNV VRAPFRYF+     P 
Sbjct  118   DYPAGKLTCYISDDGGSPVLLYALVEASNFARIWVPFCKKYNVQVRAPFRYFSGKS--PS  175

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---FATFADLDPNDHSTIIKVICE  1105
                 EF++E K+M DEY  L  KIE A + P ++     +  F + D  +H TIIK++ E
Sbjct  176   AGGHEFQQEEKRMKDEYERLREKIEAAEENPMVYETSKYYEAFRNTDKKNHPTIIKILLE  235

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N  + + G+P+L+Y++REKRP   H +KAGA+NVLTRVSGVMTNAPF++N+DCD YVNNP
Sbjct  236   NKGNDSNGIPNLVYVAREKRPNQPHYYKAGALNVLTRVSGVMTNAPFIVNIDCDMYVNNP  295

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
              VV+ AMC L+GA  E+++ F QFPQ FY+  KDDP+  Q   ++  L RG A IQG  Y
Sbjct  296   NVVVDAMCILVGAT-EKESVFAQFPQVFYNQPKDDPFGCQMITLFQMLLRGMAGIQGPLY  354

Query  1466  DGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGV  1645
              G  CFHRRK IY L+ +   T +      +++ +G+S+    +    L G  SS     
Sbjct  355   SGCNCFHRRKTIYTLNSSQNKTGK------IEENFGESEELTKATDEILRGVKSSTDHTT  408

Query  1646  -LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              LS S+++A QVA+  YE  T WG  +GW YGS+TEDIL GI I   GWK+   +P  P 
Sbjct  409   NLSTSIQSAYQVASANYENNTAWGLKVGWLYGSMTEDILMGIKIHSKGWKSVLVLPNPPA  468

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+G     G  +L Q KRW +G  EIL S   P+    F +L+FRQ LAY   +   +  
Sbjct  469   FMGLASMGGSETLIQRKRWVTGILEILISKNNPLLTFFFTHLKFRQSLAYTYFLTRSLFA  528

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIV-IPASIFIIYNLYT-LWEYMEEKESIRAWW  2176
             I EL YA LP Y ++TNSHFLP   + A++ I    FI+Y+ ++ ++EY++   S+ AWW
Sbjct  529   IPELTYAILPAYAILTNSHFLPSVQDTALLAIFVPTFILYHSHSIIFEYLQWGLSLHAWW  588

Query  2177  NNQRM  2191
             N  RM
Sbjct  589   NKVRM  593



>ref|XP_006293362.1| hypothetical protein CARUB_v10022674mg, partial [Capsella rubella]
 gb|EOA26260.1| hypothetical protein CARUB_v10022674mg, partial [Capsella rubella]
Length=785

 Score =   505 bits (1300),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 279/614 (45%), Positives = 376/614 (61%), Gaps = 35/614 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV++ IL LL SL+ +R+  +  +     W++A  CES F+FIW++
Sbjct  36    PLCERISYTNYFLRAVDLTILGLLFSLLLHRILLMRQNDT--AWVVAFFCESCFSFIWLV  93

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  +  +YP+R  E V     + P+VDMFVTTA+P  EPP++ VNTVLSLLA+ 
Sbjct  94    ITCIKWSPADYKSYPDRLDERVH----DLPSVDMFVTTADPVREPPLMVVNTVLSLLAVN  149

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACY+SDD  S +T+++L EASKFAK+WVPFCKKYNV VRAPFRYF      P  
Sbjct  150   YPANKLACYLSDDGGSSLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYF---LNCPAA  206

Query  938   S-SPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICE  1105
             +   EF ++W+ M  EY  LC K+E AT     F   + F  F++  PNDH TI+KVI E
Sbjct  207   TVGSEFSKDWEMMKSEYEKLCRKVEDATGDCYWFHADDDFKAFSNTKPNDHPTIVKVIWE  266

Query  1106  NDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
             N   +     VPH +YISREKRP + HN+KAGAMNVL R+SG+MTNAP+MLNVDCD Y N
Sbjct  267   NKGGVGDEKEVPHFVYISREKRPNYFHNYKAGAMNVLVRLSGMMTNAPYMLNVDCDMYAN  326

Query  1280  NPEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
               +VV  AMC  L     +  D  FVQ+PQ FYD   D+    Q  +      RG A IQ
Sbjct  327   EADVVGQAMCIFLQKSTMNSNDCAFVQYPQDFYDSNADELIVLQAYV-----SRGIAGIQ  381

Query  1454  GSFYDGTGCFHRRKVIYGL---------SPNDTVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             G  Y G+GCFH R+V+YG+         S +   T + L + +L + +G SK  V ++  
Sbjct  382   GPSYAGSGCFHTRRVMYGIYLDDLDDDGSLSSVATRDYLAEDNLAREFGNSKEMV-TSVV  440

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
                   S+     L+ SLEAA +V +C YE  T+WG  +GW YGS TED+ T +GI   G
Sbjct  441   NALQRKSNRQLSSLTDSLEAAREVGHCHYENQTSWGKTVGWLYGSTTEDVHTSVGIHSRG  500

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMK-CPIFAALFGNLQFRQC  1963
             W + +  P+ P FLG  P  G  ++ Q +RWA+G  EILF+ +  P     F  L+FRQC
Sbjct  501   WTSSYISPDPPAFLGAMPPGGQEAMAQQRRWAAGMLEILFNKRTTPFVGMFFRKLRFRQC  560

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEY  2143
             LAY+  ++W +R I EL Y  LP YCL+ NS   PKG  + ++I  ++  IY LYTLWE+
Sbjct  561   LAYLYVLVWGLRSIPELFYCLLPAYCLLHNSALFPKGVYLGVII--AVVGIYCLYTLWEF  618

Query  2144  MEEKESIRAWWNNQ  2185
             M    ++++W+ +Q
Sbjct  619   MILGFTVQSWFISQ  632



>ref|XP_009141248.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
B3 [Brassica rapa]
Length=753

 Score =   503 bits (1295),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 276/611 (45%), Positives = 369/611 (60%), Gaps = 30/611 (5%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             L+E         R+V++ +L LL SL+ YR+  LH       W++A +CES+FTFIW+L+
Sbjct  11    LFEKISYKRCFLRSVDLTMLGLLFSLLLYRI--LHMSQNDNVWVVAFLCESFFTFIWLLI  68

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
                KW   E   YP+R  E V     E P+VDMFVTTA+P  EPPIL VNTVLSLLA+ Y
Sbjct  69    TCIKWTPAEHKPYPDRLDERVH----ELPSVDMFVTTADPVREPPILVVNTVLSLLAVNY  124

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PANKLACYVSDD  SP+T+++L EA  FAK+WVPFCKKYNV VRAPFRYF   ++   + 
Sbjct  125   PANKLACYVSDDGCSPLTYFSLKEACNFAKIWVPFCKKYNVRVRAPFRYFL--NSLDAKE  182

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDESL  1120
               EF R+W+    EY  L GK+E AT+     + F  F++  PNDHSTI+KV+ EN   +
Sbjct  183   DSEFSRDWEMTKREYEKLSGKVEDATRDWDADDDFEAFSNTKPNDHSTIVKVVWENKGGV  242

Query  1121  A--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
                  +PH +Y+SREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD +VN  +VV
Sbjct  243   GDEKELPHFVYVSREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMFVNEADVV  302

Query  1295  LHAMC-FLLGAKDE-RDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
               AMC FL  +K+      FVQ+PQ FYD         +  ++   L RG A IQGS Y 
Sbjct  303   RQAMCIFLQKSKNSINHCAFVQYPQDFYDS-----NCEELVVLQSHLSRGFAGIQGSIYS  357

Query  1469  GTGCFHRRKVIYGLSPND--------TVTAEKLTDHD-LQKIYGKSKIFVtsatttlsgs  1621
             G+GCFH R+V+YGLS +D        +V A K  D + L + +G SK    S    L   
Sbjct  358   GSGCFHTRRVMYGLSVDDLEEDGSLSSVNARKFLDEESLARKFGSSKEIRKSVANALQRK  417

Query  1622  lssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGF  1801
              +S+   +L+  L+ A +V +C YE   +WG  IGW Y S  ED+ T I I   GW + +
Sbjct  418   SNSQ--NILTNFLDEAREVGHCQYESQKSWGKTIGWLYDSTAEDVNTSIDIHSRGWTSSY  475

Query  1802  CVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMIS  1981
               P+ P FLGC P  G  ++ Q +RW +G  E+LF+   P+       L+FRQ LAY+  
Sbjct  476   IYPDEPAFLGCMPPGGPEAMVQQRRWGTGMLEVLFNKHSPLIGIFSQKLRFRQRLAYIHI  535

Query  1982  ILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKES  2161
               W +R I EL Y  LP YCL+ NS   PKG    I +  ++  ++ +YTLWE+M    S
Sbjct  536   FTWGLRSIPELAYCLLPAYCLLHNSALFPKGLCSGITV--TLVSMHCVYTLWEFMSLGFS  593

Query  2162  IRAWWNNQRMW  2194
             + +W+ +Q  W
Sbjct  594   VHSWYVSQSFW  604



>ref|XP_009141247.1| PREDICTED: cellulose synthase-like protein B3 [Brassica rapa]
Length=759

 Score =   503 bits (1294),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 282/614 (46%), Positives = 370/614 (60%), Gaps = 32/614 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     +   RAV++ IL LL SL+ YR+ ++  +     W++A +CE  FTFIW+L
Sbjct  10    PLCERISYKSRSLRAVDLTILGLLFSLLLYRIRHMSQNDT--VWVVAFLCECCFTFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +  TKW+  E   Y +R  E V     E P+VDMFVTTA+P  EPPIL VNTVLSLLA+ 
Sbjct  68    ITCTKWSPAEHKPYLDRLDERVH----ELPSVDMFVTTADPVREPPILVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  S +T+++L EASKFAK+WVPFCKKYNV VRAPFRYF   +    +
Sbjct  124   YPANKLACYVSDDGCSALTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYFL--NPVDAK  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICEN  1108
                EF R+W+    EY  L  K+E AT         + F   ++  P+DHSTI+KVI EN
Sbjct  182   EDSEFSRDWEMTKREYEKLVQKVEDATGNSYWLDAGDDFEALSNKKPSDHSTIVKVIWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             +E +     VPH +YISREK+P + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y N 
Sbjct  242   EEGVGDEKEVPHFVYISREKKPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYANE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC F+ G+ +     FVQFPQ FYD   D+    Q  +     GRG A IQG 
Sbjct  302   ADVVRQAMCIFMEGSMNPNHCAFVQFPQKFYDSNSDEIVVLQSYV-----GRGFAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GCFH R+V+YGLS +D           T + L    L++ +GKSK  V S    L
Sbjct  357   VYAGSGCFHTRRVMYGLSVDDLEEDRNLSSVATRKLLAAERLERDFGKSKEMVKSVVDAL  416

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 + +    L  S E A  V +C YE+ T+WG  +GW Y S TED  T IGI   GW 
Sbjct  417   QRKSNPQ--DTLINSSEPAQAVGHCHYEYQTSWGKTVGWLYDSTTEDAHTSIGIHSRGWT  474

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  PE P FLGC P  G  ++ Q +RWA+G  EILF+ + P+  +    ++FRQ LAY
Sbjct  475   SSYISPEPPAFLGCMPPGGPEAMLQQRRWATGLLEILFTKQNPLNGSSCKKIRFRQSLAY  534

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +    W +R I EL Y  LP YC++  S   PKG  + IV   ++  ++ LYTLWE+M  
Sbjct  535   LYIFTWGLRSIPELFYCLLPAYCVLHGSALFPKGVCLGIVF--TLVGMHCLYTLWEFMSL  592

Query  2153  KESIRAWWNNQRMW  2194
               S+ +W+ +Q  W
Sbjct  593   GFSVHSWYASQSFW  606



>ref|XP_010413973.1| PREDICTED: cellulose synthase-like protein B2 [Camelina sativa]
Length=749

 Score =   502 bits (1292),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 281/614 (46%), Positives = 368/614 (60%), Gaps = 33/614 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     +   RA ++ IL LL SL+ +R+  LH       WL+A +CES F+ +W+L
Sbjct  10    PLCEKISYKSYFQRAADLTILGLLFSLLLHRI--LHMTQNDNVWLVAFLCESCFSIVWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
                 KW+  ET TYP+R  E V     + P+VD+FV TA+P  EPPI+ VN VLSLLA+ 
Sbjct  68    TTCIKWSPAETKTYPDRIDERVH----DLPSVDIFVPTADPVREPPIIVVNAVLSLLAIN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP NKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF   +     
Sbjct  124   YPTNKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYFL--NPLATT  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQK---PSLFNKFATFADLDPNDHSTIIKVICEN  1108
                EF R+W+    EY  LC K+E AT         + F  F++  PNDHSTI+KVI EN
Sbjct  182   KGSEFSRDWQMTKREYEKLCRKVEIATGDSHWSDADDDFEAFSNTKPNDHSTIVKVIWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y N 
Sbjct  242   KGGVGDVTEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDVYANE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL G+ +     FVQ+PQ  YD   D     Q  ++     RG A IQG 
Sbjct  302   ADVVRQAMCVFLQGSSNPNHCAFVQYPQESYDSTTDTLTVFQSFMV-----RGLAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPNDT---------VTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GCFH R+V+YGLSP D           T E L    L + +G SK  V S    L
Sbjct  357   IYLGSGCFHTRRVMYGLSPEDVEANGSLSSLATRELLAADSLPRGFGNSKEMVKSVVEAL  416

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 + +   +L+ S+EAA +V +C YE+ T WG  IGW Y S+TED+ T I I   GW 
Sbjct  417   QIKSNPQH--ILTNSIEAAQEVGHCDYEYQTNWGKTIGWLYDSMTEDLNTSIDIHSRGWT  474

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  P  P FLG  P+    +L Q +RW +G  E+LF+ + P+       L+FRQ LAY
Sbjct  475   SSYVSPNPPAFLGSMPAEVSEALLQQRRWLTGSMEVLFNKQSPLLGMFRRKLRFRQRLAY  534

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +  +L  +R I EL Y  LP YCL+ NS   PKG  + I+I  ++  +++LYTLWE+M  
Sbjct  535   L-CVLVCLRSIPELFYCLLPAYCLLHNSVLFPKGACLGIII--TLLGMHSLYTLWEFMSL  591

Query  2153  KESIRAWWNNQRMW  2194
               SI++W  +Q +W
Sbjct  592   GYSIQSWLVSQSLW  605



>ref|XP_009141249.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
B3 [Brassica rapa]
Length=753

 Score =   498 bits (1283),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 272/614 (44%), Positives = 371/614 (60%), Gaps = 38/614 (6%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     +   RAV++ IL LL SL+ YR+  ++ +     W++AL+CES F FIW+L
Sbjct  10    PLCERISHKSYFLRAVDLTILGLLFSLLLYRIQRVNEN--ETVWVVALLCESCFLFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  E   +  R  + +     +FP+VDMFVTTA+P  EPPIL VNTVLSLLA+ 
Sbjct  68    ITCIKWSPAEYKPHLHRLDKRLH----DFPSVDMFVTTADPVREPPILVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYNV +          +  P  
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRIXL--------NPLPSS  175

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---FATFADLDPNDHSTIIKVICEN  1108
                EF ++W  M  EY  LC K+E AT      +    F  F++  P DHSTI+K++CEN
Sbjct  176   RDSEFSKDWGLMKTEYEKLCRKVEDATGDSHWLDSDDDFEAFSNTKPTDHSTIVKLVCEN  235

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
              E +     VPH +YISREKR  + H++KAGAMN L RVSG+MTNAP+MLNVDCD YVN 
Sbjct  236   KEGVGDEKEVPHFVYISREKRENYHHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYVNE  295

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL    +     FVQFPQ FYD   D     ++ I+   LGRG A IQG 
Sbjct  296   ADVVRQAMCVFLQKPMNPNHCAFVQFPQDFYDSNAD-----EFIILQSYLGRGIAGIQGP  350

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              + G+GCFH RKV+YGLS +D           T   L +  L + +G SK  V S    L
Sbjct  351   IFTGSGCFHTRKVMYGLSIDDLDDSGSLSSVATKRMLAEGSLAREFGSSKEIVKSVVEAL  410

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
              G  + +    ++ S+E A +V NC YE+ T+WG  IGW Y S+ +D+ T IGI   GW 
Sbjct  411   QGKSNPQQ--TITNSIEIAKEVGNCHYEYQTSWGKTIGWLYDSMADDVNTSIGIHSRGWT  468

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  P+ P FLGC P  G  ++ Q +RW +G  E+ F+ + P+       ++FRQ LAY
Sbjct  469   SSYISPDPPAFLGCMPPMGPVAMVQWQRWGTGMLEVFFNKQSPLMGLFHQKMRFRQRLAY  528

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +   +W +R I EL Y  LP YCL+ NS   PKG  + I++  ++  +++LYTLWE+M  
Sbjct  529   ISISMWGLRSIPELFYCLLPAYCLLHNSALFPKGLCLGIIV--TLLGMHSLYTLWEFMRV  586

Query  2153  KESIRAWWNNQRMW  2194
               S+++W+ +Q +W
Sbjct  587   GFSVQSWYVSQSIW  600



>ref|NP_193264.3| cellulose synthase-like protein B5 [Arabidopsis thaliana]
 sp|Q0WT40.2|CSLB5_ARATH RecName: Full=Cellulose synthase-like protein B5; Short=AtCslB5 
[Arabidopsis thaliana]
 gb|AEE83581.1| cellulose synthase-like protein B5 [Arabidopsis thaliana]
 gb|AHL38695.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=757

 Score =   492 bits (1266),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 263/572 (46%), Positives = 351/572 (61%), Gaps = 32/572 (6%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPE  703
              WLLA  CES F+ +W++    KW+  E   Y     E V     + P++DMFV TA+  
Sbjct  50    VWLLAFFCESCFSLVWLIFTCLKWSPAEDIPYINTLNERVH----DLPSLDMFVPTADTV  105

Query  704   LEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNV  883
              E PI+TVNTVLSLLA+ YPANKLACYVSDD  SP+T+++L EASKF K+W PFCKKYNV
Sbjct  106   RESPIITVNTVLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEASKFVKIWAPFCKKYNV  165

Query  884   AVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATF  1054
              VRAPFRYF        +S   F ++WK M  EY  LC K+E AT         + F  F
Sbjct  166   RVRAPFRYFLNPLVATDDSV--FSKDWKMMKREYVKLCRKVEDATGDSHWLDADDDFEAF  223

Query  1055  ADLDPNDHSTIIKVICENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGV  1228
             ++  PNDHSTI+KV+ EN   +     VPHL+YISREKRP + H++K GAMN L RVSG+
Sbjct  224   SNTKPNDHSTIVKVVWENKGGVGDEKEVPHLVYISREKRPNYLHHYKTGAMNFLLRVSGL  283

Query  1229  MTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             MTNAP+ LNVDCD Y N P+VV  AMC FL  +K+     FVQFPQ FYD      Y ++
Sbjct  284   MTNAPYTLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFYDS-----YTNE  338

Query  1406  YKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDL  1558
               ++   LGRG A IQG FY GTGCFH R+V+YGLS +D           T E L +  L
Sbjct  339   LAVLQSILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVATREFLAEDSL  398

Query  1559  QKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYG  1738
              + YG SK  V S    L    + +    L+  +EAA +V +C YE+ T+WG N+GW Y 
Sbjct  399   VRKYGNSKELVKSVVDALQRKSNPQK--SLANLIEAAQEVGHCHYEYQTSWG-NLGWMYD  455

Query  1739  SVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKC  1918
             SV EDI T +GI   GW + F  P+ P F+G TP+ GL ++ Q +RWA+G  E+LF+ + 
Sbjct  456   SVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIEVLFNKQS  515

Query  1919  PIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP  2098
             P      G ++FRQ LAY  +++  +R I EL Y  LP YCL+ +S   PKG  +  ++ 
Sbjct  516   PFMGMFHGKIKFRQRLAYFWALMC-LRSIPELIYCLLPAYCLLHDSALFPKGPCLCTIV-  573

Query  2099  ASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
              ++  ++ LY+LW++M    S+++W+  Q +W
Sbjct  574   -TLVGMHCLYSLWQFMSLGFSVQSWYVVQSLW  604



>ref|XP_010657348.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=551

 Score =   484 bits (1245),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 263/462 (57%), Positives = 333/462 (72%), Gaps = 24/462 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL+E   + N   RA+++ I  LLLSL+AYR+ +L ++G+  TWLLA +CESWFTFIW+L
Sbjct  8     PLHEKFPQKNTFHRALDLTIFFLLLSLLAYRLLSLKNNGF--TWLLAFLCESWFTFIWIL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              VSTKWN V   TYPER L+       E P VDMFVTTA+P LEPPI+TVNTVLSLLA++
Sbjct  66    NVSTKWNPVSYKTYPERLLQCYRVD--ELPPVDMFVTTADPMLEPPIITVNTVLSLLAVD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKL+CYVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF+ +     +
Sbjct  124   YPANKLSCYVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYFSRELLPSHD  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFAT-----FADLDPNDHSTIIKVIC  1102
             +S EF +E++K+ DEY  L  +IE+AT K S+ ++ +T     F+++    H TIIKVI 
Sbjct  184   NSTEFLQEYRKIMDEYEELRRRIEHATLK-SISHELSTADFVAFSNIKKGSHPTIIKVIL  242

Query  1103  ENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
             EN ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NN
Sbjct  243   ENKESRSDGLPHLVYVSREKDPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANN  302

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
             P++  HAMC LLG+K+E+D GFVQ PQ FYDGLKDDP+ +Q  ++Y  LG G A +QG  
Sbjct  303   PQIFHHAMCLLLGSKNEQDCGFVQSPQCFYDGLKDDPFGNQLVVLYKYLGSGIAGLQGPT  362

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslss  1630
             Y GTGCFHRRKVIYGL P+  +  +    KLTD  +QK +G SK F  +A   LSG    
Sbjct  363   YIGTGCFHRRKVIYGLWPDGRMEIKGRSGKLTDERIQKTFGNSKEFTKTAARILSGLSGI  422

Query  1631  et--FGVLSYSLEAASQVANCGYEFGTTWG-------HNIGW  1729
                 + +L+  +EAA +VA C YE+GT+WG        ++GW
Sbjct  423   SHCPYDLLN-RVEAAQEVATCSYEYGTSWGTKDFGVSRSLGW  463



>dbj|BAE99708.1| cellulose synthase like protein [Arabidopsis thaliana]
Length=757

 Score =   490 bits (1262),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 262/572 (46%), Positives = 351/572 (61%), Gaps = 32/572 (6%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPE  703
              WLLA  CES F+ +W++    KW+  E   Y     E V     + P++DMFV TA+  
Sbjct  50    VWLLAFFCESCFSLVWLIFTCLKWSPAEDIPYINTLNERVH----DLPSLDMFVPTADTV  105

Query  704   LEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNV  883
              E PI+TVNTVLSLLA+ YPANKLACYVSDD  SP+T+++L EASKF K+W PFCKKYNV
Sbjct  106   RESPIITVNTVLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEASKFVKIWAPFCKKYNV  165

Query  884   AVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATF  1054
              VRAPFRYF        +S   F ++WK M  EY  LC K+E AT         + F  F
Sbjct  166   RVRAPFRYFLNPLVATDDSV--FSKDWKMMKREYVKLCRKVEDATGDSHWLDADDDFEAF  223

Query  1055  ADLDPNDHSTIIKVICENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGV  1228
             ++  PNDHSTI+KV+ EN   +     VPHL++ISREKRP + H++K GAMN L RVSG+
Sbjct  224   SNTKPNDHSTIVKVVWENKGGVGDEKEVPHLVHISREKRPNYLHHYKTGAMNFLLRVSGL  283

Query  1229  MTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             MTNAP+ LNVDCD Y N P+VV  AMC FL  +K+     FVQFPQ FYD      Y ++
Sbjct  284   MTNAPYTLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFYDS-----YTNE  338

Query  1406  YKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDL  1558
               ++   LGRG A IQG FY GTGCFH R+V+YGLS +D           T E L +  L
Sbjct  339   LAVLQSILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVATREFLAEDSL  398

Query  1559  QKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYG  1738
              + YG SK  V S    L    + +    L+  +EAA +V +C YE+ T+WG N+GW Y 
Sbjct  399   VRKYGNSKELVKSVVDALQRKSNPQK--SLANLIEAAQEVGHCHYEYQTSWG-NLGWMYD  455

Query  1739  SVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKC  1918
             SV EDI T +GI   GW + F  P+ P F+G TP+ GL ++ Q +RWA+G  E+LF+ + 
Sbjct  456   SVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIEVLFNKQS  515

Query  1919  PIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIP  2098
             P      G ++FRQ LAY  +++  +R I EL Y  LP YCL+ +S   PKG  +  ++ 
Sbjct  516   PFMGMFHGKIKFRQRLAYFWALMC-LRSIPELIYCLLPAYCLLHDSALFPKGPCLCTIV-  573

Query  2099  ASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
              ++  ++ LY+LW++M    S+++W+  Q +W
Sbjct  574   -TLVGMHCLYSLWQFMSLGFSVQSWYVVQSLW  604



>emb|CDP20180.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   478 bits (1230),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/378 (63%), Positives = 280/378 (74%), Gaps = 14/378 (4%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE K     + R +E+ IL L  SL+ YR+ +L +HG+   WL+AL+CESWFTFIW++
Sbjct  8     PLYERKHLTKIIPRLIELTILFLCFSLLGYRLLHLKNHGF--IWLVALLCESWFTFIWIV  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             VV+ KWN +   T+PER L+     + E P +DMFVTTA+P LEPPI+TVNTV+SLL+++
Sbjct  66    VVNIKWNPIAIKTHPERLLQ----RNLELPPLDMFVTTADPVLEPPIITVNTVISLLSVD  121

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACY+SDD+ASP+T++ LVEAS+FAKLW+PFCKKYNV VRAPFRYF+    F   
Sbjct  122   YPANKLACYLSDDAASPLTYFCLVEASEFAKLWIPFCKKYNVPVRAPFRYFSDQSLFTGN  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICEN  1108
             SS EF+ +W  M DEY  LC KIE A QK     L   FA F D+D   H TIIKVI EN
Sbjct  182   SSSEFQEDWNTMKDEYRRLCQKIEEAAQKSVPCELTGDFAAFVDIDKRSHPTIIKVISEN  241

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E L  G+P ++YISREKRP H H+FKAGAMNVL RVSGVMTNAPFMLNVDCD + NNP+
Sbjct  242   KEGLPDGLPPIVYISREKRPNHAHHFKAGAMNVLARVSGVMTNAPFMLNVDCDMFANNPQ  301

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             VVLHAMC LLG KDE D GFVQFPQ FYDGLKDDP+ +Q       LGRG A  QG  Y 
Sbjct  302   VVLHAMCLLLGVKDETDCGFVQFPQQFYDGLKDDPFGNQMY-----LGRGLAGHQGPLYG  356

Query  1469  GTGCFHRRKVIYGLSPND  1522
             GTGCFHRRKVIYG SP D
Sbjct  357   GTGCFHRRKVIYGSSPED  374



>gb|KDP24850.1| hypothetical protein JCGZ_24444 [Jatropha curcas]
Length=440

 Score =   478 bits (1229),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 292/382 (76%), Gaps = 12/382 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE   R N + R +++ IL LL SLI YR+  L +HG+  +WLLAL+CESWFTF+WVL
Sbjct  8     PLYEKYSRKNHIHRVLDICILFLLTSLIVYRLLTLKNHGF--SWLLALLCESWFTFVWVL  65

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              VSTKWN V+  TYPER  + VE      PAVDMFVTTA+P LEPPI+T+NTV+SLLA++
Sbjct  66    TVSTKWNPVDYKTYPERLPQRVEKF---LPAVDMFVTTADPVLEPPIITMNTVISLLAVD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFP--  931
             YPANKLACY+SDD  SP+TFY+L+E SKFAKLWVPFCKKYN+ VRAPFRYF++    P  
Sbjct  123   YPANKLACYLSDDGCSPLTFYSLLETSKFAKLWVPFCKKYNIEVRAPFRYFSSTDHKPVL  182

Query  932   --PESSPEFRREWKKMNDEYANLCGKIEYATQKPS---LFNKFATFADLDPNDHSTIIKV  1096
                 SS EF++EWKKM DEY  L  KI+ A +K +   L   FA F+ ++  +H TIIK+
Sbjct  183   CSDASSLEFQQEWKKMKDEYEELSCKIQDAAKKSTPCDLTGDFAFFSKIECKNHPTIIKI  242

Query  1097  ICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             + EN E L+ G+ HLIY+SREKRP H H++KAGAMNVLTRVSG++TNAPFMLN+DCD + 
Sbjct  243   MWENKEGLSNGLAHLIYVSREKRPNHPHHYKAGAMNVLTRVSGLITNAPFMLNMDCDMFA  302

Query  1277  NNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
             NNP++V HAMCF LG+K+E DT FVQ PQ FYDGLKDDP+ +Q  ++   +GRG  A+QG
Sbjct  303   NNPQIVRHAMCFFLGSKNEGDTAFVQTPQIFYDGLKDDPFGNQLVVLQEYIGRGIVALQG  362

Query  1457  SFYDGTGCFHRRKVIYGLSPND  1522
              FY GTGCFHRRKVIYGL PND
Sbjct  363   PFYGGTGCFHRRKVIYGLCPND  384



>ref|NP_180820.2| cellulose synthase-like protein B1 [Arabidopsis thaliana]
 sp|O80898.2|CSLB1_ARATH RecName: Full=Cellulose synthase-like protein B1; Short=AtCslB1 
[Arabidopsis thaliana]
 gb|AEC08705.1| cellulose synthase-like protein B1 [Arabidopsis thaliana]
 gb|AHL38819.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=757

 Score =   486 bits (1250),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 273/614 (44%), Positives = 370/614 (60%), Gaps = 32/614 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV + +L L  SL+ +R+   H+  Y   WL+A  CES F  + +L
Sbjct  10    PLCERISYTNYFLRAVYLTVLGLFFSLLLHRI--RHTSEYDNVWLVAFFCESCFFLVCLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  +T  +P+R  E V     + P+VDMFV TA+P  EPPI+ V+TVLSLLA+ 
Sbjct  68    ITCLKWSPADTKPFPDRLDERVH----DLPSVDMFVPTADPVREPPIMVVDTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN  VRAP RYF    +   E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNTRVRAPSRYFLKPISVATE  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEN  1108
                EF R+W+K   EY  L  K+E AT    +    + F  F++  PNDHST++KV+ EN
Sbjct  184   DY-EFNRDWEKTKREYEKLRRKVEDATGDSHMLDVEDDFEAFSNTKPNDHSTLVKVVWEN  242

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     +PH+IYISREKRP + HN K GAMN L RVSG+MTNAP++LNVDCD Y N+
Sbjct  243   KGGVGDEKEIPHIIYISREKRPNYVHNQKCGAMNFLARVSGLMTNAPYILNVDCDMYAND  302

Query  1283  PEVVLHAMCFLLGAK-DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC LL    + +   FVQF Q FYD   +        ++   LGRG A IQG 
Sbjct  303   ADVVRQAMCILLQESLNMKHCAFVQFRQEFYDSSTE-----LIVVLQSHLGRGIAGIQGP  357

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GC H R+V+YGLSP+D           T E L    L + +G SK  + S    +
Sbjct  358   IYIGSGCVHTRRVMYGLSPDDFEVDGSLSSVATREFLVKDSLARRFGNSKEMMKSVVDAI  417

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
               + + +   +L+ S+EAA +V +C YE+ T+WG+ IGW Y SV ED+ T IGI   GW 
Sbjct  418   QRNPNPQ--NILTNSIEAAREVGHCQYEYQTSWGNTIGWLYDSVAEDLNTSIGIHSRGWT  475

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  P+ P FLG  P+    +L Q +RWA+G  EILF+ + P+       ++FRQ LAY
Sbjct  476   SSYISPDTPAFLGSMPAGVPEALLQQRRWATGWIEILFNKQSPLRGLFSKKIRFRQRLAY  535

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +  I+  +R I EL Y  LP YCL+ NS   PKG  + I +  ++  I+ LYTLWE+M  
Sbjct  536   L-CIITCLRSIPELIYCLLPAYCLLHNSTLFPKGLYLGITV--TLVGIHCLYTLWEFMSL  592

Query  2153  KESIRAWWNNQRMW  2194
               S+++W  +Q +W
Sbjct  593   GYSVQSWLVSQSVW  606



>ref|XP_006285915.1| hypothetical protein CARUB_v10007426mg [Capsella rubella]
 gb|EOA18813.1| hypothetical protein CARUB_v10007426mg [Capsella rubella]
Length=761

 Score =   485 bits (1249),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 284/617 (46%), Positives = 371/617 (60%), Gaps = 35/617 (6%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PL E     + V R V++ IL LL SL++YR+  LH   Y   WL+A +CES F FIW+
Sbjct  9     LPLCEKISHKSYVLRTVDLTILGLLFSLLSYRI--LHMSQYDNAWLVAFLCESIFLFIWL  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             +++  KW+  E   YP R  E V +   + P VDMFV TA+P  EPPI+ VNTVLSLLAL
Sbjct  67    IIICVKWSPAEDKPYPNRLAERVHDH--DLPLVDMFVPTADPVREPPIIVVNTVLSLLAL  124

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP NKLACYVSDD  SP+TF++L EASKFAK+WVPFCKKYNV VRAPFRYF        
Sbjct  125   DYPPNKLACYVSDDGCSPLTFFSLREASKFAKIWVPFCKKYNVRVRAPFRYFLNPLDLTD  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF----NKFATFADLDPNDHSTIIKVIC  1102
             +S   F ++W+    EY  LC K+E AT          + F  F++  PNDHSTI+KV+ 
Sbjct  185   DSV--FIKDWEMTKREYEKLCRKVEDATGDSHWLEDANDDFEAFSNAKPNDHSTIVKVVW  242

Query  1103  ENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             EN   +     VPHL+Y+SREKRP   H++K GAMN L RVSG+MTNAP+MLNVDCD Y 
Sbjct  243   ENKAGVGDEKEVPHLVYVSREKRPNCLHHYKTGAMNYLLRVSGLMTNAPYMLNVDCDMYA  302

Query  1277  NNPEVVLHAMCFLL--GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAI  1450
             N  +VV  AMC  L    +      FVQFPQ FY+      Y  +   +   +GRG A I
Sbjct  303   NEADVVRQAMCVFLQDSKQSNHHCAFVQFPQEFYNA-----YTIELSFLQSYIGRGIAGI  357

Query  1451  QGSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsat  1603
             QG  Y G+GCFH R+V+YGLS +D           T E L +  L + YG SK  V S  
Sbjct  358   QGPIYCGSGCFHTRRVMYGLSTDDLEDNGSLSLVATREFLAEESLVRKYGSSKELVKSVV  417

Query  1604  ttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRM  1783
               L    + +    L+  +EAA +V +C YE  T+WG N+GW YGSV +D  T IGI   
Sbjct  418   HALQRKSNPQ--SNLTNFIEAAQEVGHCHYENQTSWG-NLGWLYGSVGDDTNTSIGIHMR  474

Query  1784  GWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQC  1963
             GW + F  P  P FLG  PS GL ++ Q +RWA+G  EILF+ + P F      ++FRQ 
Sbjct  475   GWTSSFVSPNPPAFLGSMPSVGLETIVQQRRWATGVAEILFNKQSP-FIGFRRKIKFRQR  533

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEY  2143
             LAY   +L  +R I EL Y+ LP YCL+ NS   PKG  + I +  ++  +Y  Y+LW++
Sbjct  534   LAYFF-VLVSLRSIPELIYSVLPAYCLLHNSTLFPKGPCLGITV--TLVGMYCQYSLWQF  590

Query  2144  MEEKESIRAWWNNQRMW  2194
             M    S+++W+ +Q +W
Sbjct  591   MRLGFSLQSWYVSQSLW  607



>ref|XP_002879400.1| hypothetical protein ARALYDRAFT_320998 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55659.1| hypothetical protein ARALYDRAFT_320998 [Arabidopsis lyrata subsp. 
lyrata]
Length=750

 Score =   484 bits (1247),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 272/614 (44%), Positives = 373/614 (61%), Gaps = 32/614 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV + IL L  SL+++R+   H   Y   W +A  CE+ F+ + +L
Sbjct  10    PLCERISYANYFLRAVYLTILGLFFSLLSHRI--RHMSEYDTVWRVAFFCETCFSLVCLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  +T  +P+R  E V     + P+VDMFV TA+P  EPPI+ V+TVLSLLA+ 
Sbjct  68    ITCLKWSPADTKPFPDRLDERVH----DLPSVDMFVPTADPVREPPIMVVDTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPAN+LACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN+ VRAPFRYF    +   E
Sbjct  124   YPANRLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNIRVRAPFRYFLNPISDVTE  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEN  1108
              S EF ++W+    EY  L  K+E AT    L    + F  F++   NDHSTI+KV+ EN
Sbjct  184   GS-EFSKDWETTKREYQKLSRKVEDATGDSHLLDVEDDFEAFSNTKSNDHSTIVKVVWEN  242

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH++YISREKRP + H+ K GAMN L RVSG+MTNAP++LNVDCD Y N+
Sbjct  243   KGGVGDEKEVPHIVYISREKRPNYLHHQKCGAMNFLARVSGLMTNAPYILNVDCDMYAND  302

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  A+C FL  + + +   FVQF Q FYD        SQ  ++   LGRG A IQG 
Sbjct  303   ADVVRQAICIFLEKSLNPKHCAFVQFLQEFYDS-----NTSQIVVLQSYLGRGIAGIQGP  357

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GC H R+V+YGLSP+D           T E L +  L + +G SK  V S    +
Sbjct  358   IYIGSGCVHTRRVMYGLSPDDLEGDGSLSLVATREFLVEDSLARRFGNSKEMVKSVVGAI  417

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
               + + +   +L+ S+EAA +V +C YE+ T+WG+ IGW Y SV ED+ T IGI   GW 
Sbjct  418   QRNPNPQ--NILTNSIEAAQEVGHCHYEYQTSWGNTIGWLYDSVAEDLNTSIGIHSRGWT  475

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +  P+ P FLG  P     +L Q +RWA+G  EILF+ + P+       ++FRQ LAY
Sbjct  476   SSYISPDTPAFLGSMPQGVPEALLQQRRWATGWIEILFNKQSPLRGMFCKKIRFRQRLAY  535

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +  I+  +R I EL Y  LP YCL+ NS   PKG  + I I  ++  ++ LYTLWE++  
Sbjct  536   L-CIITSLRSIPELIYCLLPAYCLLHNSALFPKGTYLGITI--TLVGMHCLYTLWEFVNL  592

Query  2153  KESIRAWWNNQRMW  2194
               S+++W  +Q +W
Sbjct  593   GYSVQSWLVSQSVW  606



>ref|XP_006296344.1| hypothetical protein CARUB_v10025516mg [Capsella rubella]
 gb|EOA29242.1| hypothetical protein CARUB_v10025516mg [Capsella rubella]
Length=751

 Score =   482 bits (1240),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 275/618 (44%), Positives = 371/618 (60%), Gaps = 42/618 (7%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     +   RAV + IL L  +L+ +R  N+  +     WL+A +CES F+ + +L
Sbjct  10    PLCERISYKSYYLRAVYLTILGLFFTLLLHRFQNVRENDN--VWLVASLCESCFSLVCLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW   ET  YP+R    V     + P+VD+FV T + E EPPI+ +NTVLSLLA+ 
Sbjct  68    LTCLKWTPAETKPYPDRLDARVH----DLPSVDIFVPTEDHEREPPIMVINTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF----NADHT  925
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKY+V VRAPFRYF     A  +
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYSVRVRAPFRYFLNRPAATES  183

Query  926   FPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF--NKFATFADLDPNDHSTIIKVI  1099
             F      +F ++W+ M  EY  LC  +E AT    L+  + F  F++ +PNDHSTI+KV+
Sbjct  184   F------KFSKDWEIMKREYEKLCRIVEDATGDSRLYAEDDFEAFSNTEPNDHSTIVKVV  237

Query  1100  CENDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFY  1273
              EN+        VPH +YISREKRP + H+ K GAMN L RVSG+MTNAP++LNVDCD Y
Sbjct  238   WENEGGGGDEKEVPHFVYISREKRPNNVHHHKCGAMNFLARVSGLMTNAPYILNVDCDMY  297

Query  1274  VNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAI  1450
              N  +VV  AMC FL  + +     FVQFPQ FYD   D     Q  ++   L RG A I
Sbjct  298   ANEADVVRLAMCVFLEKSLNPNHCAFVQFPQHFYDSNTD-----QLTVLQSYLVRGIAGI  352

Query  1451  QGSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsat  1603
             QG  Y GTGCFH R+ +Y LSP+D           T E L +  L + +G SK  + S  
Sbjct  353   QGPMYVGTGCFHTRRAMYNLSPDDLEDDGSLSSVATRELLCEDKLARGFGNSKEMMKSVA  412

Query  1604  ttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRM  1783
               L    + +    L+ S+EAA +V +C YE  T+WG  IGW Y SV ED+ T IGI   
Sbjct  413   DALQRKPNPQ--NNLTNSIEAAQEVGHCHYEHQTSWGKTIGWLYDSVAEDLNTSIGIHSR  470

Query  1784  GWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQC  1963
             GW + +  P+ P FLG TP  G  ++ Q +RWA+G  E+LF+ + P+       L+FRQ 
Sbjct  471   GWTSSYISPDTPAFLGSTPPGGPEAMLQQRRWATGWIEVLFNKQSPLLGMFRRKLRFRQR  530

Query  1964  LAYM-ISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWE  2140
             LAY+ +S+   +R I EL Y  LP YCL+ NS   PKG  + I I  ++  ++ +YTLWE
Sbjct  531   LAYLCVSVC--LRSIPELLYCLLPSYCLLHNSTLFPKGLYLGITI--TLVGMHCIYTLWE  586

Query  2141  YMEEKESIRAWWNNQRMW  2194
             +M    S+R+W+ +Q +W
Sbjct  587   FMSLGYSVRSWYVSQSLW  604



>gb|EEC77287.1| hypothetical protein OsI_15924 [Oryza sativa Indica Group]
Length=762

 Score =   480 bits (1236),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 260/576 (45%), Positives = 332/576 (58%), Gaps = 63/576 (11%)
 Frame = +2

Query  527   WLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSC------EFPAVDMFVT  688
             W +ALVCE+WF  +  L VS KW+ V   T PE  +      S       E PAVDM VT
Sbjct  83    WRVALVCEAWFAALCALNVSAKWSPVRFVTRPENLVAEGRTPSTTAAEYGELPAVDMLVT  142

Query  689   TANPELEPPILTVNTVLSLLALEYP--ANKLACYVSDDSASPVTFYALVEASKFAKLWVP  862
             TA+P LEPP++TVNTVLSLLAL+YP    +LACYVSDD  SP+T +AL EA+ FA  WVP
Sbjct  143   TADPALEPPLVTVNTVLSLLALDYPRAGERLACYVSDDGCSPLTCHALREAAGFAAAWVP  202

Query  863   FCKKYNVAVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF  1036
             FC++Y VAVRAPFRYF++  +      +  +F  +W  M DEY  L  +I+   ++  L 
Sbjct  203   FCRRYGVAVRAPFRYFSSSSSPESGGPADRKFLDDWTFMKDEYDKLVRRIKNTDERSLLR  262

Query  1037  NK----FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMN  1204
             +     FA F +++  +H TI+K                                     
Sbjct  263   HGGGEFFAEFLNVERRNHPTIVK-------------------------------------  285

Query  1205  VLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLK  1384
               TRVS VMTNAP MLN+DCD +VNNP+ VLHAMC LLG  DE  +GFVQ PQ FYD LK
Sbjct  286   --TRVSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALK  343

Query  1385  DDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN-------DTVTAEKL  1543
             DDP+ +Q +  +     G   +QG+FY GTGCFHRRK +YG+ PN       DT+ +   
Sbjct  344   DDPFGNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSY  403

Query  1544  TDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNI  1723
                +L   +G S+    SA   +    S     + S  +E A  V+ C Y+ GT WG  +
Sbjct  404   --KELHTRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEV  460

Query  1724  GWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEIL  1903
             GW YGS+TEDILTG  I  MGW++   V E P F+G  P  G   L Q KRWA+G +EI+
Sbjct  461   GWVYGSLTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEII  520

Query  1904  FSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEV  2083
              S   PI A +F  L+FRQCLAY+I + WP+R  FELCY  L PYC++TN  FLPK +E 
Sbjct  521   ISRNNPILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASED  580

Query  2084  AIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
                +P ++FI YN Y   EYM    S RAWWNN RM
Sbjct  581   GFSVPLALFISYNTYNFMEYMACGLSARAWWNNHRM  616



>sp|Q7PC71.1|CSLH2_ORYSI RecName: Full=Cellulose synthase-like protein H2; AltName: Full=OsCslH2 
[Oryza sativa Indica Group]
 tpg|DAA01748.1| TPA_exp: cellulose synthase-like H2 [Oryza sativa (indica cultivar-group)]
Length=762

 Score =   480 bits (1235),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 260/577 (45%), Positives = 332/577 (58%), Gaps = 63/577 (11%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSC------EFPAVDMFV  685
              W +ALVCE+WF  +  L VS KW+ V   T PE  +      S       E PAVDM V
Sbjct  82    VWRVALVCEAWFAALCALNVSAKWSPVRFVTRPENLVAEGRTPSTTAAEYGELPAVDMLV  141

Query  686   TTANPELEPPILTVNTVLSLLALEYP--ANKLACYVSDDSASPVTFYALVEASKFAKLWV  859
             TTA+P LEPP++TVNTVLSLLAL+YP    +LACYVSDD  SP+T +AL EA+ FA  WV
Sbjct  142   TTADPALEPPLVTVNTVLSLLALDYPRAGERLACYVSDDGCSPLTCHALREAAGFAAAWV  201

Query  860   PFCKKYNVAVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEYATQKPSL  1033
             PFC++Y VAVRAPFRYF++  +      +  +F  +W  M DEY  L  +I+   ++  L
Sbjct  202   PFCRRYGVAVRAPFRYFSSSSSPESGGPADRKFLDDWTFMKDEYDKLVRRIKNTDERSLL  261

Query  1034  FNK----FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAM  1201
              +     FA F +++  +H TI+K                                    
Sbjct  262   RHGGGEFFAEFLNVERRNHPTIVK------------------------------------  285

Query  1202  NVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGL  1381
                TRVS VMTNAP MLN+DCD +VNNP+ VLHAMC LLG  DE  +GFVQ PQ FYD L
Sbjct  286   ---TRVSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDAL  342

Query  1382  KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN-------DTVTAEK  1540
             KDDP+ +Q +  +     G   +QG+FY GTGCFHRRK +YG+ PN       DT+ +  
Sbjct  343   KDDPFGNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSS  402

Query  1541  LTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHN  1720
                 +L   +G S+    SA   +    S     + S  +E A  V+ C Y+ GT WG  
Sbjct  403   Y--KELHTRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQE  459

Query  1721  IGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEI  1900
             +GW YGS+TEDILTG  I  MGW++   V E P F+G  P  G   L Q KRWA+G +EI
Sbjct  460   VGWVYGSLTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEI  519

Query  1901  LFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNE  2080
             + S   PI A +F  L+FRQCLAY+I + WP+R  FELCY  L PYC++TN  FLPK +E
Sbjct  520   IISRNNPILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASE  579

Query  2081  VAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
                 +P ++FI YN Y   EYM    S RAWWNN RM
Sbjct  580   DGFSVPLALFISYNTYNFMEYMACGLSARAWWNNHRM  616



>ref|NP_001052811.2| Os04g0429500 [Oryza sativa Japonica Group]
 sp|Q7XUT9.3|CSLH2_ORYSJ RecName: Full=Cellulose synthase-like protein H2; AltName: Full=OsCslH2 
[Oryza sativa Japonica Group]
 emb|CAD41009.3| OSJNBa0042L16.13 [Oryza sativa Japonica Group]
 dbj|BAF14725.2| Os04g0429500 [Oryza sativa Japonica Group]
Length=762

 Score =   480 bits (1235),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 260/577 (45%), Positives = 332/577 (58%), Gaps = 63/577 (11%)
 Frame = +2

Query  524   TWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSC------EFPAVDMFV  685
              W +ALVCE+WF  +  L VS KW+ V   T PE  +      S       E PAVDM V
Sbjct  82    VWRVALVCEAWFAALCALNVSAKWSPVRFVTRPENLVAEGRTPSTTAAEYGELPAVDMLV  141

Query  686   TTANPELEPPILTVNTVLSLLALEYP--ANKLACYVSDDSASPVTFYALVEASKFAKLWV  859
             TTA+P LEPP++TVNTVLSLLAL+YP    +LACYVSDD  SP+T +AL EA+ FA  WV
Sbjct  142   TTADPALEPPLVTVNTVLSLLALDYPRAGERLACYVSDDGCSPLTCHALREAAGFAAAWV  201

Query  860   PFCKKYNVAVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEYATQKPSL  1033
             PFC++Y VAVRAPFRYF++  +      +  +F  +W  M DEY  L  +I+   ++  L
Sbjct  202   PFCRRYGVAVRAPFRYFSSSSSPESGGPADRKFLDDWTFMKDEYDKLVRRIKNTDERSLL  261

Query  1034  FNK----FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAM  1201
              +     FA F +++  +H TI+K                                    
Sbjct  262   RHGGGEFFAEFLNVERRNHPTIVK------------------------------------  285

Query  1202  NVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGL  1381
                TRVS VMTNAP MLN+DCD +VNNP+ VLHAMC LLG  DE  +GFVQ PQ FYD L
Sbjct  286   ---TRVSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDAL  342

Query  1382  KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN-------DTVTAEK  1540
             KDDP+ +Q +  +     G   +QG+FY GTGCFHRRK +YG+ PN       DT+ +  
Sbjct  343   KDDPFGNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSS  402

Query  1541  LTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHN  1720
                 +L   +G S+    SA   +    S     + S  +E A  V+ C Y+ GT WG  
Sbjct  403   Y--KELHTRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQE  459

Query  1721  IGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEI  1900
             +GW YGS+TEDILTG  I  MGW++   V E P F+G  P  G   L Q KRWA+G +EI
Sbjct  460   VGWVYGSLTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEI  519

Query  1901  LFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNE  2080
             + S   PI A +F  L+FRQCLAY+I + WP+R  FELCY  L PYC++TN  FLPK +E
Sbjct  520   IISRNNPILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASE  579

Query  2081  VAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
                 +P ++FI YN Y   EYM    S RAWWNN RM
Sbjct  580   DGFSVPLALFISYNTYNFMEYMACGLSARAWWNNHRM  616



>ref|XP_004158578.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
H1-like [Cucumis sativus]
Length=675

 Score =   475 bits (1222),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 262/599 (44%), Positives = 342/599 (57%), Gaps = 70/599 (12%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE      +  R +++ I +LL+SL  YRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPLYEKTNIKRSTQRVLDITIFILLVSLDGYRVLLIYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L +  KWN V   TYP+R L+       E PAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIIIKWNPVYYETYPQRLLK----REVELPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YP+NKL CYVSDD  S +T YAL                                    
Sbjct  121   DYPSNKLGCYVSDDGCSSLTLYAL------------------------------------  144

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDE  1114
                    +E  K    +   C K E   + P                      VI EN E
Sbjct  145   -------KEALKFGKIWVPFCXKYEIQVRAPF---------------------VIWENKE  176

Query  1115  SLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
              +   +P LIY+SREK P+  H++KAGAMNVLTRVSGVMTNAP+MLN+DCD +VNNP+V+
Sbjct  177   GVRDELPALIYVSREKNPQIPHHYKAGAMNVLTRVSGVMTNAPYMLNLDCDMFVNNPDVL  236

Query  1295  LHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
             L AMC LL    +++  FVQFPQTFY+GLKDDP+ +Q+ +    L  G A +QG  Y GT
Sbjct  237   LQAMCLLLHPTIDKEYAFVQFPQTFYNGLKDDPFGNQWIVTMQILIHGQAGVQGPMYMGT  296

Query  1475  GCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSY  1654
             GC HRRKV+YG SP +     K  +  L K +G SK FV SA  +L           LS 
Sbjct  297   GCIHRRKVLYGQSPKEANVDAKYNEEKLYKTFGNSKDFVKSAIRSLRSFADDS--NCLSS  354

Query  1655  SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGC  1834
             S+++  +VA   YE    WG  +GW+YGS+ ED+LTG+ I + GWK+ +  P  P FLGC
Sbjct  355   SIKSTYEVATADYEHNNAWGSEVGWKYGSIVEDVLTGMEIHKKGWKSAYITPTPPAFLGC  414

Query  1835  TPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFEL  2014
              P  G   L+  KR  +G  EIL S   PI  AL   LQFRQ L YM + L     I+E+
Sbjct  415   APLGGPVPLSHHKRAMTGLLEILISKNSPILTALSDKLQFRQRLMYMWAYLIGFGAIWEI  474

Query  2015  CYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             CYA LP +CLI+NSHFLPK  E  I +P  +F++  L  L ++ +  +S+RAWWNN RM
Sbjct  475   CYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLLKLRMLLDFFKTGQSVRAWWNNLRM  533



>gb|KFK31114.1| hypothetical protein AALP_AA6G069800 [Arabis alpina]
Length=808

 Score =   478 bits (1231),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 271/608 (45%), Positives = 364/608 (60%), Gaps = 31/608 (5%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     + V RA+++ +L LL SL+ YR+ +++ +G    W++A +CES FTF+W+L
Sbjct  10    PLCERLSYKSYVVRAMDLTVLGLLCSLLLYRILHINQNGI--GWVVAFLCESCFTFMWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
               +  W+      YPER  E V     + P+VDMFVTTA+   EPPI+ VNTVLSLLA+ 
Sbjct  68    FTNITWSPAAHKPYPERLDERVH----DLPSVDMFVTTADSVQEPPIIVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EA KFAK+WVPFCKKYNV +RAPFRYF  +H    E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEAYKFAKIWVPFCKKYNVKIRAPFRYF-LNHLASSE  182

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN  1108
                EF ++W+    EY  L  K+E  T  P   N    F  F++  PNDHSTI+KVI EN
Sbjct  183   DF-EFAKDWEMTKREYEKLSQKVEGITDDPHWLNADDDFEAFSNTKPNDHSTIVKVIWEN  241

Query  1109  DESLAVG--VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + H++KAGAMN L RVSG+MTNA +MLNVDCD Y N+
Sbjct  242   KGGVGEKKEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNALYMLNVDCDMYAND  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL    +     FVQFPQ FYD       + +       L RG   IQG 
Sbjct  302   ADVVRQAMCIFLQEPVNLNHCAFVQFPQAFYDS----NASKRINFFRSHLERGIGGIQGP  357

Query  1460  FYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GCFH R+V+YGLSP+D           T + LT+  L + +G SK  V S   +L
Sbjct  358   IYAGSGCFHTRRVMYGLSPSDLEDDGSLYSAATRDILTEESLAREFGHSKEMVKSLVESL  417

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 +      L  S+EAA +V N  YE+ T+WG  IG  Y S+ ED+ T IGI   GW 
Sbjct  418   QRKSNPR--NSLINSIEAAKEVGNVQYEYQTSWGKTIGLLYDSIMEDVNTSIGIHSRGWT  475

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
             + +   ++P FLGC P  G+ ++ Q +RW +G  EI F+ + P+       L+FRQ LAY
Sbjct  476   SSWICSDQPAFLGCMPPLGVDAMLQRRRWMTGLLEIFFNKQSPLIGMFHHKLRFRQRLAY  535

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +   +  +  I  L Y  LP YCL+ NS   PKG  + I +  ++  ++ LYTLWE+M+ 
Sbjct  536   LSISMSGLSSIPFLFYCLLPAYCLLHNSPLFPKGFCLGITL--TLVGMHCLYTLWEFMKP  593

Query  2153  KESIRAWW  2176
               S++ W+
Sbjct  594   GFSVQVWY  601



>ref|XP_004151938.1| PREDICTED: cellulose synthase-like protein B3-like [Cucumis sativus]
Length=638

 Score =   463 bits (1191),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 264/599 (44%), Positives = 353/599 (59%), Gaps = 49/599 (8%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL++       + + ++  I LLLLSL+ YR+  L ++ + +    A +CES F F   L
Sbjct  5     PLFQRVAIKRTIDKLLDATIFLLLLSLLGYRLHFLATNPFNFLHFTAFLCESSFAFTSFL  64

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             ++  K N     TYP R LE V+    E PAVD+FVTTA+  LEP I+TVNTVLS+LA++
Sbjct  65    LLVIKSNPFHCITYPHRLLERVQ----EIPAVDVFVTTADASLEPVIITVNTVLSILAVD  120

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP +KL+CYVSDD  SP+TFY+L EA KFAK+W PFCKKY + VRAPF+YF AD +   E
Sbjct  121   YPVDKLSCYVSDDGCSPITFYSLREAVKFAKIWAPFCKKYGIRVRAPFQYF-ADSSRADE  179

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDES  1117
             S  EF+  W  +  EY  LC KIE A +          F+  D  +H  IIK+I EN E 
Sbjct  180   SK-EFQHHWNIIKGEYETLCRKIEEAEEAWDS-RDLPFFSGTDSKNHDPIIKIIWENKEY  237

Query  1118  LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
               V +PHLIY+SREKR KH H++KAGA+NVL RVSG+MTNAP++LNVDCD +VN    +L
Sbjct  238   ENV-LPHLIYVSREKRLKHSHHYKAGALNVLARVSGLMTNAPYILNVDCDMFVNESTAIL  296

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTG  1477
               +C  +   ++++  +VQFPQ FYDGLKDD Y +Q  +    +  G A  QG  Y GTG
Sbjct  297   QGICPFIDPINDKEVAYVQFPQRFYDGLKDDLYGNQLIVDMEYIVSGLAGSQGPSYMGTG  356

Query  1478  CFHRRKVIYGLSPND-TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSY  1654
             C HRRKV+YG SPND  +    + +  L+K +G S+ F+ S +    G+        L  
Sbjct  357   CIHRRKVLYGHSPNDHNINGRSIQETKLRKTFGNSEEFIKSVSFASMGTTPYP--NSLQC  414

Query  1655  SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGC  1834
             S+EA   VA   YE  T WG  +GW YGSVTEDI TG+ IQ  GWK+ +  P+   FLGC
Sbjct  415   SIEALHNVATSNYEQDTCWGAKVGWYYGSVTEDIFTGMMIQGKGWKSIYLNPQPAAFLGC  474

Query  1835  TPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFEL  2014
              P+ G  +  Q+KRW +G  EIL +  CPIF A+FG L                      
Sbjct  475   APTNGPSTFTQLKRWTTGFLEILLTKNCPIFGAVFGKLDL--------------------  514

Query  2015  CYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
                               K +E  I+IP  + ++YNL  + +Y++  +SIRA+WNNQRM
Sbjct  515   ------------------KIHEREILIPILLVLLYNLQQVLQYLKMGQSIRAYWNNQRM  555



>ref|XP_006592807.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Glycine max]
Length=679

 Score =   464 bits (1193),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 274/603 (45%), Positives = 355/603 (59%), Gaps = 75/603 (12%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHG-YYYTWLLALVCESWFTFIW  571
              PLY+     + +SR ++ + LLLLL L+ YR+ N+ SH  Y +  L+A +CESWFTF W
Sbjct  7     LPLYDKYWVKHTLSRVMDSLTLLLLLLLLGYRI-NIFSHSNYTFPCLVAFICESWFTFSW  65

Query  572   VLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLA  751
             +LV+STKW+   T TY  R L  V  G  E PAVD+FVTTA+P LEPPI+T+NTVLSLLA
Sbjct  66    ILVISTKWSPAYTKTYIHRLLLRVPEG--ELPAVDLFVTTADPVLEPPIITINTVLSLLA  123

Query  752   LEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTF  928
             L+YP NKLACYVSDD  SP+TFYAL+EA +FAKLWVPFCKKYN+ +R PFRYF N   T 
Sbjct  124   LDYPHNKLACYVSDDGCSPLTFYALIEAFQFAKLWVPFCKKYNIQLRVPFRYFSNNTSTD  183

Query  929   PPESSPEFRREWKKMNDEYANLCGKIEYATQKP-SLFNKFATFADLDPNDHSTIIKVICE  1105
               E +PEF ++W KM +EY  L  KI  AT+    L  +FA F+D  P +H TIIKVI E
Sbjct  184   NNEDTPEFMQDWLKMKNEYERLTRKILNATKNSIPLVGEFAIFSDTQPRNHPTIIKVIWE  243

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAP-FMLNVDCDFYVNN  1282
             N E L+  +PHLIY+SREK+ +H H +KAGAMNVL    G+      F L  +C      
Sbjct  244   NKEGLSDELPHLIYVSREKKQEHPHQYKAGAMNVLYLGGGLAGLQGIFYLGTNC------  297

Query  1283  PEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSF  1462
                 +H    + G                Y G+++              G+ +  +    
Sbjct  298   ----MHRRKVIYGLSP-------------YHGIQN--------------GKKDHGVS---  323

Query  1463  YDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFG  1642
                 G F  +K I+G S     +A     H L+      K F  +               
Sbjct  324   ---NGKFSEKKTIFGTSKGFVESA----THALE-----GKTFTPNNN-------------  358

Query  1643  VLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPG  1822
              +  SLEAAS+V++C YE+GT WG  +GW YGS +ED+LTG+ I   GW++  C PE   
Sbjct  359   -ICKSLEAASEVSSCEYEYGTAWGKQVGWMYGSTSEDLLTGLKIHTKGWRSEVCSPELSP  417

Query  1823  FLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRP  2002
             F+GC+P   L  + Q KRW SG  +IL S  CPIF  LFG LQFRQCL Y+    W +RP
Sbjct  418   FMGCSPQDILVVIGQQKRWISGLLDILLSKHCPIFGTLFGKLQFRQCLGYLWITTWSLRP  477

Query  2003  IFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNN  2182
             + E+CYA LP YC+I NS FLPK  E+   IPA++ +IYN+ TL E ++   SIR W NN
Sbjct  478   VPEICYAALPAYCIINNSSFLPK--ELGQWIPATLLVIYNVSTLLENLKIGLSIRTWCNN  535

Query  2183  QRM  2191
             QRM
Sbjct  536   QRM  538



>ref|XP_007163870.1| hypothetical protein PHAVU_L009400g, partial [Phaseolus vulgaris]
 gb|ESW35864.1| hypothetical protein PHAVU_L009400g, partial [Phaseolus vulgaris]
Length=467

 Score =   456 bits (1173),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 232/429 (54%), Positives = 304/429 (71%), Gaps = 9/429 (2%)
 Frame = +2

Query  506   SHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFV  685
             S+ + +   LA +CESWFTF W++++++KW+   T T+P+R L+ ++    E P VD+FV
Sbjct  43    SNTFTFPCFLAFICESWFTFTWIVILNSKWSPAITVTHPDRLLQRIQ----ELPPVDLFV  98

Query  686   TTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPF  865
             TTA+P LE PI+TVNTVLSLLAL+YP NKLACYVSDD  SP+TFYALVEASKFAKLWVPF
Sbjct  99    TTADPVLESPIITVNTVLSLLALDYPTNKLACYVSDDGCSPLTFYALVEASKFAKLWVPF  158

Query  866   CKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLF  1036
             CKK+N+ VRAP RYF+       E S EFR+EW +M + Y NL  KIE  T K     L 
Sbjct  159   CKKHNIQVRAPDRYFSDVTINKNEDSLEFRQEWLQMKEMYDNLSHKIEEVTHKTIPLQLD  218

Query  1037  NKFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTR  1216
              +F+ F++ +  +H +IIKVI EN E L  G+P+LIY+SREKRP++ HN+KAGAMNVLTR
Sbjct  219   GEFSVFSNTEQRNHPSIIKVILENKEGLFDGLPYLIYVSREKRPQYNHNYKAGAMNVLTR  278

Query  1217  VSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPY  1396
             VSG+M+NAPFMLNVDCD  VNNP++VLHA+C L+ ++  ++  FVQ  Q F DG+KDDP+
Sbjct  279   VSGLMSNAPFMLNVDCDMIVNNPKIVLHALCILMDSQKGKEVAFVQCFQQFIDGIKDDPF  338

Query  1397  ASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN--DTVTAEKLTDHDLQKIY  1570
              +Q  I +  + RG A +QG FY GT  FHRR  IYGL P+  +TV   K  ++ L + +
Sbjct  339   GNQLVISFEYIIRGMAGLQGPFYGGTNTFHRRNTIYGLYPHEIETVIKGKSEENILIQQF  398

Query  1571  GKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTE  1750
             G SK F+ SA   + GS  S      S  +EAA+QVANC YE GT WG+ +GW YGS++E
Sbjct  399   GISKEFIKSAARVVGGSGYSANDITPSNFIEAATQVANCEYECGTFWGNQLGWLYGSISE  458

Query  1751  DILTGIGIQ  1777
             D+ TG+ I 
Sbjct  459   DVPTGLNIH  467



>ref|XP_004171879.1| PREDICTED: cellulose synthase-like protein B3-like, partial [Cucumis 
sativus]
Length=515

 Score =   453 bits (1166),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 245/521 (47%), Positives = 324/521 (62%), Gaps = 11/521 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL++       + + ++  I LLLLSL+ YR+  L ++ + +    A +CES F F   L
Sbjct  5     PLFQRVAIKRTIDKLLDATIFLLLLSLLGYRLHFLATNPFNFLHFTAFLCESSFAFTSFL  64

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             ++  K N     TYP R LE V+    E PAVD+FVTTA+  LEP I+TVNTVLS+LA++
Sbjct  65    LLVIKSNPFHCITYPHRLLERVQ----EIPAVDVFVTTADASLEPVIITVNTVLSILAVD  120

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP +KL+CYVSDD  SP+TFY+L EA KFAK+W PFCKKY + VRAPF+YF AD +   E
Sbjct  121   YPVDKLSCYVSDDGCSPITFYSLREAVKFAKIWAPFCKKYGIRVRAPFQYF-ADSSRADE  179

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDES  1117
             S  EF+  W  +  EY  LC KIE A +          F+  D  +H  IIK+I EN E 
Sbjct  180   SK-EFQHHWNIIKGEYVTLCRKIEEAEEAWDS-RDLPFFSGTDSKNHDPIIKIIWENKEY  237

Query  1118  LAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
               V +PHLIY+SREKR KH H++KAGA+NVL RVSG+MTNAP++LNVDCD +VN    +L
Sbjct  238   ENV-LPHLIYVSREKRLKHSHHYKAGALNVLARVSGLMTNAPYILNVDCDMFVNESTAIL  296

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTG  1477
               +C  +   ++++  +VQFPQ FYDGLKDD Y +Q  +    +  G A  QG  Y GTG
Sbjct  297   QGICPFIDPINDKEVAYVQFPQRFYDGLKDDLYGNQLIVDMEYIVSGLAGSQGPSYMGTG  356

Query  1478  CFHRRKVIYGLSPND-TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSY  1654
             C HRRKV+YG SPND  +    + +  L+K +G S+ F+ S +    G+        L  
Sbjct  357   CIHRRKVLYGHSPNDHNINGRSIQETKLRKTFGNSEEFIKSVSFASMGTTPYP--NSLQC  414

Query  1655  SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGC  1834
             S+EA   VA   YE  T WG  +GW YGSVTEDI TG+ IQ  GWK+ +  P+   FLGC
Sbjct  415   SIEALHNVATSNYEQDTCWGAKVGWYYGSVTEDIFTGMMIQGKGWKSIYLNPQPAAFLGC  474

Query  1835  TPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFR  1957
              P+ G  +  Q+KRW +G  EIL +  CPIF A+FG L  +
Sbjct  475   APTNGPSTFTQLKRWTTGFLEILLTKNCPIFGAVFGKLDLK  515



>gb|AAQ22621.1| At4g15290 [Arabidopsis thaliana]
Length=661

 Score =   458 bits (1179),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 245/521 (47%), Positives = 326/521 (63%), Gaps = 28/521 (5%)
 Frame = +2

Query  677   MFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLW  856
             MFV TA+   E PI+TVNTVLSLLA+ YPANKLACYVSDD  SP+T+++L EASKF K+W
Sbjct  1     MFVPTADTVRESPIITVNTVLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEASKFVKIW  60

Query  857   VPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF  1036
              PFCKKYNV VRAPFRYF        +S   F ++WK M  EY  LC K+E AT      
Sbjct  61    APFCKKYNVRVRAPFRYFLNPLVATDDSV--FSKDWKMMKREYVKLCRKVEDATGDSHWL  118

Query  1037  ---NKFATFADLDPNDHSTIIKVICENDESLA--VGVPHLIYISREKRPKHQHNFKAGAM  1201
                + F  F++  PNDHSTI+KV+ EN   +     VPHL++ISREKRP + H++K GAM
Sbjct  119   DADDDFEAFSNTKPNDHSTIVKVVWENKGGVGDEKEVPHLVHISREKRPNYLHHYKTGAM  178

Query  1202  NVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDG  1378
             N L RVSG+MTNAP+ LNVDCD Y N P+VV  AMC FL  +K+     FVQFPQ FYD 
Sbjct  179   NFLLRVSGLMTNAPYTLNVDCDTYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFYDS  238

Query  1379  LKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------TVT  1531
                  Y ++  ++   LGRG A IQG FY GTGCFH R+V+YGLS +D           T
Sbjct  239   -----YTNELAVLQSILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVAT  293

Query  1532  AEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTW  1711
              E L +  L + YG SK  V S    L    + +    L+  +EAA +V +C YE+ T+W
Sbjct  294   REFLAEDSLVRKYGNSKELVKSVVDALQRKSNPQK--SLANLIEAAQEVGHCHYEYQTSW  351

Query  1712  GHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGH  1891
             G N+GW Y SV EDI T +GI   GW + F  P+ P F+G TP+ GL ++ Q +RWA+G 
Sbjct  352   G-NLGWMYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGA  410

Query  1892  TEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK  2071
              E+LF+ + P      G ++FRQ LAY  +++  +R I EL Y  LP YCL+ +S   PK
Sbjct  411   IEVLFNKQSPFMGMFHGKIKFRQRLAYFWALMC-LRSIPELIYCLLPAYCLLHDSALFPK  469

Query  2072  GNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
             G  +  ++  ++  ++ LY+LW++M    S+++W+  Q +W
Sbjct  470   GPCLCTIV--TLVGMHCLYSLWQFMSLGFSVQSWYVVQSLW  508



>ref|XP_011016137.1| PREDICTED: cellulose synthase-like protein H1, partial [Populus 
euphratica]
Length=475

 Score =   452 bits (1162),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/392 (57%), Positives = 287/392 (73%), Gaps = 14/392 (4%)
 Frame = +2

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
             + P VDMFVT+A+P LEP ILTVNTV+SLLA++YPA+KLACYVSDD  SP+T+Y+LVEAS
Sbjct  1     DLPPVDMFVTSADPVLEPSILTVNTVISLLAVDYPADKLACYVSDDGCSPITYYSLVEAS  60

Query  839   KFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE-SSPEFRREWKKMNDEYANLCGKIEYA  1015
             KFAK+WVPFCKKYN+  RAPFRYF+++       +S EF++E+ KM D Y  L  KI+ A
Sbjct  61    KFAKIWVPFCKKYNIQTRAPFRYFSSELILTGSCNSLEFQQEYNKMKDGYEELASKIKDA  120

Query  1016  TQKP---SLFNKFATFADLDPNDHSTIIKVI-CENDESLAVGVPHLIYISREKRPKHQHN  1183
              +K     L   FA F++++  +H TIIKVI  +ND  L+  +PHLIY+SREKRP+H H 
Sbjct  121   VEKSMEWDLIGDFAVFSNMERKNHPTIIKVIRDQNDAGLSEALPHLIYVSREKRPEHPHR  180

Query  1184  FKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQ  1363
             +KAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP++ LHAMC LLG+ DER++GFVQ PQ
Sbjct  181   YKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNPQIFLHAMCLLLGSNDERESGFVQCPQ  240

Query  1364  TFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEK-  1540
              FYDGLKDDP+ +Q+ + +  +G G A IQG FY+GTGCFHRRKVIYG  P+D     K 
Sbjct  241   CFYDGLKDDPFGNQFVVEHKYMGNGVAGIQGPFYEGTGCFHRRKVIYGSCPDDIGNQAKR  300

Query  1541  -------LTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEF  1699
                    L+  +  +I+G SK F+ SA   L G  +      L   +EAA QVA CGYE+
Sbjct  301   LTPVHGGLSYKEQLRIFGDSKEFIRSAAHALQGKENISPKN-LPTLVEAAHQVAGCGYEY  359

Query  1700  GTTWGHNIGWRYGSVTEDILTGIGIQRMGWKT  1795
             GT+WG  +GW+YGS TEDILTG+ IQ  GW++
Sbjct  360   GTSWGIEVGWQYGSATEDILTGLMIQARGWRS  391



>gb|AAC25943.1| putative cellulose synthase [Arabidopsis thaliana]
Length=748

 Score =   461 bits (1186),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 269/617 (44%), Positives = 364/617 (59%), Gaps = 47/617 (8%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   RAV + +L L  SL+ +R+   H+  Y   WL+A  CES F  + +L
Sbjct  10    PLCERISYTNYFLRAVYLTVLGLFFSLLLHRIR--HTSEYDNVWLVAFFCESCFFLVCLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +   KW+  +T  +P+R  E V     + P+VDMFV TA+P  EPPI+ V+TVLSLLA+ 
Sbjct  68    ITCLKWSPADTKPFPDRLDERVH----DLPSVDMFVPTADPVREPPIMVVDTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN  VRAP RYF    +   E
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNTRVRAPSRYFLKPISVATE  183

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICEN  1108
                EF R+W+K   EY  L  K+E AT    +    + F  F++  PNDHST++KV+ EN
Sbjct  184   DY-EFNRDWEKTKREYEKLRRKVEDATGDSHMLDVEDDFEAFSNTKPNDHSTLVKVVWEN  242

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     +PH+IYISREKRP + HN K GAMN L RVSG+MTNAP++LNVDCD Y N+
Sbjct  243   KGGVGDEKEIPHIIYISREKRPNYVHNQKCGAMNFLARVSGLMTNAPYILNVDCDMYAND  302

Query  1283  PEVVLHAMCFLLGAK-DERDTGFVQFPQTFYDGLKDDPYASQYKIIYHC-LGRGNAAIQG  1456
              +VV  AMC LL    + +   FVQF Q FYD       +++  ++    LGRG A IQG
Sbjct  303   ADVVRQAMCILLQESLNMKHCAFVQFRQEFYDS------STELIVVLQSHLGRGIAGIQG  356

Query  1457  SFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
               Y G+GC H R+V+YGLSP+D           T E L    L + +G SK  + S    
Sbjct  357   PIYIGSGCVHTRRVMYGLSPDDFEVDGSLSSVATREFLVKDSLARRFGNSKEMMKSVVDA  416

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGH--NIGWRYGSVTEDILTGIGIQRM  1783
             +  + + +   +L+ S+EAA +V           GH   IGW Y SV ED+ T IGI   
Sbjct  417   IQRNPNPQ--NILTNSIEAAREV-----------GHFMQIGWLYDSVAEDLNTSIGIHSR  463

Query  1784  GWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQC  1963
             GW + +  P+ P FLG  P+    +L Q +RWA+G  EILF+ + P+       ++FRQ 
Sbjct  464   GWTSSYISPDTPAFLGSMPAGVPEALLQQRRWATGWIEILFNKQSPLRGLFSKKIRFRQR  523

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEY  2143
             LAY+  I+  +R I EL Y  LP YCL+ NS   PKG  + I +  ++  I+ LYTLWE+
Sbjct  524   LAYL-CIITCLRSIPELIYCLLPAYCLLHNSTLFPKGLYLGITV--TLVGIHCLYTLWEF  580

Query  2144  MEEKESIRAWWNNQRMW  2194
             M    S+++W  +Q +W
Sbjct  581   MSLGYSVQSWLVSQSVW  597



>gb|KFK31113.1| hypothetical protein AALP_AA6G069700 [Arabis alpina]
Length=549

 Score =   448 bits (1152),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 245/546 (45%), Positives = 322/546 (59%), Gaps = 32/546 (6%)
 Frame = +2

Query  485   YRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEF  664
             YR+ +++ +G    W++A +CES FTF+W+   +  W+      YP+R  E V     + 
Sbjct  15    YRILHMNQNGT--GWVVAFLCESCFTFVWLFYTNITWSPAAHIPYPDRLDERVH----DL  68

Query  665   PAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKF  844
             P+VD+FVTTA P  EPP+L VNTVLSLLA+ YPANKLACYVSDD  SP+T+++L E SKF
Sbjct  69    PSVDLFVTTAYPVREPPVLVVNTVLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEVSKF  128

Query  845   AKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQK  1024
             AK+WVPFCKKYNV VRAPFRYF    T      PEF  EW+    EY  L  ++E AT+ 
Sbjct  129   AKIWVPFCKKYNVKVRAPFRYFLNPVT--ATEDPEFAIEWEMTKREYEKLRQRVEDATED  186

Query  1025  PSLF---NKFATFADLDPNDHSTIIKVICENDESLAVG----VPHLIYISREKRPKHQHN  1183
                    N F  F++  PNDHSTI+KV    +    VG    VPHL+YISREKRP + H+
Sbjct  187   SDWLNADNDFEAFSNTKPNDHSTIVKVKVIWENKGGVGDEKEVPHLVYISREKRPNYVHH  246

Query  1184  FKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFP  1360
             +KAGAMN + RVSG+MTNAP+MLN+DCD Y N  +VV  AMC FL  +    +  FVQFP
Sbjct  247   YKAGAMNFMVRVSGLMTNAPYMLNLDCDMYANEAKVVRQAMCIFLQESVVPNNCAFVQFP  306

Query  1361  QTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND------  1522
             Q FYD       A+ + I      +G+A IQG  Y+G+GCFH R+V+YGLSP+D      
Sbjct  307   QAFYDS-----NANGFNIFQSYTEQGDAGIQGPIYEGSGCFHTRRVMYGLSPSDLEDDGS  361

Query  1523  ---TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGY  1693
                  T   LT   L + +G SK  V S    L  + + +    L+ S+ AA +V N  Y
Sbjct  362   LSSATTRRFLTQESLTREFGNSKEMVKSVAGALQRTSNPQ--NELTNSIVAAKEVGNFHY  419

Query  1694  EFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMK  1873
             E  T+WG  +GW YGS+ ED  T IGI   GW +       P FLGC P  G+    Q +
Sbjct  420   ECQTSWGKTVGWLYGSIAEDKNTSIGIHSRGWTSSCISLNPPAFLGCMPLVGVEGFLQSR  479

Query  1874  RWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITN  2053
             RW +G  E+L + + P+       L+FRQ L Y+ S +  +  I  + Y  LP YC++ N
Sbjct  480   RWMTGGLEVLLNKQSPLIGIFHQKLRFRQRLVYLSSCMGSLASIPVILYCLLPAYCILHN  539

Query  2054  SHFLPK  2071
             S   PK
Sbjct  540   SPLFPK  545



>emb|CDY19146.1| BnaA04g18860D [Brassica napus]
Length=712

 Score =   451 bits (1161),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 269/638 (42%), Positives = 354/638 (55%), Gaps = 83/638 (13%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     +   RAV++ IL LL SL+ YR+ ++  +     W++A +CE  FTFIW+L
Sbjct  10    PLCERISYKSRSLRAVDLTILGLLFSLLLYRIRHMSQNDT--VWVVAFLCECCFTFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             +  TKW+  E   Y +R  E V     E P+VDMFVTTA+P  EPPIL VNTVLSLLA+ 
Sbjct  68    ITCTKWSPAEHKPYLDRLDERVH----ELPSVDMFVTTADPVREPPILVVNTVLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  S +T+++L EASKFAK+WVPFCKKYN +                 
Sbjct  124   YPANKLACYVSDDGCSALTYFSLKEASKFAKIWVPFCKKYNNS-----------------  166

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIK-----  1093
                   R+W+    EY  L  K+E AT         + F   ++  P+DHSTI+K     
Sbjct  167   ------RDWEMTKREYEKLVQKVEDATGNSYWLDAGDDFEALSNTKPSDHSTIVKCSFFL  220

Query  1094  -------------------------VICENDESLA--VGVPHLIYISREKRPKHQHNFKA  1192
                                      VI EN+E +     VPH +YISREK+P + H++KA
Sbjct  221   GWTNQSRMFLTKRLIIRLDVAEIVVVIWENEEGVGDEKEVPHFVYISREKKPNYLHHYKA  280

Query  1193  GAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTF  1369
             GAMN L RVSG+MTNAP+MLNVDCD Y N  +VV  AMC F+ G+ +     FVQFPQ F
Sbjct  281   GAMNFLVRVSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFMEGSMNPNHCAFVQFPQKF  340

Query  1370  YDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------  1522
             YD   D+    Q  +     GRG A IQG  Y G+GCFH R+V+YGLS +D         
Sbjct  341   YDSNSDEIVVLQSYV-----GRGFAGIQGPVYAGSGCFHTRRVMYGLSVDDLEEDRNLSS  395

Query  1523  TVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFG  1702
               T + L    L++ +GKSK  V S    L    + +    L  S E A  V +C YE+ 
Sbjct  396   VATRKLLAAERLERDFGKSKEMVKSVVDALQRKSNPQ--DTLINSSEPAQAVGHCHYEYQ  453

Query  1703  TTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWA  1882
             T+WG  +GW Y S TED  T IGI   GW + +  PE P FLGC P  G  ++ Q +RWA
Sbjct  454   TSWGKTVGWLYDSTTEDAHTSIGIHSRGWTSSYISPEPPAFLGCMPPGGPEAMLQQRRWA  513

Query  1883  SGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHF  2062
             +G  EILF+ + P+  +    ++FRQ LAY+    W +R I EL Y  LP YC++  S  
Sbjct  514   TGLLEILFTKQNPLNGSSCKKIRFRQSLAYLYIFTWGLRSIPELFYCLLPAYCVLHGSAL  573

Query  2063  LPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
              PKG  + IV   ++  ++ LYTLWE+M    S+ + W
Sbjct  574   FPKGVCLGIVF--TLVGMHCLYTLWEFMSLGFSVHSCW  609



>ref|XP_006408795.1| hypothetical protein EUTSA_v10001915mg [Eutrema salsugineum]
 gb|ESQ50248.1| hypothetical protein EUTSA_v10001915mg [Eutrema salsugineum]
Length=745

 Score =   452 bits (1163),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 259/611 (42%), Positives = 356/611 (58%), Gaps = 32/611 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     + V RA+ + +L  L SL+ YR+  ++ +     W++A + E  F F W+
Sbjct  9     LPLYERISYKSYVRRALNLTVLGFLFSLLLYRILYMNQNDI--AWVMAFLYEFCFFFTWL  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L+ +  W+  E   YP+R  E V     + P+VDMFV TA+P  EPP++ VNTVLSLLA+
Sbjct  67    LITNITWSPAEYKPYPDRLDERVH----DLPSVDMFVPTADPVREPPLIVVNTVLSLLAV  122

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
              YPANKLACYVSDD  SP+T+++L EA KFAK+WVPFCKKYNV VRAPF YF   +    
Sbjct  123   NYPANKLACYVSDDGCSPLTYFSLKEACKFAKIWVPFCKKYNVRVRAPFIYFL--NPVVS  180

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVICE  1105
                PEF ++W+    EY  +   +E AT     F   + F  F++  PNDHSTI+KVI E
Sbjct  181   SEDPEFTKDWEMTKMEYEKISQIVEDATGDSHWFDADDDFEAFSNTKPNDHSTIVKVIFE  240

Query  1106  NDESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVN  1279
             N   +     VPHL+YISREKRP + H++KAGA+N L RV+G+MTNAP+MLNVDCD Y N
Sbjct  241   NKGGVGDEKEVPHLVYISREKRPNYVHHYKAGALNFLVRVTGLMTNAPYMLNVDCDMYAN  300

Query  1280  NPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQG  1456
               +VV  AMC FL  + +     FVQ    F D   D     ++ I    + RG A IQG
Sbjct  301   EADVVRQAMCIFLQESMNPNHIAFVQHSANFRDSKAD-----EFNIFPSYMERGVAGIQG  355

Query  1457  SFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsattt  1609
             + Y G+GCFH RK++YGL+P+D           T + LTD +L K++G S     S  + 
Sbjct  356   AIYTGSGCFHTRKIMYGLTPDDLEDDGSLSSVATRKILTDDNLSKVFGHSIEMTKSVVSA  415

Query  1610  lsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGW  1789
             L G L+ +    L+YSLEAA +V N  YE+ T+WG  IGW Y SV ED+ T I I   GW
Sbjct  416   LRGKLNRQH--SLTYSLEAAREVGNLHYEYQTSWGKTIGWLYDSVLEDVNTSIEIHSRGW  473

Query  1790  KTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLA  1969
              +     + P F+GCTP  GL ++ + +R  +G  EI+F+ + P+       ++FRQ LA
Sbjct  474   TSSLISSDPPAFIGCTPPVGLEAMLRKRRCFTGGLEIIFNKQSPLIGMFHQKIEFRQRLA  533

Query  1970  YMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYME  2149
             Y+   +  +  +  L Y  LP YCL+ NS   PKG  + I    ++  +   YTL  +  
Sbjct  534   YLSISMMGLGFLPVLFYCLLPAYCLLNNSPLYPKGLRLGINF--TLLGMPCFYTLRGFTS  591

Query  2150  EKESIRAWWNN  2182
                S++ W  N
Sbjct  592   PDFSVQLWCAN  602



>ref|NP_001052812.2| Os04g0429600 [Oryza sativa Japonica Group]
 sp|Q7XUU0.3|CSLH3_ORYSJ RecName: Full=Putative cellulose synthase-like protein H3; AltName: 
Full=OsCslH3 [Oryza sativa Japonica Group]
 emb|CAD41008.3| OSJNBa0042L16.14 [Oryza sativa Japonica Group]
 dbj|BAF14726.2| Os04g0429600 [Oryza sativa Japonica Group]
Length=792

 Score =   453 bits (1166),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 238/484 (49%), Positives = 301/484 (62%), Gaps = 23/484 (5%)
 Frame = +2

Query  776   ACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFR  955
             ACYVSDD  SPVT+YAL EA+ FA+ WVPFC+++ VAVRAPFRYF +   F P +  +F 
Sbjct  175   ACYVSDDGCSPVTYYALREAAGFARTWVPFCRRHGVAVRAPFRYFASAPEFGP-ADRKFL  233

Query  956   REWKKMNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICENDESLAV  1126
              +W  M  EY  L  +IE A +   L     +FA F D    +H  I+KVI +N+    +
Sbjct  234   DDWTFMKSEYDKLVRRIEDADETTLLRQGGGEFAEFMDAKRTNHRAIVKVIWDNNSKNRI  293

Query  1127  G----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVV  1294
             G     PHLIY+SREK P H H++KAGAMN LTRVS VMTNAP MLNVDCD + N+P+VV
Sbjct  294   GEEGGFPHLIYVSREKSPGHHHHYKAGAMNALTRVSAVMTNAPIMLNVDCDMFANDPQVV  353

Query  1295  LHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
             LHAMC LLG  DE  +GFVQ PQ+FY  LKDDP+ ++ ++IY          +G FY GT
Sbjct  354   LHAMCLLLGFDDEISSGFVQVPQSFYGDLKDDPFGNKLEVIY----------KGLFYGGT  403

Query  1475  GCFHRRKVIYGLSPNDTVTAEKLTD-----HDLQKIYGKSKIFVtsatttlsgslssetF  1639
             GCFH RK IYG+ P+  V   +         +LQ  +  S+    SA   +SG +S E  
Sbjct  404   GCFHCRKAIYGIEPDSIVVGREGAAGSPSYKELQFKFESSEELKESARYIISGDMSGEPI  463

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
               +S  +E A +V++C YE GT WG  +GW YGS+TEDILTG  I   GW++     E P
Sbjct  464   VDISSHIEVAKEVSSCNYESGTHWGLEVGWAYGSMTEDILTGQRIHAAGWRSAKLETEPP  523

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVR  1999
              FLGC P+ G   L Q KRWA+G  EIL S   P+  ++F +LQFRQCLAY+   +W VR
Sbjct  524   AFLGCAPTGGPACLTQFKRWATGLFEILISQNNPLLLSIFKHLQFRQCLAYLTLYVWAVR  583

Query  2000  PIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWN  2179
                ELCY  L PYCL+TN  FL K +E    I  ++F+ YN Y   EYME   S+RAWWN
Sbjct  584   GFVELCYELLVPYCLLTNQSFLSKASENCFNITLALFLTYNTYNFVEYMECGLSVRAWWN  643

Query  2180  NQRM  2191
             N RM
Sbjct  644   NHRM  647



>ref|XP_008455916.1| PREDICTED: cellulose synthase-like protein B4 isoform X3 [Cucumis 
melo]
Length=462

 Score =   441 bits (1134),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/442 (52%), Positives = 295/442 (67%), Gaps = 11/442 (2%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE       + R +++ I  LL+SL+ YR   L SH + Y   +A +CE WFTF W+L
Sbjct  8     PLYEKIEVKRPIQRLLDLTIFFLLISLLLYRFLILRSHAFTYLHTIAFLCELWFTFTWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             V++  WN +  TTYP+R L+ V+    E P VD+FVTTA+P LEPP++TVNTVLSLLA +
Sbjct  68    VINVTWNPIHYTTYPQRLLKRVD----ELPPVDVFVTTADPLLEPPLITVNTVLSLLAAD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPAN+LA YVSDD  SP+TFY+L+EA KFAK+WVPFCKKY V VRAPFRYF+ D +F  +
Sbjct  124   YPANRLAVYVSDDGCSPITFYSLIEALKFAKIWVPFCKKYEVEVRAPFRYFSGDLSF--D  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQK---PSLFNKFATFADLDPNDHSTIIKVICEN  1108
              + EF+ EW +M DEY  L   IE A +    P L +  A F++++ N+H  IIKVI EN
Sbjct  182   GTEEFQCEWSRMKDEYEKLRRNIEEAAKNVVSPDLTSDLADFSNIESNNHPPIIKVIWEN  241

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E L  G+PHL+Y+SREKRP+H H++KAGAMNVL RVSG+MTNAP++LNVDCD YVNNP 
Sbjct  242   KEGLRDGLPHLVYVSREKRPQHSHHYKAGAMNVLARVSGLMTNAPYILNVDCDMYVNNPS  301

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             V+L  MC  L    +++  FVQFPQ FY+G KDDPY +Q+ ++     RG A IQG  Y 
Sbjct  302   VLLQGMCLFLDPTIDKEYAFVQFPQRFYNGPKDDPYGNQWIVMMEFTFRGMAGIQGPGYM  361

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             GTGC HRRKV+YG SP+      K  D +L K +G SK FV SA   L           L
Sbjct  362   GTGCIHRRKVLYGQSPDGANIFGKHYDDELHKTFGNSKDFVNSAAHALRSLTDYP--NSL  419

Query  1649  SYSLEAASQVANCGYEFGTTWG  1714
             S S+ +  +VA   YE  + WG
Sbjct  420   SNSIISLKEVATSDYEINSCWG  441



>emb|CBI28828.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   443 bits (1140),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 298/471 (63%), Gaps = 52/471 (11%)
 Frame = +2

Query  704   LEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNV  883
             LEPPI+TVNTVLSLLA++YPANKL+CYVSDD ASP+TFYAL+EASKF+KLWVPFCKKY +
Sbjct  2     LEPPIITVNTVLSLLAVDYPANKLSCYVSDDGASPLTFYALLEASKFSKLWVPFCKKYGI  61

Query  884   AVRAPFRYFNADHTFPPESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFN----KFAT  1051
               RAPFRYF+++     ++S EF +E++KM + Y  L  KIE AT K   +     +F  
Sbjct  62    QTRAPFRYFSSELVSSNDNSMEFLQEYRKMKERYEELRQKIEDATLKSMSYELSSAEFVA  121

Query  1052  FADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVM  1231
             F++++  +H TIIKVI EN E+   G+PHL+Y+SREK P+H H++KAGAMNVLTRVSGVM
Sbjct  122   FSNVERENHPTIIKVILENKETRPDGLPHLVYVSREKHPRHPHHYKAGAMNVLTRVSGVM  181

Query  1232  TNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYK  1411
             TNAPFMLNVDCD Y                                          ++  
Sbjct  182   TNAPFMLNVDCDMY------------------------------------------AKTS  199

Query  1412  IIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAE---KLTDHDLQKIYGKSK  1582
             I+Y  +G G A +QG  Y GTGCFHRRKVIYGL P   +  +   KLTD  L+K +G SK
Sbjct  200   ILYKYVGSGIAGLQGPMYGGTGCFHRRKVIYGLWPEGRMEIKGRRKLTDERLEKTFGNSK  259

Query  1583  IFVtsatttlsgslsset--FGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDI  1756
              F T+A   LSG        + +L+  +EAA QVA C YE+GT+WG  IGW YG+  EDI
Sbjct  260   EFTTTAARILSGLSGISHCPYDLLN-RVEAAQQVATCSYEYGTSWGTKIGWLYGTTAEDI  318

Query  1757  LTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAAL  1936
             LTG+ I   GW++ +C  + P FLGC PS G  SL Q KRWA+G  E+ FS   P  A L
Sbjct  319   LTGMRIHAKGWRSTYCQRDPPAFLGCVPSGGPVSLTQRKRWATGLLEVQFSKNSPFIATL  378

Query  1937  FGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAI  2089
                LQFRQCLAYM  +    R I EL Y  LP YC++  SHFLPK  E A+
Sbjct  379   TAKLQFRQCLAYMWILSRGRRSIPELGYIALPAYCIMARSHFLPKVQEPAM  429



>ref|XP_008455915.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Cucumis 
melo]
Length=627

 Score =   443 bits (1140),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 235/472 (50%), Positives = 307/472 (65%), Gaps = 13/472 (3%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PLYE       + R +++ I  LL+SL+ YR   L SH + Y   +A +CE WFTF W+L
Sbjct  8     PLYEKIEVKRPIQRLLDLTIFFLLISLLLYRFLILRSHAFTYLHTIAFLCELWFTFTWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             V++  WN +  TTYP+R L+ V+    E P VD+FVTTA+P LEPP++TVNTVLSLLA +
Sbjct  68    VINVTWNPIHYTTYPQRLLKRVD----ELPPVDVFVTTADPLLEPPLITVNTVLSLLAAD  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPAN+LA YVSDD  SP+TFY+L+EA KFAK+WVPFCKKY V VRAPFRYF+ D +F  +
Sbjct  124   YPANRLAVYVSDDGCSPITFYSLIEALKFAKIWVPFCKKYEVEVRAPFRYFSGDLSF--D  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQ---KPSLFNKFATFADLDPNDHSTIIKVICEN  1108
              + EF+ EW +M DEY  L   IE A +    P L +  A F++++ N+H  IIKVI EN
Sbjct  182   GTEEFQCEWSRMKDEYEKLRRNIEEAAKNVVSPDLTSDLADFSNIESNNHPPIIKVIWEN  241

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
              E L  G+PHL+Y+SREKRP+H H++KAGAMNVL RVSG+MTNAP++LNVDCD YVNNP 
Sbjct  242   KEGLRDGLPHLVYVSREKRPQHSHHYKAGAMNVLARVSGLMTNAPYILNVDCDMYVNNPS  301

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
             V+L  MC  L    +++  FVQFPQ FY+G KDDPY +Q+ ++     RG A IQG  Y 
Sbjct  302   VLLQGMCLFLDPTIDKEYAFVQFPQRFYNGPKDDPYGNQWIVMMEFTFRGMAGIQGPGYM  361

Query  1469  GTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVL  1648
             GTGC HRRKV+YG SP+      K  D +L K +G SK FV SA   L           L
Sbjct  362   GTGCIHRRKVLYGQSPDGANIFGKHYDDELHKTFGNSKDFVNSAAHALRSLTDYP--NSL  419

Query  1649  SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG--WKTG  1798
             S S+ +  +VA   YE  + WG  +    G +   +     +Q++   W+TG
Sbjct  420   SNSIISLKEVATSDYEINSCWGTKVQEPVGCIPLLLFVFYNLQQLLQYWETG  471



>gb|KEH39001.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=485

 Score =   438 bits (1127),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 244/470 (52%), Positives = 309/470 (66%), Gaps = 22/470 (5%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++   LLLL  L+AYRV + ++H +  +  +A +CESWFT  W+
Sbjct  9     LPLYEKIWVKHTFSRVMDSFTLLLLFLLLAYRVSSYNNHNF--SCFVAFLCESWFTITWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V +   E PA+DMFVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  67    TTMSTKWTPAHTKTFLDRLLLRVSDS--ELPALDMFVTTADPVLEPPIITVNTVLSLLAL  124

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S +TFYALVEA+KFA++WVPFCKKYNV  RAPFRYF  +     
Sbjct  125   DYPANKLACYVSDDGCSTLTFYALVEAAKFAEIWVPFCKKYNVQCRAPFRYFCDEAMANN  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                P+F+ +W KM +EY  L  KIE A QK     L  +FA F+     +H TII+VI E
Sbjct  185   NDLPQFKHDWLKMKEEYEQLSSKIENAAQKSIPCQLMGEFAVFSQTQARNHPTIIRVIRE  244

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + ++  +PH+IYISREKRPK  H+ KAGAMNVLTRVSG+MTNAPFMLN+DCD YVNN 
Sbjct  245   N-KGISDVMPHIIYISREKRPKQPHHHKAGAMNVLTRVSGLMTNAPFMLNLDCDMYVNNS  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFY  1465
             ++VLHA+C LL +K E++  F Q PQ FYD +KDD Y +Q   +   +G G A +QG  Y
Sbjct  304   KIVLHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQLVALPMYIGSGFAGLQGIIY  363

Query  1466  DGTGCFHRRKVIYGLS-PNDTVTAEK---------LTDHDLQKIYGKSKIFVtsatttls  1615
              GT CFHRRKV+YGLS PN+   A+K         L++ +  + +G SK FV SAT  L 
Sbjct  364   AGTNCFHRRKVMYGLSPPNEIQNAKKGQGFTNGTFLSEKETMQKFGTSKGFVESATHILE  423

Query  1616  gslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTG  1765
             G  S       S  LEAAS+VA+C YE+ T WG  + W  G + E   T 
Sbjct  424   GITSDLH---KSLDLEAASKVASCDYEYNTAWGKQV-WEIGLIFESKTTN  469



>ref|XP_010089466.1| Cellulose synthase-like protein H1 [Morus notabilis]
 gb|EXB37859.1| Cellulose synthase-like protein H1 [Morus notabilis]
Length=607

 Score =   431 bits (1108),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 287/409 (70%), Gaps = 14/409 (3%)
 Frame = +2

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
             E PAVD+FVTTA+  LEPPI+TVNTVLS +A++YP +KLACYVSDD  SP+  Y+L+EA+
Sbjct  33    ELPAVDIFVTTADTVLEPPIMTVNTVLSAMAVDYPGHKLACYVSDDGCSPIILYSLIEAA  92

Query  839   KFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-----SPEFRREWKKMNDEYANLCGK  1003
             KF  LW+PFCKKY+V VRAPFRYF+ D  FPP S     S  F  EW++M DEY  +  K
Sbjct  93    KFGHLWIPFCKKYDVQVRAPFRYFSGDVVFPPSSDDDNKSSGFHLEWRRMKDEYEKVRQK  152

Query  1004  IEYA---TQKPSLFNKFATFA-DLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPK  1171
             IE A   T +     ++A F+ + + +DH +IIKVI EN E +  G+PHLIY+SREKRP 
Sbjct  153   IEEAANGTVQIECSGEYAAFSTNTNKSDHPSIIKVIWENKEKVPEGMPHLIYVSREKRPH  212

Query  1172  HQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFV  1351
               H++KAGAMNVLTRVSGVMTNAPFMLNVDCD +VNNP++VLHAMC  LG K + +  F+
Sbjct  213   CPHHYKAGAMNVLTRVSGVMTNAPFMLNVDCDMFVNNPKIVLHAMCSFLGLKPQ-ECAFI  271

Query  1352  QFPQTFYDGLKDDPYASQYKII-YHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLS-PNDT  1525
             QFPQ FY+ +KDDP+ +Q   I     GRG A IQG FY GTGCFHRRK+IYG S  N  
Sbjct  272   QFPQAFYNQVKDDPFGTQSVTIGLEMYGRGMAGIQGPFYAGTGCFHRRKLIYGFSLDNQD  331

Query  1526  VTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGT  1705
             V  ++  +  L++ +G S  F+ S T +L   +S      +S + + +SQVA+C YE GT
Sbjct  332   VQGKEDDEKILKESFGNSMEFINSLTQSLKDDISPIQ--DVSSAAQVSSQVAHCVYEHGT  389

Query  1706  TWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGL  1852
              WG  +GW YG++TE + TG+ I R G K+  C+P+ PGFLG TP++GL
Sbjct  390   AWGIKVGWGYGTLTEGVQTGLRIHRKGLKSISCIPDPPGFLGTTPTSGL  438



>emb|CAN66095.1| hypothetical protein VITISV_017805 [Vitis vinifera]
Length=579

 Score =   429 bits (1104),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 217/382 (57%), Positives = 277/382 (73%), Gaps = 13/382 (3%)
 Frame = +2

Query  602   VETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLAC  781
             +++      ++  + N   E P VDMFVTTA+P LEPPI+TVNTVLSLLA++YPANKL+C
Sbjct  6     IKSNNISTNYIHHLSNKVDELPPVDMFVTTADPMLEPPIITVNTVLSLLAVDYPANKLSC  65

Query  782   YVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRRE  961
             YVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRYF+ +     ++S EF +E
Sbjct  66    YVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYFSRELLPSHDNSTEFLQE  125

Query  962   WKKMNDEYANLCGKIEYATQKPSLFNKFAT-----FADLDPNDHSTIIKVICENDESLAV  1126
             ++K+ DEY  L  +IE+AT K S+ ++ +T     F+++    H TIIKVI EN ES + 
Sbjct  126   YRKIMDEYEELRRRIEHATLK-SISHELSTADFVAFSNIKKGSHPTIIKVILENKESRSD  184

Query  1127  GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAM  1306
             G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NNP++  HAM
Sbjct  185   GLPHLVYVSREKDPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANNPQIFHHAM  244

Query  1307  CFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFH  1486
             C LLG+K+E+D GFVQ PQ FYDGLKDDP+ +Q  ++Y  LG G A +QG  Y GTGCFH
Sbjct  245   CLLLGSKNEQDCGFVQSPQCFYDGLKDDPFGNQLVVLYKYLGSGIAGLQGPTYIGTGCFH  304

Query  1487  RRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslsset--FGVL  1648
             RRKVIYGL P+  +  +    KLTD  +QK +G SK F  +A   LSG        + +L
Sbjct  305   RRKVIYGLWPDGRMEIKGRSGKLTDERIQKTFGNSKEFTKTAARILSGLSGISHCPYDLL  364

Query  1649  SYSLEAASQVANCGYEFGTTWG  1714
             +  +EAA +VA C YE+GT+WG
Sbjct  365   N-RVEAAQEVATCSYEYGTSWG  385



>ref|XP_006582369.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Glycine max]
Length=683

 Score =   431 bits (1107),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 262/605 (43%), Positives = 347/605 (57%), Gaps = 83/605 (14%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             P YE     +   R  + ++L+LLLSL+ YRV +++++  +  W +A +CESWFTF W L
Sbjct  8     PFYEKYWYKHNYKRVTDSLLLILLLSLLGYRVISINNYSLF-PWFVAFLCESWFTFSWFL  66

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
              ++T+W+   T TYP R L+ VE    E P VD+FVTTA+PELEPPI+TVNTVLSLLAL+
Sbjct  67    TLTTQWSPAVTKTYPHRLLQSVE----ELPPVDLFVTTADPELEPPIITVNTVLSLLALD  122

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFN--ADHTFP  931
             YP +KLACYVSDD  SP TFYAL EAS+FAK WVPFCKKY+V VRAPFRYF+   +  F 
Sbjct  123   YPPHKLACYVSDDGCSPRTFYALQEASQFAKFWVPFCKKYHVQVRAPFRYFSDKPEEVFG  182

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICEND  1111
               ++PEF++EW +M D Y NL  KI                 +LD    S+II   C  D
Sbjct  183   ANNTPEFKQEWLQMKDMYDNLSSKI-----------------ELD----SSIISNPCNGD  221

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
              ++          S  +R                      TN P ++ V  +    N E 
Sbjct  222   FAV---------FSNTER----------------------TNHPSIIQVIWE----NKEH  246

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDG  1471
             +   +  L+    E+     + P  +  G  +  Y          L  G   +QG FY G
Sbjct  247   IADGLPHLIYISREKRP---KQPHHYKAGAMNVLY----------LAAGIGGLQGPFYGG  293

Query  1472  TGCFHRRKVIYGLSP----NDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF  1639
             T CFHRRKVIYGLSP     D  +   +++ +L++ +G SK  + S   TL G   S   
Sbjct  294   TNCFHRRKVIYGLSPENIEKDKFSGNSISEEELKQKFGTSKEIMKSVACTLEGRTYSYND  353

Query  1640  GVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERP  1819
               +S  ++ ASQVA C YE+GT WG  + W YGSVTED+LTG+ I + GW++ FC+P   
Sbjct  354   INISNVVDVASQVAGCAYEYGTGWGKQMAWIYGSVTEDVLTGLTIHKKGWRSEFCMPSPI  413

Query  1820  GFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYM-ISILWPV  1996
             GF G  P  G  S+ Q KRWA+G  E+ F   CPI + LF  L  RQCLAYM I   W +
Sbjct  414   GFTGFAPGGGPNSMAQQKRWATGLLEMFFCKHCPIISTLFHKLTLRQCLAYMWIINHWGL  473

Query  1997  RPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
               +FE+CYA L  YC+ITNS+FLP+  ++ I IPA+  +IY +YT  EY+ E  SIRAWW
Sbjct  474   MSVFEVCYACLLAYCIITNSNFLPQ--DLGICIPAAFLVIYKIYTASEYLAEGLSIRAWW  531

Query  2177  NNQRM  2191
             NNQRM
Sbjct  532   NNQRM  536



>gb|EAZ30773.1| hypothetical protein OsJ_14837 [Oryza sativa Japonica Group]
Length=638

 Score =   427 bits (1099),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 229/509 (45%), Positives = 295/509 (58%), Gaps = 57/509 (11%)
 Frame = +2

Query  710   PPILTVNTVLSLLALEYP--ANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNV  883
             PP++TVNTVLSLLAL+YP    +LACYVSDD  SP+T +AL EA+ FA  WVPFC++Y V
Sbjct  26    PPLVTVNTVLSLLALDYPRAGERLACYVSDDGCSPLTCHALREAAGFAAAWVPFCRRYGV  85

Query  884   AVRAPFRYFNADHTFPPE--SSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK----F  1045
             AVRAPFRYF++  +      +  +F  +W  M DEY  L  +I+   ++  L +     F
Sbjct  86    AVRAPFRYFSSSSSPESGGPADRKFLDDWTFMKDEYDKLVRRIKNTDERSLLRHGGGEFF  145

Query  1046  ATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSG  1225
             A F +++  +H TI+K                                       TRVS 
Sbjct  146   AEFLNVERRNHPTIVK---------------------------------------TRVSA  166

Query  1226  VMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             VMTNAP MLN+DCD +VNNP+ VLHAMC LLG  DE  +GFVQ PQ FYD LKDDP+ +Q
Sbjct  167   VMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALKDDPFGNQ  226

Query  1406  YKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN-------DTVTAEKLTDHDLQK  1564
              +  +     G   +QG+FY GTGCFHRRK +YG+ PN       DT+ +      +L  
Sbjct  227   MECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSY--KELHT  284

Query  1565  IYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSV  1744
              +G S+    SA   +    S     + S  +E A  V+ C Y+ GT WG  +GW YGS+
Sbjct  285   RFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEVGWVYGSL  343

Query  1745  TEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPI  1924
             TEDILTG  I  MGW++   V E P F+G  P  G   L Q KRWA+G +EI+ S   PI
Sbjct  344   TEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNPI  403

Query  1925  FAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPAS  2104
              A +F  L+FRQCLAY+I + WP+R  FELCY  L PYC++TN  FLPK +E    +P +
Sbjct  404   LATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPLA  463

Query  2105  IFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             +FI YN Y   EYM    S RAWWNN RM
Sbjct  464   LFISYNTYNFMEYMACGLSARAWWNNHRM  492



>ref|XP_010473890.1| PREDICTED: cellulose synthase-like protein B2 [Camelina sativa]
Length=695

 Score =   424 bits (1090),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 259/614 (42%), Positives = 338/614 (55%), Gaps = 87/614 (14%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     + + RA ++ IL LL SL+ +R+  +  +     WL+A +CES F+ +W+L
Sbjct  10    PLCEKISYKSCLQRAADLTILGLLFSLLLHRILYMTQNDN--VWLVAFLCESCFSIVWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
                 KW+  ET TYP+R  E V     + P+VD+FV TA+P  EPPI+ VNTVLSLLA+ 
Sbjct  68    TTCIKWSPAETKTYPDRIDERVH----DLPSVDIFVPTADPVREPPIIVVNTVLSLLAIN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YP NKLACYVSD+  SP+T+++L EASKFAK+WVPFCKKYNV VRAPFRYF   +     
Sbjct  124   YPTNKLACYVSDNGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFRYFL--NPLATT  181

Query  938   SSPEFRREWKKMNDEYANLCGKIEYATQK---PSLFNKFATFADLDPNDHSTIIKVICEN  1108
                EF  +W+    EY  LC K+E AT         + F  F++  PNDHSTI+KVI EN
Sbjct  182   KGSEFSGDWQMTKREYEKLCRKVEIATGDSHWSDADDDFEAFSNTKPNDHSTIVKVIWEN  241

Query  1109  DESLA--VGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNN  1282
                +     VPH +YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y N 
Sbjct  242   KGGVGDVTEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDVYANE  301

Query  1283  PEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGS  1459
              +VV  AMC FL G+ +     FVQ+PQ  YD   D     Q  ++     RG A IQG 
Sbjct  302   ADVVRQAMCVFLQGSSNPNHCAFVQYPQESYDSTTDTLTVFQSFMV-----RGLAGIQGP  356

Query  1460  FYDGTGCFHRRKVIYGLSPNDT---------VTAEKLTDHDLQKIYGKSKIFVtsatttl  1612
              Y G+GCFH R+V+YGLSP D           T E L    L + +G SK  V S    L
Sbjct  357   IYLGSGCFHTRRVMYGLSPEDVEANESLSYLATRELLAADSLPRGFGNSKEMVKSVVEAL  416

Query  1613  sgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWK  1792
                 + +   +L+ S+EAA +V +C YE+ T WG  IGW Y S  +              
Sbjct  417   QRKSNPQH--ILTNSIEAAQEVGHCDYEYKTNWGKTIGWLYDSFNKQ-------------  461

Query  1793  TGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAY  1972
                             S  LG   +  R                         FRQ LAY
Sbjct  462   ----------------SPLLGMFRRKLR-------------------------FRQRLAY  480

Query  1973  MISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEE  2152
             +  +L  +R I EL Y  LP YCL+ NS   PKG  V I+I  ++  +++LYTLWE+M  
Sbjct  481   L-CVLVCLRSIPELFYCLLPAYCLLHNSVLFPKGPCVGIII--TLLGMHSLYTLWEFMSL  537

Query  2153  KESIRAWWNNQRMW  2194
               SI++W  +Q +W
Sbjct  538   GYSIQSWLVSQSLW  551



>ref|XP_010930913.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Elaeis 
guineensis]
Length=558

 Score =   417 bits (1071),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 277/414 (67%), Gaps = 4/414 (1%)
 Frame = +2

Query  959   EWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDESLAVGVPH  1138
             +W+ M ++Y  L  +I+ A       ++ A F++++  +H ++IKVI EN + L  G+PH
Sbjct  3     DWRYMKNKYEELSRRIDDAASHYK-DDELADFSNIERGNHPSLIKVIWENKQGLEDGIPH  61

Query  1139  LIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLL  1318
             L+Y++REKRPKH H++KAGAMNVL RVSGVMTNAPFMLNVDCD + NNPEV+LH MC LL
Sbjct  62    LVYVAREKRPKHPHHYKAGAMNVLARVSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLL  121

Query  1319  GAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKV  1498
             G  +E  TGFVQ PQ FY  LKDDP+ +Q  ++    G G   IQG FY GTGCFHRRK+
Sbjct  122   GFDNEVSTGFVQAPQQFYGALKDDPFGNQLVVLQGITGVGFGGIQGPFYGGTGCFHRRKI  181

Query  1499  IYGLSPN--DTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF-GVLSYSLEAA  1669
             +YG +P        + L+D + Q+IYG S+  + SA+  +SG +   +    LS  +E A
Sbjct  182   LYGSAPGLAGVSKHDDLSDKEPQRIYGDSRELMESASRIISGKIRESSCNNNLSSRVEVA  241

Query  1670  SQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTG  1849
              +VA+C YEF T WG  IGW YGS+TED+LTG+ I  MGWK+ + + + P FLG  P+ G
Sbjct  242   KRVASCSYEFNTCWGKQIGWAYGSMTEDVLTGLRIHSMGWKSVYLILDPPAFLGSAPTGG  301

Query  1850  LGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFL  2029
               SL Q KRW++G  EI +    PI A     L+FR CLAY+++  W +R + ELCYA L
Sbjct  302   PASLTQYKRWSTGLLEISWGRSSPILATFTKQLKFRMCLAYLLASTWALRSMGELCYALL  361

Query  2030  PPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             P YCL+ N+ F+PK +E   VIP + F+I N++++ EY +   S+RA+WNNQRM
Sbjct  362   PAYCLLANTSFMPKASEPVFVIPLAPFLISNIHSIIEYFQCGLSVRAYWNNQRM  415



>emb|CAN60146.1| hypothetical protein VITISV_041923 [Vitis vinifera]
Length=1026

 Score =   420 bits (1080),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 270/381 (71%), Gaps = 11/381 (3%)
 Frame = +2

Query  602   VETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLAC  781
             +++      ++  + N   E P VDMFVTTA+P LEPPI+TVNTVLSLLA++YPANKL+C
Sbjct  6     IKSNNISTNYIHHLSNKVDELPPVDMFVTTADPMLEPPIITVNTVLSLLAVDYPANKLSC  65

Query  782   YVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRRE  961
             YVSDD ASP+TFYAL+EASKFAKLWVPFCKKY +  RAPFRY + +     ++S EF +E
Sbjct  66    YVSDDGASPLTFYALLEASKFAKLWVPFCKKYGIQTRAPFRYXSRELLPSHDNSTEFLQE  125

Query  962   WKKMNDEYANLCGKIEYATQKPSLFN----KFATFADLDPNDHSTIIKVICENDESLAVG  1129
             ++K+  EY  L  +IE AT K   +      F  F+++    H TIIKVI EN ES + G
Sbjct  126   YRKIMXEYEELRRRIEDATLKSISYEFSTADFVAFSNIKKGSHPTIIKVILENKESRSDG  185

Query  1130  VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMC  1309
             +PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLNVDCD Y NNP +  HAMC
Sbjct  186   LPHLVYVSREKDPKHPHHYKAGAMNVLTRVSGAMTNAPFMLNVDCDMYANNPLIFHHAMC  245

Query  1310  FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHR  1489
              LLG+K+E+D GFVQ PQ FYDGLKDDP+ +Q  ++Y  LG G A +QG  Y GTGCFHR
Sbjct  246   LLLGSKNEQDCGFVQSPQCFYDGLKDDPFGNQLVVLYKYLGSGIAGLQGPTYSGTGCFHR  305

Query  1490  RKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsatttlsgslsset--FGVLS  1651
             RKVIYGL P+  +  +    KLTD  +QK +G SK F T+A   LSG        + +L+
Sbjct  306   RKVIYGLXPDGRMEIKGRSGKLTDERIQKTFGNSKEFTTTAARJLSGLSGISHCPYDLLN  365

Query  1652  YSLEAASQVANCGYEFGTTWG  1714
               +EAA +VA C YE+GT+WG
Sbjct  366   -RVEAAQEVATCSYEYGTSWG  385


 Score =   183 bits (465),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 104/163 (64%), Gaps = 0/163 (0%)
 Frame = +2

Query  1703  TTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWA  1882
             +T    IGW YG+ TED+LTG+ I   GWK+  C P+ P FLGC PS G  +L Q KRWA
Sbjct  723   STCKSQIGWLYGTTTEDVLTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALTQQKRWA  782

Query  1883  SGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHF  2062
             +G  EILFS   P  A     LQFRQCLAY   I W +R I ELCY  LP YC++  SHF
Sbjct  783   TGXLEILFSKNSPFIAXFTAKLQFRQCLAYXWXISWALRSIPELCYLALPAYCIMAGSHF  842

Query  2063  LPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             LPK  E A++IP S+F+ YN Y L+EY     SIRA WNN RM
Sbjct  843   LPKVQEPAVLIPISLFVSYNFYXLFEYYGAGFSIRACWNNLRM  885



>emb|CAB10308.1| cellulose synthase like protein [Arabidopsis thaliana]
 emb|CAB78571.1| cellulose synthase like protein [Arabidopsis thaliana]
Length=710

 Score =   408 bits (1048),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 240/573 (42%), Positives = 322/573 (56%), Gaps = 81/573 (14%)
 Frame = +2

Query  677   MFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLW  856
             MFV TA+   E PI+TVNTVLSLLA+ YPANKLACYVSDD  SP+T+++L EASKF K+W
Sbjct  1     MFVPTADTVRESPIITVNTVLSLLAVNYPANKLACYVSDDGCSPLTYFSLKEASKFVKIW  60

Query  857   VPFCKKYNVAVRAPFRYFNADHTFPPESSPEFRREWK---------------KMNDEYAN  991
              PFCKKYNV VRAPFRYF        +S   F ++WK                M  EY  
Sbjct  61    APFCKKYNVRVRAPFRYFLNPLVATDDSV--FSKDWKMMKIYKVFYYVYFCINMKREYVK  118

Query  992   LCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICEN------------------  1108
             LC K+E AT      +    F  F++  PNDHSTI+KV+ +                   
Sbjct  119   LCRKVEDATGDSHWLDADDDFEAFSNTKPNDHSTIVKVLLKLFLKTTVRVFVQFSKVMYI  178

Query  1109  --------DESLAVG----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSG---------  1225
                     +    VG    VPHL+YISREKRP + H++K GAMN L              
Sbjct  179   LKLIIVVWENKGGVGDEKEVPHLVYISREKRPNYLHHYKTGAMNFLVNKLSHTSFFFYLR  238

Query  1226  VMTNAPFMLNVDCDFYVNNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYAS  1402
             +MTNAP+ LNVDCD Y N P+VV  AMC FL  +K+     FVQFPQ FYD   ++    
Sbjct  239   LMTNAPYTLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFYDSYTNELAVL  298

Query  1403  Q---YKIIY---HCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND---------TVTAE  1537
             Q   + +++   + LGRG A IQG FY GTGCFH R+V+YGLS +D           T E
Sbjct  299   QSVSFLLLFDQFNILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVATRE  358

Query  1538  KLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGH  1717
              L +  L + YG SK  V S    L    + +    L+  +EAA +V +C YE+ T+WG 
Sbjct  359   FLAEDSLVRKYGNSKELVKSVVDALQRKSNPQK--SLANLIEAAQEVGHCHYEYQTSWG-  415

Query  1718  NIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTE  1897
             N+GW Y SV EDI T +GI   GW + F  P+ P F+G TP+ GL ++ Q +RWA+G  E
Sbjct  416   NLGWMYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIE  475

Query  1898  ILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGN  2077
             +LF+ + P      G ++FRQ LAY  +++  +R I EL Y  LP YCL+ +S   PKG 
Sbjct  476   VLFNKQSPFMGMFHGKIKFRQRLAYFWALMC-LRSIPELIYCLLPAYCLLHDSALFPKGP  534

Query  2078  EVAIVIPASIFIIYNLYTLWEYMEEKESIRAWW  2176
              +  ++  ++  ++ LY+LW++M    S+++ W
Sbjct  535   CLCTIV--TLVGMHCLYSLWQFMSLGFSVQSCW  565



>gb|EEE50784.1| hypothetical protein OsJ_31143 [Oryza sativa Japonica Group]
Length=627

 Score =   403 bits (1035),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 210/412 (51%), Positives = 263/412 (64%), Gaps = 6/412 (1%)
 Frame = +2

Query  971   MNDEYANLCGKIEYATQKPSLF----NKFATFADLDPNDHSTIIKVICENDES-LAVGVP  1135
             +  EY  L  +IE A + PSL      +FA F D++  +H TIIKV+ +N+ S    G P
Sbjct  72    LQSEYEKLVHRIEDADE-PSLLRHGGGEFAEFLDVERGNHPTIIKVLWDNNRSRTGDGFP  130

Query  1136  HLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFL  1315
              LIY+SREK P   H++KAGAMN LTRVS +MTNAPFMLN+DCD +VNNP VVLHAMC L
Sbjct  131   RLIYVSREKSPNLHHHYKAGAMNALTRVSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLL  190

Query  1316  LGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRK  1495
             LG  DE    FVQ PQ FY  LKDDP+ +Q ++    +GRG A +QG FY GTGCFHRRK
Sbjct  191   LGFDDEISCAFVQTPQKFYGALKDDPFGNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRK  250

Query  1496  VIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQ  1675
             VIYG+      T    ++ +L   +G S  F  SA   + G+LS+E    +S  ++ A +
Sbjct  251   VIYGMRTGREGTTGYSSNKELHSKFGSSNNFKESARDVIYGNLSTEPIVDISSCVDVAKE  310

Query  1676  VANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLG  1855
             VA C YE GT WG  +GW YGS+TED+LTG  I   GW++     E P F+GC P+ G  
Sbjct  311   VAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPA  370

Query  1856  SLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPP  2035
              L Q+KRWASG  EIL S   PI    F +LQFRQCLAY+ S +WPVR  FELCYA L P
Sbjct  371   CLTQLKRWASGFLEILISRNNPILTTTFKSLQFRQCLAYLHSYVWPVRAPFELCYALLGP  430

Query  2036  YCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             YCL++N  FLPK +E    I  ++FI YN Y   E++E  +S RA WNN RM
Sbjct  431   YCLLSNQSFLPKTSEDGFYIALALFIAYNTYMFMEFIECGQSARACWNNHRM  482



>emb|CAN72832.1| hypothetical protein VITISV_017982 [Vitis vinifera]
Length=1332

 Score =   417 bits (1072),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/383 (54%), Positives = 256/383 (67%), Gaps = 15/383 (4%)
 Frame = +2

Query  1076  HSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLN  1255
             H    +VI EN ES + G+PHL+Y+SREK PKH H++KAGAMNVLTRVSG MTNAPFMLN
Sbjct  815   HKKQHEVILENKESRSDGLPHLVYVSREKHPKHPHHYKAGAMNVLTRVSGAMTNAPFMLN  874

Query  1256  VDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGR  1435
             VDCD Y NNP++  H+MC LL +K+E+D GFVQ PQ+FYDGLKDDP+ +Q+ ++Y  +  
Sbjct  875   VDCDMYANNPQIFHHSMCLLLXSKNEQDCGFVQTPQSFYDGLKDDPFGNQFGVLYKYVAS  934

Query  1436  GNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAE----KLTDHDLQKIYGKSKIFVtsat  1603
             G A +QG  Y GTGCFHRRKVIYGL P+  +  +    KLTD  L+K +G SK F  +A 
Sbjct  935   GIAGLQGPHYSGTGCFHRRKVIYGLWPDGRMEFKGRIGKLTDERLEKTFGNSKEFTKTAA  994

Query  1604  ttlsgslssetFGV------LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTG  1765
               LSG       GV      LS  +EAA Q+A+C YE+G  WG  IGW YG+ TEDILTG
Sbjct  995   RILSGLS-----GVSDCPYDLSNRVEAAHQIASCSYEYGANWGTKIGWLYGTTTEDILTG  1049

Query  1766  IGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGN  1945
             + I   GWK+  C P+ P FLGC PS G  +L Q KRWA+G  E+LFS   P        
Sbjct  1050  MRIHARGWKSTDCRPDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSPFIITFTAK  1109

Query  1946  LQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNL  2125
             LQFRQCLAYM  + W +RPI E  Y  LP YC++  SHFLP   + A++IP S+F+ YN 
Sbjct  1110  LQFRQCLAYMWILSWGLRPIPEPYYLALPAYCIMAGSHFLPNVQDPAVLIPISLFVSYNF  1169

Query  2126  YTLWEYMEEKESIRAWWNNQRMW  2194
             +TL EY     SIRA WNN RMW
Sbjct  1170  HTLLEYWGAGYSIRACWNNLRMW  1192



>gb|KDO54722.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=417

 Score =   392 bits (1006),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 256/383 (67%), Gaps = 7/383 (2%)
 Frame = +2

Query  1043  FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVS  1222
                F++ +  +H TI+KVI EN   L+  +PHL+YISREKRPKH H++KAGAMNVLTRVS
Sbjct  1     MTVFSNTERMNHPTIVKVISENKGGLSDEIPHLVYISREKRPKHPHHYKAGAMNVLTRVS  60

Query  1223  GVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYAS  1402
             G+MTNAPFMLNVDCD Y NNPE+VL AMC  LG+K+E +  F+Q PQ FYD  ++    +
Sbjct  61    GLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPENLCILN  120

Query  1403  QYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSK  1582
             +Y      +G+G   IQG FY GTG FHRR V+YGL  +       + + +L K +G SK
Sbjct  121   EY------IGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSK  174

Query  1583  IFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILT  1762
              F+ SA  TL G     +  + S SL+ A +VA+CGYE+G++WG  +G  YG+  ED LT
Sbjct  175   EFIKSAAQTLEGKTGGYSSNI-SRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLT  233

Query  1763  GIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFG  1942
             G+ I   GW++G+C+P    FLGC   +G   + Q KRWA+G  EILFS + PI A L G
Sbjct  234   GLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIG  293

Query  1943  NLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
              LQFRQCLAY+  + W +R I ELCY  LP YC+ITNS FLPK  E  ++IP ++F+IY 
Sbjct  294   KLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYK  353

Query  2123  LYTLWEYMEEKESIRAWWNNQRM  2191
             LYTL EY++   SIR+WW N  M
Sbjct  354   LYTLLEYIQAGLSIRSWWVNNCM  376



>gb|ABR16035.1| unknown [Picea sitchensis]
Length=744

 Score =   401 bits (1030),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 235/620 (38%), Positives = 325/620 (52%), Gaps = 50/620 (8%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
             FPLY T  + +++ R         ++ LI YR+  + S   +  W+   V E  F + W+
Sbjct  6     FPLYTTVEKKSSLYRVYACTRFSAIIGLIYYRLMYIPSEDSW-PWIAIFVAELGFAYCWI  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L  + +W  VE   +P+R     +    + P VD+F+ TA+P  EPP+  +NTVLS LAL
Sbjct  65    LEQAYRWWPVERKVFPKRL---SQRFGSDLPPVDIFICTADPTKEPPLTVINTVLSALAL  121

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYF-NADHTFP  931
             +YP  KL+CYVSDD  SP+TFYAL+EAS+FAK+W+PFC  Y++  R P  YF NAD    
Sbjct  122   DYPVGKLSCYVSDDGGSPLTFYALLEASRFAKIWLPFCDDYSIQDRCPEAYFSNADALQS  181

Query  932   PESSPEFRREWKKMNDEYANLCGKIEYATQKPSL----FNKFATFADLDPN----DHSTI  1087
                S  F R WK +N  Y  L  +I    +  S+      +   F D        DH +I
Sbjct  182   VNLS--FTRAWKHVNKMYLELKDRINNVVEMGSVPADKQKEHKGFKDWVSGSTKPDHPSI  239

Query  1088  IKVICENDESLAV---GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNV  1258
             ++++ E  E   +    +P LIY+SREKRP   H++KAGA+NVL RVSGVM+NAPF+L +
Sbjct  240   VQILLEKGEERDIQGNDMPGLIYVSREKRPGIPHHYKAGALNVLLRVSGVMSNAPFILTL  299

Query  1259  DCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRG  1438
             DCD Y NN E +  AMCF L  K   + G+VQFPQTF+   K+D YA+  K +     +G
Sbjct  300   DCDMYTNNSEALRQAMCFFLEPKTGHEFGYVQFPQTFHGITKNDLYANNLKTLLEIKYKG  359

Query  1439  NAAIQGSFYDGTGCFHRRKVIYG-----LSPNDTVTAEKLT---DHDLQKIYGKSKIFVt  1594
                I+G FY GTGC HRR V+ G      SP     A  +    D  + K    S     
Sbjct  360   LDGIEGPFYIGTGCIHRRDVLCGSERRRSSPKYHKAAYSIVCTEDGSVAKDKASS-----  414

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
                               S  L+ A  +ANC YE  T WG  +G  YG   EDILTG  I
Sbjct  415   ------------------SKMLKDARDLANCTYEDNTLWGKEVGMIYGCAVEDILTGFVI  456

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
             Q  GWK+ +C P R  FLGC P+    +L Q KRWA+GH E+  S  CP    +   ++ 
Sbjct  457   QCRGWKSIYCTPRRKAFLGCAPNNLNDTLIQHKRWAAGHLELFLSKFCPYLHGI-QRIRV  515

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
              Q + Y    LW +  +  LCY  +P  C++      PK +     + AS+ +    Y+L
Sbjct  516   AQRMCYSFCGLWSLSSMHILCYGLIPGLCMLRGLSLFPKVSSSYFFLFASLAVSGYGYSL  575

Query  2135  WEYMEEKESIRAWWNNQRMW  2194
              E++      ++WWN QRMW
Sbjct  576   IEFIWNGGWFKSWWNEQRMW  595



>ref|XP_006375533.1| hypothetical protein POPTR_0014s15340g, partial [Populus trichocarpa]
 gb|ERP53330.1| hypothetical protein POPTR_0014s15340g, partial [Populus trichocarpa]
Length=361

 Score =   386 bits (992),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 256/341 (75%), Gaps = 14/341 (4%)
 Frame = +2

Query  401   LYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLV  580
             L++  V    + RA ++ I  LL+SL+ YR+  L +HG+   W+LAL+CES FTFIWV+ 
Sbjct  10    LFQKVVLKYPIHRAFDITIFFLLVSLLVYRLLYLSNHGF--AWVLALLCESCFTFIWVVT  67

Query  581   VSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALEY  760
             VS KWN VE  TYPER  +  +    + P VDMFVT+A+P LEPPILTVNTV+SLLA++Y
Sbjct  68    VSCKWNPVEYKTYPERLSQKAQ----DLPPVDMFVTSADPVLEPPILTVNTVISLLAVDY  123

Query  761   PANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES  940
             PA+KLACYVSDD  SP+ +Y+LVEASKFAK+WVPFCKKYN+  RAPFRYF+++      +
Sbjct  124   PADKLACYVSDDGCSPIIYYSLVEASKFAKIWVPFCKKYNIQTRAPFRYFSSELIL---T  180

Query  941   SPEFRREWKKMNDEYANLCGKIEYATQKPSLFNK---FATFADLDPNDHSTIIKVICEND  1111
                F   + +  DEY  L  KI+ A +K   +++   FA F++++  +H TIIKVI EN+
Sbjct  181   GSLFVSLFAR--DEYEELASKIKDAVEKSMEWDQIGDFAIFSNIERKNHPTIIKVIRENE  238

Query  1112  ESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEV  1291
               L+  +PHLIYISREKRPKH + +KAGAMNVLTRVSG++TNAPFMLNVDCD +VNNP++
Sbjct  239   AGLSDALPHLIYISREKRPKHPNRYKAGAMNVLTRVSGLITNAPFMLNVDCDMFVNNPQI  298

Query  1292  VLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
              LHAMC LLG+K+ER++GFVQ PQ FYDGLKDDP+ +Q+ +
Sbjct  299   FLHAMCLLLGSKNERESGFVQCPQYFYDGLKDDPFGNQFVV  339



>ref|XP_006447593.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
 gb|ESR60833.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
Length=512

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 256/383 (67%), Gaps = 7/383 (2%)
 Frame = +2

Query  1043  FATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVS  1222
                F++ +  +H TI+KVI EN   L+  +PHL+YISREKRPKH H++KAGAMNVLTRVS
Sbjct  1     MTVFSNTERMNHPTIVKVISENKGGLSDEIPHLVYISREKRPKHPHHYKAGAMNVLTRVS  60

Query  1223  GVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYAS  1402
             G+MTNAPFMLNVDCD Y NNPE+VL AMC  LG+K+E +  F+Q PQ FYD  ++    +
Sbjct  61    GLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPENLCILN  120

Query  1403  QYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSK  1582
             +Y      +G+G   IQG FY GTG FHRR V+YGL  +       + + +L K +G SK
Sbjct  121   EY------IGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSK  174

Query  1583  IFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILT  1762
              F+ SA  TL G     +  + S SL+ A +VA+CGYE+G++WG  +G  YG+  ED LT
Sbjct  175   EFIKSAAQTLEGKTGGYSSNI-SRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLT  233

Query  1763  GIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFG  1942
             G+ I   GW++G+C+P    FLGC   +G   + Q KRWA+G  EILFS + PI A L G
Sbjct  234   GLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIG  293

Query  1943  NLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
              LQFRQCLAY+  + W +R I ELCY  LP YC+ITNS FLPK  E  ++IP ++F+IY 
Sbjct  294   KLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYK  353

Query  2123  LYTLWEYMEEKESIRAWWNNQRM  2191
             LYTL EY++   SIR+WW N  M
Sbjct  354   LYTLLEYIQAGLSIRSWWVNNCM  376



>gb|AAL85026.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AAN71948.1| putative cellulose synthase [Arabidopsis thaliana]
Length=463

 Score =   385 bits (989),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 217/459 (47%), Positives = 286/459 (62%), Gaps = 34/459 (7%)
 Frame = +2

Query  398   PLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVL  577
             PL E     N   R V++ IL  L SL+ YR+  ++ +     W++A +CES+F+FIW+L
Sbjct  10    PLCEKISYKNYFLRVVDLTILGFLFSLLLYRILLMNQNNS--VWVVAFLCESFFSFIWLL  67

Query  578   VVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLALE  757
             + S KW+     +YPER  E V     + P+VDMFVTTA+P  EPPIL  NT+LSLLA+ 
Sbjct  68    ITSIKWSPASYKSYPERLDERVH----DLPSVDMFVTTADPVREPPILVANTLLSLLAVN  123

Query  758   YPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPE  937
             YPANKLACYVSDD  SP+T+++L EASKFAK+WVPFCKKYN+ VRAPFRYF      PP 
Sbjct  124   YPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNIKVRAPFRYF----LNPPA  179

Query  938   S--SPEFRREWKKMNDEYANLCGKIEYATQKPSLF---NKFATFADLDPNDHSTIIKVIC  1102
             +  S EF ++W+    EY  L  ++E AT         + F  F++  PNDHSTI+KV+ 
Sbjct  180   ATESSEFSKDWEITKREYEKLSRRVEDATGDSHWLDAEDDFEDFSNTKPNDHSTIVKVVW  239

Query  1103  ENDESLAV--GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYV  1276
             EN   + V   VPH +YISREKRP + H++KAGAMN L RVSG+MTNAP+MLNVDCD Y 
Sbjct  240   ENKGGVGVENEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYA  299

Query  1277  NNPEVVLHAMC-FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQ  1453
             N  +VV  AMC FL  + +     FVQFPQ FYD   D     +  ++   LGRG A IQ
Sbjct  300   NEADVVRQAMCIFLQKSMNSNHCAFVQFPQEFYDSNAD-----ELTVLQSYLGRGIAGIQ  354

Query  1454  GSFYDGTGCFHRRKVIYGLSPND---------TVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
             G  Y G+GCFH R+V+YGLS +D           T + L + +L + +G S   VTS   
Sbjct  355   GPTYAGSGCFHTRRVMYGLSIDDLEDDGSLSSLATRKYLAEENLAREFGNSNEMVTSVVE  414

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNI  1723
              L    + +    L+ SLEAA +V +C +E+ T+WG  +
Sbjct  415   ALQRKPNPQ--NTLANSLEAAQEVGHCHFEYQTSWGKTV  451



>gb|EMS55737.1| Cellulose synthase-like protein H1 [Triticum urartu]
Length=687

 Score =   391 bits (1005),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 248/363 (68%), Gaps = 9/363 (2%)
 Frame = +2

Query  659   EFPAVDMFVTTANPELEPPILTVNTVLSLLALEYP-ANKLACYVSDDSASPVTFYALVEA  835
             E PAVDMFVTTA+P LEPP++TVNTVLSLLAL+YP   KLACYVSDD  SPVT YAL EA
Sbjct  49    ELPAVDMFVTTADPALEPPLITVNTVLSLLALDYPDVGKLACYVSDDGCSPVTCYALREA  108

Query  836   SKFAKLWVPFCKKYNVAVRAPFRYFN-ADHTFPPESSPEFRREWKKMNDEYANLCGKIEY  1012
             +KFA LW+PFCK+Y++ VRAPF YF+ A       +  EF   W  M  EY  L  +IE 
Sbjct  109   AKFASLWIPFCKRYDIGVRAPFMYFSSAPEVGTGTADHEFLESWALMKTEYEKLASRIEN  168

Query  1013  ATQKPSLFN---KFATFADLDPNDHSTIIKVICENDESLA-VGVPHLIYISREKRPKHQH  1180
             A +   L +   +FA F D +  +H TI+KV+ +N +S A  G PHL+Y+SREK P+H+H
Sbjct  169   ADEVSILRDGGEEFAEFIDAERGNHPTIVKVLWDNSKSKAGEGFPHLVYLSREKSPRHRH  228

Query  1181  NFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFP  1360
             NFKAGAMNVLTRVS VMTNAP MLNVDCD + NNP+V LHAMC LLG  DE  +GFVQ P
Sbjct  229   NFKAGAMNVLTRVSAVMTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDEIHSGFVQAP  288

Query  1361  QTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEK  1540
             Q FY GLKDDP+ +Q ++I   +G G A IQG+FY GTGCFHRRKVIYG+ P DTV  E 
Sbjct  289   QKFYGGLKDDPFGNQMQVITKKIGGGLAGIQGTFYGGTGCFHRRKVIYGMPPPDTVKHET  348

Query  1541  LTD---HDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTW  1711
                    +LQ  +G SK  + S+   +SG L +     +S  +E A QV +C YE GT W
Sbjct  349   RGSPSYKELQAKFGSSKELIESSRNIISGDLLARPTVDISSRVEMAKQVGDCNYEAGTCW  408

Query  1712  GHN  1720
             G  
Sbjct  409   GQE  411



>ref|XP_004165438.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=487

 Score =   384 bits (985),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 227/573 (40%), Positives = 313/573 (55%), Gaps = 103/573 (18%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              P YE         RA+++ I +LL+SL+AYRV  +++HG+ Y   +A +CE WF+F+W 
Sbjct  5     LPFYERTTIKRPTQRALDIAIFILLISLLAYRVLLMYNHGFSYLQTIAFLCEFWFSFVWF  64

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
             L + T+WN V+  TYP+R L+       EFPAVD+FVTTA+P LEPPI+TVNTVLSL+AL
Sbjct  65    LAIITRWNPVDYKTYPQRLLK----REMEFPAVDIFVTTADPVLEPPIITVNTVLSLMAL  120

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKL CY+SDD  S +T +AL EA KFAK+W+PFCK+Y+V VRAPF YF+     PP
Sbjct  121   DYPANKLGCYISDDGCSALTLFALNEALKFAKIWIPFCKRYDVQVRAPFMYFST----PP  176

Query  935   --ESSPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICEN  1108
                SS +F  +W+ +    + +       T  P + N      D+  N+   ++  +C  
Sbjct  177   HLHSSTQFLNDWETLKTRVSAVL------TNAPYILN---VDCDMFVNNPQVVLHAMC--  225

Query  1109  DESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPE  1288
                        ++++ +   K                                 YV  P+
Sbjct  226   -----------VFLNSKDDLKDIG------------------------------YVQTPQ  244

Query  1289  VVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYD  1468
                   CF  G KD                   DP+ +Q  +++          +G FY 
Sbjct  245   ------CFYDGLKD-------------------DPFGNQLVVVF----------EGPFYG  269

Query  1469  GTGCFHRRKVIYGLSPNDTV--TAEKLTDHDLQKIYGKSKIFVtsatttlsgslssetF-  1639
             GTGCFHRRKV+Y   P+ T      K ++ +L K +G SK F  SAT       ++  + 
Sbjct  270   GTGCFHRRKVLYAQFPHHTAHFLNGKASEQELIKTFGYSKTFTKSATYAFKDDQNTSGYP  329

Query  1640  --GVL-SYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVP  1810
               G+  + +L+AA+ VA CGYE  TTWG  IGW YGS +ED+LTG+ IQ  GW++ F   
Sbjct  330   PKGLFNTNNLDAANHVAGCGYEISTTWGSKIGWIYGSTSEDVLTGLVIQTRGWRSIFLAL  389

Query  1811  ERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILW  1990
               P FLGC PS  + SLNQ KRWA+G  ++LF+  CPIF  LFG LQ+RQC AY+  + W
Sbjct  390   NPPAFLGCAPSQLVASLNQQKRWATGFLQVLFNKHCPIFGTLFGKLQWRQCAAYLWMLTW  449

Query  1991  PVRPIFELCYAFLPPYCLITNSHFLPKGNEVAI  2089
              +R I EL YA LP YCLITNS F P  + + I
Sbjct  450   GLRSIPELSYALLPAYCLITNSSFFPTVSTIHI  482



>emb|CBI28830.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/357 (53%), Positives = 236/357 (66%), Gaps = 2/357 (1%)
 Frame = +2

Query  1040  KFATFADLDPNDHSTIIKVICENDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRV  1219
             +F  F+D++  +H +IIKVI EN E L  G+PHLIY+SRE  PKH H++KAGA+NVLTRV
Sbjct  28    EFVAFSDIERRNHPSIIKVILENKEGLVDGLPHLIYVSREMCPKHPHHYKAGALNVLTRV  87

Query  1220  SGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYA  1399
             SG MTNAPF+LNVDCD Y NN ++V HAMC LLG K+ +D  F Q PQ F+DGLKDDP  
Sbjct  88    SGAMTNAPFILNVDCDMYANNSQIVFHAMCLLLGCKNGQDFAFAQSPQIFHDGLKDDPLG  147

Query  1400  SQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTV-TAEKLTDHDLQKIYGK  1576
             +Q       LG G + +QG +Y GTGCFHRRK +YGL P+  + T  +  +  L++ +G 
Sbjct  148   NQLVATQKYLGEGISGLQGPYYSGTGCFHRRKFLYGLWPDGCMETGGRSPNCGLRQSFGH  207

Query  1577  SKIFVtsatttlsgslssetFGV-LSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTED  1753
             SK F  +    LSG          LS S EAA+QVA+CGYE GT+WG   GW YG  +ED
Sbjct  208   SKEFSKTVERILSGLSGKADCPYDLSSSAEAANQVADCGYECGTSWGTKNGWIYGYTSED  267

Query  1754  ILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAA  1933
             +LTG+ I   GW++  C P+ P FLGC+PS G  SL Q KRW +G  EILFS   P  A 
Sbjct  268   VLTGLKIHARGWRSAECKPDPPAFLGCSPSGGPASLTQQKRWVTGLLEILFSKNNPFIAT  327

Query  1934  LFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPAS  2104
             L   LQFRQCLAYM  + W +R I ELCY  LP YC+I NSHFLPK    +++  +S
Sbjct  328   LTAKLQFRQCLAYMYILSWGLRLIPELCYTALPAYCIIANSHFLPKVEGTSLLDTSS  384



>gb|EEC77288.1| hypothetical protein OsI_15925 [Oryza sativa Indica Group]
 gb|EEE61015.1| hypothetical protein OsJ_14838 [Oryza sativa Japonica Group]
Length=554

 Score =   378 bits (970),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 201/419 (48%), Positives = 254/419 (61%), Gaps = 22/419 (5%)
 Frame = +2

Query  971   MNDEYANLCGKIEYATQKPSLFN---KFATFADLDPNDHSTIIKVICENDESLAVG----  1129
             M  EY  L  +IE A +   L     +FA F D    +H  I+KVI +N+    +G    
Sbjct  1     MKSEYDKLVRRIEDADETTLLRQGGGEFAEFMDAKRTNHRAIVKVIWDNNSKNRIGEEGG  60

Query  1130  VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMC  1309
              PHLIY+SREK P H H++KAGAMN LTRVS VMTNAP MLNVDCD + N+P+VVLHAMC
Sbjct  61    FPHLIYVSREKSPGHHHHYKAGAMNALTRVSAVMTNAPIMLNVDCDMFANDPQVVLHAMC  120

Query  1310  FLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHR  1489
              LLG  DE  +GFVQ PQ+FY  LKDDP+ ++ ++IY          +G FY GTGCFH 
Sbjct  121   LLLGFDDEISSGFVQVPQSFYGDLKDDPFGNKLEVIY----------KGLFYGGTGCFHC  170

Query  1490  RKVIYGLSPNDTVTAEKLTD-----HDLQKIYGKSKIFVtsatttlsgslssetFGVLSY  1654
             RK IYG+ P+  V   +         +LQ  +  S+    SA   +SG +S E    +S 
Sbjct  171   RKAIYGIEPDSIVVGREGAAGSPSYKELQFKFESSEELKESARYIISGDMSGEPIVDISS  230

Query  1655  SLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGC  1834
              +E A +V++C YE GT WG  +GW YGS+TEDILTG  I   GW++     E P FLGC
Sbjct  231   HIEVAKEVSSCNYESGTHWGLEVGWAYGSMTEDILTGQRIHAAGWRSAKLETEPPAFLGC  290

Query  1835  TPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFEL  2014
              P+ G   L Q KRWA+G  EIL S   P+  ++F +LQFRQCLAY+   +W VR   EL
Sbjct  291   APTGGPACLTQFKRWATGLFEILISQNNPLLLSIFKHLQFRQCLAYLTLYVWAVRGFVEL  350

Query  2015  CYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             CY  L PYCL+TN  FL K +E    I  ++F+ YN Y   EYME   S+RAWWNN RM
Sbjct  351   CYELLVPYCLLTNQSFLSKASENCFNITLALFLTYNTYNFVEYMECGLSVRAWWNNHRM  409



>gb|KEH39002.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=358

 Score =   370 bits (950),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 240/340 (71%), Gaps = 8/340 (2%)
 Frame = +2

Query  395   FPLYETKVRNNAVSRAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWV  574
              PLYE     +  SR ++   LLLL  L+AYRV + ++H +  +  +A +CESWFT  W+
Sbjct  9     LPLYEKIWVKHTFSRVMDSFTLLLLFLLLAYRVSSYNNHNF--SCFVAFLCESWFTITWI  66

Query  575   LVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLLAL  754
               +STKW    T T+ +R L  V +   E PA+DMFVTTA+P LEPPI+TVNTVLSLLAL
Sbjct  67    TTMSTKWTPAHTKTFLDRLLLRVSDS--ELPALDMFVTTADPVLEPPIITVNTVLSLLAL  124

Query  755   EYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPP  934
             +YPANKLACYVSDD  S +TFYALVEA+KFA++WVPFCKKYNV  RAPFRYF  +     
Sbjct  125   DYPANKLACYVSDDGCSTLTFYALVEAAKFAEIWVPFCKKYNVQCRAPFRYFCDEAMANN  184

Query  935   ESSPEFRREWKKMNDEYANLCGKIEYATQKP---SLFNKFATFADLDPNDHSTIIKVICE  1105
                P+F+ +W KM +EY  L  KIE A QK     L  +FA F+     +H TII+VI E
Sbjct  185   NDLPQFKHDWLKMKEEYEQLSSKIENAAQKSIPCQLMGEFAVFSQTQARNHPTIIRVIRE  244

Query  1106  NDESLAVGVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNP  1285
             N + ++  +PH+IYISREKRPK  H+ KAGAMNVLTRVSG+MTNAPFMLN+DCD YVNN 
Sbjct  245   N-KGISDVMPHIIYISREKRPKQPHHHKAGAMNVLTRVSGLMTNAPFMLNLDCDMYVNNS  303

Query  1286  EVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQ  1405
             ++VLHA+C LL +K E++  F Q PQ FYD +KDD Y +Q
Sbjct  304   KIVLHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAYGNQ  343



>ref|XP_010088430.1| Cellulose synthase-like protein E1 [Morus notabilis]
 gb|EXB36045.1| Cellulose synthase-like protein E1 [Morus notabilis]
Length=758

 Score =   380 bits (975),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 218/627 (35%), Positives = 324/627 (52%), Gaps = 65/627 (10%)
 Frame = +2

Query  395   FPLYETKVRNNAVS-RAVEVVIlllllslIAYRVWNL----HSHGYYYTWLLALVCESWF  559
              PL+ETK     V+ R     I + +  +  YR+ ++      +   + W+  L  E WF
Sbjct  8     LPLFETKRAKGRVTYRLFASSIFVGICLIWVYRLTHIPKPGQDNAARWAWIGLLASELWF  67

Query  560   TFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVL  739
              F W+L  + +WN+V   T+ +R  +  EN   E P VD+FV TA+P +EPPI+ +NTVL
Sbjct  68    GFYWILTQAVRWNRVHRITFKDRLSQRYEND--ELPGVDVFVCTADPTIEPPIMVINTVL  125

Query  740   SLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNAD  919
             S++A ++PA KL+ Y+SDD  S +TFYAL+EASKFAK W+P+CK+++V  R+P  YF   
Sbjct  126   SVMAYDFPAEKLSVYLSDDGGSDLTFYALLEASKFAKDWIPYCKEFDVEPRSPAAYFKFM  185

Query  920   HTFPPESSPEFRREWKKMNDEYANLCGKIEYATQ----------KPSLFNKFATFADLDP  1069
                PP S  E   ++  +   Y ++  +IE  T+          K   F+++ ++  L  
Sbjct  186   SLLPPVSEAEQANKFITIKKLYKDMENRIENTTKLGRIPEEEKSKHKGFSQWESY--LSR  243

Query  1070  NDHSTIIKVICENDESLAVGV-----PHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMT  1234
              DH TI +++ +  ++ A  V     P L+Y++REKRP + HNFKAGAMN L RVS  ++
Sbjct  244   RDHDTIFQIVIDGKDADAKDVFGCTLPTLVYLAREKRPHYHHNFKAGAMNALIRVSSKIS  303

Query  1235  NAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKI  1414
             N   +LNVDCD Y NN   +  A+CFLL  +   D  FVQFPQ F +  K+D Y ++ ++
Sbjct  304   NGEIILNVDCDMYSNNSTSIRDALCFLLDEEKGHDIAFVQFPQKFENNTKNDLYGTELRV  363

Query  1415  IYHCLGRGNAAIQGSFYDGTGCFHRRKVIYG-------LSPNDTVTAEKLTDHDLQKIYG  1573
             +      G     G  Y GTGCFHRR V+ G             +   +L+  DL+    
Sbjct  364   LNKVEFSGMDGYGGPLYSGTGCFHRRNVLCGTEFGGENNEEEREIIGGELSVRDLE----  419

Query  1574  KSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTED  1753
                                          E    +A+C YE  T WG  +G +YG   ED
Sbjct  420   -----------------------------ENVRGLASCAYEENTQWGKEMGLKYGCPVED  450

Query  1754  ILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAA  1933
             ++TG+ IQ  GWK+ F  P RP F+G  P+T L +L Q KRW+ G  +IL S   P + A
Sbjct  451   VITGLSIQTRGWKSVFFSPSRPAFMGVAPTTLLQTLVQHKRWSEGDFQILLSKYSPAWYA  510

Query  1934  LFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFI  2113
                 +     L Y    LW    +  L Y+F+P  CL+ +    P  + + ++  A + I
Sbjct  511   -HNKITLGLQLGYCCYCLWAPNCLATLYYSFVPSLCLLKSIPLFPPISSLWLIPFAYVVI  569

Query  2114  IYNLYTLWEYMEEKESIRAWWNNQRMW  2194
                 Y+L E++    +I  WWN QRMW
Sbjct  570   AKYTYSLAEFLWSGGTIFGWWNEQRMW  596



>ref|XP_010057780.1| PREDICTED: cellulose synthase-like protein E1 [Eucalyptus grandis]
Length=731

 Score =   374 bits (961),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 210/616 (34%), Positives = 319/616 (52%), Gaps = 45/616 (7%)
 Frame = +2

Query  395   FPLYETKVRNNA-VSRAVEVVIlllllslIAYRVWNL--HSHGYYYTWLLALVCESWFTF  565
              PL+ETK  NN  + R   + I + +  +  +R+ +L          WL A   E WF F
Sbjct  7     LPLFETKSANNRFIFRLYTLSIFISICFIFYFRIHHLPESKTAEKLAWLGAFFSELWFAF  66

Query  566   IWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSL  745
              W L +  +WN     T+ +R  +  E     FP +D+FV TA+P +EPPI+ +NTVLS+
Sbjct  67    YWFLTIIVRWNPSYRHTFKDRLSQRYEG---VFPGIDIFVCTADPVIEPPIMVINTVLSI  123

Query  746   LALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHT  925
             +A  YP  K++ Y+SDD  S +TFYAL+E+S+F+K W+PFC+K+NV  R+P  YF +   
Sbjct  124   MAYNYPPEKMSIYLSDDGGSDLTFYALLESSQFSKKWLPFCRKFNVEPRSPEAYFRS--A  181

Query  926   FPPESSPEFRREWKKMNDEYANLCGKIEYATQ----KPSLFNKFATFAD----LDPNDHS  1081
               P +   +  E   + + Y ++  +IE   +       +  +   F +    L P DH 
Sbjct  182   VEPLNDRLWSTELSSIKNLYEDMKKRIETVAELGRIPDDIRKQHKGFLEWDTVLSPRDHQ  241

Query  1082  TIIKVICENDESLAVG-----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPF  1246
             TI++++ +  + +AV      +P L+Y++REKRP+++H+FKAGAMN L RVS  ++NAP 
Sbjct  242   TILQIVIDGRDPMAVDSEEQPLPTLVYLAREKRPRYKHHFKAGAMNALIRVSSRISNAPI  301

Query  1247  MLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHC  1426
             +LNVDCD Y NN + V   +CF +  ++  + GFVQFPQ F +   +D Y+S + ++   
Sbjct  302   ILNVDCDMYANNMDSVRDVLCFFMDEENGDEIGFVQFPQNFDNLTTNDLYSSSFNVLSKV  361

Query  1427  LGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
                G     G  Y GTGCFHRR+ + G        +E L     Q+I   + +       
Sbjct  362   ELHGMDNDGGPPYIGTGCFHRRETLCGRKYRQGSKSESLRWDHHQRIQDSASVLE-----  416

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
                               E    +A+CGYE  T WG  +G +YG   ED+LTG  I   G
Sbjct  417   ------------------ETCKPLASCGYEENTEWGKEMGLKYGCPVEDVLTGFAIHCRG  458

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W++ +  PER GFLG  P T L SL Q KRW  G  +I  S  CP+     G +  +  L
Sbjct  459   WRSVYFNPERKGFLGVAPMTLLQSLVQHKRWTEGDLQIFLSQYCPLLYG-HGKIPLKLQL  517

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYM  2146
             +Y + +LW    +  L Y  +P  CL+      PK +           +  + Y+  E++
Sbjct  518   SYCVYLLWAANCLASLFYVTIPSLCLLRGISLFPKVSSQWSYPFIYTIMATSAYSAGEFV  577

Query  2147  EEKESIRAWWNNQRMW  2194
                 ++R WWN+QRMW
Sbjct  578   WCGGTLRGWWNDQRMW  593



>ref|XP_010547636.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1068

 Score =   382 bits (981),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 231/628 (37%), Positives = 331/628 (53%), Gaps = 76/628 (12%)
 Frame = +2

Query  518   YYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGS-CEFPAVDMFVTT  691
             Y  WL++++CE WF   WVL    KW  +E  TY +R  L + + G   E  AVD+FV+T
Sbjct  295   YPLWLISVICEIWFAVSWVLDQFPKWYPIERETYLDRLSLRYEKEGKPSELAAVDVFVST  354

Query  692   ANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCK  871
              +P  EPP++T NTVLS+L+++YP +K+ACYVSDD A+ +TF AL E ++FA+ WVPFCK
Sbjct  355   VDPMKEPPLITANTVLSILSVDYPVDKVACYVSDDGAAMLTFEALSETAEFARQWVPFCK  414

Query  872   KYNVAVRAPFRYFNADHTF-PPESSPEFRREWKKMNDEY----ANLCGKIEYATQKPSLF  1036
             KYN+  RAP  YFN    +   +  P F RE + M  +Y      + G +  A + P   
Sbjct  415   KYNIEPRAPEWYFNQKMDYLKNKVHPAFVRERRAMKRDYEEFKVRINGLVATAQKVPE--  472

Query  1037  NKFATFADLDP------NDHSTIIKVICENDESLAVG---VPHLIYISREKRPKHQHNFK  1189
              +  T  D  P       DH  +I+V    D    V    +P L+Y+SREKRP   H+ K
Sbjct  473   -EGWTMQDGTPWPGNNVRDHPGMIQVFLGQDGGRDVENNELPRLVYVSREKRPGFDHHKK  531

Query  1190  AGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTF  1369
             AGAMN L RVSGV++NAP+MLNVDCD Y+NN + +  AMCF++  +  +   +VQFPQ F
Sbjct  532   AGAMNALIRVSGVLSNAPYMLNVDCDHYINNCKALREAMCFMMDPQSGKKICYVQFPQRF  591

Query  1370  YDGL-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLS-------PNDT  1525
              DG+ + D Y+++  + +    +G   +QG  Y GTGC  RR+ +YG         P  T
Sbjct  592   -DGIDRHDRYSNRNVVFFDINMKGLDGLQGPIYVGTGCVFRRQALYGFDAPKKKKLPGKT  650

Query  1526  ------------------------------------------VTAEKLTD---HDLQKIY  1570
                                                       +  EK ++     L+K +
Sbjct  651   CNCWPKWCCLCCGLRKNRKSKTKDKKTKNREASEKQIHALENIEEEKSSEAMQMKLEKKF  710

Query  1571  GKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTE  1750
             G+S +FV S      G     + G L   L  A QV +CGYE  T WG  IGW YGSVTE
Sbjct  711   GQSPVFVASTVMEDGGIARIGSPGSL---LREAIQVISCGYEDKTEWGKEIGWIYGSVTE  767

Query  1751  DILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFA  1930
             DILTG  +   GW++ +C+P+RP F G  P      L+Q+ RWA G  EI  S  CPI+ 
Sbjct  768   DILTGFKMHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPIWY  827

Query  1931  ALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIF  2110
                G L++ +  +Y+ S+++P   I  L Y  LP  CL+T    +P+ +  A ++  ++F
Sbjct  828   GYGGGLKWLERFSYINSVVYPWTSIPLLVYCSLPAICLLTGKFIVPEISNYASILFMALF  887

Query  2111  IIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
             +   +  + E    K  I  WW N++ W
Sbjct  888   LSIAVTGILEMQWGKVGIDDWWRNEQFW  915



>ref|XP_006387031.1| hypothetical protein POPTR_2114s00200g, partial [Populus trichocarpa]
 gb|ERP45945.1| hypothetical protein POPTR_2114s00200g, partial [Populus trichocarpa]
Length=469

 Score =   365 bits (938),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 230/335 (69%), Gaps = 9/335 (3%)
 Frame = +2

Query  1211  TRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDD  1390
             TRVSG++TNAPFMLNVDCD +VNNP++ LHAMC LLG+K+ER++GFVQ PQ FYDGLKDD
Sbjct  1     TRVSGLITNAPFMLNVDCDMFVNNPQIFLHAMCLLLGSKNERESGFVQCPQYFYDGLKDD  60

Query  1391  PYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEK--------LT  1546
             P+ +Q+ +++  +G G A IQG FY GTGCFHRRKVIYG  P+D     K        L+
Sbjct  61    PFGNQFVVVHKFMGNGVAGIQGPFYGGTGCFHRRKVIYGSCPDDIGNQAKRLTPVHGGLS  120

Query  1547  DHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIG  1726
               +  +I+G SK F+ SA   L G  +      L   +EAA QVA CGYE+GT+WG  +G
Sbjct  121   YKEQLRIFGDSKEFIRSAAHALQGKENISPKN-LPNLVEAAHQVAGCGYEYGTSWGTEVG  179

Query  1727  WRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILF  1906
             W+YGS TED+LTG+ I   GW++  C P+   FLGC P  G  S+ Q KRWA+G  EIL 
Sbjct  180   WQYGSATEDVLTGLMIHARGWRSLLCTPDPRAFLGCAPRGGPISMTQQKRWATGFLEILI  239

Query  1907  SMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVA  2086
             S + PI A +   LQFRQCLAY+  + W +R I ELC A LP YC IT+S FLP+ +E A
Sbjct  240   SRRSPIIATVTAKLQFRQCLAYLSLLTWGLRSIPELCSAVLPAYCTITDSSFLPEVHEPA  299

Query  2087  IVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRM  2191
             I I  ++F+ Y +YTL EY+E   SIRAWWNNQRM
Sbjct  300   IYIYMALFLSYVIYTLIEYLETGLSIRAWWNNQRM  334



>gb|KCW75092.1| hypothetical protein EUGRSUZ_E03849 [Eucalyptus grandis]
Length=742

 Score =   374 bits (959),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 210/616 (34%), Positives = 319/616 (52%), Gaps = 45/616 (7%)
 Frame = +2

Query  395   FPLYETKVRNNA-VSRAVEVVIlllllslIAYRVWNL--HSHGYYYTWLLALVCESWFTF  565
              PL+ETK  NN  + R   + I + +  +  +R+ +L          WL A   E WF F
Sbjct  18    LPLFETKSANNRFIFRLYTLSIFISICFIFYFRIHHLPESKTAEKLAWLGAFFSELWFAF  77

Query  566   IWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSL  745
              W L +  +WN     T+ +R  +  E     FP +D+FV TA+P +EPPI+ +NTVLS+
Sbjct  78    YWFLTIIVRWNPSYRHTFKDRLSQRYEG---VFPGIDIFVCTADPVIEPPIMVINTVLSI  134

Query  746   LALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHT  925
             +A  YP  K++ Y+SDD  S +TFYAL+E+S+F+K W+PFC+K+NV  R+P  YF +   
Sbjct  135   MAYNYPPEKMSIYLSDDGGSDLTFYALLESSQFSKKWLPFCRKFNVEPRSPEAYFRS--A  192

Query  926   FPPESSPEFRREWKKMNDEYANLCGKIEYATQ----KPSLFNKFATFAD----LDPNDHS  1081
               P +   +  E   + + Y ++  +IE   +       +  +   F +    L P DH 
Sbjct  193   VEPLNDRLWSTELSSIKNLYEDMKKRIETVAELGRIPDDIRKQHKGFLEWDTVLSPRDHQ  252

Query  1082  TIIKVICENDESLAVG-----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPF  1246
             TI++++ +  + +AV      +P L+Y++REKRP+++H+FKAGAMN L RVS  ++NAP 
Sbjct  253   TILQIVIDGRDPMAVDSEEQPLPTLVYLAREKRPRYKHHFKAGAMNALIRVSSRISNAPI  312

Query  1247  MLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHC  1426
             +LNVDCD Y NN + V   +CF +  ++  + GFVQFPQ F +   +D Y+S + ++   
Sbjct  313   ILNVDCDMYANNMDSVRDVLCFFMDEENGDEIGFVQFPQNFDNLTTNDLYSSSFNVLSKV  372

Query  1427  LGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsatt  1606
                G     G  Y GTGCFHRR+ + G        +E L     Q+I   + +       
Sbjct  373   ELHGMDNDGGPPYIGTGCFHRRETLCGRKYRQGSKSESLRWDHHQRIQDSASVLE-----  427

Query  1607  tlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMG  1786
                               E    +A+CGYE  T WG  +G +YG   ED+LTG  I   G
Sbjct  428   ------------------ETCKPLASCGYEENTEWGKEMGLKYGCPVEDVLTGFAIHCRG  469

Query  1787  WKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCL  1966
             W++ +  PER GFLG  P T L SL Q KRW  G  +I  S  CP+     G +  +  L
Sbjct  470   WRSVYFNPERKGFLGVAPMTLLQSLVQHKRWTEGDLQIFLSQYCPLLYG-HGKIPLKLQL  528

Query  1967  AYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYM  2146
             +Y + +LW    +  L Y  +P  CL+      PK +           +  + Y+  E++
Sbjct  529   SYCVYLLWAANCLASLFYVTIPSLCLLRGISLFPKVSSQWSYPFIYTIMATSAYSAGEFV  588

Query  2147  EEKESIRAWWNNQRMW  2194
                 ++R WWN+QRMW
Sbjct  589   WCGGTLRGWWNDQRMW  604



>gb|AAR29963.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=1051

 Score =   381 bits (978),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 228/620 (37%), Positives = 320/620 (52%), Gaps = 65/620 (10%)
 Frame = +2

Query  518   YYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGS-CEFPAVDMFVTT  691
             Y  WLL+++CE WF F W+L    KW+ V   TY +R  L +  +G   +   VD+FV+T
Sbjct  283   YPLWLLSVICEIWFAFSWILDQFPKWSPVNRETYLDRLALRYDRDGELSQLAPVDIFVST  342

Query  692   ANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCK  871
              +P  EPP++T NTVLS+LA++YP +K++CYVSDD A+ +TF AL E S+FA+ WVPFCK
Sbjct  343   VDPMKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFDALAETSEFARKWVPFCK  402

Query  872   KYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYA-------NLCGKIEYATQKP  1027
             KYN+  RAP  YF     F  +     F ++ + M  EY        +L  K E   ++ 
Sbjct  403   KYNIEPRAPEWYFAQKIDFLKDKVQTSFVKDRRAMKREYEEFKVRVNSLVAKAEKVPEEG  462

Query  1028  SLFNKFATFADLDPNDHSTIIKVICENDESLAVG---VPHLIYISREKRPKHQHNFKAGA  1198
              +      +   +  DH  +++V   +   L      +P L+Y+SREKRP  QH+ KAGA
Sbjct  463   WIMQDGTPWPGNNTRDHPGMLQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGA  522

Query  1199  MNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDG  1378
             MN L RVS V+TN  +MLN+DCD Y+NN   +  AMCFL+     R   +VQFPQ F DG
Sbjct  523   MNALVRVSAVLTNGQYMLNLDCDHYINNSSALREAMCFLMDPNLGRKICYVQFPQRF-DG  581

Query  1379  LK-DDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPN------------  1519
             +  +D YA++  + +    RG   IQG  Y GTGC   R  +YG  P             
Sbjct  582   IDTNDRYANRNTVFFDINLRGLDGIQGPVYVGTGCVFNRTALYGYEPPMKKKESGLFSKL  641

Query  1520  -----------------------------------DTVTAEKLTDHDLQKIYGKSKIFVt  1594
                                                D   +  ++   L+K +G+S +FV 
Sbjct  642   CGGKKKSKKSDKHADGSVPVFNLEDIEEGIEGSGFDDEKSLVMSQMSLEKRFGQSSVFVA  701

Query  1595  satttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGI  1774
             S      G   S T   L   L+ A  V +CGYE  + WG  IGW YGSVTEDILTG  +
Sbjct  702   STLMEYGGGPQSATPESL---LKEAIHVISCGYEDRSDWGREIGWIYGSVTEDILTGFKM  758

Query  1775  QRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQF  1954
                GW++ +C+P+RP F G  P      LNQ+ RWA G  EILFS  CPI+    G L+F
Sbjct  759   HARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLKF  818

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
              +  AY+ + ++P+  I  L Y  LP  CL+T    +P+ + +A +   S+FI      +
Sbjct  819   LERFAYINTTIYPLTSIPLLIYCILPAVCLLTGKFIIPQISNIASIWFISLFISIFATGI  878

Query  2135  WEYMEEKESIRAWWNNQRMW  2194
              E       I  WW N++ W
Sbjct  879   LEMRWSGVGIDEWWRNEQFW  898



>ref|XP_010057783.1| PREDICTED: cellulose synthase-like protein E6 [Eucalyptus grandis]
 gb|KCW75096.1| hypothetical protein EUGRSUZ_E03851 [Eucalyptus grandis]
Length=732

 Score =   372 bits (955),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 219/622 (35%), Positives = 324/622 (52%), Gaps = 60/622 (10%)
 Frame = +2

Query  398   PLYETK-VRNNAVSRAVEVVIlllllslIAYRVWNLH--SHGYYYTWLLALVCESWFTFI  568
             PL+ETK  +N  + R+  V +   ++ +  YRV +L   +    + WL A   E WF   
Sbjct  8     PLFETKPAKNLFIFRSYAVSVFAGIIFIFCYRVHHLPEPNTAARWAWLGAFFSELWFVIY  67

Query  569   WVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLL  748
             W + V  +WN V   T+ +R  +  E      P +D+FV TA+P +EPP + +NTVLS++
Sbjct  68    WFVTVVVRWNPVHRRTFKDRLSQRYEK---VLPGIDIFVCTADPVIEPPTMVINTVLSVM  124

Query  749   ALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTF  928
             A  YP +K++ Y+SDD  S +TFYA++EAS+F+K W+PFC+K+NV  R+P  YF +    
Sbjct  125   AYNYPPDKMSVYLSDDGCSDLTFYAMLEASRFSKKWLPFCRKFNVEPRSPEAYFKSAAES  184

Query  929   PPESSPEFRREWKKMNDEYANLCGKIEYATQ----KPSLFNKFATFADLDP----NDHST  1084
               +S    R+EW  M + Y ++  +IE   +       +  +   F + D      DH T
Sbjct  185   LDDSLK--RQEWLSMKNLYEDMKQRIEAMAELGRVTDDMREQHKGFLEWDSVSSRRDHQT  242

Query  1085  IIKVICENDESLAVG-----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFM  1249
             I +++ +  +S AV      +P L Y++REKRP++ HNFKAGAMN L R+S  ++NAP +
Sbjct  243   IFQILIDGTDSTAVDDEGQPLPTLAYLAREKRPQYHHNFKAGAMNALIRISSKISNAPII  302

Query  1250  LNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIYHCL  1429
             LNVDCD Y NN + V  A+CFLL  ++  D  +VQ+PQ F +  ++D Y+S   +I H  
Sbjct  303   LNVDCDMYSNNSDSVRDALCFLLDEENGHDIAYVQYPQNFDNLTENDLYSSSLGLINHVE  362

Query  1430  GRGNAAIQGSFYDGTGCFHRRKVIYGLS--PNDTVTAEKLTDHDLQKIYGKSKIFVtsat  1603
               G     G  Y GTGCFHRR  + G    P     + K   HD ++   +         
Sbjct  363   FHGLDGNGGPMYIGTGCFHRRDALSGRKYMPEGETDSLKRERHDQKQDSAR---------  413

Query  1604  ttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRM  1783
                          VL    E    +A+C YE  T WG  +G  YG   ED+LTG+ +Q  
Sbjct  414   -------------VLE---ETCKTLADCAYEENTDWGKEMGLNYGCTVEDVLTGLSMQCR  457

Query  1784  GWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQC  1963
             GW++ F  PER  F+G  P+T L SL Q KRW+ G  +I  S  CP F    G +  +  
Sbjct  458   GWRSVFFKPERNAFMGVAPTTLLQSLVQHKRWSGGDFQITLSRHCP-FLYGHGKIPLKLQ  516

Query  1964  LAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPK-----GNEVAIVIPASIFIIYNLY  2128
             + Y   +LW    +  L Y  +P  CL+      PK     G     VI A++     +Y
Sbjct  517   ICYCNYLLWAANSLPSLFYVTVPSLCLLRGISLFPKVSNLWGLPFMYVIAATM-----VY  571

Query  2129  TLWEYM-EEKESIRAWWNNQRM  2191
             +  E+M     ++R WWN+QRM
Sbjct  572   SATEFMWTCGSTLRGWWNDQRM  593



>ref|XP_003635328.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=735

 Score =   372 bits (955),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 209/618 (34%), Positives = 329/618 (53%), Gaps = 47/618 (8%)
 Frame = +2

Query  395   FPLYETKV-RNNAVSRAVEVVIlllllslIAYRVWNLHSHG----YYYTWLLALVCESWF  559
              PL+ETKV +   + R     + + ++ +  YRV +    G      + W+     E  F
Sbjct  7     LPLFETKVAKGRILYRCYAASVFVGIIFIWVYRVVHFPPAGAQLLRRWAWMGLFPSELLF  66

Query  560   TFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVL  739
             +F W L    +W+ +   T+ +R  +  E      P +D+FV TA+P +EPPI+ +NTVL
Sbjct  67    SFYWFLTQLVRWSPIYRYTFKDRLSQRYEE---VLPGIDIFVCTADPRIEPPIMVINTVL  123

Query  740   SLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNAD  919
             S++A  YP+  L+ Y+SDD  S +TFYAL+EAS+F+K W+PFC+K+++  R+P  YF+  
Sbjct  124   SVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKFSIEPRSPAAYFSTT  183

Query  920   HTFPPESSPEFRREWKKMNDEYANLCGKIEYATQ----KPSLFNKFATFADLDP----ND  1075
                PP+S+P   +EW  + + Y ++  +IE  T+       +  +   F + +     +D
Sbjct  184   SE-PPDSNPLMAQEWLSIKELYEDMKNRIETTTRLGRISEEIRKEHKGFLEWNSASTRHD  242

Query  1076  HSTIIKVICENDESLAVG-----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNA  1240
             H +I++++ +  +  AV      +P L+Y+SREKRP++ HNFKAGAMN L RVS  ++N 
Sbjct  243   HQSIVQIVIDGRDPKAVDSEGQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSSKISNG  302

Query  1241  PFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIY  1420
               +LNVDCD Y NN E V  A+CF +  +   +  +VQFPQ + +  ++D Y + +++I 
Sbjct  303   SIILNVDCDMYSNNSESVRDALCFFMDEEKGHEIAYVQFPQCYDNLTRNDLYGTCFRVII  362

Query  1421  HCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsa  1600
                  G  +  G FY GTGCFHRR  + G+  +     E   ++D +   G+    V   
Sbjct  363   QVELPGLDSNGGPFYIGTGCFHRRVALCGMKYDKECEREWKKENDRR---GRESASVLE-  418

Query  1601  tttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQR  1780
                                 E+   +A+C YE  + WG  +G +Y    EDI+TG  IQ 
Sbjct  419   --------------------ESCKVLASCTYEENSQWGKEMGVKYDCAVEDIITGFSIQC  458

Query  1781  MGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQ  1960
              GWK+ +  PER GFLG  P+T L SL Q KRW+ GH ++  S  CP F      +  + 
Sbjct  459   RGWKSVYVNPERKGFLGVAPTTLLQSLVQHKRWSEGHLQMFLSRHCP-FIYGHKKVPLKL  517

Query  1961  CLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWE  2140
              LAY I  LW    +  LCY  +P  CL+      P+   + ++  A + I  + Y+L E
Sbjct  518   QLAYSIYNLWAAYSLAMLCYVAVPSLCLLGGISLFPEIWSLWVLPFAYVIIAKHAYSLGE  577

Query  2141  YMEEKESIRAWWNNQRMW  2194
             +     +I+ WWN+QR+W
Sbjct  578   FHWYGGTIQGWWNDQRIW  595



>dbj|BAJ96780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1068

 Score =   380 bits (976),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 233/637 (37%), Positives = 328/637 (51%), Gaps = 70/637 (11%)
 Frame = +2

Query  479   IAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGS  655
             + YR+ N   + Y   WLL+++CE WF F W+L    KW+ V   TY +R  L +  +G 
Sbjct  284   LHYRITNPVRNAYPL-WLLSVICEIWFAFSWILDQFPKWSPVNRETYLDRLALRYDRDGE  342

Query  656   -CEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVE  832
               +   VD+FV+T +P  EPP++T NTVLS+LA++YP +K++CYVSDD A+ +TF AL E
Sbjct  343   LSQLAPVDIFVSTVDPMKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFDALAE  402

Query  833   ASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYA-------  988
              S+FA+ WVPFCKKYN+  RAP  YF     F  +     F ++ + M  EY        
Sbjct  403   TSEFARKWVPFCKKYNIEPRAPEWYFAQKIDFLKDKVQTSFVKDRRAMKREYEEFKVRVN  462

Query  989   NLCGKIEYATQKPSLFNKFATFADLDPNDHSTIIKVICENDESLAVG---VPHLIYISRE  1159
             +L  K E   ++  +      +   +  DH  +++V   +   L      +P L+Y+SRE
Sbjct  463   SLVAKAEKVPEEGWIMQDGTPWPGNNTRDHPGMLQVFLGHSGGLDTDGNELPRLVYVSRE  522

Query  1160  KRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERD  1339
             KRP  QH+ KAGAMN L RVS V+TN  +MLN+DCD Y+NN   +  AMCFL+     R 
Sbjct  523   KRPGFQHHKKAGAMNALVRVSAVLTNGQYMLNLDCDHYINNSSALREAMCFLMDPNLGRK  582

Query  1340  TGFVQFPQTFYDGLK-DDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSP  1516
               +VQFPQ F DG+  +D YA++  + +    RG   IQG  Y GTGC   R  +YG  P
Sbjct  583   ICYVQFPQRF-DGIDTNDRYANRNTVFFDINLRGLDGIQGPVYVGTGCVFNRTALYGYEP  641

Query  1517  -------------------------------NDTVTAEKLTDHD----------------  1555
                                            + +V    L D +                
Sbjct  642   PMKKKESGLFSKLCGGRTSKSKESKKSDKHADGSVPVFNLEDIEEGIEGSGFDDEKSLLM  701

Query  1556  ----LQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNI  1723
                 L+K +G+S +FV S      G   S T   L   L+ A  V +CGYE  + WG  I
Sbjct  702   SQMSLEKRFGQSSVFVASTLMEYGGVPQSATPESL---LKEAIHVISCGYEDRSDWGREI  758

Query  1724  GWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEIL  1903
             GW YGSVTEDILTG  +   GW++ +C+P+RP F G  P      LNQ+ RWA G  EIL
Sbjct  759   GWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEIL  818

Query  1904  FSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEV  2083
             FS  CPI+    G L+F +  AY+ + ++P+  I  L Y  LP  CL+T    +P+ + +
Sbjct  819   FSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGKFIIPQISNI  878

Query  2084  AIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
             A +   S+FI      + E       I  WW N++ W
Sbjct  879   ASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFW  915



>ref|XP_011038831.1| PREDICTED: cellulose synthase-like protein E1 [Populus euphratica]
Length=772

 Score =   372 bits (956),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 216/621 (35%), Positives = 330/621 (53%), Gaps = 56/621 (9%)
 Frame = +2

Query  398   PLYETK-VRNNAVSRAVEVVIlllllslIAYRVWNLHSHGY--YYTWLLALVCESWFTFI  568
             PL+ETK  R   + R+    + + +  ++ YRV N+   G    + W+  L  E WF F 
Sbjct  44    PLFETKGARGLVLYRSFAATLFVGVCLILFYRVSNMPRDGEEGRWVWIGLLGAELWFGFY  103

Query  569   WVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVLSLL  748
             WVL  + +WNQV   T+ +R  +  E    + P VD+FV TA+P +EPPI+ +NTVLS++
Sbjct  104   WVLTQALRWNQVYRLTFKDRLSQRYEK---DLPRVDVFVCTADPVIEPPIMVMNTVLSVM  160

Query  749   ALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTF  928
             A +YP  KLA Y+SDD+ S +TFYAL+EAS+FAK W+P+CKK++V  R+P  YF +   F
Sbjct  161   AYDYPPEKLAIYLSDDAGSDLTFYALLEASRFAKQWIPYCKKFDVQPRSPAAYFES--KF  218

Query  929   PPESS---------PEFRREWKKMND--EYANLCGKI-EYATQKPSLFNKFATFADLDPN  1072
             P                +  +++M D  E A + G+I E A  +   F+++ +++     
Sbjct  219   PTGDGGGQSQTMDFTAIKNLYQEMEDRIETATMLGRIPEEARLEHEGFSQWDSYSS--KR  276

Query  1073  DHSTIIKVICENDESLAV-----GVPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTN  1237
             DH TI+K++ +  +  +       +P L+Y++REKRP+H HNFKAGAMN L RVS  ++N
Sbjct  277   DHDTILKILIDGKDPCSTDTDGSALPTLVYLAREKRPQHFHNFKAGAMNALIRVSSKISN  336

Query  1238  APFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKII  1417
                +LN+DCD Y N+P  V  A+CF +  +   D  FVQFPQ F +  K+D Y+S +++I
Sbjct  337   GQIVLNLDCDMYSNDPLTVRDALCFFMDEEKSHDIAFVQFPQWFANVTKNDLYSSSFRVI  396

Query  1418  YHCLGRGNAAIQGSFYDGTGCFHRRKVIYG--LSPNDTVTAEKLTDHDLQKIYGKSKIFV  1591
              +    G     G  Y GTGCFHRR  + G   S +  +  +K  D+ +Q+   + +   
Sbjct  397   SNVEFHGTDGYGGPLYIGTGCFHRRDTLCGREFSQDSKIEWKKHDDNRIQQSVHELE---  453

Query  1592  tsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIG  1771
                                    E    +A+C YE  T WG+ +G +YG   ED++TG+ 
Sbjct  454   -----------------------EETKTLASCTYEQNTKWGNEMGLKYGCPVEDVITGLS  490

Query  1772  IQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQ  1951
             IQ  GWK+ +  PER  FLG  P+T    L Q KRW+ G  +ILFS   P + A  G + 
Sbjct  491   IQCKGWKSAYFNPERKAFLGLAPTTLPQVLVQHKRWSEGDFQILFSKYSPAWYA-HGRIS  549

Query  1952  FRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYT  2131
                 L Y     W    +  L Y+  P   L+      P+ +    +  A +     +Y+
Sbjct  550   LGLQLGYCCYCFWASNCLATLYYSIFPSLFLLKGISLFPQVSSPWFLPFAYVIFAKYIYS  609

Query  2132  LWEYMEEKESIRAWWNNQRMW  2194
             L E++    ++  WWN+QR+W
Sbjct  610   LAEFLWAGGTVLGWWNDQRIW  630



>ref|XP_002274290.2| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=746

 Score =   371 bits (953),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 210/620 (34%), Positives = 332/620 (54%), Gaps = 51/620 (8%)
 Frame = +2

Query  395   FPLYETKV-RNNAVSRAVEVVIlllllslIAYRVWNLHSHG----YYYTWLLALVCESWF  559
              PL+ETKV +   + R     + + ++ +  YRV +    G      + W+   + E  F
Sbjct  18    LPLFETKVAKGRILFRCYAASVFVGIIFIWVYRVVHFPPAGAQVLRRWAWMGLFLSELLF  77

Query  560   TFIWVLVVSTKWNQVETTTYPERFLEWVENGSCEFPAVDMFVTTANPELEPPILTVNTVL  739
             +F W L    +W+ +   T+ +R  +  E      P +D+FV TA+P +EPPI+ +NTVL
Sbjct  78    SFYWFLTQLVRWSPIYRYTFKDRLSQRYEE---VLPGIDIFVCTADPRIEPPIMVINTVL  134

Query  740   SLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNAD  919
             S++A  YP+  L+ Y+SDD  S +TFYAL+EAS+F+K W+PFC+K+++  R+P  YF+  
Sbjct  135   SVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKFSIEPRSPAAYFSTT  194

Query  920   HTFPPESSPEFRREWKKMNDEYANLCGKIEYATQ----KPSLFNKFATFADLDP----ND  1075
                PP+S+P   +EW  + + Y ++  +IE  T+       +  +   F + +     +D
Sbjct  195   SE-PPDSNPLMAQEWLSIKELYEDMKNRIETTTRLGRISEEIRKEHKGFLEWNSASTRHD  253

Query  1076  HSTIIKVICENDESLAVG-----VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNA  1240
             H +I++++ +  +  AV      +P L+Y+SREKRP++ HNFKAGAMN L RVS  ++N 
Sbjct  254   HQSIVQIVIDGRDPKAVDSEGQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSSKISNG  313

Query  1241  PFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDGLKDDPYASQYKIIY  1420
               +LNVDCD Y NN E V  A+CF +  +   +  +VQFPQ + +  ++D Y +  ++I 
Sbjct  314   SIILNVDCDMYSNNSESVRDALCFFMDEEKGHEIAYVQFPQCYDNLTRNDLYGTCLRVII  373

Query  1421  HCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKLTDHDLQKIYGKSKIFVtsa  1600
                  G  +  G  Y GTGCFHRR  + G+        E   ++D +   G+    V   
Sbjct  374   QVELPGLDSNGGPCYIGTGCFHRRVALCGMKYGKECEREWKRENDRR---GRESASVLE-  429

Query  1601  tttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQR  1780
                                 E+   +A+C YE  + WG  +G +Y    EDI+TG  IQ 
Sbjct  430   --------------------ESCKVLASCTYEENSQWGKEMGLKYDCAVEDIITGFSIQC  469

Query  1781  MGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGN--LQF  1954
              GWK+ +  PER GFLG  P+T L SL Q KRW+ GH +I  S  CP+   ++G+  +  
Sbjct  470   RGWKSVYFNPERKGFLGVAPTTLLQSLVQHKRWSEGHLQIFLSRHCPL---IYGHKKVPL  526

Query  1955  RQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTL  2134
             +  LAY I  LW    +  LCYA +P  CL+      P+   + ++  A + I  + Y+L
Sbjct  527   KLQLAYSIYNLWAAYSLATLCYAAVPSLCLLGGISLFPEIWSLWVLPFAYVIIAKHAYSL  586

Query  2135  WEYMEEKESIRAWWNNQRMW  2194
              E+     +I+ WWN+QR+W
Sbjct  587   GEFHWYGGTIQGWWNDQRIW  606



>gb|KHG04072.1| putative cellulose synthase A catalytic subunit 8 [UDP-forming] 
[Gossypium arboreum]
Length=1068

 Score =   379 bits (973),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 240/659 (36%), Positives = 339/659 (51%), Gaps = 78/659 (12%)
 Frame = +2

Query  437   RAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTT  616
             R V V+ L++L   + YR+ N   + Y   WL++++CE WF   W+L    KW  V   T
Sbjct  262   RMVIVLRLVILSIFLHYRITNPVPNAYAL-WLISVICEIWFAVSWILDQFPKWLPVNRET  320

Query  617   YPERF-LEWVENGS-CEFPAVDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVS  790
             Y +R  L +   G   +  AVD+FV+T +P  EPP++T NTVLS+LA++YP +K++CYVS
Sbjct  321   YLDRLALRYDREGEPSQLAAVDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVS  380

Query  791   DDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWK  967
             DD A+ +TF AL E S+FA+ WVPFCKKY++  RAP  YF     +  +   P+F +E +
Sbjct  381   DDGAAMLTFEALSETSEFARKWVPFCKKYSIEPRAPEWYFALKIDYLKDKVQPDFVKERR  440

Query  968   KMNDEY----ANLCGKIEYATQKPS---LFNKFATFADLDPNDHSTIIKVICENDESLAV  1126
              M  EY      + G +  A + P    +      +   +  DH  +I+V   +   L  
Sbjct  441   AMKREYEEFKVRINGLVAKAQKVPDEGWIMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDS  500

Query  1127  G---VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
                 +P L+Y+SREKRP  QH+ KAGAMN L RVS V+TN PF+LN+DCD Y+NN + + 
Sbjct  501   DGNELPQLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHYINNSKALR  560

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGL-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
              AMCFL+     +   +VQFPQ F DG+ K+D YA++  + +    RG   IQG  Y GT
Sbjct  561   EAMCFLMDPNLGKSVCYVQFPQRF-DGIDKNDRYANRNTVFFDINLRGLDGIQGPVYVGT  619

Query  1475  GCFHRRKVIYGLSP----------------------------------------NDTVTA  1534
             GC   R  +YG  P                                        N TV  
Sbjct  620   GCVFNRTALYGYEPPLKLKHKKRGLFSSCFSGSQKKSSKSSKKDSSNKKSGKHVNSTVPI  679

Query  1535  EKLTDHD-------------------LQKIYGKSKIFVtsatttlsgslssetFGVLSYS  1657
               L D +                   L+K +G+S +FV+S      G   S T   L   
Sbjct  680   YNLEDIEGVEGAGFDDENSHLMSQMTLEKRFGQSAVFVSSTLMENGGVPQSATPESL---  736

Query  1658  LEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCT  1837
             L+ A  V +CGYE  T WG  IGW YGSVTEDILTG  +   GW++ +C+P RP F G  
Sbjct  737   LKEAIHVISCGYEDKTDWGSEIGWIYGSVTEDILTGFKMHARGWRSIYCMPLRPAFKGSA  796

Query  1838  PSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGNLQFRQCLAYMISILWPVRPIFELC  2017
             P      LNQ+ RWA G  EILFS  CPI+    G L++ +  AY+ + ++P+  I  L 
Sbjct  797   PINLSDRLNQVLRWALGSVEILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPITAIPLLA  856

Query  2018  YAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
             Y  LP  CL+T    +P+ + +A +   S+F+      + E       I  WW N++ W
Sbjct  857   YCTLPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFW  915



>ref|XP_009766951.1| PREDICTED: cellulose synthase A catalytic subunit 8 [UDP-forming] 
[Nicotiana sylvestris]
Length=981

 Score =   377 bits (968),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 228/624 (37%), Positives = 328/624 (53%), Gaps = 66/624 (11%)
 Frame = +2

Query  518   YYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERFLEWVENGS--CEFPAVDMFVTT  691
             Y  WL++++CE WF F WVL    KW+ +   TY +R     E     C+   VD FV+T
Sbjct  205   YPLWLISVICEIWFAFSWVLDQFPKWSPINRETYIDRLSARFEREGEPCQLAPVDFFVST  264

Query  692   ANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEASKFAKLWVPFCK  871
              +P  EPP++T NTVLS+LA++YP  K++CYVSDD  S +TF +L E S+FA+ WVPFCK
Sbjct  265   VDPMKEPPLITANTVLSILAVDYPVEKVSCYVSDDGGSMLTFESLAETSEFARKWVPFCK  324

Query  872   KYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYANLCGKIEYATQKPSLFNKFA  1048
             K+++  RAP  YF+    +  +   P F +E + M  EY     ++     K     +  
Sbjct  325   KFSIEPRAPEFYFSQKFDYLKDKVQPSFVKERRAMKREYEEYKVRVNALVAKAQKTPEDG  384

Query  1049  -TFADL------DPNDHSTIIKVICENDESLAVG---VPHLIYISREKRPKHQHNFKAGA  1198
              T AD       +P DH  +I+V   +  S  +    +P L+Y+SREKRP +QH+ KAGA
Sbjct  385   WTMADGTPWPGNNPRDHPGMIQVFLGHSGSHDIEGNELPRLVYVSREKRPGYQHHKKAGA  444

Query  1199  MNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTGFVQFPQTFYDG  1378
              N L RVS V+TNAP++LN+DCD YVNN + +  AMCFL+  +  RD  +VQFPQ F DG
Sbjct  445   ENALIRVSAVLTNAPYILNLDCDHYVNNSKAIREAMCFLMDPQVGRDVCYVQFPQRF-DG  503

Query  1379  L-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPNDTVTAEKL----  1543
             + K D YA++  + +    +G   IQG  Y GTGC   R+ +YG SP++  T  K     
Sbjct  504   IDKSDRYANRNIVFFDVNMKGLDGIQGPVYVGTGCCFNRQALYGYSPSNLPTLPKSSSSC  563

Query  1544  ----------TDHDLQKIYGKSK-------IF---------VtsatttlsgslssetFGV  1645
                        + DL ++Y ++K       IF             +  +S     +TFG+
Sbjct  564   SCCCRRKKPAKEKDLTEVYREAKREDLNSAIFNLREIENYDEHERSLLISQMSFEKTFGM  623

Query  1646  LSYSLEA--------------------ASQVANCGYEFGTTWGHNIGWRYGSVTEDILTG  1765
              S  +E+                    A  V  CGYE  T WG  IGW YGSVTEDILTG
Sbjct  624   SSVFIESTLMENGGVPDSVNPSILIREAIHVIGCGYEEKTAWGKEIGWIYGSVTEDILTG  683

Query  1766  IGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPIFAALFGN  1945
               +Q  GW++ +C+P RP F G  P      L+Q+ RWA G  EI  S  CP++    G 
Sbjct  684   FKMQCRGWRSIYCMPLRPAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPLWYGFGGG  743

Query  1946  -LQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
              L++ Q LAY  +I++P   +  + Y  +P  CL+T    +P  + VA ++   +F+   
Sbjct  744   RLKWLQRLAYTNTIVYPFTSLPLIAYCTIPAVCLLTGKFIIPTLSNVASILFLGLFLSII  803

Query  2123  LYTLWEYMEEKESIRAWWNNQRMW  2194
             +  + E       I  WW N++ W
Sbjct  804   VTGVLELRWSGIGIEDWWRNEQFW  827



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   377 bits (968),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 227/627 (36%), Positives = 326/627 (52%), Gaps = 60/627 (10%)
 Frame = +2

Query  479   IAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGS  655
             + YR+ N   H     WL +++CE WF F W+L    KW  ++  TY +R  L +   G 
Sbjct  268   LRYRILN-PVHDALGLWLTSIICEIWFAFSWILDQFPKWFPIDRETYLDRLSLRYEREGE  326

Query  656   CEFPA-VDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVE  832
                 A VD+FV+T +P  EPP++T NTVLS+LA++YP +K++CY+SDD AS  TF AL E
Sbjct  327   PNMLAPVDIFVSTVDPMKEPPLVTANTVLSILAMDYPVDKISCYISDDGASMCTFEALSE  386

Query  833   ASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYANLCGKIE  1009
              ++FA+ WVPFCKK+ +  RAP  YF+    +  +   P F +E + M  EY     +I 
Sbjct  387   TAEFARKWVPFCKKFAIEPRAPEMYFSEKVDYLKDKVQPTFVKERRAMKREYEEFKVRIN  446

Query  1010  YATQKPS-------LFNKFATFADLDPNDHSTIIKVICENDESLAVG---VPHLIYISRE  1159
                 K +       +      +   +  DH  +I+V       L V    +P L+Y+SRE
Sbjct  447   AMVAKATKVPPGGWIMQDGTPWPGNNTKDHPGMIQVFLGQSGGLDVEGHELPRLVYVSRE  506

Query  1160  KRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERD  1339
             KRP  QH+ KAGAMN L RVSGV+TNAPFMLN+DCD Y+NN + V  AMCFL+  +  + 
Sbjct  507   KRPGFQHHKKAGAMNALVRVSGVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQVGKK  566

Query  1340  TGFVQFPQTFYDGL-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSP  1516
               +VQFPQ F DG+ ++D YA++  + +    +G   IQG  Y GTGC  RR+ +YG  P
Sbjct  567   VCYVQFPQRF-DGIDRNDRYANRNTVFFDINMKGLDGIQGPVYVGTGCVFRRQALYGYEP  625

Query  1517  NDTVTAEKLTDHD----------------------------------------LQKIYGK  1576
                    K+   D                                         +K +G+
Sbjct  626   PKGRKRPKMVSCDCCPCFGSRKKLPKYSQNGGNGAADIQGFDDEKELLKSQMNFEKKFGQ  685

Query  1577  SKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDI  1756
             S IFVTS      G   S +   L   L+ A  V +CGYE  T WG  +GW YGS+TEDI
Sbjct  686   SPIFVTSTLMIEGGVPPSSSPAAL---LKEAIHVISCGYEDKTEWGTELGWIYGSITEDI  742

Query  1757  LTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPI-FAA  1933
             LTG  +   GW++ +C+P+RP F G  P      LNQ+ RWA G  EI FS   P+ +  
Sbjct  743   LTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEIFFSHHSPVWYGY  802

Query  1934  LFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFI  2113
               G L++ +  AY+ + ++P   +  L Y  LP  CL+T    +P+ +  A +   ++F+
Sbjct  803   KEGKLKWLERFAYVNTTVYPFTSLPLLAYCTLPAICLLTGKFIMPEISTFASLFFIALFL  862

Query  2114  IYNLYTLWEYMEEKESIRAWWNNQRMW  2194
                +  + E      SI  WW N++ W
Sbjct  863   SIFITGILELRWSGVSIEEWWRNEQFW  889



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   377 bits (968),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 224/623 (36%), Positives = 327/623 (52%), Gaps = 56/623 (9%)
 Frame = +2

Query  479   IAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGS  655
             + YR+ N   H  +  WL +++CE WF F W+L    KW  ++  TY +R  L +   G 
Sbjct  267   LRYRILN-PVHDAFGLWLTSIICEIWFAFSWILDQFPKWFPIDRETYLDRLSLRYEREGE  325

Query  656   CEFPA-VDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVE  832
                 A VD+FV+T +P  EPP++T NT+LS+LA++YP +K++CY+SDD AS  TF AL E
Sbjct  326   PNMLAPVDIFVSTVDPMKEPPLVTANTLLSILAVDYPVDKISCYISDDGASMCTFEALSE  385

Query  833   ASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYANLCGKIE  1009
              ++F++ WVPFCKK+ +  RAP  YF+    +  +   P F +E + M  EY     +I 
Sbjct  386   TAEFSRKWVPFCKKFTIEPRAPEMYFSEKVDYLKDKVQPTFVKERRAMKREYEEFKIRIN  445

Query  1010  YATQKPS-------LFNKFATFADLDPNDHSTIIKVICENDESLAVG---VPHLIYISRE  1159
                 K +       +      +   +  DH  +I+V       L V    +P L+Y+SRE
Sbjct  446   AMVAKATKVPPGGWIMQDGTPWPGNNTKDHPGMIQVFLGQSGGLDVEGNELPRLVYVSRE  505

Query  1160  KRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERD  1339
             KRP  QH+ KAGAMN L RV+GV+TNAPFMLN+DCD Y+NN + V  AMCFL+  +  + 
Sbjct  506   KRPSFQHHKKAGAMNALVRVAGVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQVGKK  565

Query  1340  TGFVQFPQTFYDGL-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSP  1516
               +VQFPQ F DG+ + D YA++  + +    +G   IQG  Y GTGC  RR+ +YG  P
Sbjct  566   VCYVQFPQRF-DGIDRHDRYANRNTVFFDINMKGLDGIQGPVYVGTGCVFRRQALYGYEP  624

Query  1517  NDTVTAEKLTDHD------------------------------------LQKIYGKSKIF  1588
                    K+   D                                     +K +G+S IF
Sbjct  625   PKGRKRPKMVSCDCCPCFGRRKNLPKYAKDGTNVGGFEDDKEILKSQMNFEKKFGQSSIF  684

Query  1589  VtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTGI  1768
             VTS      G   S +   L   L+ A  V +CGYE  T WG  +GW YGS+TEDILTG 
Sbjct  685   VTSTLMIEGGVPPSSSPAAL---LKEAIHVISCGYEDKTEWGTELGWIYGSITEDILTGF  741

Query  1769  GIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPI-FAALFGN  1945
              +   GW++ +C+P+RP F G  P      LNQ+ RWA G  EI FS   P+ +    G 
Sbjct  742   KMHCRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEIFFSHHSPLCYGYKQGK  801

Query  1946  LQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYNL  2125
             L++ + L+Y+ + ++P   +  L Y  LP  CL+T    +P+ +  A +   ++F+   +
Sbjct  802   LKWLERLSYINTTVYPFTSLPLLAYCTLPAICLLTGKFIMPEISTFASLFFIALFLSIFI  861

Query  2126  YTLWEYMEEKESIRAWWNNQRMW  2194
               + E      SI  WW N++ W
Sbjct  862   TGILELRWSGVSIEEWWRNEQFW  884



>ref|XP_010420462.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Camelina sativa]
Length=1031

 Score =   377 bits (967),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 236/640 (37%), Positives = 336/640 (53%), Gaps = 59/640 (9%)
 Frame = +2

Query  437   RAVEVVIlllllslIAYRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTT  616
             R V V  L++L   + YR+ N   H     WL +++CE WF   W+L    KW  +E  T
Sbjct  245   RMVIVARLVILAVFLRYRLLN-PVHDALGLWLTSVICEIWFAVSWILDQFPKWFPIERET  303

Query  617   YPERF-LEWVENGSCEFPA-VDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVS  790
             Y +R  L +   G     A VD+FV+T +P  EPP++T NTVLS+LA++YP  K++CYVS
Sbjct  304   YLDRLSLRYEREGEPNMLAPVDVFVSTVDPLKEPPLVTSNTVLSILAMDYPVEKISCYVS  363

Query  791   DDSASPVTFYALVEASKFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWK  967
             DD AS +TF +L E ++FA+ WVPFCKK+++  RAP  YF     +  +   P F +E +
Sbjct  364   DDGASMLTFESLSETAEFARKWVPFCKKFSIEPRAPEMYFTLKIDYLQDKVHPTFVKERR  423

Query  968   KMNDEYANLCGKIEYATQKPS-------LFNKFATFADLDPNDHSTIIKVICENDESLAV  1126
              M  EY     +I     K S       +      +   +  DH  +I+V   +     V
Sbjct  424   AMKREYEEFKVRINALVAKASKVPLEGWIMQDGTPWPGNNTKDHPGMIQVFLGHSGGFDV  483

Query  1127  G---VPHLIYISREKRPKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVL  1297
                 +P L+Y+SREKRP  QH+ KAGAMN L RV+GV+TNAPFMLN+DCD YVNN + V 
Sbjct  484   EGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVAGVLTNAPFMLNLDCDHYVNNSKAVR  543

Query  1298  HAMCFLLGAKDERDTGFVQFPQTFYDGLK-DDPYASQYKIIYHCLGRGNAAIQGSFYDGT  1474
              AMCFL+  +  +   +VQFPQ F DG+  +D YA++  + +    +G   IQG  Y GT
Sbjct  544   EAMCFLMDPQIGKKVCYVQFPQRF-DGIDTNDRYANRNTVFFDINMKGLDGIQGPVYVGT  602

Query  1475  GCFHRRKVIYGLSP--------------------------------NDTVTA-------E  1537
             GC  +R+ +YG  P                                N  V A        
Sbjct  603   GCVFKRQALYGYDPPKGAKRPKMLSCGCCPCFGRRRKNKKHSKNDMNGDVAALGEGDKEH  662

Query  1538  KLTDHDLQKIYGKSKIFVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGH  1717
              +++ + +K +G+S IFVTS      G   S +  VL   L+ A  V +CGYE  T WG 
Sbjct  663   LMSEMNFEKKFGQSSIFVTSTLMEEGGVPPSSSPAVL---LKEAIHVISCGYEDKTEWGT  719

Query  1718  NIGWRYGSVTEDILTGIGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTE  1897
              +GW YGS+TEDILTG  +   GW++ +C+P+RP F G  P      LNQ+ RWA G  E
Sbjct  720   ELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  779

Query  1898  ILFSMKCPI-FAALFGNLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKG  2074
             I FS   P+ +    GNL++ +  AY  + ++P   I  L Y  LP  CL+T+   +P  
Sbjct  780   IFFSRHSPLWYGYKGGNLKWLERFAYANTTIYPFTSIPLLAYCILPAICLLTDKFIMPPI  839

Query  2075  NEVAIVIPASIFIIYNLYTLWEYMEEKESIRAWWNNQRMW  2194
             +  A +   S+F+   +  + E      SI  WW N++ W
Sbjct  840   STFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFW  879



>ref|XP_006453581.1| hypothetical protein CICLE_v10007321mg [Citrus clementina]
 gb|ESR66821.1| hypothetical protein CICLE_v10007321mg [Citrus clementina]
Length=1040

 Score =   377 bits (968),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 230/624 (37%), Positives = 326/624 (52%), Gaps = 59/624 (9%)
 Frame = +2

Query  485   YRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGSCE  661
             YR+ N   H     WL++++CE WF   W+L    KW  ++  TY +R    +   G   
Sbjct  269   YRILN-PVHDAIGLWLISVICEIWFAISWILDQFPKWFPIDRETYLDRLSFRYEREGEPN  327

Query  662   FPA-VDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
               A VD+FV+T +P  EPP++T NTVLS+LA++YP +K++CY+SDD AS +TF AL E +
Sbjct  328   MLAPVDIFVSTVDPLKEPPLVTANTVLSILAMDYPVDKISCYISDDGASIITFDALAETA  387

Query  839   KFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYANLCGKIEYA  1015
             +FA+ WVPFCKK+ +  RAP  YF     +  +   P F +E + M  EY     +I   
Sbjct  388   EFARKWVPFCKKFAIEPRAPEMYFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAI  447

Query  1016  TQKPS-------LFNKFATFADLDPNDHSTIIKV-ICENDESLAVG--VPHLIYISREKR  1165
               + S       +      +   +  DH  +I+V + ++    A G  +P L+Y+SREKR
Sbjct  448   VARASKIPPEGWIMPDGTPWPGNNTRDHPGMIQVFLGQSGGHDAEGNELPRLVYVSREKR  507

Query  1166  PKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTG  1345
             P  QH+ KAGAMN L RVSGV+TNAPFMLN+DCD YVNN + V  +MCFL+  +  R   
Sbjct  508   PGFQHHKKAGAMNALVRVSGVLTNAPFMLNLDCDHYVNNSKAVRESMCFLMDPQTGRKVC  567

Query  1346  FVQFPQTFYDGL-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND  1522
             +VQFPQ F DG+ + D YA++  + +    RG   IQG  Y GTGC  RR+ +YG  P  
Sbjct  568   YVQFPQRF-DGIDRHDRYANRNTVFFDINMRGLDGIQGPVYVGTGCVFRRQALYGYEPPK  626

Query  1523  TVTAEKLTDHD---------------------------------------LQKIYGKSKI  1585
                  K+   D                                        +K +G+S I
Sbjct  627   GPKRPKMVSCDCCPCFGRRKKKYSKHSANGENANLGGMDDDKELLMSQMNFEKKFGQSAI  686

Query  1586  FVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTG  1765
             FVTS      G   S +   L   L+ A  V +CGYE  T WG  +GW YGS+TEDILTG
Sbjct  687   FVTSTLMEQGGVPPSSSPASL---LKEAIHVISCGYEDKTEWGTELGWIYGSITEDILTG  743

Query  1766  IGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPI-FAALFG  1942
               +   GW++ +C+P+R  F G  P      LNQ+ RWA G  EI FS   P+ +    G
Sbjct  744   FKMHCRGWRSIYCMPKRAAFKGSAPINLSDRLNQVLRWALGSVEIFFSRHSPVWYGYKGG  803

Query  1943  NLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
             NL+F +  AY+ + ++P   I  L Y  LP  CL+T+   +P+ +  A +   ++FI   
Sbjct  804   NLRFLERFAYVNTTIYPFTSIPLLAYCVLPAICLLTDKFIMPEISTFASLFFIALFISIF  863

Query  2123  LYTLWEYMEEKESIRAWWNNQRMW  2194
                + E      SI  WW N++ W
Sbjct  864   TTGILELRWSGVSIEEWWRNEQFW  887



>gb|KDO62270.1| hypothetical protein CISIN_1g039060mg [Citrus sinensis]
Length=1040

 Score =   377 bits (968),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 230/624 (37%), Positives = 326/624 (52%), Gaps = 59/624 (9%)
 Frame = +2

Query  485   YRVWNLHSHGYYYTWLLALVCESWFTFIWVLVVSTKWNQVETTTYPERF-LEWVENGSCE  661
             YR+ N   H     WL++++CE WF   W+L    KW  ++  TY +R    +   G   
Sbjct  269   YRILN-PVHDAIGLWLISVICEIWFAISWILDQFPKWFPIDRETYLDRLSFRYEREGEPN  327

Query  662   FPA-VDMFVTTANPELEPPILTVNTVLSLLALEYPANKLACYVSDDSASPVTFYALVEAS  838
               A VD+FV+T +P  EPP++T NTVLS+LA++YP +K++CY+SDD AS +TF AL E +
Sbjct  328   MLAPVDIFVSTVDPLKEPPLVTANTVLSILAMDYPVDKISCYISDDGASIITFDALAETA  387

Query  839   KFAKLWVPFCKKYNVAVRAPFRYFNADHTFPPES-SPEFRREWKKMNDEYANLCGKIEYA  1015
             +FA+ WVPFCKK+ +  RAP  YF     +  +   P F +E + M  EY     +I   
Sbjct  388   EFARKWVPFCKKFAIEPRAPEMYFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAI  447

Query  1016  TQKPS-------LFNKFATFADLDPNDHSTIIKV-ICENDESLAVG--VPHLIYISREKR  1165
               + S       +      +   +  DH  +I+V + ++    A G  +P L+Y+SREKR
Sbjct  448   VARASKIPPEGWIMPDGTPWPGNNTRDHPGMIQVFLGQSGGHDAEGNELPRLVYVSREKR  507

Query  1166  PKHQHNFKAGAMNVLTRVSGVMTNAPFMLNVDCDFYVNNPEVVLHAMCFLLGAKDERDTG  1345
             P  QH+ KAGAMN L RVSGV+TNAPFMLN+DCD YVNN + V  +MCFL+  +  R   
Sbjct  508   PGFQHHKKAGAMNALVRVSGVLTNAPFMLNLDCDHYVNNSKAVRESMCFLMDPQTGRKVC  567

Query  1346  FVQFPQTFYDGL-KDDPYASQYKIIYHCLGRGNAAIQGSFYDGTGCFHRRKVIYGLSPND  1522
             +VQFPQ F DG+ + D YA++  + +    RG   IQG  Y GTGC  RR+ +YG  P  
Sbjct  568   YVQFPQRF-DGIDRHDRYANRNTVFFDINMRGLDGIQGPVYVGTGCVFRRQALYGYEPPK  626

Query  1523  TVTAEKLTDHD---------------------------------------LQKIYGKSKI  1585
                  K+   D                                        +K +G+S I
Sbjct  627   GPKRPKMVSCDCCPCFGRRKKKYSKHSANGENANLGGMDDDKELLMSQMNFEKKFGQSAI  686

Query  1586  FVtsatttlsgslssetFGVLSYSLEAASQVANCGYEFGTTWGHNIGWRYGSVTEDILTG  1765
             FVTS      G   S +   L   L+ A  V +CGYE  T WG  +GW YGS+TEDILTG
Sbjct  687   FVTSTLMEQGGVPPSSSPASL---LKEAIHVISCGYEDKTEWGLELGWIYGSITEDILTG  743

Query  1766  IGIQRMGWKTGFCVPERPGFLGCTPSTGLGSLNQMKRWASGHTEILFSMKCPI-FAALFG  1942
               +   GW++ +C+P+R  F G  P      LNQ+ RWA G  EI FS   P+ +    G
Sbjct  744   FKMHCRGWRSIYCMPKRAAFKGSAPINLSDRLNQVLRWALGSVEIFFSRHSPVWYGYKGG  803

Query  1943  NLQFRQCLAYMISILWPVRPIFELCYAFLPPYCLITNSHFLPKGNEVAIVIPASIFIIYN  2122
             NL+F +  AY+ + ++P   I  L Y  LP  CL+T+   +P+ +  A +   ++FI   
Sbjct  804   NLRFLERFAYVNTTIYPFTSIPLLAYCVLPAICLLTDKFIMPEISTFASLFFIALFISIF  863

Query  2123  LYTLWEYMEEKESIRAWWNNQRMW  2194
                + E      SI  WW N++ W
Sbjct  864   TTGILELRWSGVSIEEWWRNEQFW  887



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6691343371916