BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85641_g1_i1 len=551 path=[529:0-550]

Length=551
                                                                      Score     E

ref|XP_010662940.1|  PREDICTED: transcription repressor OFP10-like      121   1e-31   
ref|XP_009411403.1|  PREDICTED: transcription repressor OFP5-like       116   1e-29   
ref|XP_009401732.1|  PREDICTED: transcription repressor OFP4            110   3e-27   
ref|XP_002321359.1|  hypothetical protein POPTR_0015s00660g             108   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_007039236.1|  Ovate family protein 5                             107   5e-26   
ref|XP_006838309.1|  hypothetical protein AMTR_s00103p00131630          104   3e-25   
ref|XP_007219811.1|  hypothetical protein PRUPE_ppa026602mg             102   3e-24   
ref|XP_008234869.1|  PREDICTED: uncharacterized protein LOC103333754    102   3e-24   
ref|XP_010103071.1|  hypothetical protein L484_002607                 95.5    8e-22   
ref|XP_002519603.1|  conserved hypothetical protein                   89.4    2e-19   Ricinus communis
ref|XP_002966238.1|  hypothetical protein SELMODRAFT_407613           69.7    1e-11   
ref|XP_002982310.1|  hypothetical protein SELMODRAFT_421789           69.7    2e-11   
ref|XP_002967796.1|  hypothetical protein SELMODRAFT_69627            60.8    3e-09   
ref|XP_009624641.1|  PREDICTED: transcription repressor OFP15-like    61.6    2e-08   
ref|XP_004240188.1|  PREDICTED: transcription repressor OFP13-like    60.5    3e-08   
gb|EMT23489.1|  hypothetical protein F775_02514                       59.3    4e-08   
ref|XP_006346002.1|  PREDICTED: uncharacterized protein LOC102595094  60.1    5e-08   
ref|XP_009416042.1|  PREDICTED: transcription repressor OFP13-like    59.7    5e-08   
ref|XP_010545178.1|  PREDICTED: transcription repressor OFP12-like    58.5    8e-08   
ref|XP_007150663.1|  hypothetical protein PHAVU_005G171200g           59.7    9e-08   
ref|XP_010552817.1|  PREDICTED: transcription repressor OFP12-like    58.5    1e-07   
ref|XP_006849249.1|  hypothetical protein AMTR_s00027p00238760        59.3    1e-07   
ref|XP_011044041.1|  PREDICTED: transcription repressor OFP13-like    58.9    2e-07   
ref|XP_002269135.1|  PREDICTED: transcription repressor OFP13         58.2    2e-07   Vitis vinifera
emb|CAN62024.1|  hypothetical protein VITISV_004927                   58.2    2e-07   Vitis vinifera
ref|XP_002530160.1|  conserved hypothetical protein                   58.9    2e-07   Ricinus communis
ref|XP_004962442.1|  PREDICTED: uncharacterized protein LOC101755245  58.2    2e-07   
ref|XP_002326076.1|  ovate family protein                             58.9    3e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001235247.1|  uncharacterized protein LOC100527123             57.8    3e-07   
ref|XP_008231831.1|  PREDICTED: uncharacterized protein LOC103330999  57.8    4e-07   
ref|XP_007142874.1|  hypothetical protein PHAVU_007G024100g           57.8    4e-07   
gb|KHN10380.1|  hypothetical protein glysoja_049636                   57.4    4e-07   
ref|XP_006589708.1|  PREDICTED: uncharacterized protein LOC102668773  57.4    4e-07   
gb|AGV54162.1|  hypothetical protein                                  57.4    5e-07   
ref|XP_011046889.1|  PREDICTED: transcription repressor OFP13-like    57.8    5e-07   
ref|XP_008799737.1|  PREDICTED: transcription repressor OFP13-like    57.0    5e-07   
ref|XP_011041802.1|  PREDICTED: transcription repressor OFP4          58.2    5e-07   
ref|XP_007010460.1|  Ovate family protein 13                          57.8    5e-07   
ref|XP_009762599.1|  PREDICTED: transcription repressor OFP13-like    57.4    6e-07   
ref|XP_004497131.1|  PREDICTED: uncharacterized protein LOC101510698  57.0    8e-07   
emb|CDP10623.1|  unnamed protein product                              57.0    8e-07   
ref|XP_009596510.1|  PREDICTED: transcription repressor OFP13-like    56.6    8e-07   
ref|XP_002516628.1|  conserved hypothetical protein                   56.6    9e-07   Ricinus communis
ref|XP_010262945.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  57.0    1e-06   
ref|XP_010246483.1|  PREDICTED: transcription repressor OFP13         56.2    1e-06   
ref|XP_011090710.1|  PREDICTED: transcription repressor OFP12-like    56.2    1e-06   
gb|KDP37207.1|  hypothetical protein JCGZ_06263                       57.0    1e-06   
ref|XP_011032908.1|  PREDICTED: transcription repressor OFP13         55.8    1e-06   
ref|XP_002310994.2|  hypothetical protein POPTR_0008s01840g           55.8    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007214128.1|  hypothetical protein PRUPE_ppa018010mg           56.2    1e-06   
ref|XP_009387475.1|  PREDICTED: transcription repressor OFP13-like    55.1    2e-06   
gb|KEH44278.1|  ovate transcriptional repressor                       55.8    2e-06   
ref|XP_008391954.1|  PREDICTED: uncharacterized protein LOC103454142  56.2    2e-06   
ref|XP_004961753.1|  PREDICTED: uncharacterized protein LOC101777258  56.2    2e-06   
ref|XP_009349260.1|  PREDICTED: transcription repressor OFP15-like    55.8    2e-06   
ref|XP_009403672.1|  PREDICTED: transcription repressor OFP13-like    55.1    3e-06   
ref|XP_007027918.1|  Ovate family protein 13, putative                55.5    3e-06   
gb|EPS70453.1|  hypothetical protein M569_04311                       54.7    3e-06   
ref|XP_008442894.1|  PREDICTED: uncharacterized serine-rich prote...  55.1    3e-06   
ref|XP_002446442.1|  hypothetical protein SORBIDRAFT_06g016120        55.8    3e-06   Sorghum bicolor [broomcorn]
ref|XP_010090501.1|  hypothetical protein L484_012608                 55.1    3e-06   
ref|XP_002323398.2|  hypothetical protein POPTR_0016s07380g           55.1    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010931090.1|  PREDICTED: transcription repressor OFP13         54.7    4e-06   
ref|NP_001152151.1|  plant-specific domain TIGR01568 family protein   55.5    4e-06   Zea mays [maize]
gb|KDP36142.1|  hypothetical protein JCGZ_08786                       55.1    4e-06   
ref|XP_009349783.1|  PREDICTED: transcription repressor OFP15-like    55.5    4e-06   
ref|XP_008243474.1|  PREDICTED: uncharacterized protein LOC103341714  55.1    4e-06   
ref|XP_007202454.1|  hypothetical protein PRUPE_ppa010050mg           55.1    4e-06   
ref|XP_008667786.1|  PREDICTED: plant-specific domain TIGR01568 f...  55.5    4e-06   
ref|XP_009401180.1|  PREDICTED: transcription repressor OFP13         54.3    4e-06   
ref|NP_001145944.1|  plant-specific domain TIGR01568 family protein   55.1    4e-06   Zea mays [maize]
gb|KDO70576.1|  hypothetical protein CISIN_1g041802mg                 54.3    5e-06   
ref|XP_010553202.1|  PREDICTED: transcription repressor OFP1-like     54.3    5e-06   
gb|AFK36960.1|  unknown                                               55.1    5e-06   
ref|XP_004164609.1|  PREDICTED: uncharacterized protein LOC101227220  54.3    5e-06   
ref|XP_011080730.1|  PREDICTED: transcription repressor OFP1          55.1    5e-06   
ref|XP_004136703.1|  PREDICTED: uncharacterized protein LOC101216385  53.9    6e-06   
ref|XP_010910463.1|  PREDICTED: transcription repressor OFP13-like    53.9    6e-06   
ref|XP_008798879.1|  PREDICTED: transcription repressor OFP13         53.5    6e-06   
ref|XP_006854716.1|  hypothetical protein AMTR_s00030p00235460        53.9    6e-06   
ref|XP_009589294.1|  PREDICTED: transcription repressor OFP3-like     54.7    7e-06   
gb|KDP29272.1|  hypothetical protein JCGZ_19437                       53.9    7e-06   
ref|XP_011076850.1|  PREDICTED: transcription repressor OFP13         54.3    7e-06   
emb|CDO99927.1|  unnamed protein product                              54.3    7e-06   
ref|XP_009389776.1|  PREDICTED: transcription repressor OFP13-like    53.5    8e-06   
ref|XP_010683621.1|  PREDICTED: transcription repressor OFP13         54.3    8e-06   
ref|XP_002309397.1|  hypothetical protein POPTR_0006s22190g           54.3    8e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006481864.1|  PREDICTED: uncharacterized protein LOC102627855  54.3    8e-06   
ref|XP_006430100.1|  hypothetical protein CICLE_v10012467mg           54.3    9e-06   
ref|XP_002316486.1|  hypothetical protein POPTR_0010s24790g           53.5    9e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011094255.1|  PREDICTED: transcription repressor OFP13-like    53.9    9e-06   
ref|XP_010925191.1|  PREDICTED: transcription repressor OFP14-like    53.9    9e-06   
ref|XP_006576901.1|  PREDICTED: uncharacterized protein LOC102659610  53.9    1e-05   
ref|XP_009412405.1|  PREDICTED: transcription repressor OFP14-like    53.9    1e-05   
ref|XP_006604442.1|  PREDICTED: uncharacterized protein LOC102663...  53.5    1e-05   
ref|XP_003581214.1|  PREDICTED: transcription repressor OFP13-like    54.3    1e-05   
gb|KHN10677.1|  hypothetical protein glysoja_019108                   53.5    1e-05   
ref|XP_004975587.1|  PREDICTED: uncharacterized protein LOC101773173  53.9    1e-05   
ref|XP_008387053.1|  PREDICTED: uncharacterized protein LOC103449509  53.9    1e-05   
ref|XP_008784093.1|  PREDICTED: transcription repressor OFP13-like    53.1    1e-05   
ref|NP_001236966.1|  uncharacterized protein LOC100527503             53.5    1e-05   
gb|KHM98764.1|  hypothetical protein glysoja_030817                   53.5    1e-05   
gb|KCW50561.1|  hypothetical protein EUGRSUZ_J00277                   53.5    1e-05   
ref|XP_009372561.1|  PREDICTED: transcription repressor OFP13-like    53.9    1e-05   
gb|EMT04058.1|  hypothetical protein F775_01001                       53.5    1e-05   
ref|XP_010031300.1|  PREDICTED: transcription repressor OFP13         53.5    1e-05   
gb|KHN45278.1|  hypothetical protein glysoja_043453                   52.0    2e-05   
ref|XP_004486277.1|  PREDICTED: protein Shroom4-like                  53.5    2e-05   
ref|XP_009627121.1|  PREDICTED: transcription repressor OFP5          53.9    2e-05   
gb|KHN02569.1|  hypothetical protein glysoja_002593                   52.8    2e-05   
ref|XP_010541469.1|  PREDICTED: transcription repressor OFP3          53.1    2e-05   
ref|XP_010695079.1|  PREDICTED: transcription repressor OFP13         53.1    2e-05   
ref|XP_002275570.1|  PREDICTED: transcription repressor OFP13         52.8    2e-05   Vitis vinifera
ref|XP_009358432.1|  PREDICTED: transcription repressor OFP2-like     53.5    2e-05   
ref|XP_002439563.1|  hypothetical protein SORBIDRAFT_09g012740        53.1    2e-05   Sorghum bicolor [broomcorn]
emb|CAN61477.1|  hypothetical protein VITISV_021409                   52.8    2e-05   Vitis vinifera
ref|XP_003616018.1|  Plant-specific domain TIGR01568 family protein   53.5    2e-05   
gb|EYU19830.1|  hypothetical protein MIMGU_mgv1a022507mg              52.8    2e-05   
emb|CDP04054.1|  unnamed protein product                              53.5    2e-05   
ref|XP_009402806.1|  PREDICTED: transcription repressor OFP13-like    52.0    2e-05   
ref|XP_003629846.1|  hypothetical protein MTR_8g087530                53.1    3e-05   
ref|XP_008810113.1|  PREDICTED: transcription repressor OFP14-like    52.8    3e-05   
ref|XP_010919418.1|  PREDICTED: transcription repressor OFP13-like    52.4    3e-05   
ref|XP_011043235.1|  PREDICTED: transcription repressor OFP6-like     52.0    3e-05   
emb|CBI30728.3|  unnamed protein product                              52.0    3e-05   
ref|XP_008775318.1|  PREDICTED: transcription repressor OFP14-like    52.4    3e-05   
ref|XP_010254472.1|  PREDICTED: transcription repressor OFP14-like    52.4    3e-05   
ref|XP_011004320.1|  PREDICTED: transcription repressor OFP13-like    52.0    3e-05   
ref|XP_007017502.1|  Ovate family protein 8, putative                 52.8    3e-05   
ref|XP_002892365.1|  hypothetical protein ARALYDRAFT_470713           52.8    3e-05   
ref|XP_006417868.1|  hypothetical protein EUTSA_v10009577mg           52.8    3e-05   
ref|XP_010104796.1|  hypothetical protein L484_018851                 52.4    3e-05   
ref|XP_009386725.1|  PREDICTED: transcription repressor OFP1-like     52.8    4e-05   
ref|XP_009787220.1|  PREDICTED: transcription repressor OFP15-like    52.4    4e-05   
ref|XP_002313599.1|  hypothetical protein POPTR_0009s16320g           52.0    4e-05   Populus trichocarpa [western balsam poplar]
gb|KHN08720.1|  hypothetical protein glysoja_037042                   52.4    4e-05   
gb|EPS72549.1|  hypothetical protein M569_02209                       51.2    4e-05   
ref|XP_009764897.1|  PREDICTED: transcription repressor OFP5          52.8    4e-05   
ref|XP_002528201.1|  conserved hypothetical protein                   52.4    4e-05   Ricinus communis
ref|XP_006588856.1|  PREDICTED: uncharacterized protein LOC100806620  52.4    4e-05   
ref|XP_002299642.1|  ovate family protein                             52.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010430037.1|  PREDICTED: transcription repressor OFP14-like    52.4    4e-05   
ref|XP_007142050.1|  hypothetical protein PHAVU_008G248300g           52.4    4e-05   
ref|XP_009374363.1|  PREDICTED: transcription repressor OFP4-like     52.4    5e-05   
ref|XP_006653379.1|  PREDICTED: uncharacterized protein LOC102709361  52.0    5e-05   
gb|KHN06430.1|  hypothetical protein glysoja_010774                   52.4    5e-05   
ref|XP_006594926.1|  PREDICTED: uncharacterized protein LOC102670259  50.8    5e-05   
ref|XP_011032802.1|  PREDICTED: transcription repressor OFP14-like    52.0    5e-05   
ref|XP_003518202.1|  PREDICTED: uncharacterized protein LOC100816044  52.0    5e-05   
ref|XP_003518343.1|  PREDICTED: uncharacterized protein LOC100780926  52.4    5e-05   
gb|KHN48028.1|  hypothetical protein glysoja_015498                   52.0    5e-05   
ref|XP_004961935.1|  PREDICTED: uncharacterized protein LOC101785753  51.6    5e-05   
ref|XP_010417768.1|  PREDICTED: transcription repressor OFP14-like    52.0    6e-05   
gb|AEW07785.1|  hypothetical protein 0_11531_01                       50.4    6e-05   
ref|XP_009402214.1|  PREDICTED: transcription repressor OFP1-like     52.0    6e-05   
gb|AFW56088.1|  hypothetical protein ZEAMMB73_550984                  52.0    6e-05   
gb|AFG67771.1|  hypothetical protein 0_11531_01                       50.4    6e-05   
ref|NP_001052758.1|  Os04g0415100                                     52.0    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004294737.1|  PREDICTED: uncharacterized protein LOC101298496  52.0    6e-05   
gb|EEE60972.1|  hypothetical protein OsJ_14751                        52.0    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77250.1|  hypothetical protein OsI_15834                        52.0    6e-05   Oryza sativa Indica Group [Indian rice]
gb|AEW07786.1|  hypothetical protein 0_11531_01                       50.1    6e-05   
ref|XP_006833280.1|  hypothetical protein AMTR_s00109p00024120        51.6    6e-05   
ref|XP_007202838.1|  hypothetical protein PRUPE_ppa014570mg           52.0    6e-05   
ref|XP_002439957.1|  hypothetical protein SORBIDRAFT_09g023390        52.0    6e-05   Sorghum bicolor [broomcorn]
ref|XP_011021025.1|  PREDICTED: transcription repressor OFP4-like     52.0    7e-05   
ref|XP_001752154.1|  predicted protein                                52.4    7e-05   
ref|XP_009602773.1|  PREDICTED: transcription repressor OFP7-like     50.4    7e-05   
ref|XP_009774072.1|  PREDICTED: transcription repressor OFP14         51.6    7e-05   
ref|XP_004501129.1|  PREDICTED: uncharacterized protein LOC101512953  51.6    7e-05   
ref|XP_010651853.1|  PREDICTED: transcription repressor OFP13-like    50.4    7e-05   
ref|XP_002518279.1|  hypothetical protein RCOM_0815310                52.0    7e-05   Ricinus communis
emb|CAE01517.1|  OJ991214_12.6                                        51.6    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011079872.1|  PREDICTED: transcription repressor OFP16-like    51.2    7e-05   
gb|EPS72109.1|  hypothetical protein M569_02648                       49.3    7e-05   
ref|XP_009419680.1|  PREDICTED: transcription repressor OFP4-like     51.6    7e-05   
ref|NP_178114.1|  ovate family protein 14                             51.6    7e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933952.1|  PREDICTED: transcription repressor OFP13-lik...  51.2    8e-05   
ref|XP_010315430.1|  PREDICTED: transcription repressor OFP15         51.6    8e-05   
ref|XP_008241648.1|  PREDICTED: uncharacterized protein LOC103340060  51.6    8e-05   
ref|XP_010108488.1|  hypothetical protein L484_010681                 51.6    8e-05   
gb|KEH41949.1|  ovate transcriptional repressor                       50.8    8e-05   
ref|XP_002458691.1|  hypothetical protein SORBIDRAFT_03g038320        50.1    8e-05   Sorghum bicolor [broomcorn]
ref|XP_006389705.1|  hypothetical protein EUTSA_v10019813mg           51.6    9e-05   
ref|XP_002265116.1|  PREDICTED: transcription repressor OFP5          51.6    9e-05   Vitis vinifera
ref|XP_010539496.1|  PREDICTED: transcription repressor OFP14-like    51.2    9e-05   
ref|XP_009619234.1|  PREDICTED: transcription repressor OFP13-like    51.2    9e-05   
emb|CAN76919.1|  hypothetical protein VITISV_015621                   50.4    9e-05   Vitis vinifera
ref|XP_010931348.1|  PREDICTED: transcription repressor OFP3          51.6    9e-05   
ref|XP_009136961.1|  PREDICTED: transcription repressor OFP5-like...  51.2    1e-04   
gb|KDP21442.1|  hypothetical protein JCGZ_21913                       50.8    1e-04   
ref|XP_009136962.1|  PREDICTED: transcription repressor OFP5-like...  51.2    1e-04   
ref|XP_004970678.1|  PREDICTED: protein sister of odd and bowel-like  50.8    1e-04   
ref|XP_009801448.1|  PREDICTED: transcription repressor OFP3-like     51.2    1e-04   
ref|XP_002276629.1|  PREDICTED: transcription repressor OFP4          51.2    1e-04   Vitis vinifera
ref|XP_004305636.1|  PREDICTED: uncharacterized protein LOC101293706  51.2    1e-04   
ref|XP_009136960.1|  PREDICTED: transcription repressor OFP5-like...  51.2    1e-04   
emb|CAH66423.1|  H0622F05.6                                           51.2    1e-04   Oryza sativa [red rice]
ref|XP_002517130.1|  conserved hypothetical protein                   50.4    1e-04   Ricinus communis
gb|EPS69579.1|  hypothetical protein M569_05187                       48.5    1e-04   
ref|XP_009777531.1|  PREDICTED: transcription repressor OFP13-like    50.8    1e-04   
ref|NP_172174.1|  ovate family protein 4                              50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310801.1|  ovate family protein                             51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007208152.1|  hypothetical protein PRUPE_ppa022134mg           51.2    1e-04   
ref|XP_010912802.1|  PREDICTED: transcription repressor OFP14         50.8    1e-04   
ref|XP_010106010.1|  hypothetical protein L484_021187                 50.8    1e-04   
ref|XP_006366994.1|  PREDICTED: uncharacterized protein LOC102580284  50.1    1e-04   
ref|XP_009126889.1|  PREDICTED: transcription repressor OFP3          50.8    1e-04   
ref|XP_002447357.1|  hypothetical protein SORBIDRAFT_06g033540        50.8    1e-04   Sorghum bicolor [broomcorn]
ref|XP_006445767.1|  hypothetical protein CICLE_v10016377mg           50.4    1e-04   
ref|XP_002319964.2|  hypothetical protein POPTR_0013s15120g           50.8    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011025749.1|  PREDICTED: transcription repressor OFP7          50.8    1e-04   
ref|XP_004494233.1|  PREDICTED: uncharacterized protein LOC101497716  50.4    1e-04   
ref|XP_010665684.1|  PREDICTED: transcription repressor OFP5          50.8    2e-04   
emb|CDY58970.1|  BnaC09g38050D                                        50.1    2e-04   
gb|KDO43030.1|  hypothetical protein CISIN_1g035731mg                 50.4    2e-04   
ref|XP_010239501.1|  PREDICTED: transcription repressor OFP13-like    50.8    2e-04   
ref|XP_004490708.1|  PREDICTED: uncharacterized protein LOC101489571  50.8    2e-04   
ref|XP_008354530.1|  PREDICTED: uncharacterized protein LOC103418164  50.8    2e-04   
emb|CDX92512.1|  BnaA10g15510D                                        50.1    2e-04   
ref|XP_006400526.1|  hypothetical protein EUTSA_v10015317mg           50.1    2e-04   
emb|CDO98061.1|  unnamed protein product                              50.4    2e-04   
ref|XP_010317346.1|  PREDICTED: transcription repressor OFP5          50.8    2e-04   
ref|XP_002312831.1|  hypothetical protein POPTR_0009s16330g           49.7    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010536003.1|  PREDICTED: transcription repressor OFP8          50.4    2e-04   
ref|XP_008446745.1|  PREDICTED: uncharacterized protein LOC103489...  50.1    2e-04   
ref|XP_009407003.1|  PREDICTED: transcription repressor OFP3-like     50.4    2e-04   
ref|XP_008456619.1|  PREDICTED: uncharacterized protein LOC103496522  50.1    2e-04   
ref|XP_008384677.1|  PREDICTED: uncharacterized protein LOC103447277  50.8    2e-04   
ref|XP_006654470.1|  PREDICTED: uncharacterized protein LOC102700991  50.4    2e-04   
ref|XP_010233191.1|  PREDICTED: transcription repressor OFP1-like     50.8    2e-04   
ref|XP_010933951.1|  PREDICTED: transcription repressor OFP13-lik...  50.4    2e-04   
ref|XP_007162447.1|  hypothetical protein PHAVU_001G153000g           50.1    2e-04   
ref|XP_006577092.1|  PREDICTED: formin-I-like                         50.4    2e-04   
ref|XP_010252093.1|  PREDICTED: transcription repressor OFP1-like     50.4    2e-04   
ref|XP_004960006.1|  PREDICTED: uncharacterized protein LOC101777954  50.4    2e-04   
ref|XP_009626147.1|  PREDICTED: transcription repressor OFP14         50.4    2e-04   
gb|KHN33169.1|  hypothetical protein glysoja_039485                   50.4    2e-04   
ref|XP_002520717.1|  conserved hypothetical protein                   49.7    2e-04   Ricinus communis
ref|XP_004140993.1|  PREDICTED: uncharacterized protein LOC101209686  50.1    2e-04   
gb|KGN46052.1|  hypothetical protein Csa_6G046300                     50.1    2e-04   
ref|XP_004495193.1|  PREDICTED: uncharacterized protein LOC101502325  49.7    2e-04   
ref|XP_004970397.1|  PREDICTED: uncharacterized protein LOC101773811  50.4    2e-04   
ref|NP_001136474.1|  uncharacterized protein LOC100216587             50.4    2e-04   Zea mays [maize]
ref|XP_006358138.1|  PREDICTED: caldesmon-like                        50.4    2e-04   
ref|XP_003593824.1|  hypothetical protein MTR_2g018030                50.4    2e-04   
gb|KDP22779.1|  hypothetical protein JCGZ_00366                       50.4    2e-04   
ref|XP_008446744.1|  PREDICTED: uncharacterized protein DDB_G0271...  50.1    2e-04   
gb|KDO58264.1|  hypothetical protein CISIN_1g045319mg                 48.5    2e-04   
gb|EYU46568.1|  hypothetical protein MIMGU_mgv1a013517mg              49.7    2e-04   
ref|XP_002887851.1|  ATOFP14/OFP14                                    50.1    2e-04   
ref|XP_004250469.2|  PREDICTED: transcription repressor OFP13         49.7    2e-04   
ref|XP_008679446.1|  PREDICTED: putative GPI-anchored protein PB1...  50.1    2e-04   
emb|CDY29674.1|  BnaA04g17530D                                        50.1    3e-04   
emb|CDY62219.1|  BnaCnng39640D                                        50.1    3e-04   
ref|XP_007159490.1|  hypothetical protein PHAVU_002G241900g           50.1    3e-04   
emb|CDY44933.1|  BnaA02g04380D                                        49.3    3e-04   
emb|CDY32990.1|  BnaA10g11960D                                        50.1    3e-04   
ref|XP_004173791.1|  PREDICTED: uncharacterized LOC101204431          50.1    3e-04   
ref|XP_004135368.1|  PREDICTED: uncharacterized protein LOC101204431  50.1    3e-04   
ref|XP_009793465.1|  PREDICTED: transcription repressor OFP4-like     50.1    3e-04   
ref|XP_004305296.1|  PREDICTED: uncharacterized protein LOC101295357  50.1    3e-04   
emb|CDY01560.1|  BnaC07g35500D                                        50.1    3e-04   
emb|CDY02063.1|  BnaC04g14380D                                        50.1    3e-04   
gb|EYU41482.1|  hypothetical protein MIMGU_mgv1a026971mg              49.3    3e-04   
ref|XP_002523863.1|  hypothetical protein RCOM_1282480                48.9    3e-04   Ricinus communis
ref|XP_004504419.1|  PREDICTED: uncharacterized protein LOC101510071  50.1    3e-04   
ref|XP_006424138.1|  hypothetical protein CICLE_v10030253mg           48.9    3e-04   
ref|XP_002510365.1|  conserved hypothetical protein                   50.1    3e-04   Ricinus communis
ref|XP_009120867.1|  PREDICTED: transcription repressor OFP8          49.3    3e-04   
ref|XP_006306181.1|  hypothetical protein CARUB_v10011767mg           49.7    3e-04   
ref|XP_009141063.1|  PREDICTED: transcription repressor OFP2-like     49.7    3e-04   
ref|XP_006481846.1|  PREDICTED: uncharacterized protein LOC102621792  48.1    3e-04   
ref|XP_010453556.1|  PREDICTED: transcription repressor OFP3-like     49.7    3e-04   
ref|XP_004977345.1|  PREDICTED: mucin-19-like                         49.7    3e-04   
ref|XP_006381702.1|  hypothetical protein POPTR_0006s16140g           49.7    3e-04   
ref|NP_180599.1|  ovate family protein 2                              49.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03642.1|  unnamed protein product                              49.7    3e-04   
gb|KDO51193.1|  hypothetical protein CISIN_1g043280mg                 49.7    3e-04   
ref|XP_009126381.1|  PREDICTED: transcription repressor OFP8-like     48.9    3e-04   
ref|XP_009393971.1|  PREDICTED: transcription repressor OFP14-like    49.7    3e-04   
ref|XP_006427037.1|  hypothetical protein CICLE_v10027509mg           49.7    3e-04   
ref|XP_009120344.1|  PREDICTED: transcription repressor OFP3-like     49.7    3e-04   
ref|XP_007144644.1|  hypothetical protein PHAVU_007G173000g           49.3    3e-04   
ref|XP_008792265.1|  PREDICTED: transcription repressor OFP2-like     49.7    4e-04   
ref|XP_010912356.1|  PREDICTED: transcription repressor OFP13-like    49.3    4e-04   
ref|XP_004234614.1|  PREDICTED: transcription repressor OFP7-like...  49.7    4e-04   
ref|XP_002866259.1|  ATOFP3/OFP3                                      49.7    4e-04   
ref|XP_006592771.1|  PREDICTED: uncharacterized protein LOC102661990  48.5    4e-04   
gb|KCW69594.1|  hypothetical protein EUGRSUZ_F03014                   49.7    4e-04   
gb|KFK27365.1|  hypothetical protein AALP_AA8G373400                  49.7    4e-04   
ref|XP_007034767.1|  Ovate family protein 12, putative                49.3    4e-04   
ref|XP_007015722.1|  Uncharacterized protein TCM_041298               49.3    4e-04   
ref|XP_010317715.1|  PREDICTED: transcription repressor OFP7-like...  49.7    4e-04   
gb|KHN01889.1|  hypothetical protein glysoja_044815                   49.7    4e-04   
ref|NP_200644.1|  ovate family protein 3                              49.3    4e-04   
ref|XP_003544334.1|  PREDICTED: uncharacterized protein LOC100797854  49.7    4e-04   
gb|KHN17967.1|  hypothetical protein glysoja_035053                   48.5    4e-04   
ref|XP_010062454.1|  PREDICTED: transcription repressor OFP14         49.3    4e-04   
emb|CDY43860.1|  BnaC09g33830D                                        49.3    4e-04   
ref|NP_001055670.1|  Os05g0441400                                     49.3    4e-04   
ref|XP_001763963.1|  predicted protein                                49.7    4e-04   
ref|XP_002441859.1|  hypothetical protein SORBIDRAFT_08g003620        49.3    4e-04   
gb|EYU21877.1|  hypothetical protein MIMGU_mgv1a020161mg              49.3    4e-04   
gb|EYU45676.1|  hypothetical protein MIMGU_mgv1a021422mg              49.3    4e-04   
ref|XP_008674880.1|  PREDICTED: uncharacterized protein LOC103651061  49.3    4e-04   
ref|NP_001066202.1|  Os12g0158300                                     49.3    4e-04   
ref|XP_007227310.1|  hypothetical protein PRUPE_ppa016655mg           49.3    5e-04   
emb|CDX99420.1|  BnaC01g11320D                                        49.3    5e-04   
ref|XP_006348493.1|  PREDICTED: uncharacterized protein LOC102586488  49.3    5e-04   
gb|EMS50273.1|  hypothetical protein TRIUR3_18530                     48.9    5e-04   
gb|KFK28564.1|  hypothetical protein AALP_AA7G012700                  49.3    5e-04   
ref|XP_009106780.1|  PREDICTED: transcription repressor OFP14         49.3    5e-04   
ref|XP_006575070.1|  PREDICTED: uncharacterized protein LOC102660213  48.5    5e-04   
emb|CDX87287.1|  BnaA07g35860D                                        49.3    5e-04   
gb|KHN04235.1|  hypothetical protein glysoja_040999                   49.3    5e-04   
ref|XP_008220895.1|  PREDICTED: uncharacterized protein LOC103320934  49.3    5e-04   
ref|XP_011085317.1|  PREDICTED: uncharacterized protein LOC105167340  49.3    5e-04   
ref|XP_006301331.1|  hypothetical protein CARUB_v10021740mg           48.9    5e-04   
gb|EPS64432.1|  hypothetical protein M569_10349                       46.2    5e-04   
ref|XP_009385627.1|  PREDICTED: transcription repressor OFP14-like    48.9    6e-04   
ref|XP_004293215.1|  PREDICTED: uncharacterized protein LOC101308843  48.9    6e-04   
gb|EPS61859.1|  hypothetical protein M569_12934                       46.2    6e-04   
ref|XP_011095118.1|  PREDICTED: transcription repressor OFP1          49.3    6e-04   
ref|XP_003635864.1|  hypothetical protein MTR_013s0007                48.9    6e-04   
ref|XP_010483413.1|  PREDICTED: transcription repressor OFP3-like     48.9    6e-04   
ref|XP_008442333.1|  PREDICTED: uncharacterized protein LOC103486236  48.9    6e-04   
ref|XP_010475442.1|  PREDICTED: transcription repressor OFP4-like     48.9    6e-04   
ref|XP_009383053.1|  PREDICTED: transcription repressor OFP13-like    48.9    6e-04   
ref|XP_006833284.1|  hypothetical protein AMTR_s00109p00026640        48.9    6e-04   
ref|XP_008793509.1|  PREDICTED: transcription repressor OFP14-like    48.1    6e-04   
ref|XP_006588632.1|  PREDICTED: uncharacterized protein LOC102663296  48.5    6e-04   
ref|XP_008657114.1|  PREDICTED: uncharacterized protein LOC103636549  48.9    6e-04   
ref|XP_010452383.1|  PREDICTED: transcription repressor OFP13-like    48.9    6e-04   
ref|XP_010249776.1|  PREDICTED: transcription repressor OFP14-like    48.9    6e-04   
gb|KHN03806.1|  hypothetical protein glysoja_011035                   48.5    6e-04   
gb|KFK26818.1|  hypothetical protein AALP_AA8G297500                  48.9    6e-04   
ref|XP_004978717.1|  PREDICTED: mucin-19-like                         48.9    6e-04   
ref|XP_007146867.1|  hypothetical protein PHAVU_006G077000g           48.9    6e-04   
ref|XP_008360410.1|  PREDICTED: uncharacterized protein LOC103424115  48.9    6e-04   
ref|XP_010420776.1|  PREDICTED: transcription repressor OFP8-like     48.5    7e-04   
ref|NP_001152486.1|  plant-specific domain TIGR01568 family protein   48.5    7e-04   
ref|XP_003590633.1|  Ethylene receptor                                48.5    7e-04   
ref|XP_010530387.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  48.9    7e-04   
ref|XP_010443554.1|  PREDICTED: transcription repressor OFP3-like     48.9    7e-04   
ref|XP_002449021.1|  hypothetical protein SORBIDRAFT_05g003530        48.9    7e-04   
gb|AFW78118.1|  plant-specific domain TIGR01568 family protein        48.5    7e-04   
ref|XP_008375550.1|  PREDICTED: uncharacterized protein LOC103438780  48.5    7e-04   
ref|XP_001783542.1|  predicted protein                                49.3    7e-04   
ref|XP_010457847.1|  PREDICTED: transcription repressor OFP4-like     48.9    7e-04   
ref|XP_010095277.1|  hypothetical protein L484_014618                 48.9    7e-04   
ref|XP_006410100.1|  hypothetical protein EUTSA_v10017964mg           48.9    7e-04   
ref|XP_010434489.1|  PREDICTED: transcription repressor OFP5-like     48.9    7e-04   
gb|KHN48405.1|  hypothetical protein glysoja_042270                   48.9    7e-04   
ref|XP_003552922.1|  PREDICTED: uncharacterized protein LOC100798120  48.9    7e-04   
gb|KDP45718.1|  hypothetical protein JCGZ_17325                       48.9    7e-04   
ref|XP_007024118.1|  Ovate family protein 14, putative                48.5    8e-04   
ref|XP_006843708.1|  hypothetical protein AMTR_s00007p00212750        48.9    8e-04   
ref|XP_006398934.1|  hypothetical protein EUTSA_v10014455mg           48.5    8e-04   
ref|XP_009384772.1|  PREDICTED: transcription repressor OFP2-like     48.5    8e-04   
ref|XP_010493041.1|  PREDICTED: transcription repressor OFP8-like     48.1    8e-04   
ref|XP_004172085.1|  PREDICTED: uncharacterized protein LOC101229726  48.5    9e-04   
ref|XP_010916741.1|  PREDICTED: transcription repressor OFP7-like     48.5    9e-04   
ref|XP_011077817.1|  PREDICTED: transcription repressor OFP13-like    48.5    9e-04   
ref|XP_004137682.1|  PREDICTED: uncharacterized protein LOC101203459  48.5    9e-04   
ref|XP_010439804.1|  PREDICTED: transcription repressor OFP5          48.5    9e-04   
ref|XP_004236407.1|  PREDICTED: transcription repressor OFP14         48.5    9e-04   
gb|EYU18097.1|  hypothetical protein MIMGU_mgv1a025702mg              48.5    9e-04   
ref|XP_011070423.1|  PREDICTED: uncharacterized protein LOC105156079  47.8    0.001   
gb|EYU22326.1|  hypothetical protein MIMGU_mgv1a025822mg              48.5    0.001   
gb|KFK24919.1|  hypothetical protein AALP_AA8G042100                  48.1    0.001   
ref|XP_008462672.1|  PREDICTED: putative uncharacterized protein ...  48.5    0.001   
gb|EYU21547.1|  hypothetical protein MIMGU_mgv1a012553mg              48.1    0.001   
ref|XP_006283967.1|  hypothetical protein CARUB_v10005090mg           48.5    0.001   
ref|XP_009419860.1|  PREDICTED: transcription repressor OFP1-like     48.1    0.001   



>ref|XP_010662940.1| PREDICTED: transcription repressor OFP10-like [Vitis vinifera]
Length=115

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  406  ISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIV  227
            ISFSASLP D    F+DS+CAV YS DP SD+R SI+EMI +VGV DW+EMEEL+YCYI 
Sbjct  33   ISFSASLPGDVCGGFADSVCAVKYSMDPFSDMRESIMEMIREVGVHDWNEMEELVYCYIA  92

Query  226  LNSLEVHGFIEQAFLSLCSTST  161
            LNS +VH FI+ AFLSLCS+S+
Sbjct  93   LNSSQVHQFIQDAFLSLCSSSS  114



>ref|XP_009411403.1| PREDICTED: transcription repressor OFP5-like [Musa acuminata 
subsp. malaccensis]
Length=112

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  406  ISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIV  227
            +SFSASLP D   A ++SICAV YS+DP++D R SILEMI D GV+DW EMEEL+YCY+V
Sbjct  23   LSFSASLPGDVRGALAESICAVKYSSDPLADFRESILEMIRDGGVKDWEEMEELVYCYVV  82

Query  226  LNSLEVHGFIEQAFLSLCST  167
            LNS +V  FI  AFLS+CST
Sbjct  83   LNSSDVRCFIADAFLSVCST  102



>ref|XP_009401732.1| PREDICTED: transcription repressor OFP4 [Musa acuminata subsp. 
malaccensis]
Length=113

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  406  ISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIV  227
            ISFSA LP D      +SICAV YS DP +D R SILEMI D GV+DW EMEEL+YCY+V
Sbjct  32   ISFSARLPGDVRGDLKESICAVKYSVDPFADFRKSILEMIRDGGVRDWEEMEELVYCYVV  91

Query  226  LNSLEVHGFIEQAFLSLCS  170
            LN  ++H FI +AFLS+CS
Sbjct  92   LNPSDLHCFIAEAFLSVCS  110



>ref|XP_002321359.1| hypothetical protein POPTR_0015s00660g [Populus trichocarpa]
 gb|EEF05486.1| hypothetical protein POPTR_0015s00660g [Populus trichocarpa]
Length=103

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -2

Query  406  ISFSASLPDDAHEAFS-DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYI  230
            IS SASLP+D   AFS D+ICAV  S DP SD+RASILEMI +VGV DW EMEEL+YCYI
Sbjct  21   ISLSASLPEDVCGAFSGDTICAVKLSKDPFSDMRASILEMIQNVGVHDWDEMEELVYCYI  80

Query  229  VLNSLEVHGFIEQAFLSL  176
             LNS ++HG I  AFLSL
Sbjct  81   ALNSPDLHGIIANAFLSL  98



>ref|XP_007039236.1| Ovate family protein 5 [Theobroma cacao]
 gb|EOY23737.1| Ovate family protein 5 [Theobroma cacao]
Length=119

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -2

Query  454  QEMEVQEVkkkkKNRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVG  275
             +ME ++ + K+ +RI SFSA+LP D    F+ S+C V  S DP SDIR SIL+MI D G
Sbjct  25   NKMERKKRRLKRHDRI-SFSATLPGDGSGVFAGSLCVVKLSKDPFSDIRESILDMIDDAG  83

Query  274  VQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSLC  173
            V+DW+ MEEL+YCYI LNS EVH  I  AFLSLC
Sbjct  84   VRDWNTMEELVYCYIALNSPEVHEIIVNAFLSLC  117



>ref|XP_006838309.1| hypothetical protein AMTR_s00103p00131630 [Amborella trichopoda]
 gb|ERN00878.1| hypothetical protein AMTR_s00103p00131630 [Amborella trichopoda]
Length=88

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -2

Query  409  IISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYI  230
            I SFSASLP D H  F+DSICAV YS DP  D R SI++M+ +  V++W+E+EEL+YCY+
Sbjct  9    ITSFSASLPTDVHGLFADSICAVQYSLDPSMDFRVSIIQMMREKEVREWAEVEELVYCYL  68

Query  229  VLNSLEVHGFIEQAFLSL  176
             LN  +VHGFI  AFLSL
Sbjct  69   ALNPCDVHGFIRDAFLSL  86



>ref|XP_007219811.1| hypothetical protein PRUPE_ppa026602mg [Prunus persica]
 gb|EMJ21010.1| hypothetical protein PRUPE_ppa026602mg [Prunus persica]
Length=102

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
            NR+ S SASLPDD    F+ S C V YSTDP+ D+R SILEMI   GV DW++M+EL+YC
Sbjct  21   NRV-SLSASLPDDVCGVFAGSACLVKYSTDPIFDMRESILEMIRYEGVCDWNDMKELVYC  79

Query  235  YIVLNSLEVHGFIEQAFLSLCST  167
            Y+ LN  EVH  + +AFLSLCS 
Sbjct  80   YVALNPPEVHEIVREAFLSLCSN  102



>ref|XP_008234869.1| PREDICTED: uncharacterized protein LOC103333754 [Prunus mume]
Length=102

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
            NR+ S SASLPDD    F+ S C V YSTDP+ D+R SILEMI   GV DW++MEEL+YC
Sbjct  21   NRL-SLSASLPDDVCGVFAGSACLVKYSTDPIFDMRESILEMIRYEGVCDWNDMEELVYC  79

Query  235  YIVLNSLEVHGFIEQAFLSLCST  167
            Y+ LN  EVH  + +AFLSLCS 
Sbjct  80   YVALNPPEVHEIVREAFLSLCSN  102



>ref|XP_010103071.1| hypothetical protein L484_002607 [Morus notabilis]
 gb|EXB94720.1| hypothetical protein L484_002607 [Morus notabilis]
Length=95

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -2

Query  406  ISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDV-GVQDWSEMEELIYCYI  230
            IS SASLP D    F+ S C V  + DP+SD+R SI+EMI DV GV DW+++EEL+YCYI
Sbjct  13   ISLSASLPGDVCGVFAGSTCVVKCTADPISDLRESIMEMIQDVDGVCDWNDIEELVYCYI  72

Query  229  VLNSLEVHGFIEQAFLSLCS  170
             LNS +VH  + QAFLSL S
Sbjct  73   ALNSSDVHPIVRQAFLSLGS  92



>ref|XP_002519603.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42748.1| conserved hypothetical protein [Ricinus communis]
Length=99

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = -2

Query  439  QEVkkkkKNRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWS  260
            +++   + NRI SFSASLP+D     + SI  V  S DP S+++ASI+EMI ++ V+DW+
Sbjct  3    KKIWHNRSNRI-SFSASLPEDVCGELAGSIGIVKLSVDPFSELKASIVEMIEELDVRDWN  61

Query  259  EMEELIYCYIVLN-SLEVHGFIEQAFLSLCST  167
             MEEL+YCYIVLN S +VH  I+ AF+SLC +
Sbjct  62   AMEELVYCYIVLNSSSQVHHIIKDAFVSLCDS  93



>ref|XP_002966238.1| hypothetical protein SELMODRAFT_407613 [Selaginella moellendorffii]
 gb|EFJ32265.1| hypothetical protein SELMODRAFT_407613 [Selaginella moellendorffii]
Length=227

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
             R  S SA+LP D     S++I  VM S DP +D R S+ +M+ + G+ +W E++EL+YC
Sbjct  132  RRNHSLSAALPPDLRGPASNAIPLVMESCDPYNDFRVSMEQMVRENGIFEWPELQELLYC  191

Query  235  YIVLNSLEVHGFIEQAFLSL  176
            YI LNS + H  I+ AF  L
Sbjct  192  YIALNSPDQHESIKLAFADL  211



>ref|XP_002982310.1| hypothetical protein SELMODRAFT_421789 [Selaginella moellendorffii]
 gb|EFJ16555.1| hypothetical protein SELMODRAFT_421789 [Selaginella moellendorffii]
Length=227

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
             R  S SA+LP D     S++I  VM S DP +D R S+ +M+ + G+ +W E++EL+YC
Sbjct  132  RRNHSLSAALPPDLRGPASNAIPLVMESCDPYNDFRVSMEQMVRENGIFEWPELQELLYC  191

Query  235  YIVLNSLEVHGFIEQAFLSL  176
            YI LNS + H  I+ AF  L
Sbjct  192  YIALNSPDQHESIKLAFADL  211



>ref|XP_002967796.1| hypothetical protein SELMODRAFT_69627, partial [Selaginella moellendorffii]
 ref|XP_002992622.1| hypothetical protein SELMODRAFT_49611, partial [Selaginella moellendorffii]
 gb|EFJ06324.1| hypothetical protein SELMODRAFT_49611, partial [Selaginella moellendorffii]
 gb|EFJ31143.1| hypothetical protein SELMODRAFT_69627, partial [Selaginella moellendorffii]
Length=67

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  337  YSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            YS +P  D R S+LEMI + G+Q W ++EEL++CY+ LNS E H  I+Q+F
Sbjct  2    YSHNPYQDFRDSMLEMIREKGLQQWCDLEELLFCYLSLNSPEHHEVIKQSF  52



>ref|XP_009624641.1| PREDICTED: transcription repressor OFP15-like [Nicotiana tomentosiformis]
Length=269

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  382  DDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHG  203
            D+ +  F +S+   + S DP  D R S+ EM+   G+QDW  +E+L+ CY+ LN    HG
Sbjct  124  DEGNLYFKESVVMALDSKDPFVDFRKSMEEMVEAHGIQDWENLEQLLTCYLKLNCKTNHG  183

Query  202  FIEQAFLSL  176
            +I  AF+ L
Sbjct  184  YIVGAFVDL  192



>ref|XP_004240188.1| PREDICTED: transcription repressor OFP13-like [Solanum lycopersicum]
Length=229

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   G++DW  ++EL+ CY+ LN    HGF+  AF
Sbjct  114  FKESVILAMESKDPYLDFKKSMKEMVESQGIKDWDNLQELLACYLKLNGEVNHGFVLGAF  173

Query  184  LSL  176
            + L
Sbjct  174  VDL  176



>gb|EMT23489.1| hypothetical protein F775_02514 [Aegilops tauschii]
Length=154

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -2

Query  385  PDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVH  206
            P D  E  + ++   M S DP  D RAS+ EM+   G++DW  +EEL+  Y+ LN+  VH
Sbjct  47   PADYSELKAGAVVVSMESEDPYGDFRASMAEMVVAHGLRDWEGLEELLAWYLKLNAKGVH  106

Query  205  GFIEQAFLSL  176
            G I  AF+ L
Sbjct  107  GVIVGAFVDL  116



>ref|XP_006346002.1| PREDICTED: uncharacterized protein LOC102595094 [Solanum tuberosum]
Length=233

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   G++DW  ++EL+ CY+ LN    HGF+  AF
Sbjct  118  FKESVILAMESKDPYLDFKKSMKEMVESQGIKDWDNLQELLACYLKLNGEVNHGFVLGAF  177

Query  184  LSL  176
            + +
Sbjct  178  VDM  180



>ref|XP_009416042.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F DS+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI  AF
Sbjct  124  FKDSVVLAMESEDPYRDFRLSMEEMVVAHGLRDWERLEELLEWYLRVNGKKTHGFIVGAF  183

Query  184  LSL  176
            + L
Sbjct  184  VDL  186



>ref|XP_010545178.1| PREDICTED: transcription repressor OFP12-like [Tarenaya hassleriana]
Length=193

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = -2

Query  382  DDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQD----WSEMEELIYCYIVLNSL  215
            D   E+ SDS+     S DP +D R S+ EM+   G++D    W ++ EL+ CY+ LN  
Sbjct  106  DGGDESSSDSVAVQTDSPDPYADFRRSMEEMVEARGLRDAKTNWEKLHELLLCYLALNPK  165

Query  214  EVHGFIEQAFLSL  176
              HGFI +AF  L
Sbjct  166  CAHGFIVRAFSDL  178



>ref|XP_007150663.1| hypothetical protein PHAVU_005G171200g [Phaseolus vulgaris]
 gb|ESW22657.1| hypothetical protein PHAVU_005G171200g [Phaseolus vulgaris]
Length=263

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 8/76 (11%)
 Frame = -2

Query  394  ASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHD-VGVQDWSEMEELIYCYIVLNS  218
            A LPDD       SI  + +ST P  D R S+ EM+    GV DW  MEEL++CY+ LN 
Sbjct  164  ALLPDD-------SIALLSHSTSPYEDFRGSMEEMVKKHEGVVDWDFMEELLFCYLNLNR  216

Query  217  LEVHGFIEQAFLSLCS  170
             + H FI  AF+ L +
Sbjct  217  KKSHKFILGAFVDLAA  232



>ref|XP_010552817.1| PREDICTED: transcription repressor OFP12-like [Tarenaya hassleriana]
Length=188

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 38/75 (51%), Gaps = 4/75 (5%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQD----WSEMEELIYCYIVLNSLE  212
            D H    D +    YS DP +D R S+ EM+   G+ D    W ++ EL+ CY+ LN   
Sbjct  102  DRHSTAMDGVAVDTYSPDPYADFRRSMEEMVEARGLHDARANWEKLHELLLCYLALNPKN  161

Query  211  VHGFIEQAFLSLCST  167
             H FI +AF  L  T
Sbjct  162  AHSFIVRAFADLLVT  176



>ref|XP_006849249.1| hypothetical protein AMTR_s00027p00238760 [Amborella trichopoda]
 gb|ERN10830.1| hypothetical protein AMTR_s00027p00238760 [Amborella trichopoda]
Length=249

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            E +S+S+   M S DP+ D R S+ EMI   G++DW+ + EL+ CY+ LN    H +I  
Sbjct  172  EFYSESVTMSMSSEDPLWDFRVSMEEMIEAHGLRDWAMLHELLQCYLKLNEKRTHKYIVG  231

Query  190  AFLSL  176
            AFL L
Sbjct  232  AFLDL  236



>ref|XP_011044041.1| PREDICTED: transcription repressor OFP13-like [Populus euphratica]
Length=268

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   G+ DW  +EEL+YCY+ +N    HG+I  AF
Sbjct  126  FKESVVLSMESQDPYLDFKKSMEEMVEAHGLTDWEGLEELLYCYLKVNGKSNHGYIIGAF  185

Query  184  LSL  176
            + L
Sbjct  186  VDL  188



>ref|XP_002269135.1| PREDICTED: transcription repressor OFP13 [Vitis vinifera]
 emb|CBI25021.3| unnamed protein product [Vitis vinifera]
Length=226

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -2

Query  409  IISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYI  230
            I+   A   ++ H  F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+
Sbjct  105  ILEEKAKAANEIH-PFKESVVLAMESEDPYVDFRKSMEEMVESHGLKDWDCLEELLGWYL  163

Query  229  VLNSLEVHGFIEQAFLSL  176
             +N  + HGFI  AF+ L
Sbjct  164  RVNGKKNHGFIVGAFVDL  181



>emb|CAN62024.1| hypothetical protein VITISV_004927 [Vitis vinifera]
Length=226

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -2

Query  409  IISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYI  230
            I+   A   ++ H  F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+
Sbjct  105  ILEEKAKAANEIH-PFKESVVLAMESEDPYVDFRKSMEEMVESHGLKDWDCLEELLGWYL  163

Query  229  VLNSLEVHGFIEQAFLSL  176
             +N  + HGFI  AF+ L
Sbjct  164  RVNGKKNHGFIVGAFVDL  181



>ref|XP_002530160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32215.1| conserved hypothetical protein [Ricinus communis]
Length=289

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
            AF +SI   M S DP  D + S+ EM+   G++DW  +EEL+ CY+ +N    HG+I  A
Sbjct  142  AFKESIALSMDSQDPYVDFKKSMEEMVEAHGLKDWESLEELLSCYLKVNGKSNHGYIIGA  201

Query  187  FLSL  176
            F+ L
Sbjct  202  FVDL  205



>ref|XP_004962442.1| PREDICTED: uncharacterized protein LOC101755245 [Setaria italica]
Length=247

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 2/92 (2%)
 Frame = -2

Query  451  EMEVQEVkkkkKNRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGV  272
             +  + V      R+ + SAS           S   V  STDP  D R S++EMI +  V
Sbjct  147  RLRSRRVHAISGGRVSTTSAS--GHRRSVARRSFAVVKASTDPPRDFRESMVEMIAENKV  204

Query  271  QDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            Q   +MEEL+ CY+ LNS E HG I + F  +
Sbjct  205  QTPEDMEELLECYLSLNSREYHGVIMEVFRGI  236



>ref|XP_002326076.1| ovate family protein [Populus trichocarpa]
 gb|EEF00458.1| ovate family protein [Populus trichocarpa]
Length=386

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            ++  S+S   VM S DP  D + S++EMI +  +QD  ++EEL+ CY+ LNS + H FI 
Sbjct  312  NKTLSESFAVVMSSVDPQRDFKDSMVEMIVENNIQDSKDLEELLACYLSLNSKKYHDFII  371

Query  193  QAF  185
            +AF
Sbjct  372  KAF  374



>ref|NP_001235247.1| uncharacterized protein LOC100527123 [Glycine max]
 gb|ACU16170.1| unknown [Glycine max]
 gb|KHN11448.1| hypothetical protein glysoja_015343 [Glycine soja]
Length=239

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  127  FKESVVLAMESEDPYEDFKRSMEEMVESHGVRDWEGLEELLTWYLRVNGKNNHGFIVGAF  186

Query  184  LSL  176
            + L
Sbjct  187  VDL  189



>ref|XP_008231831.1| PREDICTED: uncharacterized protein LOC103330999 [Prunus mume]
Length=238

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI  AF
Sbjct  128  FKESVVLAMESEDPYKDFRRSMEEMVESHGLKDWESLEELLGWYLRVNKKKNHGFIVGAF  187



>ref|XP_007142874.1| hypothetical protein PHAVU_007G024100g [Phaseolus vulgaris]
 gb|ESW14868.1| hypothetical protein PHAVU_007G024100g [Phaseolus vulgaris]
Length=243

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  135  FKESVVLAMESEDPYEDFKRSMEEMVESHGVRDWEGLEELLTWYLKVNGRNNHGFIVGAF  194

Query  184  LSL  176
            + L
Sbjct  195  VDL  197



>gb|KHN10380.1| hypothetical protein glysoja_049636 [Glycine soja]
Length=251

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  137  FKESVVLAMESEDPYEDFKRSMEEMVESHGVRDWEGLEELLTWYLRVNGRNNHGFIVGAF  196

Query  184  LSL  176
            + L
Sbjct  197  VDL  199



>ref|XP_006589708.1| PREDICTED: uncharacterized protein LOC102668773 [Glycine max]
Length=251

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  137  FKESVVLAMESEDPYEDFKRSMEEMVESHGVRDWEGLEELLTWYLRVNGRNNHGFIVGAF  196

Query  184  LSL  176
            + L
Sbjct  197  VDL  199



>gb|AGV54162.1| hypothetical protein [Phaseolus vulgaris]
Length=243

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  135  FKESVVLAMESEDPYEDFKRSMEEMVESHGVRDWEGLEELLTWYLKVNGRNNHGFIVGAF  194

Query  184  LSL  176
            + L
Sbjct  195  VDL  197



>ref|XP_011046889.1| PREDICTED: transcription repressor OFP13-like [Populus euphratica]
Length=276

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +++   M S DP  D + S+ EM+   G+ DW  +EEL+YCY+ +N    HG+I  AF
Sbjct  129  FKETVVLSMESQDPYLDFKKSMEEMVEAHGLTDWEGLEELLYCYLKVNGKSNHGYIIGAF  188

Query  184  LSL  176
            + L
Sbjct  189  VDL  191



>ref|XP_008799737.1| PREDICTED: transcription repressor OFP13-like [Phoenix dactylifera]
Length=219

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGF  200
            D    F +SI   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HG+
Sbjct  122  DGAFPFKESIALAMESEDPYKDFRVSMEEMVVAHGLKDWECLEELLLWYLRVNGKKTHGY  181

Query  199  IEQAFLSL  176
            I  AF+ L
Sbjct  182  IVGAFVDL  189



>ref|XP_011041802.1| PREDICTED: transcription repressor OFP4 [Populus euphratica]
Length=386

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            ++  S+S   VM S DP  D + S++EMI +  +QD  ++E+L+ CY+ LNS + H FI 
Sbjct  312  NKTLSESFAVVMSSVDPQRDFKDSMVEMIVENNIQDSKDLEDLLACYLSLNSRKYHDFIV  371

Query  193  QAF  185
            +AF
Sbjct  372  KAF  374



>ref|XP_007010460.1| Ovate family protein 13 [Theobroma cacao]
 gb|EOY19270.1| Ovate family protein 13 [Theobroma cacao]
Length=281

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N    HGFI  A
Sbjct  172  PFKESVVLAMESADPYVDFRKSMEEMVETHGLKDWKILEELLGWYLQVNGKTNHGFIIGA  231

Query  187  FLSL  176
            F+ L
Sbjct  232  FIDL  235



>ref|XP_009762599.1| PREDICTED: transcription repressor OFP13-like [Nicotiana sylvestris]
Length=249

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +SI   M S DP  D + S+ EM+   G++DW +++EL+  Y+ +N    HGFI  A
Sbjct  133  PFKESIILAMESEDPYLDFKKSMKEMVESQGIKDWKDLQELLAWYLKMNGKINHGFILSA  192

Query  187  FLSL  176
            F+ L
Sbjct  193  FVDL  196



>ref|XP_004497131.1| PREDICTED: uncharacterized protein LOC101510698 [Cicer arietinum]
Length=243

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  131  FKESVVLAMESEDPYEDFKRSMEEMVESHGVKDWEGLEELLSWYLRVNGKNNHGFIVGAF  190

Query  184  LSL  176
            + L
Sbjct  191  VDL  193



>emb|CDP10623.1| unnamed protein product [Coffea canephora]
Length=264

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   + S DP +D R S+ EM+   G++DW  +E+L+ CY+ +N    HG+I  AF
Sbjct  124  FKESLVMAVDSRDPFADFRRSMEEMVEAHGLKDWESLEDLLTCYLRVNGKSNHGYIVGAF  183

Query  184  LSL  176
            + L
Sbjct  184  VDL  186



>ref|XP_009596510.1| PREDICTED: transcription repressor OFP13-like [Nicotiana tomentosiformis]
Length=248

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +SI   M S DP  D + S+ EM+   G++DW +++EL+  Y+ +N    HGFI  A
Sbjct  133  PFKESIVLAMESEDPYLDFKKSMKEMVESQGIKDWEDLQELLAWYLKMNGKVNHGFILSA  192

Query  187  FLSL  176
            F+ L
Sbjct  193  FVDL  196



>ref|XP_002516628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45752.1| conserved hypothetical protein [Ricinus communis]
Length=235

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ +M+   G++DW  +EEL+  Y+ +N  + HGFI  AF
Sbjct  124  FQESVVLAMESDDPYVDFRRSMEDMVESHGLKDWGSLEELLVWYLKVNGKKNHGFIIGAF  183

Query  184  LSL  176
            + L
Sbjct  184  IDL  186



>ref|XP_010262945.1| PREDICTED: LOW QUALITY PROTEIN: transcription repressor OFP13 
[Nelumbo nucifera]
Length=313

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI  A
Sbjct  178  PFKESVVLAMESQDPYVDFRTSMEEMVEAHGLKDWECLEELLGWYLRVNGKKTHGFIVGA  237

Query  187  FL  182
            F+
Sbjct  238  FI  239



>ref|XP_010246483.1| PREDICTED: transcription repressor OFP13 [Nelumbo nucifera]
Length=232

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI  AF
Sbjct  116  FKESVVLAMESQDPYVDFRTSMEEMVEAHGLKDWECLEELLGWYLRVNGKKTHGFIVGAF  175

Query  184  L  182
            +
Sbjct  176  V  176



>ref|XP_011090710.1| PREDICTED: transcription repressor OFP12-like [Sesamum indicum]
Length=233

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 36/72 (50%), Gaps = 6/72 (8%)
 Frame = -2

Query  385  PDDAHEAFSDSICAVMYSTDPVSDIRASILEMIH-----DVGVQDWSEMEELIYCYIVLN  221
            P DA    S  +    YS DP SD R S+LEMI      DV   DW  + EL+ CY+ LN
Sbjct  130  PKDAGALVSGGVAVQTYSPDPYSDFRKSMLEMIEARDLTDVNA-DWEFLHELLLCYLTLN  188

Query  220  SLEVHGFIEQAF  185
                H FI  AF
Sbjct  189  PKHTHKFIVGAF  200



>gb|KDP37207.1| hypothetical protein JCGZ_06263 [Jatropha curcas]
Length=322

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 38/75 (51%), Gaps = 11/75 (15%)
 Frame = -2

Query  388  LPDDAHEAFSDSICAVMYSTDPVSDIRASILEM----IHDVGVQDWSEMEELIYCYIVLN  221
            LPDD        I  + YS  P  D R S+ EM    I   G  DW  M+EL+YCY+ LN
Sbjct  222  LPDDC-------IAVIQYSASPADDFRRSMQEMAESRIEREGKMDWDFMQELLYCYLDLN  274

Query  220  SLEVHGFIEQAFLSL  176
              + H FI  AF+ L
Sbjct  275  EQKSHKFILNAFVDL  289



>ref|XP_011032908.1| PREDICTED: transcription repressor OFP13 [Populus euphratica]
Length=214

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HG+I  AF
Sbjct  112  FKESVVLAMESEDPYVDFRRSMEEMVESHGLKDWDCLEELLGWYLKVNGKKNHGYIVGAF  171

Query  184  LSL  176
            + L
Sbjct  172  VDL  174



>ref|XP_002310994.2| hypothetical protein POPTR_0008s01840g [Populus trichocarpa]
 gb|EEE88361.2| hypothetical protein POPTR_0008s01840g [Populus trichocarpa]
Length=214

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HG+I  AF
Sbjct  112  FKESVVLAMESEDPYVDFRRSMEEMVESHGLKDWDCLEELLGWYLKVNGKKNHGYIVGAF  171

Query  184  LSL  176
            + L
Sbjct  172  VDL  174



>ref|XP_007214128.1| hypothetical protein PRUPE_ppa018010mg [Prunus persica]
 gb|EMJ15327.1| hypothetical protein PRUPE_ppa018010mg [Prunus persica]
Length=244

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI  AF
Sbjct  125  FKESVVLAMESEDPYKDFRRSMEEMVESHGLKDWECLEELLGWYLRVNKKKNHGFIVGAF  184



>ref|XP_009387475.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata 
subsp. malaccensis]
Length=213

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 3/80 (4%)
 Frame = -2

Query  397  SASLPDDAHE---AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIV  227
            ++S+ D+A +    F  S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ 
Sbjct  103  TSSIVDEAKDRELPFRGSVALAMESEDPYRDFRLSMEEMVVAHGMKDWRRLEELLLWYLR  162

Query  226  LNSLEVHGFIEQAFLSLCST  167
            +N  + HG I  AF+ L  T
Sbjct  163  VNRRKTHGAIVGAFVDLLLT  182



>gb|KEH44278.1| ovate transcriptional repressor [Medicago truncatula]
Length=254

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ E++   GV+DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  135  FKESVVLAMESEDPYEDFKRSMEEIVESHGVKDWDGLEELLSWYLKVNGKNNHGFIVGAF  194

Query  184  LSL  176
            + L
Sbjct  195  VDL  197



>ref|XP_008391954.1| PREDICTED: uncharacterized protein LOC103454142 [Malus domestica]
Length=301

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF
Sbjct  152  FKESVALSMDSADPIVDFRKSMEEMVEAHGLKDWENLEELLCWYLRVNGKSNHGYIVGAF  211

Query  184  LSL  176
            + L
Sbjct  212  VDL  214



>ref|XP_004961753.1| PREDICTED: uncharacterized protein LOC101777258 [Setaria italica]
Length=363

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            A    ++S   V  S DP  D R S+ EMI + G++D +++E+L+ CY+ LN+ E H  I
Sbjct  287  APPPLAESFAVVKASADPRRDFRESMEEMIAEKGIRDAADLEDLLACYLALNAAEHHDLI  346

Query  196  ----EQAFLSLCSTS  164
                EQ + SL S +
Sbjct  347  VEVFEQIWASLASAA  361



>ref|XP_009349260.1| PREDICTED: transcription repressor OFP15-like [Pyrus x bretschneideri]
Length=307

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF
Sbjct  152  FKESVALSMDSADPIVDFRKSMEEMVEAHGLKDWENLEELLCWYLRVNGKSNHGYIVGAF  211

Query  184  LSL  176
            + L
Sbjct  212  VDL  214



>ref|XP_009403672.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata 
subsp. malaccensis]
Length=230

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F  S+   + S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  125  FEGSVALAVESDDPHRDFRRSMEEMVTAHGLRDWERLEELLGWYLRVNGKTTHGFIVGAF  184

Query  184  LSL  176
            + L
Sbjct  185  VDL  187



>ref|XP_007027918.1| Ovate family protein 13, putative [Theobroma cacao]
 gb|EOY08420.1| Ovate family protein 13, putative [Theobroma cacao]
Length=259

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP +D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF
Sbjct  116  FKESVVLSMESQDPFADFRKSMEEMVEAHGLKDWGGLEELLCWYLRVNGKSNHGYIVGAF  175

Query  184  LSL  176
            + L
Sbjct  176  VDL  178



>gb|EPS70453.1| hypothetical protein M569_04311, partial [Genlisea aurea]
Length=223

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F  S+   M S DP SD + S+ E++   GV++W ++EEL+  Y+ +N    HGFI  AF
Sbjct  119  FKGSVAMSMESEDPYSDFKRSMREVVESHGVREWEKLEELLGWYLRMNGKMNHGFIVGAF  178

Query  184  LSL  176
            + L
Sbjct  179  VDL  181



>ref|XP_008442894.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
Length=235

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            +H     +    M S DP SD R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI
Sbjct  113  SHPLKEGTTVMSMDSNDPYSDFRKSMEEMVEAHGMKDWESLEELLNWYLRVNGKKNHGFI  172

Query  196  EQAFLSL  176
              AF+ L
Sbjct  173  LGAFVDL  179



>ref|XP_002446442.1| hypothetical protein SORBIDRAFT_06g016120 [Sorghum bicolor]
 gb|EES10770.1| hypothetical protein SORBIDRAFT_06g016120 [Sorghum bicolor]
Length=330

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  361  SDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFL  182
            S ++   + S DP  D RAS+ EM+   G++DW  +EEL+  Y+ LN+  VH  I  AF+
Sbjct  228  SSAVVVTVESKDPYGDFRASMAEMVAAHGLRDWEALEELLAWYLKLNAKGVHAAIVGAFI  287

Query  181  SLCST  167
             L  T
Sbjct  288  DLLVT  292



>ref|XP_010090501.1| hypothetical protein L484_012608 [Morus notabilis]
 gb|EXB39600.1| hypothetical protein L484_012608 [Morus notabilis]
Length=260

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            +   +S+   M S DP  D R S+ EM+   GV++W  +EE++  Y+ +N  E HGFI  
Sbjct  131  QPLRESVVLAMESDDPYRDFRRSMEEMVEINGVKEWEGLEEMLGWYLRVNGKENHGFIVG  190

Query  190  AFLSL  176
            AF+ L
Sbjct  191  AFMDL  195



>ref|XP_002323398.2| hypothetical protein POPTR_0016s07380g [Populus trichocarpa]
 gb|EEF05159.2| hypothetical protein POPTR_0016s07380g [Populus trichocarpa]
Length=266

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D + S+ EM+   G+ DW  +EEL+ CY+ +N    HG+I  AF
Sbjct  126  FKESVVLSMDSRDPYLDFKKSMEEMVEAHGLTDWEGLEELLSCYLKVNGKSNHGYIIGAF  185

Query  184  LSL  176
            + L
Sbjct  186  VDL  188



>ref|XP_010931090.1| PREDICTED: transcription repressor OFP13 [Elaeis guineensis]
Length=220

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGF  200
            D    F +SI   M S DP  D R S+ EM+   G+ DW  +EEL+  Y+ +N  + HG+
Sbjct  122  DGAFPFKESIVLAMDSEDPYHDFRVSMEEMVVAHGLNDWDCLEELLLWYLRVNGTKTHGY  181

Query  199  IEQAFLSL  176
            I  AF+ L
Sbjct  182  IVGAFVDL  189



>ref|NP_001152151.1| plant-specific domain TIGR01568 family protein [Zea mays]
 gb|ACG46072.1| plant-specific domain TIGR01568 family protein [Zea mays]
Length=320

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  385  PDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVH  206
            P +A  A   ++   + S DP  D RAS+ EM+   G++DW  +EEL+  Y+ LN+  VH
Sbjct  210  PAEAVTAKGGAVVVTVESKDPYGDFRASMAEMVAAHGLRDWEALEELLAWYLKLNAKGVH  269

Query  205  GFIEQAFLSL  176
              I  AF+ L
Sbjct  270  AAIVGAFVDL  279



>gb|KDP36142.1| hypothetical protein JCGZ_08786 [Jatropha curcas]
Length=266

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  382  DDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHG  203
            ++    F +SI   M S +P  D + S+ EM+   G++DW  +EEL+ CY+ +N    HG
Sbjct  117  NNGEFPFKESIVLSMDSQEPYLDFKKSMEEMVEAHGLKDWEGLEELLCCYLKVNGKSNHG  176

Query  202  FIEQAFLSL  176
            +I  AF+ L
Sbjct  177  YIIGAFVDL  185



>ref|XP_009349783.1| PREDICTED: transcription repressor OFP15-like [Pyrus x bretschneideri]
Length=311

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF
Sbjct  152  FKESVALSMDSADPIVDFRKSMEEMVEAHGLKDWENLEELLCWYLRVNGKGNHGYIVGAF  211

Query  184  LSL  176
            + L
Sbjct  212  VDL  214



>ref|XP_008243474.1| PREDICTED: uncharacterized protein LOC103341714 [Prunus mume]
Length=282

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N+   HG+I  AF
Sbjct  136  FKESVVLSMDSPDPIVDFRKSMEEMVEAHGLKDWDHLEELLCWYLRVNAKSNHGYIVGAF  195

Query  184  LSL  176
            + L
Sbjct  196  VDL  198



>ref|XP_007202454.1| hypothetical protein PRUPE_ppa010050mg [Prunus persica]
 gb|EMJ03653.1| hypothetical protein PRUPE_ppa010050mg [Prunus persica]
Length=266

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N+   HG+I  AF
Sbjct  136  FKESVVLSMDSPDPILDFRKSMEEMVEAHGLKDWDHLEELLCWYLRVNAKSNHGYIVGAF  195

Query  184  LSL  176
            + L
Sbjct  196  VDL  198



>ref|XP_008667786.1| PREDICTED: plant-specific domain TIGR01568 family protein isoform 
X1 [Zea mays]
Length=366

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  385  PDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVH  206
            P +A  A   ++   + S DP  D RAS+ EM+   G++DW  +EEL+  Y+ LN+  VH
Sbjct  256  PAEAVTAKGGAVVVTVESKDPYGDFRASMAEMVAAHGLRDWEALEELLAWYLKLNAKGVH  315

Query  205  GFIEQAFLSL  176
              I  AF+ L
Sbjct  316  AAIVGAFVDL  325



>ref|XP_009401180.1| PREDICTED: transcription repressor OFP13 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F  S+   M S DP  D R S+ EM+   G+ DW  +EEL+  Y+ +N  + H F+  AF
Sbjct  126  FEGSVVLAMESEDPYRDFRRSMEEMVAAHGLNDWERLEELLVWYLKVNGKKTHRFVAAAF  185

Query  184  LSL  176
              L
Sbjct  186  ADL  188



>ref|NP_001145944.1| plant-specific domain TIGR01568 family protein [Zea mays]
 gb|ACL52897.1| unknown [Zea mays]
 tpg|DAA37884.1| TPA: plant-specific domain TIGR01568 family protein [Zea mays]
 gb|AIB05764.1| OFP transcription factor, partial [Zea mays]
Length=325

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  385  PDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVH  206
            P +A  A   ++   + S DP  D RAS+ EM+   G++DW  +EEL+  Y+ LN+  VH
Sbjct  215  PAEAVTAKGGAVVVTVESKDPYGDFRASMAEMVAAHGLRDWEALEELLAWYLKLNAKGVH  274

Query  205  GFIEQAFLSL  176
              I  AF+ L
Sbjct  275  AAIVGAFVDL  284



>gb|KDO70576.1| hypothetical protein CISIN_1g041802mg, partial [Citrus sinensis]
Length=223

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            + +S+   M S DP  D + S++EM+   G++DW ++EEL+  Y+ +N    HG+I  AF
Sbjct  127  YKESLVCSMESQDPYVDFKKSMVEMVEAHGLKDWEDLEELLCWYLRMNGKSNHGYIVGAF  186

Query  184  LSL  176
            + L
Sbjct  187  VDL  189



>ref|XP_010553202.1| PREDICTED: transcription repressor OFP1-like [Tarenaya hassleriana]
Length=226

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            A   FSDS   V  S DP  D +AS++EMI +  ++   ++EEL+ CY+ LNS E H  I
Sbjct  150  ASAGFSDSFVVVKTSMDPYGDFKASMMEMIVENRIRAKKDLEELLACYLSLNSDEYHDII  209

Query  196  EQAF  185
             + F
Sbjct  210  IRVF  213



>gb|AFK36960.1| unknown [Lotus japonicus]
Length=348

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -2

Query  412  RIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCY  233
            R +S  AS  D  +  F D    V  S DP SD R S++EMI +  +++  ++E+L+ CY
Sbjct  262  RSVSSGASK-DSRNAGFPDGFAVVKSSFDPQSDFRDSMVEMIVENKIRESKDLEDLLACY  320

Query  232  IVLNSLEVHGFIEQAF  185
            + LNS E H  I +AF
Sbjct  321  LSLNSSEYHELIVKAF  336



>ref|XP_004164609.1| PREDICTED: uncharacterized protein LOC101227220 [Cucumis sativus]
 gb|KGN59180.1| hypothetical protein Csa_3G778360 [Cucumis sativus]
Length=234

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            +H     +    M S DP SD R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI
Sbjct  113  SHPLKEGTTVMSMDSDDPYSDFRKSMEEMVEAHGMKDWESLEELLNWYLRVNGKKNHGFI  172

Query  196  EQAFLSL  176
              AF+ L
Sbjct  173  LGAFVDL  179



>ref|XP_011080730.1| PREDICTED: transcription repressor OFP1 [Sesamum indicum]
Length=335

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            +SDS   V  S DP  D R S++EMI +  ++   ++EEL+ CY+ LNS + HG I +AF
Sbjct  264  YSDSFAIVKASFDPERDFRDSMMEMILENNIRASKDLEELLACYLSLNSNQYHGLIIKAF  323



>ref|XP_004136703.1| PREDICTED: uncharacterized protein LOC101216385 [Cucumis sativus]
Length=208

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            +H     +    M S DP SD R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI
Sbjct  113  SHPLKEGTTVMSMDSDDPYSDFRKSMEEMVEAHGMKDWESLEELLNWYLRVNGKKNHGFI  172

Query  196  EQAFLSL  176
              AF+ L
Sbjct  173  LGAFVVL  179



>ref|XP_010910463.1| PREDICTED: transcription repressor OFP13-like [Elaeis guineensis]
Length=218

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F       M S DP  D + S+ EM+   GV+DW  +EE++  Y+ +N    HGFI +AF
Sbjct  129  FEGGFAMAMDSKDPYWDFKVSMEEMVAAHGVKDWGWLEEMLGWYLRVNGTWTHGFIVRAF  188

Query  184  LSL  176
            + L
Sbjct  189  VDL  191



>ref|XP_008798879.1| PREDICTED: transcription repressor OFP13 [Phoenix dactylifera]
Length=191

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F  S+   + S DP  D + S+ EM+   GV+DW  ++E++  Y+ LN    HGFI  AF
Sbjct  119  FEGSVAMAIDSKDPYWDFKVSMEEMVVAHGVKDWGWLQEMLGWYLKLNGKRTHGFIVGAF  178

Query  184  LSL  176
            + L
Sbjct  179  VDL  181



>ref|XP_006854716.1| hypothetical protein AMTR_s00030p00235460 [Amborella trichopoda]
 gb|ERN16183.1| hypothetical protein AMTR_s00030p00235460 [Amborella trichopoda]
Length=219

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -2

Query  361  SDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFL  182
             +S    M S DP  D R S+ EM+   G+++WS +EEL+ CY+ +N  + H +I  AF+
Sbjct  148  KESFMLAMESDDPYMDFRVSMEEMVQAHGIKEWSCLEELLQCYLRVNGKKAHKYIVGAFV  207

Query  181  SL  176
             L
Sbjct  208  DL  209



>ref|XP_009589294.1| PREDICTED: transcription repressor OFP3-like [Nicotiana tomentosiformis]
Length=306

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = -2

Query  376  AHEAFS-DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGF  200
              E+FS +S   V  STDP  D R S++EM+ +  ++   ++E L+ CY+ LNS E HG 
Sbjct  230  KKESFSAESFAIVKTSTDPEKDFRESMIEMVVENNIKASKDLENLLACYLSLNSDEYHGL  289

Query  199  IEQAF  185
            I +AF
Sbjct  290  IIKAF  294



>gb|KDP29272.1| hypothetical protein JCGZ_19437 [Jatropha curcas]
Length=220

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            + F +S+   + S +P  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HGFI  
Sbjct  100  KPFKESVVLALESENPYVDFRRSMEEMVESHGLKDWDCLEELLRWYLKVNGKKNHGFIVG  159

Query  190  AFLSL  176
            AF+ L
Sbjct  160  AFIDL  164



>ref|XP_011076850.1| PREDICTED: transcription repressor OFP13 [Sesamum indicum]
Length=270

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   + S DP SD + S+ EM+   G+++W  +EEL+  Y+ +N    HGFI  AF
Sbjct  137  FKESVALALESDDPYSDFKKSMQEMVESHGLKEWDCLEELLGWYLRMNGKSNHGFIVGAF  196

Query  184  LSL  176
            + L
Sbjct  197  VDL  199



>emb|CDO99927.1| unnamed protein product [Coffea canephora]
Length=254

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
              +S+   M S DP  D + S+ EM+   G++DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  130  LKESVVLAMESEDPYMDFKKSMEEMVETNGLKDWESLEELLGWYLKMNGQTNHGFIVGAF  189

Query  184  LSL  176
            + L
Sbjct  190  VDL  192



>ref|XP_009389776.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            + +SI   M S DP  D R+S+ EM+   G+++W  ++EL+ CY+ LN  + H  I  AF
Sbjct  123  YHESITMAMSSEDPYQDFRSSMEEMVAAHGLREWHSLQELLQCYLRLNEKKNHKVIVMAF  182

Query  184  LSL  176
            + L
Sbjct  183  VDL  185



>ref|XP_010683621.1| PREDICTED: transcription repressor OFP13 [Beta vulgaris subsp. 
vulgaris]
Length=295

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGF  200
            D+   + +S    M S  P  D R S+ EM+   G++DW  +EEL+ CY+ +N    HG+
Sbjct  141  DSKVVYKESEIMSMDSNSPYEDFRRSMEEMVEAHGLKDWQGLEELLGCYLKINGKNNHGY  200

Query  199  IEQAFLSL  176
            I  AF+ L
Sbjct  201  IVGAFIDL  208



>ref|XP_002309397.1| hypothetical protein POPTR_0006s22190g [Populus trichocarpa]
 gb|EEE92920.1| hypothetical protein POPTR_0006s22190g [Populus trichocarpa]
Length=278

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +++   M S DP  D + S+ EM+   G+ DW  +EEL+ CY+ +N    HG+I  AF
Sbjct  129  FKETVVLSMESQDPYLDFKKSMEEMVEAHGLTDWEGLEELLSCYLKVNGESNHGYIVSAF  188

Query  184  LSL  176
            + L
Sbjct  189  VDL  191



>ref|XP_006481864.1| PREDICTED: uncharacterized protein LOC102627855 [Citrus sinensis]
Length=287

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            + +S+   M S DP  D + S++EM+   G++DW ++EEL+  Y+ +N    HG+I  AF
Sbjct  127  YKESLVCSMESQDPYVDFKKSMVEMVEAHGLKDWEDLEELLCWYLRMNGKSNHGYIVGAF  186

Query  184  LSL  176
            + L
Sbjct  187  VDL  189



>ref|XP_006430100.1| hypothetical protein CICLE_v10012467mg [Citrus clementina]
 gb|ESR43340.1| hypothetical protein CICLE_v10012467mg [Citrus clementina]
Length=268

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            + +S+   M S DP  D + S++EM+   G++DW ++EEL+  Y+ +N    HG+I  AF
Sbjct  127  YKESLVCSMESQDPYVDFKKSMVEMVEAHGLKDWEDLEELLCWYLRMNGKSNHGYIVGAF  186

Query  184  LSL  176
            + L
Sbjct  187  VDL  189



>ref|XP_002316486.1| hypothetical protein POPTR_0010s24790g [Populus trichocarpa]
 gb|EEF02657.1| hypothetical protein POPTR_0010s24790g [Populus trichocarpa]
Length=210

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N  + HG+I  A
Sbjct  111  PFKESVELEMESEDPYVDFRRSMEEMVESHGLKDWDCLEELLGWYLKVNGKKNHGYIVGA  170

Query  187  FLSL  176
            F+ L
Sbjct  171  FVDL  174



>ref|XP_011094255.1| PREDICTED: transcription repressor OFP13-like [Sesamum indicum]
Length=271

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -2

Query  343  VMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
             M S DP +D R S+ EM+   G+++W  +EEL+ CY+ +N    HG+I  AF+ L
Sbjct  141  AMDSRDPFTDFRVSMEEMVEAHGLKEWECLEELLSCYLRVNGKSNHGYIVGAFVDL  196



>ref|XP_010925191.1| PREDICTED: transcription repressor OFP14-like [Elaeis guineensis]
Length=251

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = -2

Query  361  SDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNSLEVHGFI  197
             D +    +S DP  D R S+ EM+    V      DW  MEEL++CY+ LN   VH +I
Sbjct  151  GDGVAVTTFSKDPYDDFRRSMQEMVDARHVDPHQTLDWDFMEELLFCYLELNDRSVHKYI  210

Query  196  EQAFLSL  176
             +AF  L
Sbjct  211  LRAFTDL  217



>ref|XP_006576901.1| PREDICTED: uncharacterized protein LOC102659610 [Glycine max]
Length=250

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIH------DVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            SI    YS DP +D R S+ EM+       DV  + W E+ EL+ CY+ LN    H FI 
Sbjct  155  SIAVTKYSPDPYADFRQSMEEMVAARPELMDVASK-WRELHELLLCYLALNPKSTHKFIL  213

Query  193  QAF----LSLCSTS  164
            +AF    LSL S S
Sbjct  214  RAFSDFLLSLISRS  227



>ref|XP_009412405.1| PREDICTED: transcription repressor OFP14-like [Musa acuminata 
subsp. malaccensis]
Length=278

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 5/70 (7%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNSLEVH  206
            EA  D +  V +S DP  D R S+  M+    V+     DW  M+EL++CY+ LN  +VH
Sbjct  162  EARGDGVAVVTFSKDPYDDFRRSMQGMVDARHVEPNQPLDWDFMKELLFCYLELNDRKVH  221

Query  205  GFIEQAFLSL  176
              I +AF  L
Sbjct  222  KHILRAFTDL  231



>ref|XP_006604442.1| PREDICTED: uncharacterized protein LOC102663086 isoform X1 [Glycine 
max]
 ref|XP_006604443.1| PREDICTED: uncharacterized protein LOC102663086 isoform X2 [Glycine 
max]
 ref|XP_006604444.1| PREDICTED: uncharacterized protein LOC102663086 isoform X3 [Glycine 
max]
Length=235

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 46/92 (50%), Gaps = 11/92 (12%)
 Frame = -2

Query  409  IISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIH------DVGVQDWSEMEE  248
            I+  S+S   +A      S+    YS DP +D R S+ EM+       DV  + W E+ E
Sbjct  124  ILGLSSSDESEAKALLDRSVAVRKYSPDPYADFRQSMEEMVAARPELMDVAAK-WRELHE  182

Query  247  LIYCYIVLNSLEVHGFIEQAF----LSLCSTS  164
            L+ CY+ LN    H FI +AF    LSL S S
Sbjct  183  LLLCYLALNPKSTHKFILRAFSDFLLSLISRS  214



>ref|XP_003581214.1| PREDICTED: transcription repressor OFP13-like [Brachypodium distachyon]
Length=316

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            ++   + S +P  D R S+ EM+   GV+DW  +EEL+ CY+ LN+  VH  I  AF+ +
Sbjct  221  AVVVTVESENPYGDFRESMAEMVAAHGVRDWEGLEELLACYLKLNAKGVHAVIVGAFVDM  280



>gb|KHN10677.1| hypothetical protein glysoja_019108 [Glycine soja]
Length=235

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIH------DVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            SI    YS DP +D R S+ EM+       DV  + W E+ EL+ CY+ LN    H FI 
Sbjct  140  SIAVTKYSPDPYADFRQSMEEMVAARPELMDVASK-WRELHELLLCYLALNPKSTHKFIL  198

Query  193  QAF----LSLCSTS  164
            +AF    LSL S S
Sbjct  199  RAFSDFLLSLISRS  212



>ref|XP_004975587.1| PREDICTED: uncharacterized protein LOC101773173 [Setaria italica]
Length=323

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = -2

Query  403  SFSASLPDD---AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCY  233
            S +A+ PD    A E    ++   + S DP  D RAS+ EM+   G++DW  +EEL+  Y
Sbjct  199  SATAAAPDKNESAAEVKGVAVVVTVESKDPYRDFRASMAEMVAAHGLRDWEALEELLAWY  258

Query  232  IVLNSLEVHGFIEQAFLSL  176
            + LN+  VH  I  AF+ L
Sbjct  259  LKLNAKGVHAAIVGAFIDL  277



>ref|XP_008387053.1| PREDICTED: uncharacterized protein LOC103449509 [Malus domestica]
Length=296

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   + S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF
Sbjct  154  FKESVALSIDSPDPIVDFRKSMEEMVEAHGLKDWENLEELLCWYLRVNGKSNHGYIVGAF  213

Query  184  LSL  176
            + L
Sbjct  214  VDL  216



>ref|XP_008784093.1| PREDICTED: transcription repressor OFP13-like [Phoenix dactylifera]
Length=220

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F  S    M S DP  D R S+ EM+   G++DW  ++EL+  Y+ +N  + HGFI  AF
Sbjct  127  FKKSFALAMESEDPYHDFRVSMEEMVVAHGLKDWECLKELLLWYLRVNGKKTHGFIVGAF  186

Query  184  LSL  176
            + L
Sbjct  187  VDL  189



>ref|NP_001236966.1| uncharacterized protein LOC100527503 [Glycine max]
 gb|ACU16598.1| unknown [Glycine max]
Length=249

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = -2

Query  370  EAFSD-SICAVMYSTDPVSDIRASILEMIHD-VGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            EA  D SI  +  ST P  D + S+ EM+++   V DW  MEEL++CY+ LN  + H FI
Sbjct  145  EALPDNSIALLTRSTSPYEDFKRSMQEMVNNHESVVDWDFMEELLFCYLNLNEKKSHKFI  204

Query  196  EQAFLSLCS  170
              AF+ L +
Sbjct  205  LSAFVDLIT  213



>gb|KHM98764.1| hypothetical protein glysoja_030817 [Glycine soja]
Length=249

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = -2

Query  370  EAFSD-SICAVMYSTDPVSDIRASILEMIHD-VGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            EA  D SI  +  ST P  D + S+ EM+++   V DW  MEEL++CY+ LN  + H FI
Sbjct  145  EALPDNSIALLTRSTSPYEDFKRSMQEMVNNHESVVDWDFMEELLFCYLNLNEKKSHKFI  204

Query  196  EQAFLSLCS  170
              AF+ L +
Sbjct  205  LSAFVDLIT  213



>gb|KCW50561.1| hypothetical protein EUGRSUZ_J00277, partial [Eucalyptus grandis]
Length=237

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S +P  D R S+ EM+   G++DW  +E L+  Y+ +N  + HGFI +AF
Sbjct  130  FKESVVLAMESENPYVDFRRSMEEMVESHGLKDWECLEALLGWYLRVNGKKNHGFIVEAF  189

Query  184  LSL  176
            + L
Sbjct  190  VDL  192



>ref|XP_009372561.1| PREDICTED: transcription repressor OFP13-like [Pyrus x bretschneideri]
Length=315

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   + S DP+ D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF
Sbjct  159  FKESVALSIDSPDPIVDFRKSMEEMVEAHGLKDWENLEELLCWYLRVNGKSNHGYIVGAF  218

Query  184  LSL  176
            + L
Sbjct  219  VDL  221



>gb|EMT04058.1| hypothetical protein F775_01001 [Aegilops tauschii]
Length=266

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (53%), Gaps = 0/68 (0%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGF  200
            D   AF  +    M S++P  D RAS+ EM+   GV+DW  ME ++  Y+  N    HG 
Sbjct  164  DKTVAFEGATAVTMDSSNPYRDFRASMEEMVMSHGVKDWCWMEMMLGWYLRANGKSTHGL  223

Query  199  IEQAFLSL  176
            I  AF+ L
Sbjct  224  IVGAFVDL  231



>ref|XP_010031300.1| PREDICTED: transcription repressor OFP13 [Eucalyptus grandis]
Length=245

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S +P  D R S+ EM+   G++DW  +E L+  Y+ +N  + HGFI +AF
Sbjct  130  FKESVVLAMESENPYVDFRRSMEEMVESHGLKDWECLEALLGWYLRVNGKKNHGFIVEAF  189

Query  184  LSL  176
            + L
Sbjct  190  VDL  192



>gb|KHN45278.1| hypothetical protein glysoja_043453 [Glycine soja]
Length=163

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            E F +S+   M S DP  D R S+ EM+  +GV+DW  +E+L+  Y+  N+   H +I  
Sbjct  13   EPFKNSVVLTMDSEDPHVDFRKSMEEMVETLGVEDWESLEDLLCWYLQANAKSNHEYIIG  72

Query  190  AFLSL  176
            AF+ L
Sbjct  73   AFVDL  77



>ref|XP_004486277.1| PREDICTED: protein Shroom4-like [Cicer arietinum]
Length=369

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   +  S +P  D R S++EMI + G++   EMEEL+ CY+ LN+ E H  I + F
Sbjct  288  DSFAVIKCSLNPKQDFRDSMIEMIEEKGIKKPEEMEELLACYLTLNADEYHDLIIKVF  345



>ref|XP_009627121.1| PREDICTED: transcription repressor OFP5 [Nicotiana tomentosiformis]
Length=425

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   V  S DP  D R S+LEMI   G+++  E+EEL+ CY+ LN  E H  I + F
Sbjct  340  DSYAVVKSSFDPFRDFRESMLEMITQRGIKNSEELEELLACYLTLNCDEYHDLIIKVF  397



>gb|KHN02569.1| hypothetical protein glysoja_002593 [Glycine soja]
Length=204

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 46/92 (50%), Gaps = 11/92 (12%)
 Frame = -2

Query  409  IISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIH------DVGVQDWSEMEE  248
            I+  S+S   +A      S+    YS DP +D R S+ EM+       DV  + W E+ E
Sbjct  93   ILGLSSSDESEAKALLDRSVAVRKYSPDPYADFRQSMEEMVAARPELMDVASK-WRELHE  151

Query  247  LIYCYIVLNSLEVHGFIEQAF----LSLCSTS  164
            L+ CY+ LN    H FI +AF    LSL S S
Sbjct  152  LLLCYLALNPKSTHKFILRAFSDFLLSLISRS  183



>ref|XP_010541469.1| PREDICTED: transcription repressor OFP3 [Tarenaya hassleriana]
Length=267

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  385  PDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVH  206
            P+  ++  ++S   V+ S DP  D R S++EMI +  +++  ++E+L+ CY+ LNS E H
Sbjct  189  PEKENKGIAESFAMVLTSVDPERDFRQSMVEMIVENNIREQKDLEDLLACYLSLNSSEYH  248

Query  205  GFIEQAF  185
              I  AF
Sbjct  249  HVIINAF  255



>ref|XP_010695079.1| PREDICTED: transcription repressor OFP13 [Beta vulgaris subsp. 
vulgaris]
Length=243

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQD-WSEMEELIYCYIVLNSLEVHG  203
            +    F  SI   + S  P  D + S+ EM+  +GV+D W  +EEL+  Y+ +N  E HG
Sbjct  129  NKKRPFKKSIAMSLVSDHPYEDFKRSMEEMVESLGVRDDWEGLEELLRWYLKVNGRETHG  188

Query  202  FIEQAFLSLC  173
            +I  AF+ L 
Sbjct  189  YIINAFVDLV  198



>ref|XP_002275570.1| PREDICTED: transcription repressor OFP13 [Vitis vinifera]
Length=229

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM    G++DW  +EEL+  Y+ +N  + HG+I  AF
Sbjct  113  FKESVVLSMESEDPYVDFRRSMEEMAEAHGLKDWESLEELLSWYLRVNEKQNHGYIIGAF  172

Query  184  LSL  176
            + L
Sbjct  173  VDL  175



>ref|XP_009358432.1| PREDICTED: transcription repressor OFP2-like [Pyrus x bretschneideri]
Length=383

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
             +  FS+S   V  S DP  D R S++EMI +  ++   ++E+L+ CY+ LNS E H  I
Sbjct  308  KNRRFSESFAVVKTSVDPQRDFRESMMEMIVENNIRAAKDLEDLLACYLSLNSNEYHDLI  367

Query  196  EQAF  185
             +AF
Sbjct  368  VKAF  371



>ref|XP_002439563.1| hypothetical protein SORBIDRAFT_09g012740 [Sorghum bicolor]
 gb|EES17993.1| hypothetical protein SORBIDRAFT_09g012740 [Sorghum bicolor]
Length=247

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
            N +I+ ++++      A   S+  V  STDP  D + S++EMI +  +    +M+EL+ C
Sbjct  158  NSVITTTSAI-GGRRSAARRSLAVVKTSTDPPRDFKESMVEMIVENDMNAPEDMQELLEC  216

Query  235  YIVLNSLEVHGFIEQAF  185
            Y+ LNS E HG I++ F
Sbjct  217  YLSLNSREYHGVIKEVF  233



>emb|CAN61477.1| hypothetical protein VITISV_021409 [Vitis vinifera]
Length=231

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S DP  D R S+ EM    G++DW  +EEL+  Y+ +N  + HG+I  AF
Sbjct  113  FKESVVLSMESEDPYVDFRRSMEEMAEAHGLKDWESLEELLSWYLRVNEKQNHGYIIGAF  172

Query  184  LSL  176
            + L
Sbjct  173  VDL  175



>ref|XP_003616018.1| Plant-specific domain TIGR01568 family protein [Medicago truncatula]
 gb|AES98976.1| ovate transcriptional repressor [Medicago truncatula]
Length=349

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F D    V  S DP+SD + S++EMI +  +++  ++E+L+ CY+ LNS E H  I +A
Sbjct  277  GFVDGFAVVKSSIDPISDFKESMVEMIVENNIRESKDLEDLLACYLSLNSSEYHDVIVKA  336

Query  187  F  185
            F
Sbjct  337  F  337



>gb|EYU19830.1| hypothetical protein MIMGU_mgv1a022507mg, partial [Erythranthe 
guttata]
Length=250

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            + +S+   M S DP  D + S+ EM+   G++DW  +EEL+  Y+ +N    HGFI  AF
Sbjct  152  YKESVAVAMESEDPYLDFKKSMAEMVESHGLEDWDCLEELLRWYLKMNGKINHGFIVGAF  211

Query  184  LSL  176
            + L
Sbjct  212  VDL  214



>emb|CDP04054.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
             + FS+S   V  S DP  D R S++EMI +  ++   ++EEL+ CY+ LNS E H  I 
Sbjct  332  KKGFSESFAIVKASIDPEKDFRESMMEMIVENNIRASKDLEELLACYLSLNSDEYHELII  391

Query  193  QAF  185
            +AF
Sbjct  392  KAF  394



>ref|XP_009402806.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata 
subsp. malaccensis]
Length=186

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F  SI   + S DP  D + S+ EM+   GV DW+ +++++  Y++LN  + HGFI  AF
Sbjct  83   FEGSIAMAVESEDPYRDFKQSMEEMLLAHGVGDWAWLQQMLEWYLLLNGKKNHGFIIGAF  142

Query  184  LSL  176
            + L
Sbjct  143  MDL  145



>ref|XP_003629846.1| hypothetical protein MTR_8g087530 [Medicago truncatula]
 gb|AET04322.1| ovate transcriptional repressor [Medicago truncatula]
Length=339

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 39/74 (53%), Gaps = 9/74 (12%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFL-  182
            DS   V  S DP  D R S++EMI +  +    EMEEL+ CY+ LNS E H  I +AF  
Sbjct  258  DSFAVVKCSLDPQQDFRDSMIEMIKEKHISQPEEMEELLACYLSLNSNEFHDIIIKAFRQ  317

Query  181  --------SLCSTS  164
                    SLC+ S
Sbjct  318  VWLCMSQSSLCNKS  331



>ref|XP_008810113.1| PREDICTED: transcription repressor OFP14-like [Phoenix dactylifera]
Length=259

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = -2

Query  361  SDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNSLEVHGFI  197
             D +    +S DP  D R S+ +M+    V      DW  MEEL++CY+ LN   VH +I
Sbjct  158  GDGVAVTTFSKDPYDDFRRSMQDMVDARHVDPHQALDWDFMEELLFCYLELNDRSVHKYI  217

Query  196  EQAFLSLC  173
             +AF  L 
Sbjct  218  LRAFTDLT  225



>ref|XP_010919418.1| PREDICTED: transcription repressor OFP13-like [Elaeis guineensis]
Length=244

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S+   M S DP  D RAS+ EM+    +++W  ++EL++CY+ LN  + H  I  AF+ 
Sbjct  161  ESVALAMASDDPYHDFRASMEEMVEAYQLREWPSLQELLHCYLRLNEKKNHKIIVMAFVD  220

Query  178  L  176
            L
Sbjct  221  L  221



>ref|XP_011043235.1| PREDICTED: transcription repressor OFP6-like [Populus euphratica]
Length=193

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            DSI  V YS DP  D + S+++M+ +  +   +++EEL+ C++ LNS   H  I QAF  
Sbjct  107  DSIAVVKYSNDPFQDFKHSMVQMVVEKNIYSRNDLEELLNCFLGLNSPCHHSVIVQAFAE  166

Query  178  LCS  170
            +C+
Sbjct  167  ICN  169



>emb|CBI30728.3| unnamed protein product [Vitis vinifera]
Length=195

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            +S   V  S DP  D R S++EMI + G+    E+EEL+ CY+ LNS E H  I + F
Sbjct  115  ESFAVVKSSLDPQKDFRDSMIEMIMEKGISQPEELEELLACYLTLNSDEYHDLIIKVF  172



>ref|XP_008775318.1| PREDICTED: transcription repressor OFP14-like [Phoenix dactylifera]
Length=255

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (51%), Gaps = 6/75 (8%)
 Frame = -2

Query  379  DAHEA-FSDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNS  218
            DA  A   D +    ++ DP  D R S+ +M+    V      DW  MEEL++CY+ LN 
Sbjct  148  DAGPAVLGDGVAVTTFTKDPYDDFRRSMQDMVEARHVDPRQPLDWDFMEELLFCYLELND  207

Query  217  LEVHGFIEQAFLSLC  173
              VH +I +AF  L 
Sbjct  208  RSVHKYILRAFTDLA  222



>ref|XP_010254472.1| PREDICTED: transcription repressor OFP14-like [Nelumbo nucifera]
Length=250

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQ----DWSEMEELIYCYIVLNSLEVHGFIEQ  191
            DSI  + YS++P  D + S+ EM+     +    DW  MEEL++CY++LN  + H +I  
Sbjct  164  DSIAILTYSSNPYDDFQRSMKEMVDAYFWRYRTIDWDFMEELLFCYLMLNEKKSHKYILG  223

Query  190  AFLSLCST  167
            AF+ L +T
Sbjct  224  AFVDLIAT  231



>ref|XP_011004320.1| PREDICTED: transcription repressor OFP13-like [Populus euphratica]
Length=221

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -2

Query  382  DDAHE-AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVH  206
            D+A++  F + +   M S DP  D R+S+ E +   G+++W ++EEL+  Y+ +N  + H
Sbjct  104  DEANKFPFPEFVALAMESEDPYEDFRSSMEETVETCGLKNWEDVEELLAWYLRMNRKQHH  163

Query  205  GFIEQAFLSLCSTSTT  158
             FI +AF+ L + + +
Sbjct  164  CFIVEAFVDLFAAAPS  179



>ref|XP_007017502.1| Ovate family protein 8, putative [Theobroma cacao]
 gb|EOY14727.1| Ovate family protein 8, putative [Theobroma cacao]
Length=343

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  388  LPDDAHEA-FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLE  212
            +P +A E   S+S+  V  S DP  D + S+LEMI +  + +  ++E+L+ C++ LNS +
Sbjct  259  MPREAAEGKVSESVAVVKKSEDPYEDFKRSMLEMILEKQMFEAKDLEQLLQCFLSLNSRQ  318

Query  211  VHGFIEQAF  185
             HG I +AF
Sbjct  319  YHGIIVEAF  327



>ref|XP_002892365.1| hypothetical protein ARALYDRAFT_470713 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68624.1| hypothetical protein ARALYDRAFT_470713 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFL  182
            DS   +  S DP  D R S++EMI +  ++   +ME+L+ CY+ LN+ E H  I + F+
Sbjct  235  DSFAVIKSSLDPKKDFRESMVEMIAESNIRTSKDMEDLLACYLTLNAKEYHNLIIKVFV  293



>ref|XP_006417868.1| hypothetical protein EUTSA_v10009577mg [Eutrema salsugineum]
 gb|ESQ36221.1| hypothetical protein EUTSA_v10009577mg [Eutrema salsugineum]
Length=313

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFL  182
            DS   +  S DP  D R S++EMI +  ++D  +ME+L+ CY+ LN  E H  I + F+
Sbjct  242  DSFAVIKSSVDPNKDFRESMVEMIEENDIRDSQDMEDLLACYLSLNPKEYHDLIFKVFV  300



>ref|XP_010104796.1| hypothetical protein L484_018851 [Morus notabilis]
 gb|EXC01937.1| hypothetical protein L484_018851 [Morus notabilis]
Length=292

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F +S+   M S +P  D + S+ EM+  +G+++W  +EEL+  Y+ +N  + HG+I  AF
Sbjct  134  FKESVALSMESKNPYLDFKKSMEEMVEALGIKEWEGLEELLCWYLKMNGKDNHGYIVGAF  193

Query  184  LSL  176
            + L
Sbjct  194  VDL  196



>ref|XP_009386725.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=361

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
             + F +S   V  S+DP  D R S++EMI +  ++   ++EEL+ CY++LNS E H  I 
Sbjct  268  RKGFLESFAVVKSSSDPGRDFRDSMVEMIVENNIRASKDLEELLACYLLLNSNEYHDVIV  327

Query  193  QAF  185
            +AF
Sbjct  328  KAF  330



>ref|XP_009787220.1| PREDICTED: transcription repressor OFP15-like [Nicotiana sylvestris]
Length=284

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            ++   + S DP  D R S+ EM+    +QDW  +EEL+ CY+ +N    HG+I  AF+ L
Sbjct  141  TVVMALDSKDPFVDFRKSMEEMVEAHEIQDWENLEELLTCYLKVNCKSNHGYIVGAFVDL  200



>ref|XP_002313599.1| hypothetical protein POPTR_0009s16320g [Populus trichocarpa]
 gb|EEE87554.1| hypothetical protein POPTR_0009s16320g [Populus trichocarpa]
Length=221

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F + +   M S DP  D R+S+ E +   G+++W ++EEL+  Y+ +N  + H FI +AF
Sbjct  111  FPECVALAMESEDPYEDFRSSMEETVETCGLKNWEDVEELLAWYLRMNRQQHHCFIIEAF  170

Query  184  LSLCSTS  164
            + L S +
Sbjct  171  VDLFSAA  177



>gb|KHN08720.1| hypothetical protein glysoja_037042 [Glycine soja]
Length=268

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            E F +S+   M S DP  D R S+ EM+  +GV+DW  +E+L+  Y+  N+   H +I  
Sbjct  131  EPFKNSVVLTMDSEDPHVDFRKSMEEMVETLGVEDWESLEDLLCWYLQANTKSNHEYIIG  190

Query  190  AFLSL  176
            AF+ L
Sbjct  191  AFVDL  195



>gb|EPS72549.1| hypothetical protein M569_02209, partial [Genlisea aurea]
Length=178

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 6/59 (10%)
 Frame = -2

Query  337  YSTDPVSDIRASILEM-----IHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            YS DP +D R S+ EM     IHDVG ++W  + EL+ CY+ LN    H FI  AF  L
Sbjct  109  YSPDPFADFRRSMQEMVEAREIHDVG-ENWDYLHELLICYLSLNPESTHEFIVGAFADL  166



>ref|XP_009764897.1| PREDICTED: transcription repressor OFP5 [Nicotiana sylvestris]
Length=429

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   V  S DP  D R S++EMI   G+++  E+EEL+ CY+ LN  E H  I + F
Sbjct  344  DSYAVVKSSFDPFRDFRESMIEMITQRGIKNSEELEELLACYLTLNCDEYHDLIIKVF  401



>ref|XP_002528201.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34208.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -2

Query  367  AFSDSICAVM-YSTDPVSDIRASILEMI----HDVGVQDWSEMEELIYCYIVLNSLEVHG  203
             FSD   AV  YS  P +D R S+ EM+     + G  +W  M+EL++CY+ LN  + H 
Sbjct  191  KFSDDYIAVKTYSRSPSNDFRRSMQEMVEARLQEDGKVNWDFMQELLFCYLNLNEKKSHK  250

Query  202  FIEQAFLSL  176
            FI  AF+ L
Sbjct  251  FILSAFVDL  259



>ref|XP_006588856.1| PREDICTED: uncharacterized protein LOC100806620 [Glycine max]
Length=267

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            E F +S+   M S DP  D R S+ EM+  +GV+DW  +E+L+  Y+  N+   H +I  
Sbjct  130  EPFKNSVVLTMDSEDPHVDFRKSMEEMVETLGVEDWESLEDLLCWYLQANTKSNHEYIIG  189

Query  190  AFLSL  176
            AF+ L
Sbjct  190  AFVDL  194



>ref|XP_002299642.1| ovate family protein [Populus trichocarpa]
 gb|EEE84447.1| ovate family protein [Populus trichocarpa]
Length=295

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 11/75 (15%)
 Frame = -2

Query  388  LPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDV----GVQDWSEMEELIYCYIVLN  221
            LPDD        I  + YS  P  D R S+ EM+ +     G  DW  MEEL+ CY+ LN
Sbjct  195  LPDDC-------IAVLTYSPSPYDDFRRSMQEMVEEKLQNNGKVDWDFMEELLLCYLNLN  247

Query  220  SLEVHGFIEQAFLSL  176
                H FI  AF+ L
Sbjct  248  EKTSHKFILSAFVDL  262



>ref|XP_010430037.1| PREDICTED: transcription repressor OFP14-like [Camelina sativa]
Length=299

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIH-DVGVQ----DWSEMEELIYCYIVLNSLEVHGFIEQA  188
            I  + YS +P  D R S++EM+   +G++    DW  MEEL++CY+ LN  + H FI  A
Sbjct  198  IAVLKYSDEPQDDFRLSMVEMLESKLGMREREVDWDLMEELLFCYLDLNDKKSHKFILSA  257

Query  187  FLSL  176
            F+ L
Sbjct  258  FVDL  261



>ref|XP_007142050.1| hypothetical protein PHAVU_008G248300g [Phaseolus vulgaris]
 gb|ESW14044.1| hypothetical protein PHAVU_008G248300g [Phaseolus vulgaris]
Length=379

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
            +F D    V  S DP SD R S++EMI +  ++   ++E+L+ CY+ LNS E H  I +A
Sbjct  307  SFPDGFAVVKSSFDPQSDFRESMVEMIVENNIRASKDLEDLLACYLSLNSSEYHDLIVKA  366

Query  187  F  185
            F
Sbjct  367  F  367



>ref|XP_009374363.1| PREDICTED: transcription repressor OFP4-like [Pyrus x bretschneideri]
Length=385

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             S+S   V  S DP  D R S++EMI +  ++   ++EEL+ CY+ LNS E H  I +AF
Sbjct  314  LSESFAVVKSSVDPQRDFRHSMMEMIVENNIRAAKDLEELLACYLSLNSKEYHELIVKAF  373



>ref|XP_006653379.1| PREDICTED: uncharacterized protein LOC102709361 [Oryza brachyantha]
Length=340

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R+S+ +M+   G++DW  +EEL+  Y+ LN   VHG I  AF+ L
Sbjct  251  SEDPYGDFRSSMADMVAAHGLRDWEGLEELLAWYLKLNGKGVHGVIVGAFIDL  303



>gb|KHN06430.1| hypothetical protein glysoja_010774, partial [Glycine soja]
Length=410

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   V  S DP  D R S++EMI +  + +  EME+L+ CY+ LNS E H  I Q F
Sbjct  329  DSFAVVKCSLDPRKDFRDSMIEMITEKQISEPEEMEDLLACYLTLNSNEYHDLIIQVF  386



>ref|XP_006594926.1| PREDICTED: uncharacterized protein LOC102670259 [Glycine max]
Length=184

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            DSI     S DP  D RASIL+MI +  +   +E++EL+ C++ LN+   H  I QAF+ 
Sbjct  94   DSIAVEKDSNDPHKDFRASILQMILEREIYTETELQELLECFLQLNATCHHQVIVQAFME  153

Query  178  LC  173
            +C
Sbjct  154  IC  155



>ref|XP_011032802.1| PREDICTED: transcription repressor OFP14-like [Populus euphratica]
Length=293

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 11/75 (15%)
 Frame = -2

Query  388  LPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDV----GVQDWSEMEELIYCYIVLN  221
            LPDD        I  + YS  P  D R S+ EM+ +     G  DW  MEEL+ CY+ LN
Sbjct  193  LPDDC-------IAVLTYSPSPYDDFRRSMQEMVEEKLQNNGKVDWDFMEELLLCYLNLN  245

Query  220  SLEVHGFIEQAFLSL  176
                H FI  AF+ L
Sbjct  246  EKTSHKFILSAFVDL  260



>ref|XP_003518202.1| PREDICTED: uncharacterized protein LOC100816044 [Glycine max]
Length=276

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            E F +S+   M S DP  D R S+ EM+  +GV+DW  +E+L+  Y+  N+   H +I  
Sbjct  126  EPFKNSVVLTMDSEDPHVDFRKSMEEMVETLGVEDWESLEDLLCWYLQANAKSNHEYIIG  185

Query  190  AFLSL  176
            AF+ L
Sbjct  186  AFVDL  190



>ref|XP_003518343.1| PREDICTED: uncharacterized protein LOC100780926 [Glycine max]
 gb|KHN40984.1| hypothetical protein glysoja_013326 [Glycine soja]
Length=383

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F D    V  S DP SD R S++EMI +  ++   ++E+L+ CY+ LNS E H  I +A
Sbjct  311  GFPDGFAVVKSSFDPQSDFRESMVEMIVENNIRASKDLEDLLACYLSLNSSEYHDLIVKA  370

Query  187  F  185
            F
Sbjct  371  F  371



>gb|KHN48028.1| hypothetical protein glysoja_015498 [Glycine soja]
Length=413

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   V  S DP  D R S++EMI +  + +  EME+L+ CY+ LNS E H  I Q F
Sbjct  332  DSFAVVKCSLDPQKDFRDSMIEMITEKQISEPEEMEDLLACYLTLNSSEYHDLIIQVF  389



>ref|XP_004961935.1| PREDICTED: uncharacterized protein LOC101785753 [Setaria italica]
Length=259

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 35/69 (51%), Gaps = 0/69 (0%)
 Frame = -2

Query  382  DDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHG  203
            D +  +F D +     S DP  D RAS+ EM+   GV DW  +E ++  Y+  N  + H 
Sbjct  146  DASSSSFGDGVAVAFDSADPYRDFRASMEEMVSAHGVGDWEWLERMLAWYLGANGRDTHP  205

Query  202  FIEQAFLSL  176
             I  AF+ L
Sbjct  206  AIVTAFVDL  214



>ref|XP_010417768.1| PREDICTED: transcription repressor OFP14-like [Camelina sativa]
Length=283

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIH-DVGVQ----DWSEMEELIYCYIVLNSLEVHGFIEQA  188
            I  + YS +P  D R S++EM+   +G++    DW  MEEL++CY+ LN  + H FI  A
Sbjct  192  IAVLKYSDEPQDDFRLSMVEMMESKLGMREREVDWDLMEELLFCYLDLNDKKSHKFILSA  251

Query  187  FLSL  176
            F+ L
Sbjct  252  FVDL  255



>gb|AEW07785.1| hypothetical protein 0_11531_01, partial [Pinus radiata]
 gb|AFG67772.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67773.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67776.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67777.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67779.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67780.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67781.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67782.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67783.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
Length=158

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -2

Query  388  LPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEV  209
            +P D      +S+  V  S DP  D R S+LEMI +  +   +++E+L+ C++ LNS + 
Sbjct  75   VPADIDGKVGESVAVVKSSEDPYHDFRDSMLEMILEKQIFQANDLEKLLQCFLSLNSRQH  134

Query  208  HGFIEQAFLSL  176
            HG I +AF  +
Sbjct  135  HGVIVEAFTEI  145



>ref|XP_009402214.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=393

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
              S+S   V  S+DP  D R S+LEMI +  ++   ++EEL+ CY+ LNS E H  I +A
Sbjct  320  GLSESFAVVKSSSDPQRDFRDSMLEMIVENNIRASKDLEELLACYLSLNSDEYHDVIVKA  379

Query  187  F  185
            F
Sbjct  380  F  380



>gb|AFW56088.1| hypothetical protein ZEAMMB73_550984 [Zea mays]
 gb|AIB05770.1| OFP transcription factor, partial [Zea mays]
Length=337

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S+   + S DP  D RAS+ EM+   G++DW+++EEL+  Y+ +N  + H  I  AF+ L
Sbjct  242  SVAVAVDSGDPYGDFRASMEEMVSAHGLRDWAQLEELLAWYLRINGKQHHHLIVGAFVDL  301



>gb|AFG67771.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67774.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67775.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
 gb|AFG67778.1| hypothetical protein 0_11531_01, partial [Pinus taeda]
Length=158

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -2

Query  388  LPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEV  209
            +P D      +S+  V  S DP  D R S+LEMI +  +   +++E+L+ C++ LNS + 
Sbjct  75   VPADIDGKVGESVAVVKSSEDPYHDFRDSMLEMILEKQIFQANDLEKLLQCFLSLNSRQH  134

Query  208  HGFIEQAFLSL  176
            HG I +AF  +
Sbjct  135  HGVIVEAFTEI  145



>ref|NP_001052758.1| Os04g0415100 [Oryza sativa Japonica Group]
 dbj|BAF14672.1| Os04g0415100, partial [Oryza sativa Japonica Group]
Length=327

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R+S+ +M+   G++DW  +EEL+  Y+ LN+  VHG I  AF+ +
Sbjct  242  SEDPYGDFRSSMADMVAAHGLRDWEGLEELLAWYLKLNAKGVHGVIVGAFIDM  294



>ref|XP_004294737.1| PREDICTED: uncharacterized protein LOC101298496 [Fragaria vesca 
subsp. vesca]
Length=386

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
              SDS   V  S DP  D + S+ EMI +  +++  ++E+L+ CY+ LNS E H  I +A
Sbjct  314  GISDSFAVVKSSLDPQRDFKDSMREMIMENNIKESKDLEDLLACYLSLNSREYHDLIVKA  373

Query  187  F  185
            F
Sbjct  374  F  374



>gb|EEE60972.1| hypothetical protein OsJ_14751 [Oryza sativa Japonica Group]
Length=344

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R+S+ +M+   G++DW  +EEL+  Y+ LN+  VHG I  AF+ +
Sbjct  259  SEDPYGDFRSSMADMVAAHGLRDWEGLEELLAWYLKLNAKGVHGVIVGAFIDM  311



>gb|EEC77250.1| hypothetical protein OsI_15834 [Oryza sativa Indica Group]
Length=344

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R+S+ +M+   G++DW  +EEL+  Y+ LN+  VHG I  AF+ +
Sbjct  259  SEDPYGDFRSSMADMVAAHGLRDWEGLEELLAWYLKLNAKGVHGVIVGAFIDM  311



>gb|AEW07786.1| hypothetical protein 0_11531_01, partial [Pinus lambertiana]
Length=158

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  388  LPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEV  209
            +P D      +S+  V  S DP  D R S+LEMI +  +    ++E+L+ C++ LNS + 
Sbjct  75   VPADIDGKVGESVAVVKSSEDPYHDFRDSMLEMILEKQIFQAKDLEKLLQCFLSLNSRQH  134

Query  208  HGFIEQAFLSL  176
            HG I +AF  +
Sbjct  135  HGVIVEAFTEI  145



>ref|XP_006833280.1| hypothetical protein AMTR_s00109p00024120 [Amborella trichopoda]
 gb|ERM98558.1| hypothetical protein AMTR_s00109p00024120 [Amborella trichopoda]
Length=300

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S+  V  S DP SD RAS+LEMI    +    E++ L++C++ LNS   H  I QAF  
Sbjct  218  ESVAVVKRSKDPYSDFRASMLEMIVHKQIFGAEELKHLLHCFLSLNSSHHHHVILQAFSE  277

Query  178  LC  173
            +C
Sbjct  278  IC  279



>ref|XP_007202838.1| hypothetical protein PRUPE_ppa014570mg [Prunus persica]
 gb|EMJ04037.1| hypothetical protein PRUPE_ppa014570mg [Prunus persica]
Length=349

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = -2

Query  436  EVkkkkKNRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSE  257
            E++     R+  F   +P        +S   V  S DP  D + S++EMI +  + D  E
Sbjct  239  EMETAAPARLSVFQRLIPCTVEGKVRESFAVVKKSEDPYEDFKRSMMEMILEKQMFDERE  298

Query  256  MEELIYCYIVLNSLEVHGFIEQAF  185
            +E+L++C++ LNS E HG I +AF
Sbjct  299  LEQLLHCFLSLNSREHHGVIVEAF  322



>ref|XP_002439957.1| hypothetical protein SORBIDRAFT_09g023390 [Sorghum bicolor]
 gb|EES18387.1| hypothetical protein SORBIDRAFT_09g023390 [Sorghum bicolor]
Length=377

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             ++S   V  S +P  D R S+ EMI + G++D +++E+L+ CY+ LN+ E H  I + F
Sbjct  304  LAESFAVVKSSANPRRDFRESMEEMIAEKGIRDAADLEDLLACYLALNAAEHHDLIVEVF  363



>ref|XP_011021025.1| PREDICTED: transcription repressor OFP4-like [Populus euphratica]
Length=385

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            ++  S+S   V +S DP  D + S++EMI +  ++   ++E+L+ CY+ LNS E H  I 
Sbjct  311  NKTLSESFAVVKFSVDPQRDFKDSMMEMIVEKNIRGSKDLEDLLACYLSLNSKEYHYIIV  370

Query  193  QAF  185
            +AF
Sbjct  371  KAF  373



>ref|XP_001752154.1| predicted protein [Physcomitrella patens]
 gb|EDQ82887.1| predicted protein [Physcomitrella patens]
Length=765

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -2

Query  403  SFSASLPDDAHEAFSDSICAVMYST-DPVSDIRASILEMIHDVGVQDWSEMEELIYCYIV  227
            S S   P  A     +S+  V+ S+ DP  D RAS+++MI D  +Q  S+MEEL+ CY+ 
Sbjct  679  SASPRPPIPAGNVAKESVAVVVESSYDPYGDFRASMIDMIIDQNIQQTSDMEELLQCYLA  738

Query  226  LNSLEVHGFIEQAF  185
            LN  + H  I + F
Sbjct  739  LNEPDYHQVIVEVF  752



>ref|XP_009602773.1| PREDICTED: transcription repressor OFP7-like [Nicotiana tomentosiformis]
Length=183

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S+  V  S DP  D R S+L+MI +  +    ++ EL+ C++ LNS   H  I QAF+ +
Sbjct  102  SVAVVKNSDDPFKDFRQSMLQMILEKEIYKQDDLHELLNCFLELNSPSHHDIIIQAFMEI  161

Query  175  CSTSTT*KILL  143
            C+   +  +LL
Sbjct  162  CNNGKSSPLLL  172



>ref|XP_009774072.1| PREDICTED: transcription repressor OFP14 [Nicotiana sylvestris]
Length=301

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = -2

Query  403  SFSASLPDDAHEAFS--DSICAVMYSTDPVSDIRASILEM----IHDVGVQDWSEMEELI  242
            S + S  D + E  S  D I  V YS  P  D R S+ EM    ++D G  +W  MEEL+
Sbjct  190  SLAISTSDGSKETLSANDFITVVTYSPSPYDDFRQSMQEMMEARLNDQGKINWEFMEELL  249

Query  241  YCYIVLNSLEVHGFIEQAFLSL  176
            +CY  LN  + + +I  AF+ L
Sbjct  250  FCYFNLNDKKSYKYILSAFVDL  271



>ref|XP_004501129.1| PREDICTED: uncharacterized protein LOC101512953 [Cicer arietinum]
Length=253

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
            NR    +  +     E   +S   V  S DP  D + S++EMI ++ + +  ++E+L+ C
Sbjct  148  NRRGKETKGVKSSMEEKVKESFAVVKKSKDPYEDFKKSMVEMIAEMEIYETEDLEQLLQC  207

Query  235  YIVLNSLEVHGFIEQAFLSL  176
            ++ LN    HG I +AF+ +
Sbjct  208  FLALNCRNYHGVIVRAFMEI  227



>ref|XP_010651853.1| PREDICTED: transcription repressor OFP13-like [Vitis vinifera]
Length=174

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNSL  215
            D+   F + +   + S DP  + R S+ EMI D G+Q     DW+ +E L+  Y+ +NS 
Sbjct  95   DSRFPFQEFVVVALQSNDPYVNFRISMEEMIEDYGLQANGLKDWNYLEALLAWYLRMNSK  154

Query  214  EVHGFIEQAFLSL  176
              HGFI  AF+ +
Sbjct  155  TNHGFIVAAFVDM  167



>ref|XP_002518279.1| hypothetical protein RCOM_0815310 [Ricinus communis]
 gb|EEF44039.1| hypothetical protein RCOM_0815310 [Ricinus communis]
Length=406

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            ++  S+S   V  STDP  D + S++EMI +  ++   ++E+L+ CY+ LNS E H  I 
Sbjct  332  NKTLSESFAVVKSSTDPQKDFKDSMVEMIIENNIRASRDLEDLLACYLSLNSKEYHDLIV  391

Query  193  QAF  185
            +AF
Sbjct  392  KAF  394



>emb|CAE01517.1| OJ991214_12.6 [Oryza sativa Japonica Group]
Length=316

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R+S+ +M+   G++DW  +EEL+  Y+ LN+  VHG I  AF+ +
Sbjct  231  SEDPYGDFRSSMADMVAAHGLRDWEGLEELLAWYLKLNAKGVHGVIVGAFIDM  283



>ref|XP_011079872.1| PREDICTED: transcription repressor OFP16-like [Sesamum indicum]
Length=215

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 35/67 (52%), Gaps = 6/67 (9%)
 Frame = -2

Query  361  SDSICAVMYSTDPVSDIRASILEM-----IHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
             DSI    YS DP  D R S+ EM     IHDV  ++W  + EL+ CY+ LN    H +I
Sbjct  120  GDSIAVPTYSPDPFLDFRRSMQEMVEAREIHDV-RENWDYLHELLMCYLSLNPKSTHKYI  178

Query  196  EQAFLSL  176
              AF  L
Sbjct  179  VGAFADL  185



>gb|EPS72109.1| hypothetical protein M569_02648, partial [Genlisea aurea]
Length=108

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S+DP     AS+ EM+   G++DW  +EEL+ CY+ +N+   HG+I  AF+ +
Sbjct  52   SSDPRRHFGASMEEMVAAHGIRDWDALEELLSCYLRVNAKSNHGYIISAFVDV  104



>ref|XP_009419680.1| PREDICTED: transcription repressor OFP4-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            +A   S+  V  S+DP  D R S++EMI    ++   EMEEL+ CY+ LNS + H  I +
Sbjct  202  KALLGSLVVVKSSSDPQRDFRESMVEMIIGNNIRSPKEMEELLACYLSLNSWKYHSLIVK  261

Query  190  AF  185
             F
Sbjct  262  EF  263



>ref|NP_178114.1| ovate family protein 14 [Arabidopsis thaliana]
 sp|Q9S7T5.1|OFP14_ARATH RecName: Full=Transcription repressor OFP14; AltName: Full=Ovate 
family protein 14; Short=AtOFP14 [Arabidopsis thaliana]
 gb|AAD55464.1|AC009322_4 Hypothetical protein [Arabidopsis thaliana]
 gb|AAG52238.1|AC011717_6 hypothetical protein; 23631-24515 [Arabidopsis thaliana]
 gb|AAY78676.1| ovate protein-related [Arabidopsis thaliana]
 gb|AEE36334.1| ovate family protein 14 [Arabidopsis thaliana]
Length=294

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIH-DVGVQ----DWSEMEELIYCYIVLNSLEVHGFIEQA  188
            I  + Y+ +P  D R S++EM+   +G++    DW  MEEL++CY+ LN  + H FI  A
Sbjct  193  IAVLRYTDEPQEDFRQSMVEMMESKLGMRESEVDWDLMEELLFCYLDLNDKKSHKFILSA  252

Query  187  FLSL  176
            F+ L
Sbjct  253  FVDL  256



>ref|XP_010933952.1| PREDICTED: transcription repressor OFP13-like isoform X2 [Elaeis 
guineensis]
Length=242

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S+   + S DP  D RAS+ EM+    +++W  ++EL++CY+ LN  + H  I  AF+ 
Sbjct  164  ESVALALASDDPYHDFRASMAEMVEAHQLREWPRLQELLHCYLRLNEEKTHEIIVLAFVD  223

Query  178  L  176
            L
Sbjct  224  L  224



>ref|XP_010315430.1| PREDICTED: transcription repressor OFP15 [Solanum lycopersicum]
Length=298

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R S+ EM+    ++DW  +EEL+ CY+ +N    HG+I  AF+ L
Sbjct  149  SNDPFVDFRKSMEEMVEAYEIKDWENLEELLTCYLKVNCKSNHGYIVGAFVDL  201



>ref|XP_008241648.1| PREDICTED: uncharacterized protein LOC103340060 [Prunus mume]
Length=349

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = -2

Query  436  EVkkkkKNRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSE  257
            E++     R+  F   +P        +S   V  S DP  D + S++EMI +  + D  E
Sbjct  239  EMETAAPARLSVFQRLIPCTVEGKVRESFAVVKKSEDPYEDFKRSMMEMILEKQMFDERE  298

Query  256  MEELIYCYIVLNSLEVHGFIEQAF------LSLCSTST  161
            +E+L++C++ LNS E HG I +AF      L  C+T +
Sbjct  299  LEQLLHCFLSLNSREHHGVIVEAFAEIWEALFCCATGS  336



>ref|XP_010108488.1| hypothetical protein L484_010681 [Morus notabilis]
 gb|EXC19550.1| hypothetical protein L484_010681 [Morus notabilis]
Length=364

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             S+S   V  S DP  D R S++EMI +  ++   ++EEL+ CY+ LNS E H  I +AF
Sbjct  293  LSESFAVVKSSVDPQRDFRDSMVEMIVENNIRASKDLEELLACYLSLNSKEYHDVIVKAF  352



>gb|KEH41949.1| ovate transcriptional repressor [Medicago truncatula]
Length=227

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +++   M S +P  D + SI+EM+   G+ DW  +E+L+  Y  +N    HGFI  A
Sbjct  126  PFKNTLEVSMDSRNPCEDFKESIVEMVEAYGINDWETLEKLLSWYFEVNEKRNHGFIIDA  185

Query  187  FLSL  176
            F  L
Sbjct  186  FFDL  189



>ref|XP_002458691.1| hypothetical protein SORBIDRAFT_03g038320 [Sorghum bicolor]
 gb|EES03811.1| hypothetical protein SORBIDRAFT_03g038320 [Sorghum bicolor]
Length=165

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             ++S   V  S DP  D R S+ EMI + G++  +++E+L+ CY+ LN+ E H  I + F
Sbjct  94   LAESFAVVKSSRDPRRDFRESMEEMITENGIRTAADLEDLLACYLSLNAAEYHDLIVEVF  153



>ref|XP_006389705.1| hypothetical protein EUTSA_v10019813mg [Eutrema salsugineum]
 gb|ESQ26991.1| hypothetical protein EUTSA_v10019813mg [Eutrema salsugineum]
Length=313

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIH-DVGVQ----DWSEMEELIYCYIVLNSLEVHGFIEQA  188
            I  + Y+ +P  D R S++EM+   +G +    DW  MEEL++CY+ LN  + H FI  A
Sbjct  209  IAVLRYTAEPQEDFRLSMVEMMESKLGTRETEVDWDLMEELLFCYLDLNDKKSHRFILSA  268

Query  187  FLSL  176
            F+ L
Sbjct  269  FVDL  272



>ref|XP_002265116.1| PREDICTED: transcription repressor OFP5 [Vitis vinifera]
Length=444

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            +S   V  S DP  D R S++EMI + G+    E+EEL+ CY+ LNS E H  I + F
Sbjct  364  ESFAVVKSSLDPQKDFRDSMIEMIMEKGISQPEELEELLACYLTLNSDEYHDLIIKVF  421



>ref|XP_010539496.1| PREDICTED: transcription repressor OFP14-like [Tarenaya hassleriana]
Length=305

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = -2

Query  397  SASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIH-DVGVQ----DWSEMEELIYCY  233
            SA LP++        I  + Y+ DP  D R S++EM+   +G +    DW  MEEL++CY
Sbjct  196  SAVLPENC-------IAVLRYTPDPQEDFRQSMVEMVEARLGAREWDVDWDFMEELLFCY  248

Query  232  IVLNSLEVHGFIEQAFLSL  176
            + LN  + H +I  AF+ L
Sbjct  249  LDLNEKKSHRYILSAFVDL  267



>ref|XP_009619234.1| PREDICTED: transcription repressor OFP13-like [Nicotiana tomentosiformis]
Length=244

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = -2

Query  382  DDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQD-WSEMEELIYCYIVLNSLEVH  206
            +D    F +S+   M S DP  D + S+ EM+   G++D W  ++EL+  Y+ +N    H
Sbjct  124  EDEDLPFKESVALAMESEDPYLDFKKSMEEMVETHGIKDSWKSLQELLGWYLKMNGKVNH  183

Query  205  GFIEQAFLSL  176
            GFI  AF+ L
Sbjct  184  GFIVGAFVDL  193



>emb|CAN76919.1| hypothetical protein VITISV_015621 [Vitis vinifera]
Length=196

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = -2

Query  379  DAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNSL  215
            D+   F + +   + S DP  + R S+ EMI D G+Q     DW+ +E L+  Y+ +NS 
Sbjct  117  DSRFPFQEFVVVALQSNDPYVNFRISMEEMIEDYGLQANGLKDWNYLEALLAWYLRMNSK  176

Query  214  EVHGFIEQAFLSL  176
              HGFI  AF+ +
Sbjct  177  TNHGFIVAAFVDM  189



>ref|XP_010931348.1| PREDICTED: transcription repressor OFP3 [Elaeis guineensis]
Length=388

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            +   +S   ++ S+DP  D R S++EMI +  ++   ++EEL+ CY+ LNS E HG I +
Sbjct  315  KGLRESFAIIISSSDPQRDFRESMVEMIVENNIRASKDLEELLACYLSLNSKEYHGVIVK  374

Query  190  AF  185
             F
Sbjct  375  VF  376



>ref|XP_009136961.1| PREDICTED: transcription repressor OFP5-like isoform X2 [Brassica 
rapa]
Length=323

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -2

Query  397  SASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNS  218
             A L     E  ++S   V  S+DP  D R S++EMI + G+    E++EL+ CY+ LN+
Sbjct  242  KAKLRAKEQEMENESFAVVKCSSDPQKDFRDSMIEMIMENGINRPEELKELLVCYLRLNT  301

Query  217  LEVHGFI  197
             E H  I
Sbjct  302  DEYHDMI  308



>gb|KDP21442.1| hypothetical protein JCGZ_21913 [Jatropha curcas]
Length=245

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 4/65 (6%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQD----WSEMEELIYCYIVLNSLEVHGFIEQ  191
            DS+    YS DP  D R S+ EM+    ++D    W  + EL+ CY+ LN    H FI +
Sbjct  151  DSVAVPTYSPDPYLDFRRSMQEMVEARRLEDVKANWDYLHELLLCYLALNPKNTHKFIVR  210

Query  190  AFLSL  176
            AF  L
Sbjct  211  AFADL  215



>ref|XP_009136962.1| PREDICTED: transcription repressor OFP5-like isoform X3 [Brassica 
rapa]
Length=319

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -2

Query  397  SASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNS  218
             A L     E  ++S   V  S+DP  D R S++EMI + G+    E++EL+ CY+ LN+
Sbjct  242  KAKLRAKEQEMENESFAVVKCSSDPQKDFRDSMIEMIMENGINRPEELKELLVCYLRLNT  301

Query  217  LEVHGFI  197
             E H  I
Sbjct  302  DEYHDMI  308



>ref|XP_004970678.1| PREDICTED: protein sister of odd and bowel-like [Setaria italica]
Length=245

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            EAF   +     S DP +D RAS+ EM+   GV DW  +EE++  Y+  N  + H  I  
Sbjct  139  EAFGGGVAVAFESADPYADFRASMEEMVAAHGVGDWGWLEEMLGWYLRANDQDTHCAIVS  198

Query  190  AFL  182
            AF+
Sbjct  199  AFI  201



>ref|XP_009801448.1| PREDICTED: transcription repressor OFP3-like [Nicotiana sylvestris]
Length=302

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -2

Query  376  AHEAFS-DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGF  200
              E+FS  S   V  STDP  D R S++EMI +  ++    +E L+ CY+ LNS E H  
Sbjct  226  KKESFSAGSFAIVKTSTDPEKDFRESMIEMIVENNIKASKNLENLLACYLSLNSNEYHDL  285

Query  199  IEQAF  185
            I +AF
Sbjct  286  IIKAF  290



>ref|XP_002276629.1| PREDICTED: transcription repressor OFP4 [Vitis vinifera]
Length=387

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
             + S+S   V  S DP  D R S+LEMI +  ++   ++EEL+ CY+ LNS E H  I +
Sbjct  314  RSLSESCAVVKASFDPERDFRDSMLEMIVENNIRASKDLEELLACYLSLNSDEYHDLIVK  373

Query  190  AF  185
            AF
Sbjct  374  AF  375



>ref|XP_004305636.1| PREDICTED: uncharacterized protein LOC101293706 [Fragaria vesca 
subsp. vesca]
Length=281

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S+   M S DP  D R S+ EM+   G++DW  +EEL+  Y+ +N    HG+I  AF+ L
Sbjct  135  SVALSMDSPDPYVDFRKSMEEMVEAHGLKDWEHLEELLCWYLRVNGKSNHGYIVGAFVDL  194



>ref|XP_009136960.1| PREDICTED: transcription repressor OFP5-like isoform X1 [Brassica 
rapa]
Length=325

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -2

Query  397  SASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNS  218
             A L     E  ++S   V  S+DP  D R S++EMI + G+    E++EL+ CY+ LN+
Sbjct  242  KAKLRAKEQEMENESFAVVKCSSDPQKDFRDSMIEMIMENGINRPEELKELLVCYLRLNT  301

Query  217  LEVHGFI  197
             E H  I
Sbjct  302  DEYHDMI  308



>emb|CAH66423.1| H0622F05.6 [Oryza sativa Indica Group]
Length=312

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R+S+ +M+   G++DW  +EEL+  Y+ LN+  VHG I  AF+ +
Sbjct  227  SEDPYGDFRSSMADMVAAHGLRDWEGLEELLAWYLNLNAKGVHGVIVGAFIDM  279



>ref|XP_002517130.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45293.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 39/82 (48%), Gaps = 6/82 (7%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMI-----HDVGVQDWSEME  251
            N II    +   +     +  +    YS DP +D R S+LEMI      DV   DW  + 
Sbjct  114  NSIIESPETPSAEPQTPLNGGVAVKKYSPDPYADFRQSMLEMIEARKPRDVKA-DWDYLH  172

Query  250  ELIYCYIVLNSLEVHGFIEQAF  185
            EL+ CY+ LN  + H FI  AF
Sbjct  173  ELLSCYLNLNPKQTHKFIISAF  194



>gb|EPS69579.1| hypothetical protein M569_05187 [Genlisea aurea]
Length=108

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   V+ S DP+ D R S++EMI + G+    ++E L+ CY+ LN  E H  I  AF
Sbjct  42   DSFAMVVSSFDPMRDFRDSMVEMIRERGITRCVDLERLLACYLTLNGDEYHHIIFAAF  99



>ref|XP_009777531.1| PREDICTED: transcription repressor OFP13-like [Nicotiana sylvestris]
Length=246

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQD-WSEMEELIYCYIVLNSLEVHGFIEQA  188
            F +S+   M S DP  D + S+ EM+   G++D W  ++EL+  Y+ +N    HGFI  A
Sbjct  131  FKESVALAMESEDPYLDFKKSMEEMVETHGIKDSWKSLQELLGWYLKMNGKVNHGFIVGA  190

Query  187  FLSL  176
            F+ L
Sbjct  191  FVDL  194



>ref|NP_172174.1| ovate family protein 4 [Arabidopsis thaliana]
 sp|F4HNU8.1|OFP4_ARATH RecName: Full=Transcription repressor OFP4; AltName: Full=Ovate 
family protein 4; Short=AtOFP4 [Arabidopsis thaliana]
 gb|AEE28053.1| ovate family protein 4 [Arabidopsis thaliana]
Length=315

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFL  182
            DS   +  S DP  D R S++EMI +  ++  ++ME+L+ CY+ LN  E H  I + F+
Sbjct  243  DSFAVIKSSIDPSKDFRESMVEMIAENNIRTSNDMEDLLVCYLTLNPKEYHDLIIKVFV  301



>ref|XP_002310801.1| ovate family protein [Populus trichocarpa]
 gb|EEE91251.1| ovate family protein [Populus trichocarpa]
Length=361

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = -2

Query  412  RIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCY  233
            R+  F   +P        +S   V  S DP  D + S++EMI +  + +  ++E+L++C+
Sbjct  265  RLSRFQWLIPCTVEGKVRESFAVVKRSEDPYEDFKRSMMEMILEKEMFEEKDLEQLLHCF  324

Query  232  IVLNSLEVHGFIEQAFLSLCST  167
            + LNS E HG I QAF  +  T
Sbjct  325  LSLNSREHHGVIVQAFSEIWET  346



>ref|XP_007208152.1| hypothetical protein PRUPE_ppa022134mg [Prunus persica]
 gb|EMJ09351.1| hypothetical protein PRUPE_ppa022134mg [Prunus persica]
Length=416

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
             +   S+S   V  S DP  D R S++EMI +  +++  ++E+L+ CY+ LNS E H  I
Sbjct  341  KNRRLSESFAVVKSSVDPQKDFRDSMVEMIVENNIRESKDLEDLLACYLSLNSNEYHDLI  400

Query  196  EQAF  185
             +AF
Sbjct  401  VKAF  404



>ref|XP_010912802.1| PREDICTED: transcription repressor OFP14 [Elaeis guineensis]
Length=256

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 36/75 (48%), Gaps = 5/75 (7%)
 Frame = -2

Query  382  DDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQ-----DWSEMEELIYCYIVLNS  218
            D       D +  + +S DP  D R S+ +M+    V      DW  MEEL+ CY+ LN 
Sbjct  149  DAGPAVLGDGVAVMTFSKDPYDDFRRSMQDMLEARHVDPRQPLDWEFMEELLVCYLELND  208

Query  217  LEVHGFIEQAFLSLC  173
              VH +I +AF  L 
Sbjct  209  RSVHKYILRAFTDLT  223



>ref|XP_010106010.1| hypothetical protein L484_021187 [Morus notabilis]
 gb|EXC07280.1| hypothetical protein L484_021187 [Morus notabilis]
Length=295

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            +S   V  S DP  D + S+LEMI    + + S++EEL+ C++ LNS + HG I +AF
Sbjct  219  ESFAVVKKSEDPYEDFKRSMLEMIMGKQMFEASDLEELLQCFLTLNSRQYHGVIVEAF  276



>ref|XP_006366994.1| PREDICTED: uncharacterized protein LOC102580284 [Solanum tuberosum]
Length=203

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -2

Query  412  RIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCY  233
            R+  F   +P +      +S   V  S DP  D ++S++EMI +  + + +++E+L+ C+
Sbjct  115  RLSVFKKLIPCNVEGKVKESFAIVKKSEDPYEDFKSSMMEMILEKKMFEKNDLEQLLECF  174

Query  232  IVLNSLEVHGFIEQAFLSLCST  167
            + LN+   HG I +AF  +  T
Sbjct  175  LSLNAKNCHGVIVEAFSEIWKT  196



>ref|XP_009126889.1| PREDICTED: transcription repressor OFP3, partial [Brassica rapa]
Length=248

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
              +  S+S   V+ S DP  D R S++EMI +  +++ +++E+L+ CY+ LNS E H  I
Sbjct  174  KRKGNSESFAIVLTSVDPERDFRESMVEMIVENKMKEQTDLEDLLACYLSLNSSEYHDII  233

Query  196  EQAF  185
             +AF
Sbjct  234  IKAF  237



>ref|XP_002447357.1| hypothetical protein SORBIDRAFT_06g033540 [Sorghum bicolor]
 gb|EES11685.1| hypothetical protein SORBIDRAFT_06g033540 [Sorghum bicolor]
Length=275

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 32/64 (50%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
            AF  +    + S DP  D R S+ EM+   G  DW  +EE++  Y+  N    HG I  A
Sbjct  171  AFDGATALAIESADPYGDFRRSMEEMVLSHGADDWGWLEEMLGWYLRANGKNTHGLIVGA  230

Query  187  FLSL  176
            F+ L
Sbjct  231  FVDL  234



>ref|XP_006445767.1| hypothetical protein CICLE_v10016377mg [Citrus clementina]
 ref|XP_006485467.1| PREDICTED: uncharacterized protein LOC102628563 [Citrus sinensis]
 gb|ESR59007.1| hypothetical protein CICLE_v10016377mg [Citrus clementina]
Length=251

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVG-VQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
            F +S+   M S +P  D R S+ EM+   G ++DW  +EEL+  Y+ +N  + HGFI  A
Sbjct  133  FKESVVLAMDSENPYVDFRRSMEEMVETHGLIKDWDCLEELLGWYLRVNGKKHHGFIVDA  192

Query  187  FLSLCST  167
            F+ L ++
Sbjct  193  FVDLLAS  199



>ref|XP_002319964.2| hypothetical protein POPTR_0013s15120g [Populus trichocarpa]
 gb|EEE95887.2| hypothetical protein POPTR_0013s15120g [Populus trichocarpa]
Length=432

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  373  HEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            ++  S+S   V +S DP  D + S++EMI +  ++   ++E+L+ CY+ LNS E H  I 
Sbjct  358  NKTLSESFAVVKFSVDPQRDFKDSMVEMIVENNIRGSKDLEDLLACYLSLNSKEYHYIIV  417

Query  193  QAF  185
            +AF
Sbjct  418  KAF  420



>ref|XP_011025749.1| PREDICTED: transcription repressor OFP7 [Populus euphratica]
Length=361

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -2

Query  412  RIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCY  233
            R+  F   +P        +S   V  S DP  D + S++EMI +  + +  ++E+L++C+
Sbjct  265  RLSRFQWLIPCTVEGKVRESFAVVKRSEDPYEDFKRSMMEMILEKEMFEEKDLEQLLHCF  324

Query  232  IVLNSLEVHGFIEQAF  185
            + LNS E HG I QAF
Sbjct  325  LSLNSREHHGVIVQAF  340



>ref|XP_004494233.1| PREDICTED: uncharacterized protein LOC101497716 [Cicer arietinum]
Length=270

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F DS+   M S DP  D R S+ EM+    V+DW  ++EL+  Y+ +N    HG+I  AF
Sbjct  116  FKDSVVLSMESQDPYVDFRKSMEEMVEAHDVKDWECLQELLCWYLRVNEKTNHGYIVGAF  175

Query  184  LSL  176
            + L
Sbjct  176  VDL  178



>ref|XP_010665684.1| PREDICTED: transcription repressor OFP5 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  355  SICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            S   V  + +P  D R S+ EMI +  ++   E+EEL+ CY+ LN+ E HG I +AF
Sbjct  319  SFAVVKSTRNPQQDFRDSMFEMIMEKRIRKPEELEELLACYLTLNADEYHGLIIKAF  375



>emb|CDY58970.1| BnaC09g38050D [Brassica napus]
Length=214

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S   V  S DP  D R S++EMI +  +   +E+++L+ C++ LNSL+ H  I Q FL 
Sbjct  147  ESFAVVKKSEDPYEDFRTSMVEMIVERQIFAAAELQKLLQCFLSLNSLQHHSVIVQVFLE  206

Query  178  LCST  167
            + +T
Sbjct  207  IYAT  210



>gb|KDO43030.1| hypothetical protein CISIN_1g035731mg [Citrus sinensis]
Length=229

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVG-VQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
            F +S+   M S +P  D R S+ EM+   G ++DW  +EEL+  Y+ +N  + HGFI  A
Sbjct  110  FKESVVLAMDSENPYVDFRRSMEEMVETHGLIKDWDCLEELLGWYLRVNGKKHHGFIVDA  169

Query  187  FLSLCST  167
            F+ L ++
Sbjct  170  FVDLLAS  176



>ref|XP_010239501.1| PREDICTED: transcription repressor OFP13-like [Brachypodium distachyon]
Length=349

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 46/84 (55%), Gaps = 5/84 (6%)
 Frame = -2

Query  412  RIISFSASLPDDAHEAFS-----DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEE  248
            R ++ +A  P  + +  S     +S+   + S DP  D RAS+ EM+   GV+ W++++E
Sbjct  161  RRMAAAAGSPRKSGKGASCLMVEESVAVAVESADPYGDFRASMEEMVAAHGVRGWADLQE  220

Query  247  LIYCYIVLNSLEVHGFIEQAFLSL  176
            L+  Y+ +N+   H  I  AF+ L
Sbjct  221  LLTWYLRVNAKRNHPLIVAAFVDL  244



>ref|XP_004490708.1| PREDICTED: uncharacterized protein LOC101489571 [Cicer arietinum]
Length=366

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F D    V  S DP SD + S++EMI +  +++  ++E+L+ CY+ LNS E H  I +AF
Sbjct  295  FLDGFAVVKSSIDPQSDFKESMVEMIVENNIRESKDLEDLLACYLSLNSSEYHDLIVKAF  354



>ref|XP_008354530.1| PREDICTED: uncharacterized protein LOC103418164 [Malus domestica]
Length=383

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             S+S   V  S DP  D R S++EMI +  ++   ++E+L+ CY+ LNS E H  I +AF
Sbjct  312  LSESFAVVKTSVDPQRDFRESMMEMIVENNIRAAKDLEDLLACYLSLNSNEYHDLIVKAF  371



>emb|CDX92512.1| BnaA10g15510D [Brassica napus]
Length=214

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S   V  S DP  D R S++EMI +  +   +E+++L+ C++ LNSL+ H  I Q FL 
Sbjct  147  ESFAVVKKSEDPYEDFRTSMVEMIVERQIFAAAELQKLLQCFLSLNSLQHHSVIVQVFLE  206

Query  178  LCST  167
            + +T
Sbjct  207  IYAT  210



>ref|XP_006400526.1| hypothetical protein EUTSA_v10015317mg [Eutrema salsugineum]
 gb|ESQ41979.1| hypothetical protein EUTSA_v10015317mg [Eutrema salsugineum]
Length=215

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S   V  S DP  D R S++EMI +  +   +E+++L+ C++ LNSL+ H  I Q FL 
Sbjct  148  ESFAVVKKSEDPYEDFRTSMVEMIVERQIFAAAELKQLLQCFLSLNSLQHHSVIVQVFLE  207

Query  178  LCST  167
            + +T
Sbjct  208  IYAT  211



>emb|CDO98061.1| unnamed protein product [Coffea canephora]
Length=289

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 4/65 (6%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMI----HDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            D I  + YS  P  D + S+ EM+    H  G  DW  MEEL++CY+ LN  + + FI +
Sbjct  193  DFITVLKYSVSPHDDFKKSMHEMVDARLHHNGKIDWEFMEELLFCYLNLNDKKSYRFILR  252

Query  190  AFLSL  176
            AF+ L
Sbjct  253  AFVDL  257



>ref|XP_010317346.1| PREDICTED: transcription repressor OFP5 [Solanum lycopersicum]
Length=377

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  346  AVMYST-DPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            A+M S+ DP SD R S++EMI   G++   E+EEL+ CY+ LN  E H  I + F
Sbjct  299  AIMKSSFDPFSDFRDSMIEMITQRGIKSSEELEELLACYLTLNCDEYHDIIIKVF  353



>ref|XP_002312831.1| hypothetical protein POPTR_0009s16330g [Populus trichocarpa]
 gb|EEE86786.1| hypothetical protein POPTR_0009s16330g [Populus trichocarpa]
Length=185

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            DSI  V YS DP  D + S+L+M+ +  +   +++EEL+ C++ LNS   H  I QAF  
Sbjct  107  DSIAVVKYSNDPFQDFKHSMLQMVVEKNIYSRNDLEELLNCFLELNSPCHHSVIVQAFTE  166

Query  178  L  176
            +
Sbjct  167  I  167



>ref|XP_010536003.1| PREDICTED: transcription repressor OFP8 [Tarenaya hassleriana]
Length=280

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = -2

Query  415  NRIISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYC  236
            ++ +S    LP++      DS   V  S+DP  D R S++EMI +  +    ++++L+ C
Sbjct  196  DKDVSGGGLLPENG--KVKDSFAVVKKSSDPYEDFRTSMVEMIVERQIFAADDLQQLLQC  253

Query  235  YIVLNSLEVHGFIEQAFLSLCST  167
            ++ LNS   HG I Q FL +  T
Sbjct  254  FLSLNSRHHHGVIVQVFLEIYET  276



>ref|XP_008446745.1| PREDICTED: uncharacterized protein LOC103489374 isoform X2 [Cucumis 
melo]
Length=229

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +S+   + S +P  D R S+ EM+   GV+DW  +EEL+  Y+  N    H FI  A
Sbjct  145  GFKESLIVSIESENPYEDFRKSMGEMVESHGVKDWDGLEELLGWYLKANWKNNHRFIIGA  204

Query  187  FLSL  176
            F+ L
Sbjct  205  FVDL  208



>ref|XP_009407003.1| PREDICTED: transcription repressor OFP3-like [Musa acuminata 
subsp. malaccensis]
Length=344

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -2

Query  370  EAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQ  191
            +  S S   V  S+DP  D R S++EMI +  ++   ++EEL+ CY+ LNS E HG I  
Sbjct  271  KGLSGSFAVVKSSSDPQRDFRDSMVEMIVENNIRASKDLEELLACYLSLNSDEYHGVIVA  330

Query  190  AF  185
             F
Sbjct  331  VF  332



>ref|XP_008456619.1| PREDICTED: uncharacterized protein LOC103496522 [Cucumis melo]
Length=227

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            +   M S DP  D R S+ EM+   G+++W  +EEL+  Y+ +N ++ HG+I  AF+ L
Sbjct  136  VLMAMESEDPYLDFRRSMEEMVECHGIRNWEWLEELLNWYLRMNGMKNHGYILGAFVDL  194



>ref|XP_008384677.1| PREDICTED: uncharacterized protein LOC103447277 [Malus domestica]
Length=380

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             S+S   V  S DP  D R S++EMI +  ++   ++E+L+ CY+ LNS E H  I +AF
Sbjct  309  LSESFAVVKSSVDPQRDFRDSMMEMIVENNIRAAKDLEDLLACYLSLNSKEYHELIVKAF  368



>ref|XP_006654470.1| PREDICTED: uncharacterized protein LOC102700991 [Oryza brachyantha]
Length=249

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = -2

Query  391  SLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLE  212
            S  DDA  +F   +     S DP  D RAS+ EM+   GV DW  +E ++  Y+  N  E
Sbjct  139  SATDDA-ASFGGGVAVAFDSEDPYEDFRASMAEMLAAHGVGDWDWLEAMLGWYLRANGKE  197

Query  211  VHGFIEQAFLSL  176
             H  I  AF+ L
Sbjct  198  THAAIVAAFVDL  209



>ref|XP_010233191.1| PREDICTED: transcription repressor OFP1-like [Brachypodium distachyon]
Length=472

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   V+ S+D   D R S+ EMI D G++D +++E+L+ CY+VLN  + H  I + F
Sbjct  403  DSYAVVVLSSDIRKDFRESMEEMIADKGIRDAADLEDLLACYLVLNEAKFHEIIVEVF  460



>ref|XP_010933951.1| PREDICTED: transcription repressor OFP13-like isoform X1 [Elaeis 
guineensis]
Length=307

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLS  179
            +S+   + S DP  D RAS+ EM+    +++W  ++EL++CY+ LN  + H  I  AF+ 
Sbjct  164  ESVALALASDDPYHDFRASMAEMVEAHQLREWPRLQELLHCYLRLNEEKTHEIIVLAFVD  223

Query  178  L  176
            L
Sbjct  224  L  224



>ref|XP_007162447.1| hypothetical protein PHAVU_001G153000g [Phaseolus vulgaris]
 gb|ESW34441.1| hypothetical protein PHAVU_001G153000g [Phaseolus vulgaris]
Length=241

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 39/76 (51%), Gaps = 7/76 (9%)
 Frame = -2

Query  394  ASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIH------DVGVQDWSEMEELIYCY  233
            A++ + A  A   S+   MYS +P +D R S+ EM+       DV   +W  + EL+ CY
Sbjct  132  ATVDEKAKAALDGSVAVEMYSPNPYADFRRSMEEMVAARPELIDVAA-NWKALHELLLCY  190

Query  232  IVLNSLEVHGFIEQAF  185
            + LN    H FI  AF
Sbjct  191  LALNPRSTHKFILCAF  206



>ref|XP_006577092.1| PREDICTED: formin-I-like [Glycine max]
Length=283

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F DS+   + S DP  D R S+ EM+    V+DW  ++EL+  Y+ +N    HG+I  AF
Sbjct  129  FKDSVVMSVDSQDPYVDFRRSMEEMVEAQCVKDWEGLQELLCWYLKVNGKTNHGYIVGAF  188

Query  184  LSL  176
            + L
Sbjct  189  VDL  191



>ref|XP_010252093.1| PREDICTED: transcription repressor OFP1-like [Nelumbo nucifera]
Length=415

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 2/75 (3%)
 Frame = -2

Query  409  IISFSASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYI  230
            + S S S P    +  S+S   V  S DP  D R S++EMI +  ++   +ME+L+ CY+
Sbjct  331  VSSTSTSRP--RRKGLSESFAVVKSSFDPQRDFRDSMVEMIVENNIRASKDMEDLLACYL  388

Query  229  VLNSLEVHGFIEQAF  185
             LNS E H  I + F
Sbjct  389  SLNSNEYHDLIVKVF  403



>ref|XP_004960006.1| PREDICTED: uncharacterized protein LOC101777954 [Setaria italica]
Length=251

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -2

Query  334  STDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            S DP  D R S+ EM+   GV DW  +EE++  Y+  N  + HG I  AF+ L
Sbjct  168  SADPYGDFRRSMEEMVMSHGVNDWGWLEEMLGWYLRANGKKTHGLIVGAFVDL  220



>ref|XP_009626147.1| PREDICTED: transcription repressor OFP14 [Nicotiana tomentosiformis]
Length=300

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = -2

Query  403  SFSASLPDDAHEAFS--DSICAVMYSTDPVSDIRASILEM----IHDVGVQDWSEMEELI  242
            S + S  D + E  +  D I  V YS  P  D R S+ EM    ++D G  +W  MEEL+
Sbjct  189  SLAISTSDGSKETLNADDFITVVTYSPSPYDDFRQSMQEMMEARLNDQGKINWEFMEELL  248

Query  241  YCYIVLNSLEVHGFIEQAFLSL  176
            +CY  LN  + + +I  AF+ L
Sbjct  249  FCYFNLNDKKSYKYILSAFVDL  270



>gb|KHN33169.1| hypothetical protein glysoja_039485 [Glycine soja]
Length=273

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            F DS+   + S DP  D R S+ EM+    V+DW  ++EL+  Y+ +N    HG+I  AF
Sbjct  119  FKDSVVMSVDSQDPYVDFRRSMEEMVEAQCVKDWEGLQELLCWYLKVNGKTNHGYIVGAF  178

Query  184  LSL  176
            + L
Sbjct  179  VDL  181



>ref|XP_002520717.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41679.1| conserved hypothetical protein [Ricinus communis]
Length=211

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 6/66 (9%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIH-----DVGVQDWSEMEELIYCYIVLNSLEVHGFIE  194
            DS+    YS DP  D R S+ EM+      DV  ++W  + EL+ CY+ LN    H FI 
Sbjct  130  DSVAVPTYSPDPYLDFRRSMQEMVEARDFVDVK-ENWDYLHELLLCYLALNPKSTHKFIV  188

Query  193  QAFLSL  176
            +AF  L
Sbjct  189  RAFADL  194



>ref|XP_004140993.1| PREDICTED: uncharacterized protein LOC101209686 [Cucumis sativus]
 ref|XP_004159482.1| PREDICTED: uncharacterized protein LOC101226524 [Cucumis sativus]
Length=223

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            +   M S DP  D R S+ EM+   G+++W  +EEL+  Y+ +N ++ HG+I  AF+ L
Sbjct  132  VLMAMESEDPYLDFRRSMEEMVECHGIRNWEWLEELLNWYLRMNGMKNHGYILGAFVDL  190



>gb|KGN46052.1| hypothetical protein Csa_6G046300 [Cucumis sativus]
Length=227

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  352  ICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAFLSL  176
            +   M S DP  D R S+ EM+   G+++W  +EEL+  Y+ +N ++ HG+I  AF+ L
Sbjct  136  VLMAMESEDPYLDFRRSMEEMVECHGIRNWEWLEELLNWYLRMNGMKNHGYILGAFVDL  194



>ref|XP_004495193.1| PREDICTED: uncharacterized protein LOC101502325 [Cicer arietinum]
Length=211

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 35/72 (49%), Gaps = 7/72 (10%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIH------DVGVQDWSEMEELIYCYIVLNSLEVHG  203
            F  S+    YS DP  D R S+ EM+       DV   +W+ + EL+ CY+ LN    H 
Sbjct  137  FEGSVAVPTYSPDPYMDFRRSMQEMVEARPELMDVK-SNWNNLHELLLCYLALNPNNTHN  195

Query  202  FIEQAFLSLCST  167
            FI  AF  L  T
Sbjct  196  FIMAAFADLIVT  207



>ref|XP_004970397.1| PREDICTED: uncharacterized protein LOC101773811 [Setaria italica]
Length=364

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             ++S   V  S DP  D R S+ EMI + G++  +++E+L+ CY+ LN+ E H  I + F
Sbjct  293  LAESFAVVKTSRDPRRDFRESMEEMIAENGIRTAADLEDLLACYLALNAAEYHDLIVEVF  352



>ref|NP_001136474.1| uncharacterized protein LOC100216587 [Zea mays]
 gb|ACF82004.1| unknown [Zea mays]
 gb|AFW78377.1| hypothetical protein ZEAMMB73_391666 [Zea mays]
 gb|AIB05284.1| OFP transcription factor, partial [Zea mays]
Length=366

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  364  FSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
             ++S   V  S DP  D R S+ EMI + G++  +++E+L+ CY+ LN+ E H  I + F
Sbjct  285  LAESFAVVKSSADPRRDFRESMEEMIAEKGIRGAADLEDLLACYLALNADEHHDLIVEVF  344

Query  184  LSLCSTSTT*KILLYNN  134
              + ++  + K +  N 
Sbjct  345  EEIWASLASAKPMKGNR  361



>ref|XP_006358138.1| PREDICTED: caldesmon-like [Solanum tuberosum]
Length=491

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  346  AVMYST-DPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            A+M S+ DP SD R S++EMI   G++   E+EEL+ CY+ LN  E H  I + F
Sbjct  332  AIMKSSFDPFSDFRDSMIEMITQRGIKSSEELEELLACYLTLNCDEYHDIIIKVF  386



>ref|XP_003593824.1| hypothetical protein MTR_2g018030 [Medicago truncatula]
 gb|AES64075.1| ovate transcriptional repressor [Medicago truncatula]
Length=357

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  358  DSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQAF  185
            DS   +  S++P  D R S++EMI +  +    EMEEL+ CY+ LN+ E H  I + F
Sbjct  277  DSFAVIKCSSNPKQDFRDSMIEMIEEKQISKAEEMEELLACYLTLNADEYHDLIIKVF  334



>gb|KDP22779.1| hypothetical protein JCGZ_00366 [Jatropha curcas]
Length=389

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  376  AHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFI  197
            +  + SDS+  V  S DP  D R S++EMI +  ++   ++E+L+ CY+ LNS E H  I
Sbjct  313  SRRSLSDSLAIVKSSFDPQRDFRESMVEMIVENNIRASKDLEDLLACYLSLNSNEYHDLI  372

Query  196  EQAF  185
             + F
Sbjct  373  IKVF  376



>ref|XP_008446744.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Cucumis melo]
Length=284

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  AFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNSLEVHGFIEQA  188
             F +S+   + S +P  D R S+ EM+   GV+DW  +EEL+  Y+  N    H FI  A
Sbjct  145  GFKESLIVSIESENPYEDFRKSMGEMVESHGVKDWDGLEELLGWYLKANWKNNHRFIIGA  204

Query  187  FLSL  176
            F+ L
Sbjct  205  FVDL  208



>gb|KDO58264.1| hypothetical protein CISIN_1g045319mg [Citrus sinensis]
Length=149

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -2

Query  397  SASLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQDWSEMEELIYCYIVLNS  218
            + S+ + A   F D +   + S D  SD R S+ EM+   G++ W  +EEL+  ++ +N 
Sbjct  51   TGSILETAKFQFKDCVALAIDSEDAYSDFRRSMEEMVEAYGLKYWEHLEELLALFLRMNK  110

Query  217  LEVHGFIEQAFLSLCS  170
             + HG I  AF+ + S
Sbjct  111  KKNHGIIVGAFIDIFS  126



>gb|EYU46568.1| hypothetical protein MIMGU_mgv1a013517mg [Erythranthe guttata]
Length=218

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 36/76 (47%), Gaps = 4/76 (5%)
 Frame = -2

Query  391  SLPDDAHEAFSDSICAVMYSTDPVSDIRASILEMIHDVGVQD----WSEMEELIYCYIVL  224
            +LP +     S SI    YS DP  D R S+ EM+    + D    W  + EL+ CY+ L
Sbjct  112  NLPPENDTVSSGSIAVPTYSPDPFMDFRRSMQEMVEAREIDDVRENWDYLHELLMCYLSL  171

Query  223  NSLEVHGFIEQAFLSL  176
            N    H +I  AF  L
Sbjct  172  NPKSTHKYIVGAFADL  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 572029174332