BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85618_g1_i1 len=1239 path=[1:0-1238]

Length=1239
                                                                      Score     E

ref|XP_009794784.1|  PREDICTED: heme-binding-like protein At3g101...    330   1e-108   
ref|XP_009629040.1|  PREDICTED: heme-binding-like protein At3g101...    327   2e-107   
ref|XP_010312298.1|  PREDICTED: heme-binding-like protein At3g101...    320   7e-105   
ref|XP_006338998.1|  PREDICTED: heme-binding-like protein At3g101...    320   2e-104   
ref|XP_010262719.1|  PREDICTED: heme-binding-like protein At3g101...    314   3e-102   
ref|XP_007205928.1|  hypothetical protein PRUPE_ppa011641mg             313   7e-102   
ref|XP_010101837.1|  hypothetical protein L484_023627                   306   2e-99    
ref|XP_003632661.1|  PREDICTED: heme-binding-like protein At3g101...    306   4e-99    
ref|XP_010262718.1|  PREDICTED: heme-binding-like protein At3g101...    305   6e-99    
ref|XP_008239829.1|  PREDICTED: uncharacterized protein LOC103338406    318   4e-98    
ref|XP_011009153.1|  PREDICTED: heme-binding-like protein At3g101...    302   1e-97    
ref|XP_010928956.1|  PREDICTED: heme-binding-like protein At3g101...    301   2e-97    
ref|XP_002322949.2|  SOUL heme-binding family protein                   301   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_007026821.1|  Fructokinase-like 1                                315   6e-97    
ref|XP_010675294.1|  PREDICTED: heme-binding-like protein At3g101...    300   9e-97    
ref|XP_011094955.1|  PREDICTED: heme-binding-like protein At3g101...    298   2e-96    
gb|KDO58029.1|  hypothetical protein CISIN_1g028987mg                   298   4e-96    
ref|XP_006429262.1|  hypothetical protein CICLE_v10012815mg             297   9e-96    
ref|XP_002527880.1|  protein with unknown function                      296   3e-95    Ricinus communis
ref|XP_003604821.1|  Heme-binding-like protein                          293   4e-94    
ref|XP_009370231.1|  PREDICTED: heme-binding-like protein At3g101...    290   5e-93    
ref|XP_008359773.1|  PREDICTED: LOW QUALITY PROTEIN: heme-binding...    289   1e-92    
ref|XP_004302669.1|  PREDICTED: heme-binding-like protein At3g101...    288   2e-92    
ref|XP_007133956.1|  hypothetical protein PHAVU_010G006500g             288   3e-92    
ref|XP_009416215.1|  PREDICTED: heme-binding-like protein At3g101...    287   6e-92    
ref|XP_004506644.1|  PREDICTED: heme-binding-like protein At3g101...    289   7e-92    
ref|XP_008798949.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    302   9e-92    
ref|XP_006338999.1|  PREDICTED: heme-binding-like protein At3g101...    287   9e-92    
ref|XP_008345509.1|  PREDICTED: heme-binding-like protein At3g101...    283   3e-90    
ref|XP_008370044.1|  PREDICTED: heme-binding-like protein At3g101...    282   8e-90    
ref|XP_004156587.1|  PREDICTED: heme-binding-like protein At3g101...    280   5e-89    
ref|XP_008442480.1|  PREDICTED: uncharacterized protein LOC103486334    293   3e-88    
ref|XP_010044056.1|  PREDICTED: uncharacterized protein LOC104433104    277   6e-88    
ref|XP_009358825.1|  PREDICTED: uncharacterized protein LOC103949435    291   7e-88    
ref|XP_009133222.1|  PREDICTED: uncharacterized protein LOC103857751    276   1e-87    
ref|XP_004249669.1|  PREDICTED: uncharacterized protein LOC101250355    276   2e-87    
ref|XP_010044057.1|  PREDICTED: uncharacterized protein LOC104433106    276   4e-87    
gb|AAK43920.1|AF370601_1  Unknown protein                               275   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565876.2|  heam-binding protein 2                                275   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001276155.1|  uncharacterized protein LOC100817967               273   2e-86    
ref|XP_009143435.1|  PREDICTED: uncharacterized protein LOC103867148    273   1e-85    
emb|CDY07759.1|  BnaA03g17520D                                          271   1e-85    
ref|XP_002879719.1|  soul heme-binding family protein                   271   3e-85    
ref|XP_008350504.1|  PREDICTED: heme-binding-like protein At3g101...    270   6e-85    
emb|CDX74922.1|  BnaA05g06680D                                          269   2e-84    
emb|CDY14500.1|  BnaC03g20950D                                          268   3e-84    
ref|XP_010044055.1|  PREDICTED: heme-binding-like protein At3g101...    267   5e-84    
gb|EEC71815.1|  hypothetical protein OsI_04454                          267   1e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001044817.1|  Os01g0850900                                       266   1e-83    Oryza sativa Japonica Group [Japonica rice]
gb|KHM98940.1|  Heme-binding-like protein, chloroplastic                265   3e-83    
ref|XP_004970594.1|  PREDICTED: heme-binding-like protein At3g101...    265   6e-83    
emb|CDX91419.1|  BnaC04g07310D                                          264   8e-83    
ref|XP_006295430.1|  hypothetical protein CARUB_v10024529mg             263   6e-82    
gb|EMT00657.1|  hypothetical protein F775_29949                         260   7e-81    
gb|EPS74387.1|  hypothetical protein M569_00369                         259   8e-81    
ref|XP_002456642.1|  hypothetical protein SORBIDRAFT_03g039990          258   4e-80    Sorghum bicolor [broomcorn]
ref|XP_006646483.1|  PREDICTED: heme-binding-like protein At3g101...    257   1e-79    
emb|CDX93337.1|  BnaC04g45590D                                          256   2e-79    
emb|CBH32522.1|  SOUL heme-binding domain containing protein,expr...    255   3e-79    
ref|XP_010509244.1|  PREDICTED: heme-binding-like protein At3g101...    256   5e-79    
ref|XP_010505403.1|  PREDICTED: heme-binding-like protein At3g101...    256   6e-79    
ref|XP_010509243.1|  PREDICTED: heme-binding-like protein At3g101...    256   6e-79    
gb|KFK36697.1|  hypothetical protein AALP_AA4G157400                    254   1e-78    
gb|ACG28868.1|  hypothetical protein                                    253   2e-78    Zea mays [maize]
ref|NP_001142199.1|  uncharacterized protein LOC100274367               253   3e-78    Zea mays [maize]
ref|XP_010528657.1|  PREDICTED: fructokinase-like 1, chloroplastic      266   3e-78    
ref|XP_010517079.1|  PREDICTED: heme-binding-like protein At3g101...    254   4e-78    
ref|XP_003564620.1|  PREDICTED: heme-binding-like protein At3g101...    253   4e-78    
gb|ACF86103.1|  unknown                                                 251   1e-77    Zea mays [maize]
gb|KDP24508.1|  hypothetical protein JCGZ_25072                         255   2e-76    
emb|CDY18413.1|  BnaA04g21740D                                          249   3e-76    
gb|EYU41820.1|  hypothetical protein MIMGU_mgv1a014154mg                247   4e-76    
ref|XP_009141708.1|  PREDICTED: uncharacterized protein LOC103865641    250   6e-76    
ref|XP_003604820.1|  Heme-binding-like protein                          246   9e-76    
ref|XP_006410997.1|  hypothetical protein EUTSA_v10017151mg             247   1e-75    
ref|NP_001235669.1|  uncharacterized protein LOC100499762               244   5e-75    
gb|ABK26183.1|  unknown                                                 231   5e-70    Picea sitchensis
ref|XP_001755534.1|  predicted protein                                  224   3e-67    
ref|XP_002973807.1|  hypothetical protein SELMODRAFT_442225             201   1e-58    
emb|CBI30446.3|  unnamed protein product                                214   1e-58    
ref|XP_002983590.1|  hypothetical protein SELMODRAFT_445583             201   2e-58    
gb|AIL90544.1|  hypothetical protein POPTRDRAFT_735696                  187   4e-54    
gb|AIL90558.1|  hypothetical protein POPTRDRAFT_735696                  186   1e-53    
gb|AIL90531.1|  hypothetical protein POPTRDRAFT_735696                  185   2e-53    
gb|AIL90533.1|  hypothetical protein POPTRDRAFT_735696                  185   2e-53    
gb|AIL90530.1|  hypothetical protein POPTRDRAFT_735696                  184   5e-53    
gb|AIL90554.1|  hypothetical protein POPTRDRAFT_735696                  184   6e-53    
gb|AIL90532.1|  hypothetical protein POPTRDRAFT_735696                  184   6e-53    
gb|AIL90535.1|  hypothetical protein POPTRDRAFT_735696                  183   1e-52    
gb|AIL90551.1|  hypothetical protein POPTRDRAFT_735696                  183   1e-52    
gb|AIL90555.1|  hypothetical protein POPTRDRAFT_735696                  183   1e-52    
gb|AIL90552.1|  hypothetical protein POPTRDRAFT_735696                  183   2e-52    
gb|AIL90540.1|  hypothetical protein POPTRDRAFT_735696                  182   2e-52    
gb|AIL90547.1|  hypothetical protein POPTRDRAFT_735696                  182   3e-52    
gb|AIL90545.1|  hypothetical protein POPTRDRAFT_735696                  182   3e-52    
gb|AIL90550.1|  hypothetical protein POPTRDRAFT_735696                  182   3e-52    
gb|AIL90553.1|  hypothetical protein POPTRDRAFT_735696                  182   4e-52    
ref|XP_005535065.1|  hypothetical protein, conserved                    155   2e-40    
gb|AFK47803.1|  unknown                                                 147   6e-39    
gb|ACH60736.1|  SOUL heme-binding family protein                        135   2e-34    Pseudotsuga menziesii
gb|ACH60737.1|  SOUL heme-binding family protein                        134   2e-34    Pseudotsuga menziesii
gb|ACH60728.1|  SOUL heme-binding family protein                        134   4e-34    Pseudotsuga menziesii
gb|ACH60726.1|  SOUL heme-binding family protein                        134   4e-34    Pseudotsuga menziesii
gb|ACH60731.1|  SOUL heme-binding family protein                        134   4e-34    Pseudotsuga menziesii
ref|XP_002499422.1|  predicted protein                                  137   4e-34    Micromonas commoda
gb|ACH60725.1|  SOUL heme-binding family protein                        134   4e-34    Pseudotsuga menziesii
gb|ACH60730.1|  SOUL heme-binding family protein                        133   8e-34    Pseudotsuga menziesii
gb|ACH60727.1|  SOUL heme-binding family protein                        133   9e-34    Pseudotsuga menziesii
gb|ACH60747.1|  SOUL heme-binding family protein                        132   2e-33    Pseudotsuga macrocarpa
ref|XP_005706202.1|  SOUL heme-binding protein                          138   5e-33    
ref|XP_005770291.1|  hypothetical protein EMIHUDRAFT_209880             129   3e-31    
emb|CBN74963.1|  conserved unknown protein                              126   3e-30    
ref|WP_015421378.1|  SOUL heme-binding protein                          123   2e-29    
gb|KHG20344.1|  Lactate utilization B                                   121   2e-29    
dbj|GAF52734.1|  hypothetical protein JCM18900_11264                    122   6e-29    
dbj|GAF58381.1|  hypothetical protein JCM18902_1162                     122   7e-29    
ref|WP_014547368.1|  SOUL heme-binding protein                          121   1e-28    
ref|WP_011903253.1|  SOUL heme-binding protein                          120   1e-28    
ref|WP_034733695.1|  heme-binding protein                               120   2e-28    
ref|XP_003078259.1|  SOUL heme-binding family protein (ISS)             121   2e-28    
gb|KFZ28043.1|  heme-binding protein                                    120   2e-28    
dbj|GAF54507.1|  LOW QUALITY PROTEIN: hypothetical protein JCM189...    120   3e-28    
dbj|GAF60565.1|  hypothetical protein JCM18903_488                      120   3e-28    
ref|WP_003038078.1|  SOUL heme-binding protein                          120   4e-28    
ref|WP_003032660.1|  SOUL heme-binding protein                          119   6e-28    
ref|WP_003040829.1|  SOUL heme-binding protein                          119   6e-28    
ref|XP_002947806.1|  hypothetical protein VOLCADRAFT_57321              120   7e-28    
ref|WP_025650520.1|  MULTISPECIES: heme-binding protein                 119   9e-28    
ref|WP_020443801.1|  SOUL heme-binding protein                          119   1e-27    
gb|ABE26685.1|  SOUL domain protein                                     118   2e-27    Francisella tularensis subsp. mediasiatica
ref|XP_004039332.1|  soul heme-binding protein, putative                118   2e-27    
ref|WP_003022600.1|  SOUL heme-binding protein                          117   3e-27    
ref|WP_004286807.1|  SOUL heme-binding protein                          117   3e-27    
ref|WP_035737326.1|  SOUL heme-binding protein                          117   4e-27    
ref|WP_003017595.1|  SOUL heme-binding protein                          117   4e-27    
ref|WP_006272355.1|  heme-binding protein                               117   4e-27    
ref|WP_010200210.1|  SOUL heme-binding protein                          117   5e-27    
ref|WP_011514027.1|  SOUL heme-binding protein                          117   7e-27    
ref|WP_037233137.1|  heme-binding protein                               117   7e-27    
ref|XP_002180141.1|  predicted protein                                  117   9e-27    Phaeodactylum tricornutum CCAP 1055/1
gb|AAW50048.1|  hypothetical protein FTT1651                            117   9e-27    
ref|XP_002180145.1|  predicted protein                                  117   9e-27    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001416988.1|  predicted protein                                  116   9e-27    Ostreococcus lucimarinus CCE9901
ref|WP_029415390.1|  heme-binding protein                               116   9e-27    
ref|WP_012280210.1|  SOUL heme-binding protein                          115   1e-26    
ref|WP_028818386.1|  heme-binding protein                               115   1e-26    
ref|WP_013921824.1|  SOUL heme-binding protein                          115   1e-26    
ref|WP_027129553.1|  SOUL heme-binding protein                          115   1e-26    
ref|WP_032734259.1|  SOUL heme-binding protein                          115   2e-26    
ref|WP_007223851.1|  hypothetical protein                               115   3e-26    
ref|WP_022951274.1|  SOUL heme-binding protein                          115   3e-26    
ref|XP_005715111.1|  unnamed protein product                            114   3e-26    
gb|AIT09539.1|  SOUL heme-binding protein                               114   3e-26    
ref|XP_007511227.1|  SOUL heme-binding protein                          114   3e-26    
ref|WP_012429035.1|  SOUL heme-binding protein                          114   4e-26    
ref|XP_002291840.1|  predicted protein                                  114   5e-26    Thalassiosira pseudonana CCMP1335
ref|WP_009022254.1|  soul heme-binding protein                          113   7e-26    
ref|WP_010932797.1|  hypothetical protein                               113   1e-25    
ref|WP_012475749.1|  SOUL heme-binding protein                          111   4e-25    
ref|WP_006975652.1|  SOUL heme-binding protein                          112   5e-25    
dbj|BAP88785.1|  SOUL domain heme-binding protein                       111   6e-25    
ref|XP_004305335.1|  PREDICTED: heme-binding-like protein At3g101...    112   7e-25    
ref|WP_008106880.1|  hypothetical protein                               108   4e-24    
ref|WP_012506689.1|  SOUL heme-binding protein                          108   4e-24    
ref|WP_023459644.1|  hypothetical protein                               108   6e-24    
ref|XP_009627513.1|  PREDICTED: heme-binding-like protein At3g101...    110   6e-24    
gb|KHD88266.1|  heme-binding protein                                    107   7e-24    
emb|CDS53917.1|  hypothetical protein                                   107   1e-23    
ref|WP_019954950.1|  hypothetical protein                               107   1e-23    
ref|WP_036809541.1|  hypothetical protein                               107   1e-23    
ref|WP_036772511.1|  hypothetical protein                               107   1e-23    
gb|ESQ73595.1|  hypothetical protein ABAC402_18400                      107   1e-23    
ref|WP_031236083.1|  heme-binding protein                               107   2e-23    
ref|XP_004029760.1|  hypothetical protein IMG5_173800                   106   2e-23    
ref|XP_002882654.1|  soul heme-binding family protein                   108   2e-23    
ref|WP_027458263.1|  hypothetical protein                               106   3e-23    
ref|XP_010543498.1|  PREDICTED: heme-binding-like protein At3g101...    107   3e-23    
gb|EXJ14184.1|  hypothetical protein D779_2855                          105   3e-23    
ref|XP_003055781.1|  predicted protein                                  105   4e-23    
ref|WP_011473650.1|  heme-binding protein                               106   4e-23    
ref|WP_033155441.1|  heme-binding protein                               105   4e-23    
ref|XP_010543497.1|  PREDICTED: heme-binding-like protein At3g101...    107   5e-23    
ref|XP_010486603.1|  PREDICTED: heme-binding-like protein At3g101...    107   6e-23    
gb|KFK38401.1|  hypothetical protein AALP_AA3G108200                    107   6e-23    
ref|XP_001693693.1|  SOUL heme-binding protein                          105   7e-23    Chlamydomonas reinhardtii
ref|WP_010920406.1|  heme-binding protein                               105   9e-23    
ref|WP_009031667.1|  heme-binding protein                               103   2e-22    
ref|WP_026604007.1|  heme-binding protein                               103   2e-22    
ref|XP_008387000.1|  PREDICTED: heme-binding-like protein At3g101...    105   2e-22    
ref|XP_009336949.1|  PREDICTED: heme-binding-like protein At3g101...    105   2e-22    
ref|XP_009374712.1|  PREDICTED: heme-binding-like protein At3g101...    105   2e-22    
emb|CBI30300.3|  unnamed protein product                                104   3e-22    
ref|XP_001772875.1|  predicted protein                                  103   4e-22    
ref|XP_010480740.1|  PREDICTED: heme-binding-like protein At3g101...    105   4e-22    
ref|WP_011341075.1|  SOUL domain heme-binding protein                   103   4e-22    
emb|CDP15419.1|  unnamed protein product                                104   4e-22    
emb|CAN62765.1|  hypothetical protein VITISV_021815                     103   5e-22    Vitis vinifera
ref|XP_008442843.1|  PREDICTED: heme-binding-like protein At3g101...    104   5e-22    
ref|XP_010464672.1|  PREDICTED: heme-binding-like protein At3g101...    105   5e-22    
ref|XP_010464673.1|  PREDICTED: heme-binding-like protein At3g101...    105   5e-22    
ref|XP_010654092.1|  PREDICTED: heme-binding-like protein At3g101...    104   5e-22    
ref|WP_020485405.1|  hypothetical protein                               102   5e-22    
ref|XP_002282544.1|  PREDICTED: heme-binding-like protein At3g101...    104   5e-22    Vitis vinifera
ref|WP_011664427.1|  heme-binding protein                               102   6e-22    
ref|XP_010683730.1|  PREDICTED: heme-binding-like protein At3g101...    104   7e-22    
ref|XP_004952646.1|  PREDICTED: heme-binding-like protein At3g101...    103   8e-22    
ref|XP_003625826.1|  Heme-binding-like protein                          103   9e-22    
ref|XP_008787765.1|  PREDICTED: heme-binding-like protein At3g101...    103   1e-21    
ref|XP_009761730.1|  PREDICTED: heme-binding-like protein At3g101...    103   1e-21    
ref|WP_009852476.1|  soul heme-binding protein                          101   1e-21    
ref|WP_007041304.1|  heme-binding protein                               101   1e-21    
gb|EEC73327.1|  hypothetical protein OsI_07524                          102   2e-21    Oryza sativa Indica Group [Indian rice]
ref|XP_010271648.1|  PREDICTED: heme-binding-like protein At3g101...    103   2e-21    
gb|KDP37298.1|  hypothetical protein JCGZ_06752                         103   2e-21    
emb|CDY60166.1|  BnaAnng16600D                                          103   2e-21    
ref|WP_007233951.1|  heme-binding protein                               101   2e-21    
ref|XP_004149204.1|  PREDICTED: heme-binding-like protein At3g101...    103   2e-21    
ref|XP_003575075.1|  PREDICTED: heme-binding-like protein At3g101...    103   2e-21    
ref|XP_010101558.1|  hypothetical protein L484_015382                   102   2e-21    
gb|EKD24354.1|  hypothetical protein ACD_81C00040G0004                  101   2e-21    
ref|WP_039718725.1|  hypothetical protein                               101   2e-21    
ref|WP_013419593.1|  heme-binding protein                               101   2e-21    
ref|XP_010059784.1|  PREDICTED: heme-binding-like protein At3g101...    102   2e-21    
ref|XP_008243573.1|  PREDICTED: heme-binding-like protein At3g101...    102   2e-21    
ref|WP_008196859.1|  SOUL heme-binding protein                          101   2e-21    
emb|CDY00906.1|  BnaC05g42940D                                          102   2e-21    
ref|WP_011734075.1|  heme-binding protein                               100   3e-21    
ref|WP_005141531.1|  heme-binding protein                               100   3e-21    
ref|XP_007202476.1|  hypothetical protein PRUPE_ppa010378mg             101   3e-21    
ref|XP_006339129.1|  PREDICTED: heme-binding-like protein At3g101...    102   3e-21    
ref|XP_010931138.1|  PREDICTED: heme-binding-like protein At3g101...    102   3e-21    
ref|NP_001147650.1|  SOUL heme-binding protein                          101   5e-21    Zea mays [maize]
ref|XP_009146872.1|  PREDICTED: heme-binding-like protein At3g101...    101   5e-21    
ref|WP_012045868.1|  heme-binding protein                             99.8    5e-21    
ref|WP_037561492.1|  heme-binding protein                             99.4    6e-21    
ref|WP_013645082.1|  SOUL heme-binding protein                        99.4    6e-21    
ref|WP_024447602.1|  heme-binding protein                             99.8    7e-21    
ref|WP_012509421.1|  SOUL heme-binding protein                        99.4    8e-21    
ref|WP_009800641.1|  hypothetical protein                             99.4    8e-21    
ref|WP_006613316.1|  heme-binding protein                             99.4    9e-21    
ref|XP_002528755.1|  protein with unknown function                      100   9e-21    Ricinus communis
ref|WP_007042718.1|  heme-binding protein                             99.4    1e-20    
ref|XP_006648692.1|  PREDICTED: heme-binding-like protein At3g101...  99.8    1e-20    
ref|WP_011457331.1|  SOUL heme-binding protein                        97.1    1e-20    
ref|WP_005575513.1|  SOUL heme-binding protein                        99.4    1e-20    
gb|KHG26870.1|  hypothetical protein F383_03442                         100   1e-20    
gb|ACN33800.1|  unknown                                                 100   1e-20    Zea mays [maize]
ref|XP_006407606.1|  hypothetical protein EUTSA_v10021175mg             100   2e-20    
ref|WP_007170167.1|  heme-binding protein                             98.6    2e-20    
ref|NP_001047029.1|  Os02g0533200                                     99.8    2e-20    Oryza sativa Japonica Group [Japonica rice]
ref|WP_011834051.1|  hypothetical protein                             97.1    3e-20    
ref|XP_002452205.1|  hypothetical protein SORBIDRAFT_04g021730        99.8    3e-20    Sorghum bicolor [broomcorn]
ref|XP_006279664.1|  hypothetical protein CARUB_v10026829mg           99.8    3e-20    
ref|WP_007192883.1|  heme-binding protein                             97.8    3e-20    
ref|WP_011893763.1|  heme-binding protein                             97.8    3e-20    
ref|WP_029389540.1|  hypothetical protein                             97.4    3e-20    
ref|WP_024813119.1|  hypothetical protein                             97.8    3e-20    
ref|WP_014714154.1|  SOUL heme-binding protein                        96.3    3e-20    
ref|XP_004494187.1|  PREDICTED: heme-binding-like protein At3g101...  99.0    4e-20    
ref|WP_037335803.1|  hypothetical protein                             97.4    4e-20    
ref|WP_012497022.1|  SOUL heme-binding protein                        97.4    4e-20    
ref|WP_009577106.1|  hypothetical protein                               101   5e-20    
ref|WP_011699256.1|  heme-binding protein                             97.4    5e-20    
gb|EYU38636.1|  hypothetical protein MIMGU_mgv1a011003mg              98.6    6e-20    
ref|WP_012901627.1|  putative heme-binding protein                    96.7    6e-20    
ref|WP_013820448.1|  SOUL heme-binding protein                        97.1    6e-20    
gb|AHF03879.1|  heme-binding protein                                  96.7    6e-20    
dbj|GAM11105.1|  heme-binding-like protein At3g10130, chloroplastic   96.7    7e-20    
ref|XP_007027750.1|  Soul heme-binding family protein isoform 1       98.6    8e-20    
gb|KEZ78188.1|  SOUL heme-binding protein                             97.4    9e-20    
ref|XP_006855045.1|  hypothetical protein AMTR_s00031p00080280        98.2    1e-19    
ref|XP_007162906.1|  hypothetical protein PHAVU_001G190400g           98.2    1e-19    
ref|WP_007107567.1|  SOUL heme-binding protein                        96.7    1e-19    
ref|WP_010875754.1|  hypothetical protein                             95.9    1e-19    
ref|WP_014780284.1|  heme-binding protein                             96.3    1e-19    
ref|WP_011746331.1|  SOUL heme-binding protein                        95.9    1e-19    
ref|WP_011997493.1|  SOUL heme-binding protein                        94.0    1e-19    
ref|WP_026546398.1|  heme-binding protein                             95.5    1e-19    
ref|WP_011159134.1|  hypothetical protein                             95.9    1e-19    
ref|WP_024445368.1|  heme-binding protein                             95.9    1e-19    
ref|WP_013471411.1|  heme-binding protein                             95.9    2e-19    
ref|WP_020490337.1|  hypothetical protein                             95.1    2e-19    
ref|WP_007194597.1|  heme-binding protein                             95.1    2e-19    
emb|CDR34822.1|  Heme-binding protein                                 95.1    2e-19    
ref|WP_007422997.1|  MULTISPECIES: heme-binding protein               95.1    3e-19    
ref|WP_026381172.1|  hypothetical protein                             95.1    3e-19    
ref|NP_187624.1|  SOUL heme-binding family protein                    97.1    3e-19    
gb|AAM20597.1|  unknown protein                                       96.7    3e-19    
ref|WP_034942950.1|  heme-binding protein                             94.4    3e-19    
ref|XP_002289954.1|  predicted protein                                95.1    4e-19    
ref|WP_014107189.1|  heme-binding protein                             94.7    4e-19    
ref|WP_036339487.1|  heme-binding protein                             94.7    4e-19    
gb|EXI63863.1|  SOUL heme-binding protein                             94.7    4e-19    
ref|XP_008873436.1|  hypothetical protein H310_09200                  95.1    4e-19    
dbj|BAJ87128.1|  predicted protein                                    96.3    5e-19    
ref|XP_009829758.1|  hypothetical protein H257_06279                  95.1    5e-19    
ref|XP_006430192.1|  hypothetical protein CICLE_v10012335mg           95.9    6e-19    
ref|WP_007419558.1|  SOUL heme-binding protein                        94.4    6e-19    
ref|WP_023412227.1|  hypothetical protein                             94.4    7e-19    
ref|WP_035228145.1|  heme-binding protein                             94.0    7e-19    
ref|WP_006365715.1|  SOUL heme-binding protein                        94.0    7e-19    
gb|KFK38402.1|  hypothetical protein AALP_AA3G108200                  96.3    8e-19    
ref|XP_009379807.1|  PREDICTED: heme-binding-like protein At3g101...  95.1    1e-18    
ref|WP_034808915.1|  heme-binding protein                             93.6    1e-18    
ref|WP_009665658.1|  heme-binding protein                             93.2    1e-18    
ref|WP_024451095.1|  heme-binding protein                             93.6    1e-18    
ref|WP_006182359.1|  heme-binding protein                             93.6    1e-18    
ref|WP_037154720.1|  heme-binding protein                             93.2    1e-18    
ref|WP_015281579.1|  SOUL heme-binding protein                        93.2    2e-18    
ref|WP_036402688.1|  heme-binding protein                             92.8    2e-18    
ref|WP_026541174.1|  heme-binding protein                             92.4    2e-18    
ref|WP_007230550.1|  SOUL heme-binding protein                        92.4    2e-18    
gb|KDO70424.1|  hypothetical protein CISIN_1g0224721mg                92.4    3e-18    
ref|WP_032404960.1|  heme-binding protein                             92.4    3e-18    
ref|WP_034958325.1|  hypothetical protein                             92.4    3e-18    
ref|WP_037175828.1|  heme-binding protein                             92.4    3e-18    
ref|WP_032379934.1|  heme-binding protein                             92.4    3e-18    
ref|WP_024817746.1|  heme-binding protein                             92.0    3e-18    
gb|KDO70422.1|  hypothetical protein CISIN_1g0224721mg                92.8    3e-18    
ref|XP_003554437.1|  PREDICTED: heme-binding-like protein At3g101...  94.0    3e-18    
gb|KDO70423.1|  hypothetical protein CISIN_1g0224721mg                92.4    3e-18    
ref|XP_008873482.1|  hypothetical protein H310_09238                  92.4    4e-18    
ref|WP_008712476.1|  SOUL heme-binding protein                        92.4    4e-18    
ref|WP_037187660.1|  heme-binding protein                             92.0    4e-18    
ref|WP_014209469.1|  heme-binding protein                             92.0    5e-18    
ref|WP_036413019.1|  heme-binding protein                             92.0    5e-18    
ref|WP_032096309.1|  MULTISPECIES: SOUL heme-binding protein          91.3    5e-18    
ref|WP_008010951.1|  SOUL heme-binding protein                        91.7    5e-18    
ref|WP_014814424.1|  heme-binding protein                             91.7    6e-18    
ref|XP_006481768.1|  PREDICTED: heme-binding-like protein At3g101...  92.8    7e-18    
ref|XP_009829760.1|  hypothetical protein H257_06281                  91.7    7e-18    
ref|WP_026377363.1|  heme-binding protein                             91.3    8e-18    
ref|XP_011006621.1|  PREDICTED: heme-binding-like protein At3g101...  92.8    8e-18    
gb|AHF04056.1|  heme-binding protein                                  91.3    8e-18    
ref|WP_013268627.1|  heme-binding protein                             90.9    9e-18    
ref|XP_011006620.1|  PREDICTED: heme-binding-like protein At3g101...  92.4    9e-18    
ref|WP_011643670.1|  SOUL heme-binding protein                        91.3    9e-18    
ref|WP_011390755.1|  SOUL heme-binding protein                        90.5    1e-17    
ref|WP_036406749.1|  heme-binding protein                             90.9    1e-17    
ref|WP_022702051.1|  SOUL heme-binding protein                        90.5    1e-17    
ref|WP_019676635.1|  hypothetical protein                             90.9    1e-17    
ref|WP_013501518.1|  SOUL heme-binding protein                        90.5    1e-17    
ref|WP_008415030.1|  heme-binding protein                             90.5    1e-17    
ref|WP_005071372.1|  heme-binding protein                             90.9    1e-17    
ref|WP_036446220.1|  heme-binding protein                             90.5    1e-17    
ref|WP_009146791.1|  heme-binding protein                             90.1    2e-17    
ref|WP_034903986.1|  hypothetical protein                             90.5    2e-17    
emb|CDO30014.1|  SOUL heme-binding protein                            90.5    2e-17    
ref|WP_038293645.1|  SOUL heme-binding protein                        89.7    2e-17    
ref|WP_008382912.1|  SOUL heme-binding protein                        90.5    2e-17    
ref|WP_014873010.1|  heme-binding protein                             90.1    2e-17    
ref|WP_018775878.1|  hypothetical protein                             89.7    2e-17    
ref|XP_002323500.2|  SOUL heme-binding family protein                 91.3    2e-17    
gb|KGI66775.1|  heme-binding protein                                  89.7    2e-17    
ref|WP_027287368.1|  hypothetical protein                             89.7    2e-17    
dbj|GAM10420.1|  heme-binding-like protein At3g10130, chloroplastic   89.7    2e-17    
ref|WP_009471226.1|  heme-binding protein                             89.4    2e-17    
ref|XP_011077863.1|  PREDICTED: heme-binding-like protein At3g101...  91.3    3e-17    
ref|WP_023372135.1|  heme-binding protein                             89.7    3e-17    
ref|WP_006005100.1|  heme-binding protein                             89.7    3e-17    
ref|WP_032395345.1|  heme-binding protein                             89.7    3e-17    
ref|WP_006012741.1|  hypothetical protein                             89.4    3e-17    
gb|EAZ23311.1|  hypothetical protein OsJ_07008                        89.0    4e-17    
ref|WP_009146546.1|  heme-binding protein                             89.4    4e-17    
ref|WP_008453948.1|  SOUL heme-binding protein                        89.0    5e-17    
ref|WP_008892554.1|  SOUL heme-binding protein                        89.0    6e-17    
ref|WP_020674666.1|  hypothetical protein                             88.6    6e-17    
ref|XP_002139953.1|  SOUL heme-binding protein                        89.0    6e-17    
ref|XP_005853692.1|  soul heme-binding protein                        91.7    6e-17    
ref|WP_028272103.1|  heme-binding protein                             88.2    7e-17    
ref|WP_003894470.1|  soul heme-binding protein                        88.2    7e-17    
ref|WP_012969303.1|  heme-binding protein                             88.6    8e-17    
gb|EWM28188.1|  soul heme-binding protein                             91.7    8e-17    
ref|WP_007259171.1|  SOUL heme-binding protein                        88.6    8e-17    
ref|XP_009761729.1|  PREDICTED: heme-binding-like protein At3g101...  90.5    8e-17    
ref|WP_014954189.1|  SOUL heme-binding protein                        87.4    9e-17    
ref|WP_015355100.1|  MULTISPECIES: SOUL heme-binding protein          88.2    1e-16    
ref|WP_020728148.1|  hypothetical protein                             88.2    1e-16    
ref|WP_005062475.1|  heme-binding protein                             88.2    1e-16    
ref|WP_008444624.1|  SOUL heme-binding protein                        88.2    1e-16    
ref|WP_013295383.1|  hypothetical protein                             87.4    1e-16    
ref|WP_012393502.1|  heme-binding protein                             88.2    1e-16    
ref|WP_026539656.1|  heme-binding protein                             87.8    1e-16    
ref|WP_020786481.1|  hypothetical protein                             87.8    1e-16    
ref|WP_011500295.1|  SOUL heme-binding protein                        86.7    1e-16    
ref|WP_003887262.1|  heme-binding protein                             87.4    2e-16    
ref|XP_010312233.1|  PREDICTED: heme-binding-like protein At3g101...  86.7    2e-16    
ref|WP_011503831.1|  SOUL heme-binding protein                        87.4    2e-16    
ref|WP_030134329.1|  MULTISPECIES: heme-binding protein               87.4    2e-16    
ref|XP_006366858.1|  PREDICTED: heme-binding-like protein At3g101...  87.8    2e-16    
ref|WP_039347458.1|  SOUL heme-binding protein                        87.0    2e-16    
ref|WP_014863933.1|  heme-binding protein                             87.4    2e-16    
ref|WP_013881890.1|  heme-binding protein                             87.0    3e-16    
emb|CEA14574.1|  SOUL heme-binding protein                            87.0    3e-16    
ref|WP_030097084.1|  heme-binding protein                             87.0    3e-16    
gb|EMS45107.1|  Laccase-8                                             90.5    3e-16    
dbj|BAM69329.1|  conserved hypothetical protein                       85.9    3e-16    
ref|WP_021133053.1|  SOUL heme-binding protein                        86.7    3e-16    
ref|WP_030487163.1|  heme-binding protein                             85.9    4e-16    
ref|WP_026357078.1|  heme-binding protein                             86.7    4e-16    
ref|WP_012029083.1|  heme-binding protein                             86.3    4e-16    
ref|WP_023985291.1|  MULTISPECIES: heme-binding protein               85.9    5e-16    
ref|WP_027506443.1|  heme-binding protein                             85.9    5e-16    
ref|WP_031576880.1|  hypothetical protein                             85.1    6e-16    
ref|WP_011855847.1|  heme-binding protein                             85.9    7e-16    
ref|XP_006366857.1|  PREDICTED: heme-binding-like protein At3g101...  88.2    7e-16    
ref|WP_011560289.1|  MULTISPECIES: heme-binding protein               85.5    8e-16    
ref|WP_011414682.1|  hypothetical protein                             85.5    8e-16    
ref|WP_010143553.1|  heme-binding protein                             85.5    8e-16    
ref|WP_014813996.1|  heme-binding protein                             85.5    8e-16    
ref|WP_002726633.1|  heme-binding protein                             85.5    9e-16    
gb|KIC67673.1|  heme-binding protein                                  85.1    9e-16    
ref|WP_008847777.1|  SOUL heme-binding protein                        85.1    9e-16    
ref|WP_026940955.1|  hypothetical protein                             85.5    9e-16    
ref|WP_023844496.1|  SOUL heme-binding protein                        85.1    1e-15    
ref|WP_015910013.1|  heme-binding protein                             85.1    1e-15    
ref|WP_015304820.1|  SOUL heme-binding protein                        85.1    1e-15    
ref|WP_015324051.1|  SOUL heme-binding protein                        84.0    1e-15    
ref|WP_008964113.1|  heme-binding protein                             84.7    1e-15    
ref|WP_010130927.1|  heme-binding protein                             85.1    1e-15    
ref|WP_039196144.1|  hypothetical protein                             84.7    2e-15    
ref|WP_013768527.1|  SOUL heme-binding protein                        84.7    2e-15    
ref|WP_003933326.1|  heme-binding protein                             84.7    2e-15    
ref|WP_011690756.1|  heme-binding protein                             84.3    2e-15    
ref|WP_011770125.1|  heme-binding protein                             84.7    2e-15    
ref|WP_008949143.1|  heme-binding protein                             84.3    2e-15    
ref|WP_033923209.1|  hypothetical protein                             84.3    2e-15    
gb|KGK99380.1|  hypothetical protein LI82_05115                       83.6    2e-15    
ref|WP_018406405.1|  hypothetical protein                             84.0    2e-15    
emb|CDK37822.1|  SOUL heme-binding protein                            84.0    3e-15    
ref|XP_001773242.1|  predicted protein                                85.9    3e-15    
ref|XP_009601395.1|  PREDICTED: heme-binding-like protein At3g101...  84.3    3e-15    
gb|EXI87293.1|  SOUL heme-binding protein                             83.6    3e-15    
gb|AIA15921.1|  SOUL heme-binding protein                             83.2    3e-15    
ref|WP_028795850.1|  heme-binding protein                             83.2    4e-15    
ref|WP_020045232.1|  hypothetical protein                             83.6    4e-15    
ref|XP_010313708.1|  PREDICTED: heme-binding-like protein At3g101...  84.0    4e-15    
ref|WP_027318781.1|  hypothetical protein                             83.6    4e-15    
ref|WP_013645055.1|  SOUL heme-binding protein                        83.2    5e-15    
ref|WP_008608619.1|  heme-binding protein                             83.2    5e-15    
gb|AII86722.1|  SOUL heme-binding protein                             83.2    5e-15    
ref|WP_011440831.1|  SOUL heme-binding protein                        83.2    5e-15    
ref|XP_009804707.1|  PREDICTED: heme-binding-like protein At3g101...  83.6    5e-15    
ref|WP_028275655.1|  heme-binding protein                             82.8    6e-15    
ref|WP_006648194.1|  SOUL heme-binding protein                        83.2    6e-15    
ref|WP_019904435.1|  hypothetical protein                             82.8    6e-15    
ref|WP_029703360.1|  hypothetical protein                             85.1    6e-15    
ref|WP_027848389.1|  heme-binding protein                             82.8    7e-15    
ref|WP_010178173.1|  SOUL heme-binding protein                        82.8    7e-15    
ref|XP_002502391.1|  predicted protein                                84.7    7e-15    
ref|WP_030331347.1|  heme-binding protein                             82.4    7e-15    
ref|XP_010688101.1|  PREDICTED: uncharacterized protein LOC104902117  85.5    8e-15    
ref|WP_008983469.1|  heme-binding protein                             82.8    8e-15    
ref|WP_007981713.1|  heme-binding protein                             82.4    9e-15    
ref|XP_009601394.1|  PREDICTED: uncharacterized protein LOC104096...  85.1    1e-14    
ref|XP_006339128.1|  PREDICTED: heme-binding-like protein At3g101...  83.6    1e-14    
ref|WP_007164767.1|  hypothetical protein                             82.4    1e-14    
ref|XP_009601392.1|  PREDICTED: uncharacterized protein LOC104096...  84.7    1e-14    
gb|EXI81070.1|  SOUL heme-binding protein                             82.4    1e-14    
ref|WP_011813220.1|  heme-binding protein                             82.0    1e-14    
ref|XP_006395243.1|  hypothetical protein EUTSA_v10004416mg           84.3    1e-14    
ref|XP_004287378.1|  PREDICTED: uncharacterized protein LOC101313543  84.7    1e-14    
ref|WP_036785692.1|  soul heme-binding protein                        81.6    2e-14    
emb|CDX85305.1|  BnaC07g26160D                                        84.3    2e-14    
ref|XP_004251583.1|  PREDICTED: uncharacterized protein LOC101267...  84.0    2e-14    
ref|WP_018771335.1|  hypothetical protein                             81.3    2e-14    
ref|XP_010535883.1|  PREDICTED: uncharacterized protein LOC104811045  84.0    2e-14    
ref|XP_009151573.1|  PREDICTED: uncharacterized protein LOC103874902  84.0    2e-14    
ref|WP_029202510.1|  heme-binding protein                             80.9    2e-14    
ref|WP_023386334.1|  hypothetical protein                             80.5    2e-14    
gb|ABK24599.1|  unknown                                               84.3    2e-14    
ref|WP_014922494.1|  heme-binding protein                             80.9    3e-14    
ref|XP_009804706.1|  PREDICTED: uncharacterized protein LOC104249...  84.0    3e-14    
ref|XP_006826773.1|  hypothetical protein AMTR_s00136p00096760        83.6    3e-14    
emb|CDY71704.1|  BnaCnng74050D                                        83.6    3e-14    
dbj|BAO30022.1|  SOUL heme-binding protein                            81.3    3e-14    
ref|WP_007256932.1|  hypothetical protein                             81.6    3e-14    
ref|WP_008386141.1|  SOUL heme-binding protein                        81.3    3e-14    
ref|XP_009374064.1|  PREDICTED: uncharacterized protein LOC103963...  83.6    3e-14    
ref|WP_009210005.1|  hypothetical protein                             82.8    4e-14    
ref|WP_024365483.1|  heme-binding protein                             80.5    4e-14    
gb|KFK38230.1|  hypothetical protein AALP_AA3G085800                  83.2    4e-14    
ref|XP_005650150.1|  SOUL heme-binding protein                        81.3    4e-14    
ref|WP_008000615.1|  SOUL heme-binding protein                        80.9    4e-14    
gb|AFK48684.1|  unknown                                               81.3    4e-14    
ref|WP_012036842.1|  hypothetical protein                             80.1    5e-14    
ref|WP_006064835.1|  SOUL heme-binding protein                        80.5    6e-14    
ref|XP_006475773.1|  PREDICTED: uncharacterized protein LOC102609473  82.8    6e-14    
gb|KDP32346.1|  hypothetical protein JCGZ_13271                       82.4    8e-14    
ref|XP_007202142.1|  hypothetical protein PRUPE_ppa006983mg           82.4    8e-14    
ref|WP_007634051.1|  heme-binding protein                             79.3    9e-14    
ref|XP_006451016.1|  hypothetical protein CICLE_v10008577mg           82.4    9e-14    
ref|WP_029651864.1|  SOUL heme-binding protein                        79.3    9e-14    
ref|WP_036797199.1|  hypothetical protein                             79.3    1e-13    
ref|WP_018762280.1|  hypothetical protein                             79.3    1e-13    
ref|WP_020444979.1|  SOUL heme-binding protein                        79.3    1e-13    
ref|WP_012298921.1|  heme-binding protein                             79.0    1e-13    
ref|WP_038309679.1|  hypothetical protein                             79.3    1e-13    
ref|WP_027831954.1|  heme-binding protein                             79.3    1e-13    
ref|WP_008444075.1|  SOUL heme-binding protein                        79.0    1e-13    



>ref|XP_009794784.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Nicotiana sylvestris]
Length=199

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 182/205 (89%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGMILGKITVETPKYE+I + A+YEIR+YP +VIA+VTY PTQF+GNKDGGF LLANYIG
Sbjct  1    MGMILGKITVETPKYELIQSTADYEIRKYPASVIAQVTYDPTQFKGNKDGGFMLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQNAKPEKIAMTAPVIT+ S      IAMTAPVVTK G  +GE+  VTMQFILP+K
Sbjct  61   ALGNPQNAKPEKIAMTAPVITKSSEK----IAMTAPVVTKSG--DGENNMVTMQFILPAK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKPLDERV +KE GERK+GVV+FSGTA+DKVV+EKVE L++CLERDGYKIIG+
Sbjct  115  YTKAEEAPKPLDERVVVKEEGERKFGVVQFSGTASDKVVKEKVENLRKCLERDGYKIIGD  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            FEL RYNPPWT+PP KTNEVMIPVE
Sbjct  175  FELARYNPPWTIPPFKTNEVMIPVE  199



>ref|XP_009629040.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Nicotiana tomentosiformis]
Length=199

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 180/205 (88%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGMILGKI VETPKYE+I + A+YEIR+YP +VIA+VTY PTQF+GNKDGGF LLANYIG
Sbjct  1    MGMILGKICVETPKYELIQSTADYEIRKYPASVIAQVTYDPTQFKGNKDGGFMLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQNAKPE IAMTAPVIT+ S      IAMTAPVVTK G  +GES  VTMQFILP+K
Sbjct  61   ALGNPQNAKPETIAMTAPVITKSSEK----IAMTAPVVTKNG--DGESNMVTMQFILPAK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKPLDERV IKE GERK+GVV+FSGTA+DKVV+EKVE L++CLERDGYKIIG+
Sbjct  115  YTKAEEAPKPLDERVMIKEEGERKFGVVQFSGTASDKVVKEKVENLRKCLERDGYKIIGD  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            +EL RYNPPWT+PP KTNEVMIPVE
Sbjct  175  YELARYNPPWTIPPFKTNEVMIPVE  199



>ref|XP_010312298.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Solanum lycopersicum]
Length=199

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 176/205 (86%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGMILGKI+VETPKYE+I +  +YEIR+YP AVIA+VTY PTQF+GNKDGGF LLANYIG
Sbjct  1    MGMILGKISVETPKYELIQSTTDYEIRKYPAAVIAQVTYDPTQFKGNKDGGFMLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN+KPE IAMTAPVIT+ S      IAMTAPVVTK G  +GE   VTMQFILP+K
Sbjct  61   ALGNPQNSKPETIAMTAPVITKSSEQ----IAMTAPVVTKTG--DGEKNTVTMQFILPAK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKPLDERV I E GERKYGVVKFSGTA DK+V+EKVE LK+ LERDG+KIIGE
Sbjct  115  YTKAEEAPKPLDERVVIVEEGERKYGVVKFSGTANDKMVKEKVENLKKWLERDGFKIIGE  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            FEL RYNPPWTLPP KTNEVMIPVE
Sbjct  175  FELARYNPPWTLPPFKTNEVMIPVE  199



>ref|XP_006338998.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Solanum tuberosum]
Length=199

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 176/205 (86%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGMILGKI+VETPKYE+I +  +YEIR+YP AVIA+VTY PT F+GNKDGGF LLANYIG
Sbjct  1    MGMILGKISVETPKYELIQSTPDYEIRKYPAAVIAQVTYDPTNFKGNKDGGFMLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN+KPE IAMTAPVIT+ S      IAMTAPVVTK G  +GE+  VTMQFILP+K
Sbjct  61   ALGNPQNSKPETIAMTAPVITKSSEE----IAMTAPVVTKSG--DGENNTVTMQFILPAK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKPLDERV I E GERKYGVVKFSGTA DKVV+EKVE LK+ LERDG+KIIGE
Sbjct  115  YTKAEEAPKPLDERVVIVEEGERKYGVVKFSGTANDKVVKEKVENLKKWLERDGFKIIGE  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            FEL RYNPPWTLPP KTNEVMIPVE
Sbjct  175  FELARYNPPWTLPPFKTNEVMIPVE  199



>ref|XP_010262719.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Nelumbo nucifera]
Length=204

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKITVETPK+EV+ ++ +YEIR+Y  +V+AEVTY P++FRGN DGGFT+LANYIG
Sbjct  1    MGLVFGKITVETPKFEVLQSSTDYEIRKYSSSVVAEVTYDPSEFRGNPDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG PQN KPEKIAMTAPVIT+ S +++E+IAMTAPVVTK GG +GE K V MQF+LPSK
Sbjct  61   ALGKPQNTKPEKIAMTAPVITQTSETTAEKIAMTAPVVTKNGG-DGEKKMVAMQFVLPSK  119

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP DERV IKE GERKYGVVKFSG ATDKVVEEKVE LK+ LERDGYKI G+
Sbjct  120  YTKAEEAPKPTDERVVIKEEGERKYGVVKFSGMATDKVVEEKVEKLKQSLERDGYKITGK  179

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPPL+ NEVMIP+E
Sbjct  180  FLLARYNPPWTLPPLRRNEVMIPIE  204



>ref|XP_007205928.1| hypothetical protein PRUPE_ppa011641mg [Prunus persica]
 gb|EMJ07127.1| hypothetical protein PRUPE_ppa011641mg [Prunus persica]
Length=202

 Score =   313 bits (801),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 174/205 (85%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+ +  +YEIRQYPP+VIA++TYHP+Q +G+KDGGF++LANYIG
Sbjct  1    MGMVFGKIRVETPKYKVLQSTIDYEIRQYPPSVIAQLTYHPSQMKGDKDGGFSVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A GNPQN KPEKIAMTAPVIT+ S      IAMTAPVVTK GG E E K VTM+F+LPSK
Sbjct  61   AFGNPQNTKPEKIAMTAPVITKSSGEK---IAMTAPVVTKTGGAEDEKKMVTMEFLLPSK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAP+P+DERV I+E GERKYGVV F G ATD+VVEEKVE LK+ LERDGYKIIGE
Sbjct  118  YEKAEEAPRPVDERVVIREEGERKYGVVTFRGVATDEVVEEKVEKLKQSLERDGYKIIGE  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPP +TNEVMIP+E
Sbjct  178  FLLARYNPPWTLPPFRTNEVMIPIE  202



>ref|XP_010101837.1| hypothetical protein L484_023627 [Morus notabilis]
 gb|EXB89974.1| hypothetical protein L484_023627 [Morus notabilis]
Length=200

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 174/205 (85%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI+VETPK+EV+ +  +YEIR+Y P+VIA+VTY P+QFRGNKDGGFTLLANYIG
Sbjct  1    MGMVFGKISVETPKHEVVQSTNDYEIRKYEPSVIAQVTYDPSQFRGNKDGGFTLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ S      IAMTAPVVT+ GGGE E KAVTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKASEK----IAMTAPVVTQSGGGE-EKKAVTMQFLLPAK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAP+P+DERV I E GERKYGVV+F G AT++VVE KVE LK+ LERDGYK++GE
Sbjct  116  YRKAEEAPRPVDERVVITEEGERKYGVVRFGGVATEQVVEVKVEKLKKSLERDGYKVVGE  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLP  + NEVMIPVE
Sbjct  176  FLLARYNPPWTLPAFRINEVMIPVE  200



>ref|XP_003632661.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Vitis vinifera]
 emb|CAN82905.1| hypothetical protein VITISV_007253 [Vitis vinifera]
Length=200

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK++VI ++A+YEIR+YPP VIAEVTY P+QFRG+KDGGFTLLANYIG
Sbjct  1    MGMVFGKICVETPKFQVIQSSADYEIRKYPPTVIAEVTYDPSQFRGDKDGGFTLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKI MTAPV+T+ +      IAMTAPVVTK G G GE K VTMQF+LPSK
Sbjct  61   ALGNPQNTKPEKIEMTAPVVTKYAEK----IAMTAPVVTKSGEG-GEGKTVTMQFLLPSK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAP+P+DERV I+E GERKYGVVKF G AT+KVV  KVE L++ LERDG+K+IGE
Sbjct  116  YTKAEEAPRPVDERVVIREEGERKYGVVKFGGVATEKVVGAKVESLEKSLERDGFKLIGE  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLP  +TNEVMIP+E
Sbjct  176  FVLARYNPPWTLPAFRTNEVMIPIE  200



>ref|XP_010262718.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Nelumbo nucifera]
Length=205

 Score =   305 bits (782),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKITVETPK+EV+ ++ +YEIR+Y  +V+AEVTY P++FRGN DGGFT+LANYIG
Sbjct  1    MGMVLGKITVETPKFEVLQSSTDYEIRKYSSSVVAEVTYDPSEFRGNPDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
             LG PQN KPEKIAMTAPVIT+ S +++E+IAMTAPVVTK  GG+GE K V MQF+LPSK
Sbjct  61   VLGKPQNTKPEKIAMTAPVITQTSETTAEKIAMTAPVVTK-XGGDGEKKMVAMQFVLPSK  119

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP DERV IKE GERKYGVVKFSG ATDKVV EK E LK+ LERDGY I G+
Sbjct  120  YTKAEEAPKPTDERVVIKEEGERKYGVVKFSGVATDKVVNEKAEKLKQSLERDGYTITGK  179

Query  330  FELGRYNPPW-TLPPLKTNEVMIPVE  256
            F L RYNPPW TLPPL+TNEVM P+E
Sbjct  180  FLLARYNPPWLTLPPLRTNEVMFPIE  205



>ref|XP_008239829.1| PREDICTED: uncharacterized protein LOC103338406 [Prunus mume]
Length=661

 Score =   318 bits (816),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+ +  +YEIRQYPP+V A++TYHP+Q +G+KDGGFT+LANYIG
Sbjct  1    MGMVFGKIRVETPKYKVLQSTIDYEIRQYPPSVTAQLTYHPSQMKGDKDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A GNPQN KPEKIAMTAPVIT+ S+     IAMTAPVVTK GG E E K VTM+F+LPSK
Sbjct  61   AFGNPQNTKPEKIAMTAPVITKSSAEK---IAMTAPVVTKTGGAEDEKKMVTMEFLLPSK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAP+P+DERV I+E GERKYGVV F G ATD+VVEEKVE LK+ LERDGYKIIGE
Sbjct  118  YEKAEEAPRPVDERVVIREEGERKYGVVTFRGVATDEVVEEKVEKLKQSLERDGYKIIGE  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE*MN  247
            F L RYNPPWTLPP +TNEVMIP+E +N
Sbjct  178  FLLARYNPPWTLPPFRTNEVMIPIETLN  205



>ref|XP_011009153.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Populus euphratica]
Length=203

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+    S + IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKTGGGSEK-IAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV IKE G RKYGVVKF G AT++ V E+VE LK+ LERDG K+IGE
Sbjct  119  YKKAEEAPKPVDERVVIKEEGVRKYGVVKFGGVATEQAVAERVEKLKKSLERDGLKVIGE  178

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPPL+TNEVMIP+E
Sbjct  179  FLLARYNPPWTLPPLRTNEVMIPIE  203



>ref|XP_010928956.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Elaeis guineensis]
Length=199

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 175/205 (85%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKITVETPK+EV+H+  +YEIR+Y P+V+AEVTY P+Q RG++DGGF +LANYIG
Sbjct  1    MGLVFGKITVETPKHEVLHSCPDYEIRKYSPSVVAEVTYDPSQLRGDRDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG PQNAKPEKIAMTAPVIT+ SS S + IAMTAPV+T      G++KA TMQF+LP+K
Sbjct  61   ALGQPQNAKPEKIAMTAPVITKSSSQSEK-IAMTAPVIT-----SGDNKATTMQFVLPAK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y   EEAPKPLDERV IK  GERKYGVV+FSG ATDKVV+EKVE L+R LERDG+K++G+
Sbjct  115  YKSVEEAPKPLDERVVIKAEGERKYGVVRFSGVATDKVVQEKVEKLRRSLERDGHKVVGD  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPPL+TNEVM+P+E
Sbjct  175  FLLARYNPPWTLPPLRTNEVMLPIE  199



>ref|XP_002322949.2| SOUL heme-binding family protein [Populus trichocarpa]
 gb|EEF04710.2| SOUL heme-binding family protein [Populus trichocarpa]
Length=203

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+    S + IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKTGGGSEK-IAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I+E G RKYGVVKF G AT++ V E+VE LK+ LERDG K+IGE
Sbjct  119  YKKAEEAPKPVDERVVIREEGVRKYGVVKFGGVATEQAVAERVEKLKKSLERDGLKVIGE  178

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPPL+TNEVMIP+E
Sbjct  179  FLLARYNPPWTLPPLRTNEVMIPIE  203



>ref|XP_007026821.1| Fructokinase-like 1 [Theobroma cacao]
 gb|EOY07323.1| Fructokinase-like 1 [Theobroma cacao]
Length=647

 Score =   315 bits (807),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 181/209 (87%), Gaps = 5/209 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGMILGKI+VETPKYEV+ ++A+YEIR+Y P+V+AEVTY P+QF+GNKDGGF++LANYIG
Sbjct  1    MGMILGKISVETPKYEVVQSSADYEIRKYSPSVVAEVTYDPSQFKGNKDGGFSVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQNAKPEKIAMTAPVIT+   S SE+IAMTAPV+TK     GE   VTMQF+LP+ 
Sbjct  61   ALGNPQNAKPEKIAMTAPVITKSPGSESEKIAMTAPVITK-----GEKNMVTMQFLLPAM  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y RAEEAPKPLDERV I+E GERKYGVVKF+G ATD+VVEEKVE LK+ LERDG+K+IGE
Sbjct  116  YERAEEAPKPLDERVVIREEGERKYGVVKFAGVATDQVVEEKVENLKKSLERDGHKVIGE  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE*MNL  244
            F L RYNPPWTLP  +TNEVM+PV+ + L
Sbjct  176  FLLARYNPPWTLPAFRTNEVMLPVQTVGL  204



>ref|XP_010675294.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=206

 Score =   300 bits (768),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG+ILGKITVETPKYEV+ +  EYEIR+YPP+VIA++TY P+Q +  KDGGF++LANYIG
Sbjct  1    MGLILGKITVETPKYEVLQSTNEYEIRKYPPSVIAQITYDPSQMKDKKDGGFSILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRes-sssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
             +G  QN K EK+AMTAPVIT+++ ++S+E+IAMTAPVVTK G GEGE+K V+MQF+LP+
Sbjct  61   VVGKAQNTKAEKVAMTAPVITQDTGAASAEKIAMTAPVVTKDGDGEGEAKMVSMQFVLPA  120

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            KY  AE+APKPLDERV IKE GE+KYGVVKFSG A+D VV++KVE LK  LE+DG K++G
Sbjct  121  KYKTAEDAPKPLDERVVIKEEGEKKYGVVKFSGVASDVVVKDKVEKLKSALEKDGVKVVG  180

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
            E+ L RYNPPWTLPPL+TNEVMIPVE
Sbjct  181  EYMLARYNPPWTLPPLRTNEVMIPVE  206



>ref|XP_011094955.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Sesamum indicum]
Length=200

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKITVETPKYEV+    +YEIR+Y P+VIAEVTY PTQF  +KDGGFT+LANYIG
Sbjct  1    MGMVLGKITVETPKYEVLATTGDYEIRKYSPSVIAEVTYDPTQFNSDKDGGFTILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A G P N KPEKI MT PVIT+ +S     IAMTAPVVTK G G  E+  VTM FILPSK
Sbjct  61   AFGKPMNEKPEKIEMTVPVITKTASEK---IAMTAPVVTKSGVGGSET--VTMGFILPSK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP+PLDERV I+E GERKYGVV+FSG A D+VV EKVE LK CLERDGYK+ G+
Sbjct  116  YVKAEDAPRPLDERVVIREEGERKYGVVRFSGVARDEVVAEKVEKLKACLERDGYKVAGD  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F LGRYNPPWTLPPL+TNEVMIPVE
Sbjct  176  FVLGRYNPPWTLPPLRTNEVMIPVE  200



>gb|KDO58029.1| hypothetical protein CISIN_1g028987mg [Citrus sinensis]
Length=200

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI+VETPKYEVI +  +YEIR+Y P+V+AEVTY P+ F+GNKDGGF++LANYIG
Sbjct  1    MGMVFGKISVETPKYEVIQSTFDYEIRKYAPSVVAEVTYDPSTFKGNKDGGFSVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ S    + IAMTAPVVTK      E K VTMQF+LP K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKSSPEEEK-IAMTAPVVTKSD----EKKMVTMQFVLPEK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I+E GERKYGVVKF G A+D+VV EKV+ LK+ LE+DGYK++G+
Sbjct  116  YQKAEEAPKPVDERVVIREEGERKYGVVKFGGVASDEVVGEKVDKLKKSLEKDGYKVVGQ  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPP +TNEVMIPVE
Sbjct  176  FLLARYNPPWTLPPFRTNEVMIPVE  200



>ref|XP_006429262.1| hypothetical protein CICLE_v10012815mg [Citrus clementina]
 ref|XP_006480936.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Citrus sinensis]
 gb|ESR42502.1| hypothetical protein CICLE_v10012815mg [Citrus clementina]
Length=200

 Score =   297 bits (761),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI+VETPKYEVI +  +YEIR+Y P+V+AEVTY P+ F+GNKDGGF++LANYIG
Sbjct  1    MGMVFGKISVETPKYEVIQSTFDYEIRKYAPSVVAEVTYDPSTFKGNKDGGFSVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ S    + IAMTAPVVTK      E K VTMQF+LP K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKSSPEGEK-IAMTAPVVTKSD----EKKMVTMQFVLPEK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I+E G+RKYGVVKF G A+D+VV EKV+ LK+ LE+DGYK+IG+
Sbjct  116  YQKAEEAPKPVDERVVIREEGQRKYGVVKFGGVASDEVVGEKVDKLKKSLEKDGYKVIGQ  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPP +TNEVMIPVE
Sbjct  176  FLLARYNPPWTLPPFRTNEVMIPVE  200



>ref|XP_002527880.1| protein with unknown function [Ricinus communis]
 gb|EEF34511.1| protein with unknown function [Ricinus communis]
Length=201

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 172/205 (84%), Gaps = 4/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKITVETPKYEVI + +EYEIR+Y PAV+A+VTY  TQF+G+KDGGF +LANYIG
Sbjct  1    MGLVFGKITVETPKYEVIESLSEYEIRKYAPAVLAQVTYDRTQFKGDKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A+GNP N KPEKIAMTAPVIT+        IAMTAPVVTK GGG G++  VTMQF+LP K
Sbjct  61   AVGNPHNTKPEKIAMTAPVITKSGGEK---IAMTAPVVTKEGGG-GDNTTVTMQFLLPDK  116

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+APKP DERV IKE GE+KYGVVKF G AT++VV+EKV+ LK+ LERDG+K+IGE
Sbjct  117  YKKAEDAPKPTDERVVIKEEGEKKYGVVKFGGVATEQVVQEKVDKLKQNLERDGHKLIGE  176

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPP +TNEVMIP+E
Sbjct  177  FVLARYNPPWTLPPFRTNEVMIPIE  201



>ref|XP_003604821.1| Heme-binding-like protein [Medicago truncatula]
 gb|AES87018.1| SOUL heme-binding family protein [Medicago truncatula]
Length=202

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 166/205 (81%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKYEV     +YEIR Y P+V AEVTY P+QF+GNKDGGF +LANYIG
Sbjct  1    MGMVFGKIGVETPKYEVTKTTQDYEIRIYAPSVAAEVTYDPSQFKGNKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ S+     IAMTAPVVTK       +K VTMQFILPS 
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKGSAEK---IAMTAPVVTKSSEEGERNKMVTMQFILPSS  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP DERV I+E GERKYGVVKFSG A+D+VV+EKVE L+  LERDG+K+IG+
Sbjct  118  YEKAEEAPKPTDERVVIREEGERKYGVVKFSGVASDEVVKEKVEKLRLSLERDGFKVIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F LGRYNPPWTLP  +TNEVMIP+E
Sbjct  178  FLLGRYNPPWTLPMFRTNEVMIPIE  202



>ref|XP_009370231.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Pyrus x bretschneideri]
 ref|XP_009370262.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Pyrus x bretschneideri]
Length=202

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 173/205 (84%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI+VETPKY+V+H+ A YEIRQY P+V+A+ TY P+  +G+KDGGFT+LANYIG
Sbjct  1    MGMVFGKISVETPKYKVLHSTALYEIRQYAPSVVAQFTYDPSDLKGDKDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+  +  SE+IAMTAPVVT+   G+   + VTM+F+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKTQNPESEKIAMTAPVVTREEKGK---RMVTMEFLLPAK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+APKP+DERV I+E GERKYGVV F+G AT++VV EKVE LK  LE+DGYKIIG+
Sbjct  118  YGKAEDAPKPVDERVVIREEGERKYGVVGFAGVATEEVVAEKVEKLKESLEKDGYKIIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLPP +TNEVMIP+E
Sbjct  178  YILARYNPPWTLPPFRTNEVMIPIE  202



>ref|XP_008359773.1| PREDICTED: LOW QUALITY PROTEIN: heme-binding-like protein At3g10130, 
chloroplastic [Malus domestica]
Length=202

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+H+ A YEIRQYPP+V+A+ TY P+  +G+KDGGF +LANYIG
Sbjct  1    MGMVFGKICVETPKYKVLHSTALYEIRQYPPSVVAQFTYDPSDLKGDKDGGFAILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+  +  SE IAMTAPVVT+   G    K VTM+F+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKSQNQESEMIAMTAPVVTREEKGR---KMVTMEFLLPAK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I E GERKYGVV F+G AT+KVV EKVE LK  LE+DGYKIIG+
Sbjct  118  YGKAEEAPKPVDERVVITEEGERKYGVVGFTGVATEKVVAEKVEKLKERLEKDGYKIIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
              L RYNPPWTLPP +TNEV+IP+E
Sbjct  178  HLLARYNPPWTLPPFRTNEVLIPIE  202



>ref|XP_004302669.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=200

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 173/205 (84%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+ + A+YEIRQYPP+VIA+VTY P+ F+G+KDGGF++LANYIG
Sbjct  1    MGMVFGKICVETPKYQVLKSTADYEIRQYPPSVIAQVTYDPSVFKGDKDGGFSVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A G PQN KPEKIAMTAPVIT++S++    IAMTAPVVTK  G   ++K VTMQF+LP+K
Sbjct  61   AFGKPQNTKPEKIAMTAPVITQQSTAEK--IAMTAPVVTKEAG---DAKTVTMQFLLPAK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I+E G RKYGVV F G+A+++VVE++VE LKR LE+DG+KI GE
Sbjct  116  YQKAEEAPKPVDERVVIREEGGRKYGVVTFGGSASEQVVEDRVEKLKRALEKDGFKITGE  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L R+NPPWTLP  +TNEVMIPVE
Sbjct  176  YLLARFNPPWTLPAFRTNEVMIPVE  200



>ref|XP_007133956.1| hypothetical protein PHAVU_010G006500g [Phaseolus vulgaris]
 gb|ESW05950.1| hypothetical protein PHAVU_010G006500g [Phaseolus vulgaris]
Length=207

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKI+VET KYEVI + +EYEIR+Y P V+AEVTY P+QF+ NKDGGF +LA+YIG
Sbjct  1    MGLVFGKISVETAKYEVIKSTSEYEIRKYVPCVVAEVTYDPSQFKENKDGGFMVLASYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGE--GESKAVTMQFILP  517
            A+GNPQN KPEKIAMTAPVIT+ES    E+IAMTAPVVTK G GE   ++K VTMQF+LP
Sbjct  61   AVGNPQNTKPEKIAMTAPVITKESGGGGEKIAMTAPVVTKDGAGEEGKKNKMVTMQFVLP  120

Query  516  SKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKII  337
            + Y +AEEAPKP DERV IKE GERKYGVVKF G A+++VV EKVE L+ CLE DG+K++
Sbjct  121  AVYGKAEEAPKPTDERVLIKEEGERKYGVVKFGGVASEEVVREKVEKLRVCLETDGFKVV  180

Query  336  GEFELGRYNPPWTLPPLKTNEVMIPVE  256
            G++ L RYNPPWT+P  +TNEVMIPVE
Sbjct  181  GDYVLARYNPPWTIPVFRTNEVMIPVE  207



>ref|XP_009416215.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=199

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 167/205 (81%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG+ILGKI+VETPKYEVIHA  +YEIR+Y P V+AEVTY P++ RG+ DGGF +LANYIG
Sbjct  1    MGLILGKISVETPKYEVIHACPDYEIRKYSPRVVAEVTYDPSKLRGDPDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG PQN +PEKIAMTAPVIT+        IAMTAPV+T   G   E K VTMQF+LPSK
Sbjct  61   ALGKPQNVRPEKIAMTAPVITKAGPEK---IAMTAPVITNVAG---EGKEVTMQFVLPSK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y+RAEEAP P+DERV +++ GE K+GVV+FSG  TD+ V E+VE L+RCLERDG+K++G+
Sbjct  115  YSRAEEAPAPVDERVVVRDEGEAKFGVVRFSGLTTDQAVAERVEQLRRCLERDGHKVVGD  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLP L+TNEVM+P+E
Sbjct  175  FLLARYNPPWTLPFLRTNEVMLPIE  199



>ref|XP_004506644.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Cicer arietinum]
Length=248

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 173/219 (79%), Gaps = 11/219 (5%)
 Frame = -1

Query  912  HSRSLLHNILNSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRG  733
            HS+SL         MGM+ GKI VETPKYEVI    +YEIR+Y P+V AEVTY P++F+G
Sbjct  41   HSQSL---------MGMVFGKIGVETPKYEVIKTTQDYEIRKYAPSVAAEVTYDPSEFKG  91

Query  732  NKDGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEG  553
            NKDGGF +LANYIGALGNPQN KPEKIAMTAPVIT+E++ S + I MTAPVVTK GG E 
Sbjct  92   NKDGGFMVLANYIGALGNPQNTKPEKIAMTAPVITKETTLSEK-IPMTAPVVTKSGGDE-  149

Query  552  ESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEML  373
             +K VTMQFILPS Y + EEAPKP+DERV I+E GER YGVVKF G A+D VV+EKVE L
Sbjct  150  TNKKVTMQFILPSNYGKGEEAPKPIDERVVIREEGERVYGVVKFGGVASDDVVKEKVEKL  209

Query  372  KRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
               LE+DG+K++G+F L RYNPPWT+P  +TNEVMIPVE
Sbjct  210  SLSLEKDGFKVVGDFLLARYNPPWTIPVFRTNEVMIPVE  248



>ref|XP_008798949.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713712 
[Phoenix dactylifera]
Length=665

 Score =   302 bits (773),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++LGKIT+ETPK+EV+H+  +YEIR+Y P+V+AEVTY P+Q RG++DGGF +LANYIG
Sbjct  1    MGLVLGKITLETPKHEVLHSCPDYEIRKYSPSVVAEVTYEPSQLRGDRDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG PQNAKPEKIAMTAPVIT+  S S + IAMTAPV+T G     ++KA TMQF+LP+K
Sbjct  61   ALGQPQNAKPEKIAMTAPVITKSPSQSEK-IAMTAPVITSG-----DNKATTMQFVLPAK  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y  AEEAPKPLDERV IK  GERKYGV +FSG ATDKVVEE+VE L+R LERDGYK+ G+
Sbjct  115  YKTAEEAPKPLDERVVIKAEGERKYGVARFSGVATDKVVEERVEKLRRSLERDGYKVAGD  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPPL+TNEVM+PVE
Sbjct  175  FLLARYNPPWTLPPLRTNEVMLPVE  199



>ref|XP_006338999.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Solanum tuberosum]
Length=199

 Score =   287 bits (734),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 161/205 (79%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKI VETPKYE I + A+YEIR+YP AVIA+VTY P QF+G+KDGGF LL NYIG
Sbjct  1    MGIVFGKICVETPKYESIQSTADYEIRKYPAAVIAQVTYDPIQFKGDKDGGFKLLTNYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              GNPQN+ PEKIAMT PVIT+ S      IAMT PVVTK    +GE   VTMQFILP+ 
Sbjct  61   IFGNPQNSNPEKIAMTTPVITKSSEK----IAMTTPVVTKSD--DGEKNTVTMQFILPAT  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y + EEAPKPLDERV I E GERKYGV+KF GTA+DK+V+EKVE LK+ LERDG KIIGE
Sbjct  115  YTKGEEAPKPLDERVVIVEEGERKYGVMKFGGTASDKIVKEKVENLKKLLERDGCKIIGE  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            FEL RYNP W LPP KTNEV IPVE
Sbjct  175  FELARYNPTWILPPFKTNEVRIPVE  199



>ref|XP_008345509.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Malus domestica]
Length=202

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 170/205 (83%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG + GKI+VETP Y+VIH+ A YEIRQY P+V+A+ TY P+  +G+KDGGFT+LANYIG
Sbjct  1    MGTVFGKISVETPNYKVIHSTALYEIRQYAPSVVAQFTYDPSDLKGSKDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+  +  SE+IAMTAPVVT+   G+   + VTM+F+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKTQNPESEKIAMTAPVVTREEKGK---RMVTMEFLLPAK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+APKP+DERV I+E GERKYGVV  +G AT++VV EKVE LK  LE+DGYKIIG+
Sbjct  118  YGKAEDAPKPVDERVVIREEGERKYGVVGSAGVATEEVVAEKVEKLKESLEKDGYKIIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLPP +TNEVMIP+E
Sbjct  178  YILARYNPPWTLPPFRTNEVMIPIE  202



>ref|XP_008370044.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Malus domestica]
Length=202

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG + GKI+VETP Y+VIH+ A YEIRQY P+V+A+ TY P+  +G KDGGFT+LANYIG
Sbjct  1    MGTVFGKISVETPNYKVIHSTALYEIRQYAPSVVAQFTYDPSDLKGXKDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+  +  SE+IAMTAPVVT+   G+   + VTM+F+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKTQNPESEKIAMTAPVVTREEKGK---RMVTMEFLLPAK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+APKP+DERV I+E GERKYGVV  +G AT++VV EKVE LK  LE+DGYKIIG+
Sbjct  118  YGKAEDAPKPVDERVVIREEGERKYGVVGXAGVATEEVVAEKVEKLKESLEKDGYKIIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLPP +TNEVMIP+E
Sbjct  178  YILARYNPPWTLPPFRTNEVMIPIE  202



>ref|XP_004156587.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Cucumis sativus]
 gb|KGN58806.1| hypothetical protein Csa_3G732630 [Cucumis sativus]
Length=198

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 169/205 (82%), Gaps = 7/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG+ILGKI+VETPKYE++ + ++YEIR+Y P+V+AEV Y PTQFRGNKDGGFT+LA YIG
Sbjct  1    MGLILGKISVETPKYELVQSTSDYEIRKYEPSVVAEVAYDPTQFRGNKDGGFTVLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A+G PQN K EK+AMTAPVIT+        I+MTAPVVT+GG   GE K VTMQF+LPSK
Sbjct  61   AIGEPQNIKSEKVAMTAPVITKSEK-----ISMTAPVVTEGG--GGEGKPVTMQFVLPSK  113

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP DERV IKE GERK  VV+FSG AT+ VV EKVE LK+ LE+DG+K+IG+
Sbjct  114  YKKAEEAPKPADERVVIKEEGERKLAVVRFSGIATEGVVAEKVEKLKKSLEKDGHKVIGD  173

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLP L+TNEVMIPVE
Sbjct  174  YVLARYNPPWTLPSLRTNEVMIPVE  198



>ref|XP_008442480.1| PREDICTED: uncharacterized protein LOC103486334 [Cucumis melo]
Length=662

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 169/205 (82%), Gaps = 7/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG+ILGKI+VETPKYE+I + ++YEIR+Y P+V+AEV Y PTQFRGNKDGGFT+LA YIG
Sbjct  1    MGLILGKISVETPKYELIQSTSDYEIRKYEPSVVAEVAYDPTQFRGNKDGGFTVLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A+G PQN K EK+AMTAPVIT+        I+MTAPVVT GGG EG  K VTMQF+LPSK
Sbjct  61   AIGEPQNIKSEKVAMTAPVITKSEK-----ISMTAPVVTGGGGSEG--KPVTMQFVLPSK  113

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP DERV IKE GERK  VV+FSG AT+ VV EKVE LK+ LE+DG+K+IG+
Sbjct  114  YKKAEEAPKPADERVVIKEEGERKLAVVRFSGIATEGVVAEKVEQLKKSLEKDGHKVIGD  173

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLP L+TNEVMIPV+
Sbjct  174  YVLARYNPPWTLPSLRTNEVMIPVD  198



>ref|XP_010044056.1| PREDICTED: uncharacterized protein LOC104433104 [Eucalyptus grandis]
Length=204

 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 163/209 (78%), Gaps = 9/209 (4%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK +V+H+ A YEIR Y P+V+AEV Y P+QF+G++DGGFT+LANYIG
Sbjct  1    MGMVFGKICVETPKCQVLHSCANYEIRHYAPSVVAEVAYTPSQFKGDRDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKG---GGGEGESK-AVTMQFI  523
            A GNPQN KPEKIAMT PVIT+        IAMT PV+T+G   GG EG  + AVTM+F+
Sbjct  61   AFGNPQNTKPEKIAMTTPVITKSEK-----IAMTTPVITQGPPRGGREGSGEEAVTMRFV  115

Query  522  LPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYK  343
            LP+KY RAEE P+PLDERV ++E   RKYGVV+FSG AT+ V  EK E L+  LERDG+K
Sbjct  116  LPAKYGRAEEVPRPLDERVVVREEEGRKYGVVRFSGVATEGVTREKAERLREWLERDGHK  175

Query  342  IIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            + GEF L RYNPPWTLPP +TNEVMIP+E
Sbjct  176  VAGEFVLARYNPPWTLPPFRTNEVMIPIE  204



>ref|XP_009358825.1| PREDICTED: uncharacterized protein LOC103949435 [Pyrus x bretschneideri]
Length=655

 Score =   291 bits (746),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 170/212 (80%), Gaps = 6/212 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+H+ A YEIRQYPP+V+A+ TY P+  +G+KDGGF +LANYIG
Sbjct  1    MGMVFGKICVETPKYKVLHSTALYEIRQYPPSVVAQFTYDPSDLKGDKDGGFAILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+  +   E+IAMTAPVVT+   G    K VTM+F+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKTQNPEGEKIAMTAPVVTREEKGR---KTVTMEFLLPAK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I E GERKYGVV F+G AT+KVV EKVE LK  L +DGYKIIG+
Sbjct  118  YGKAEEAPKPVDERVVITEEGERKYGVVGFTGVATEKVVAEKVEKLKESLVKDGYKIIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE*MNLNAP  235
              L RYNPPWTLPP +TNEVMIP+   +LN P
Sbjct  178  HLLARYNPPWTLPPFRTNEVMIPI---DLNPP  206



>ref|XP_009133222.1| PREDICTED: uncharacterized protein LOC103857751 [Brassica rapa]
Length=200

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 160/205 (78%), Gaps = 5/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK+ V+ +   YEIR+YPPAV AEVTY P+ F+G+KDGGF +LA YIG
Sbjct  1    MGMVFGKIAVETPKHTVVKSGDGYEIREYPPAVAAEVTYDPSDFKGDKDGGFMVLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              G P+N KPEKIAMTAPVIT+E       IAMTAPVVTK GGG GE K VTMQF+LP  
Sbjct  61   VFGKPENQKPEKIAMTAPVITKEGEK----IAMTAPVVTKEGGG-GEKKTVTMQFLLPEM  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP+P DERV IKE G RKYGVV FSGTA + VV EKV+ L+  LERDG+KI G+
Sbjct  116  YKKAEDAPRPTDERVVIKEEGGRKYGVVTFSGTAAESVVSEKVKKLRSDLERDGFKITGD  175

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLPP KTNEVMIPVE
Sbjct  176  YVLARYNPPWTLPPFKTNEVMIPVE  200



>ref|XP_004249669.1| PREDICTED: uncharacterized protein LOC101250355 [Solanum lycopersicum]
Length=199

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 157/205 (77%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKI VETPKY+ I + A+YEIR+YP AV+A+VTY P QF+G+KDGGF LL NYIG
Sbjct  1    MGIVFGKICVETPKYKTIQSTADYEIRKYPAAVMAQVTYDPIQFKGDKDGGFKLLTNYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              GNPQN+ PEKIAMT PVIT+        IAMT PVVTK    + E   VTMQFILP+ 
Sbjct  61   IFGNPQNSNPEKIAMTTPVITKSGEK----IAMTTPVVTKSD--DREKNTVTMQFILPAT  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y + EEAPKPLDERV I E GERKYGV+KF GTA++K+V EKVE LK+ LERDG  IIGE
Sbjct  115  YTKCEEAPKPLDERVVIVEEGERKYGVMKFGGTASEKIVIEKVENLKKLLERDGCNIIGE  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            FEL RYNP W LPP KTNEV IPVE
Sbjct  175  FELARYNPTWILPPFKTNEVRIPVE  199



>ref|XP_010044057.1| PREDICTED: uncharacterized protein LOC104433106 [Eucalyptus grandis]
Length=217

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 12/217 (6%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK +V+H+ A YEIR Y P+V+AEV Y P+QF+G++DGGFT+LANYIG
Sbjct  1    MGMVFGKIRVETPKCKVLHSCANYEIRHYAPSVVAEVAYTPSQFKGDRDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRess--------ssseEIAMTAPVVTKG---GGGEGESK  544
            A GNPQNAKPEKIAMT PVIT+           + SE+IAMT PV+T+G   GG EG  +
Sbjct  61   AFGNPQNAKPEKIAMTTPVITKSEKIAMTTPVITKSEKIAMTTPVITQGPPRGGREGSGE  120

Query  543  -AVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKR  367
             AVTM+F+LP+KY RAEE P+PLDERV ++E   RKYGVV+FSG AT+ V  EK E L+ 
Sbjct  121  EAVTMRFVLPAKYGRAEEVPRPLDERVVVREEEGRKYGVVRFSGVATEGVTREKAERLRE  180

Query  366  CLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             LERDG+K+ GEF L RYNPPWTLPP +TNEVMIP+E
Sbjct  181  WLERDGHKVAGEFVLARYNPPWTLPPFRTNEVMIPIE  217



>gb|AAK43920.1|AF370601_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK96803.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10101.1| unknown protein [Arabidopsis thaliana]
Length=215

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 163/215 (76%), Gaps = 10/215 (5%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF LLA YIG
Sbjct  1    MGMVFGKIAVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQLLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRe----------ssssseEIAMTAPVVTKGGGGEGESKA  541
              G P+N KPEKIAMTAPVIT+E           +  SE+I MT+PVVTK GGGEG  K 
Sbjct  61   VFGKPENEKPEKIAMTAPVITKEGEKIAMTAPVITKESEKIEMTSPVVTKEGGGEGRKKL  120

Query  540  VTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCL  361
            VTMQF+LPS Y +AEEAP+P DERV IKE G RKYGV+KFSG A++ VV EKV+ L   L
Sbjct  121  VTMQFLLPSMYKKAEEAPRPTDERVVIKEEGGRKYGVIKFSGIASESVVSEKVKKLSSHL  180

Query  360  ERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            E+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  181  EKDGFKITGDFVLARYNPPWTLPPFRTNEVMIPVE  215



>ref|NP_565876.2| heam-binding protein 2 [Arabidopsis thaliana]
 gb|AEC09472.1| SOUL heme-binding-like protein [Arabidopsis thaliana]
Length=225

 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 164/219 (75%), Gaps = 10/219 (5%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF LLA
Sbjct  7    KTYIMGMVFGKIAVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQLLA  66

Query  702  NYIGALGNPQNAKPEKIAMTAPVITR----------essssseEIAMTAPVVTKGGGGEG  553
             YIG  G P+N KPEKIAMTAPVIT+            +  SE+I MT+PVVTK GGGEG
Sbjct  67   KYIGVFGKPENEKPEKIAMTAPVITKEGEKIAMTAPVITKESEKIEMTSPVVTKEGGGEG  126

Query  552  ESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEML  373
              K VTMQF+LPS Y +AEEAP+P DERV IKE G RKYGV+KFSG A++ VV EKV+ L
Sbjct  127  RKKLVTMQFLLPSMYKKAEEAPRPTDERVVIKEEGGRKYGVIKFSGIASESVVSEKVKKL  186

Query  372  KRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
               LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  187  SSHLEKDGFKITGDFVLARYNPPWTLPPFRTNEVMIPVE  225



>ref|NP_001276155.1| uncharacterized protein LOC100817967 [Glycine max]
 gb|ACU19835.1| unknown [Glycine max]
Length=213

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 171/213 (80%), Gaps = 8/213 (4%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKITVET KYE I + +EYEIR+Y P+V+ EVTY P+QF+GNKDGGF +LANYIG
Sbjct  1    MGLVFGKITVETAKYEAIKSTSEYEIRKYAPSVVVEVTYDPSQFKGNKDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssse----EIAMTAPVVTKGGGGEG----ESKAVT  535
            A+G PQN KPEKIAMTAPVIT++S         +IAMTAPVVTK GGGEG     +K VT
Sbjct  61   AVGKPQNTKPEKIAMTAPVITKDSVGGGGSDGEKIAMTAPVVTKEGGGEGEEGRRNKMVT  120

Query  534  MQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLER  355
            MQF+LP+ Y +AEEAPKP DERV I+E G RKYGVVKF G A+++VV E+VE L+  LE+
Sbjct  121  MQFVLPAVYGKAEEAPKPTDERVVIREEGLRKYGVVKFGGVASEQVVRERVEKLRESLEK  180

Query  354  DGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            DG+K++G+F LGRYNPPWT+P  +TNEVMIPVE
Sbjct  181  DGFKVVGDFLLGRYNPPWTIPAFRTNEVMIPVE  213



>ref|XP_009143435.1| PREDICTED: uncharacterized protein LOC103867148 [Brassica rapa]
Length=230

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 161/208 (77%), Gaps = 6/208 (3%)
 Frame = -1

Query  879  SFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLAN  700
            ++ MGM+ GKI+VETPKY V+ +   YEIR+YPPAV AE+TY P++F+ N+DGGFT+LA 
Sbjct  29   AYIMGMVFGKISVETPKYTVVKSCDGYEIREYPPAVAAEITYDPSEFKDNRDGGFTVLAK  88

Query  699  YIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFIL  520
            YIG  G P+N KPEKIAMTAPVIT+E       IAMTAPVVTK  G E   K VTMQF+L
Sbjct  89   YIGVFGKPENQKPEKIAMTAPVITKEGEK----IAMTAPVVTKEEGSE--KKTVTMQFLL  142

Query  519  PSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKI  340
            P  Y +AE+AP+P DERV IKE G RKYGVV FSGTA + VV EKV+ L+  LERDG+KI
Sbjct  143  PEVYKKAEDAPRPTDERVVIKEEGGRKYGVVTFSGTAAESVVSEKVKKLRSDLERDGFKI  202

Query  339  IGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             G++ L RYNPPWTLPP KTNEVMIPVE
Sbjct  203  TGDYVLARYNPPWTLPPFKTNEVMIPVE  230



>emb|CDY07759.1| BnaA03g17520D [Brassica napus]
Length=193

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 156/205 (76%), Gaps = 12/205 (6%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK+ V+ +   YEIR+YPPAV AEVTY P++F+G+KDGGF +LA YIG
Sbjct  1    MGMVFGKIAVETPKHTVVKSGDGYEIREYPPAVAAEVTYDPSEFKGDKDGGFMVLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              G P+N KPEKIAMTAP            IAMTAPVVTK GGG  E K VTMQF+LP  
Sbjct  61   VFGKPENQKPEKIAMTAP------------IAMTAPVVTKEGGGGDEKKTVTMQFLLPEM  108

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP+P DERV IKE G RKYGVVKFSGTA++ VV EKV+ L+  LERDG+KI G+
Sbjct  109  YKKAEDAPRPTDERVVIKEEGGRKYGVVKFSGTASESVVSEKVKKLRSDLERDGFKITGD  168

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLP  KTNEVMIPVE
Sbjct  169  YVLARYNPPWTLPSFKTNEVMIPVE  193



>ref|XP_002879719.1| soul heme-binding family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55978.1| soul heme-binding family protein [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 162/222 (73%), Gaps = 17/222 (8%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF +LA
Sbjct  7    TTYIMGMVFGKIVVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQVLA  66

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG-------------G  562
             YIG  G P+N KPEKIAMTAPVIT+E       IAMTAPV+TK               G
Sbjct  67   KYIGVFGKPENEKPEKIAMTAPVITKEGEK----IAMTAPVITKESEKIVMTSPVVTKEG  122

Query  561  GEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
            GEG  K VTMQF+LPS Y +AEEAP+P DERV I+E G RKYGVVKFSGTA+D VV EKV
Sbjct  123  GEGGKKMVTMQFLLPSMYKKAEEAPRPTDERVVIREEGGRKYGVVKFSGTASDSVVSEKV  182

Query  381  EMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            + L   LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  183  KKLTSDLEKDGFKITGDFILARYNPPWTLPPFRTNEVMIPVE  224



>ref|XP_008350504.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Malus domestica]
Length=202

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+H+ A YEIRQYPP+V+A+ TY P+  +G+KDGGF +LANYIG
Sbjct  1    MGMVFGKICVETPKYKVLHSTALYEIRQYPPSVVAQFTYDPSDLKGDKDGGFAILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+  +  SE IAMTAPVVT+   G    K VTM+F+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITKSQNQESEMIAMTAPVVTREEKG---XKMVTMEFLLPAK  117

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP+DERV I E GERKYGVV F+G AT+KVV EKVE LK  LE+DGYKIIG+
Sbjct  118  YGKAEEAPKPVDERVVITEEGERKYGVVGFTGVATEKVVVEKVEKLKERLEKDGYKIIGD  177

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
              L RYNPPWTLPP +TNEV+IP+E
Sbjct  178  HLLARYNPPWTLPPFRTNEVLIPIE  202



>emb|CDX74922.1| BnaA05g06680D [Brassica napus]
Length=230

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = -1

Query  879  SFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLAN  700
            ++ MGM+ GKI+VETPKY V+ +   YEIR+YPPAV AE+TY P++F+ N+DGGFT+LA 
Sbjct  29   AYIMGMVFGKISVETPKYTVVKSCDGYEIREYPPAVAAEITYDPSEFKDNRDGGFTVLAK  88

Query  699  YIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFIL  520
            YIG  G P+N KPEKIAMTAPVIT+E       IAMTAPVVTK  GGE   K VTMQF+L
Sbjct  89   YIGVFGKPENQKPEKIAMTAPVITKEGEK----IAMTAPVVTKEEGGE--KKTVTMQFLL  142

Query  519  PSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKI  340
            P  Y +AE+AP+P DERV IKE G RKYGVV F G A + VV EKV+ L+  LERDG+KI
Sbjct  143  PEVYKKAEDAPRPTDERVVIKEEGGRKYGVVTFGGNAAESVVGEKVKKLRSDLERDGFKI  202

Query  339  IGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             G++ L RYNPPWTLPP KTNEVMIPVE
Sbjct  203  TGDYVLARYNPPWTLPPFKTNEVMIPVE  230



>emb|CDY14500.1| BnaC03g20950D [Brassica napus]
Length=193

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 153/205 (75%), Gaps = 12/205 (6%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK+ V+ +   YEIR+YPPAV AEVTY P++F+G+KDGGF +LA YIG
Sbjct  1    MGMVFGKIAVETPKHTVVKSGDGYEIREYPPAVAAEVTYDPSEFKGDKDGGFMVLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              G P+N KPEKIAMTAP            IAMTAPVVTK GGG  E K VTMQF+LP  
Sbjct  61   VFGKPENQKPEKIAMTAP------------IAMTAPVVTKEGGGGDEKKTVTMQFLLPEV  108

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP P DERV IKE G RKYGVVKFSGTA +  V EKV  L+  LERDG+KI G+
Sbjct  109  YKKAEDAPLPTDERVVIKEEGGRKYGVVKFSGTAAEGAVSEKVNKLRSDLERDGFKITGD  168

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLPP KTNEVMIPVE
Sbjct  169  YVLARYNPPWTLPPFKTNEVMIPVE  193



>ref|XP_010044055.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Eucalyptus grandis]
Length=205

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 165/210 (79%), Gaps = 10/210 (5%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG +LG+I+VETPKY+V+ ++AEYEIR Y PAV+AEVTY P+Q  G++DGGF +LA+YIG
Sbjct  1    MGSVLGRISVETPKYQVLSSSAEYEIRHYAPAVVAEVTYTPSQLDGSRDGGFRVLADYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESK-----AVTMQF  526
            ALGNP+NAKPEKIAMTAPVIT+        IAMTAPV+T+G  G G        AVTM+F
Sbjct  61   ALGNPKNAKPEKIAMTAPVITKSEK-----IAMTAPVITQGPPGGGGGGGEEEEAVTMRF  115

Query  525  ILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGY  346
            +LP+KY  AEEAPKPLDERV ++E   RKYGVV+F G AT+ V  EK E L+  LERDG+
Sbjct  116  VLPAKYGSAEEAPKPLDERVVVREEEGRKYGVVRFGGVATEGVATEKAERLREWLERDGH  175

Query  345  KIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            K+ GEF L RYNPPWT+PPL+TNEVMIP+E
Sbjct  176  KVAGEFVLARYNPPWTVPPLRTNEVMIPIE  205



>gb|EEC71815.1| hypothetical protein OsI_04454 [Oryza sativa Indica Group]
Length=216

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 166/222 (75%), Gaps = 23/222 (10%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKITVETPK+EV+H  A YE+R+YPP V+AEVTY P + +G++DGGFT+L NYIG
Sbjct  1    MGMVLGKITVETPKHEVLHTGAGYEVRKYPPCVVAEVTYDPAEMKGDRDGGFTVLGNYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKG-----------------GG  562
            ALGNPQN KPEKI MTAPVIT   S   E IAMTAPV+T G                 G 
Sbjct  61   ALGNPQNTKPEKIDMTAPVIT---SGEPESIAMTAPVITSGEPEPVAMTAPVITAEERGQ  117

Query  561  GEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
            G+G+   +TMQF+LPSKY++ EEAP+P DERV +++ GERKYGVV+FSG   DK V+EK 
Sbjct  118  GKGQ---MTMQFLLPSKYSKVEEAPRPTDERVVLRQVGERKYGVVRFSGLTGDKAVKEKA  174

Query  381  EMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            E LK  LE+DG+ + G F L RYNPP+TLPPL+TNEVM+PVE
Sbjct  175  EWLKAALEKDGFTVKGPFVLARYNPPFTLPPLRTNEVMVPVE  216



>ref|NP_001044817.1| Os01g0850900 [Oryza sativa Japonica Group]
 dbj|BAB92846.1| SOUL heme-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF06731.1| Os01g0850900 [Oryza sativa Japonica Group]
 dbj|BAG88877.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95764.1| unnamed protein product [Oryza sativa Japonica Group]
Length=216

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 166/222 (75%), Gaps = 23/222 (10%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKITVETPK+EV+H  A YE+R+YPP V+AEVTY P + +G++DGGFT+L NYIG
Sbjct  1    MGMVLGKITVETPKHEVLHTGAGYEVRKYPPCVVAEVTYDPAEMKGDRDGGFTVLGNYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKG-----------------GG  562
            ALGNPQN KPEKI MTAPVIT   S   E IAMTAPV+T G                   
Sbjct  61   ALGNPQNTKPEKIDMTAPVIT---SGEPESIAMTAPVITSGEPEPVAMTAPVITAEERSQ  117

Query  561  GEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
            G+G+   +TMQF+LPSKY++ EEAP+P DERV +++ GERKYGVV+FSG   DKVV+EK 
Sbjct  118  GKGQ---MTMQFLLPSKYSKVEEAPRPTDERVVLRQVGERKYGVVRFSGLTGDKVVKEKA  174

Query  381  EMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            E LK  LE+DG+ + G F L RYNPP+TLPPL+TNEVM+PVE
Sbjct  175  EWLKAALEKDGFTVKGPFVLARYNPPFTLPPLRTNEVMVPVE  216



>gb|KHM98940.1| Heme-binding-like protein, chloroplastic [Glycine soja]
Length=203

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 164/205 (80%), Gaps = 2/205 (1%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKI+VET KYEVI + +EYEIR+Y P+V+AEVTY P+QF+GNKDGGF +LANYIG
Sbjct  1    MGLVFGKISVETAKYEVIKSTSEYEIRKYAPSVVAEVTYDPSQFKGNKDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A+G PQN KPEKIAMTAPVIT++S     E+  T     +G  G   +K VTMQF+LP+ 
Sbjct  61   AVGKPQNTKPEKIAMTAPVITKDSVGGDGEV--TKEGGGEGEEGNKNNKMVTMQFVLPAV  118

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP DERV I+E GERKYGVVKF G A+++VV EKVE L+  LE+DG+K++G+
Sbjct  119  YGKAEEAPKPTDERVVIREEGERKYGVVKFGGVASEQVVREKVEKLRESLEKDGFKVVGD  178

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F LGRYNPPWT+P  +TNEVMIPVE
Sbjct  179  FLLGRYNPPWTIPAFRTNEVMIPVE  203



>ref|XP_004970594.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Setaria italica]
Length=221

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 168/221 (76%), Gaps = 16/221 (7%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKITVETPK+EV+H  A YEIR+YPP V AE TY P +++G+ DGGFT+LANYIG
Sbjct  1    MGMVLGKITVETPKHEVLHTGAGYEIRRYPPCVAAEFTYDPKEWKGDPDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRes---sssseEIAMTAPVVTKGGGGE----------GE  550
            ALG PQN KPEKIAMTAPVIT  +    +SSE+IAMTAPV+T GG  E           +
Sbjct  61   ALGKPQNTKPEKIAMTAPVITSGAGDGEASSEKIAMTAPVITTGGEPEPVAMTAPVITDD  120

Query  549  SKA---VTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVE  379
             +A   VTMQF+LPSKYA+AE+AP+P DERV I+E  ERKYGV +FSG A +K V EK E
Sbjct  121  QQAPGKVTMQFLLPSKYAKAEDAPRPTDERVVIREVPERKYGVARFSGVAAEKTVREKAE  180

Query  378  MLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             L+  LE+DGY + G F L RYNPP+TLPPL+TNEVMIPVE
Sbjct  181  GLRAALEKDGYTVKGPFVLARYNPPFTLPPLRTNEVMIPVE  221



>emb|CDX91419.1| BnaC04g07310D [Brassica napus]
Length=201

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKI+VETPKY V+ +   YEIR+YPPAV AE+TY P++F+ NKDGGF++LA YIG
Sbjct  1    MGIVFGKISVETPKYTVVKSGDGYEIREYPPAVAAEITYDPSEFKDNKDGGFSVLAKYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              G P+N KPEKIAMTAPVIT+E       IAMTAPVVTK  GG GE K VTMQF+LP  
Sbjct  61   VFGKPENQKPEKIAMTAPVITKEGEK----IAMTAPVVTKEEGGGGEKKTVTMQFLLPEV  116

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP+P DERV I+E G RKYGVV FSGTA + VV EKVE L+  LERDG+KI G+
Sbjct  117  YKKAEDAPRPTDERVVIREEGGRKYGVVTFSGTAAESVVGEKVEKLRSDLERDGFKITGD  176

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWTLPP KTNEVMIPVE
Sbjct  177  YVLARYNPPWTLPPFKTNEVMIPVE  201



>ref|XP_006295430.1| hypothetical protein CARUB_v10024529mg [Capsella rubella]
 gb|EOA28328.1| hypothetical protein CARUB_v10024529mg [Capsella rubella]
Length=225

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 161/219 (74%), Gaps = 10/219 (5%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF +LA
Sbjct  7    KAYIMGMVFGKIVVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQVLA  66

Query  702  NYIGALGNPQNAKPEKIAMTAPVITR----------essssseEIAMTAPVVTKGGGGEG  553
             YIG  G P+N KPE IAMTAPVIT+            +  SE+I MT+PVVTK GG +G
Sbjct  67   KYIGVFGKPENEKPETIAMTAPVITKEGEKIAMTAPVITKESEKIEMTSPVVTKEGGEQG  126

Query  552  ESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEML  373
              K VTMQF+LPS Y + EEAP+P D RV I+E G RKYGVVKFSGTA++ VV EKV+ L
Sbjct  127  GKKMVTMQFLLPSIYTKPEEAPRPTDARVVIREEGGRKYGVVKFSGTASESVVSEKVKKL  186

Query  372  KRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
               LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  187  TSDLEKDGFKINGDFVLARYNPPWTLPPFRTNEVMIPVE  225



>gb|EMT00657.1| hypothetical protein F775_29949 [Aegilops tauschii]
Length=224

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 156/217 (72%), Gaps = 14/217 (6%)
 Frame = -1

Query  864  MILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGAL  685
            ++LGKI VETPK+EV+H    YEIR+YPP V AEVTY P + +G++DGGF +LANYIGA 
Sbjct  8    LMLGKIIVETPKHEVLHTGDGYEIRKYPPCVAAEVTYDPKEMKGDRDGGFQVLANYIGAF  67

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTK--------------GGGGEGES  547
            G PQN KPE IAMTAPVIT      +E IAMTAPV+T                 G E ++
Sbjct  68   GKPQNTKPEAIAMTAPVITSSGGGEAEPIAMTAPVITSSEPEPVAMTVPVLTAEGREEQA  127

Query  546  KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKR  367
              VTMQF+LPSKYA+AEEAP+P DERV ++E GERKY VV FSG A DKVV EK E LK 
Sbjct  128  GKVTMQFLLPSKYAKAEEAPRPTDERVVLREVGERKYAVVTFSGLAGDKVVAEKAEGLKA  187

Query  366  CLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             L++DG+ + G F L RYNPPWTLPPL+TNEVM PVE
Sbjct  188  ALQKDGHAVTGPFVLSRYNPPWTLPPLRTNEVMFPVE  224



>gb|EPS74387.1| hypothetical protein M569_00369, partial [Genlisea aurea]
Length=197

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++LGKI+VETPKYE++ A  +YEIRQYPPAVIAEVTY P  +  +KD GF LL +YIG
Sbjct  1    MGLMLGKISVETPKYEILAATDDYEIRQYPPAVIAEVTYDPADWNSDKDAGFKLLTDYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A G P+N KPE IAMTAPV+T+ +   S  IAMTAPVVTK GG       VTM FILPS+
Sbjct  61   AFGKPKNQKPESIAMTAPVLTKAAQGES--IAMTAPVVTKRGG-----DLVTMAFILPSR  113

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP P+DERV I+E G +KY  V+FSG A+++VV  KVE LK  L RDGY I G+
Sbjct  114  YEKAEDAPVPVDERVAIREEGAKKYAAVRFSGVASERVVAAKVEKLKIDLLRDGYVIAGD  173

Query  330  FELGRYNPPWTLPPLKTNEVMIPV  259
            F L RYNPP+TLPPL+TNEVMIPV
Sbjct  174  FVLARYNPPFTLPPLRTNEVMIPV  197



>ref|XP_002456642.1| hypothetical protein SORBIDRAFT_03g039990 [Sorghum bicolor]
 gb|EES01762.1| hypothetical protein SORBIDRAFT_03g039990 [Sorghum bicolor]
Length=220

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 160/220 (73%), Gaps = 15/220 (7%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKITVETPK+EV+H  A YEIR+YPP + AE TY P +++GN DGGFT+LANYIG
Sbjct  1    MGMVLGKITVETPKHEVLHTGAGYEIRKYPPCIAAEFTYDPKEWKGNPDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITR---essssseEIAMTAPVVTKG------------GGGE  556
            ALG PQN KPEKIAMTAPVIT    +   S+E+IAMTAPV+T G               +
Sbjct  61   ALGKPQNTKPEKIAMTAPVITTGGGDDGESAEKIAMTAPVITTGEPEPVAMTAPVITDDQ  120

Query  555  GESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEM  376
                 VTMQF+LPSKY + EEAP+P DERV I+E  ERK+GV +FSG AT+K V  K E 
Sbjct  121  QAPGKVTMQFLLPSKYTKVEEAPRPTDERVVIREVPERKFGVARFSGVATEKAVRAKAEG  180

Query  375  LKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            LK  LE+DGY I G F L RYNPP+TLPPL+TNEVM PVE
Sbjct  181  LKAALEKDGYAIKGPFVLARYNPPFTLPPLRTNEVMFPVE  220



>ref|XP_006646483.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Oryza brachyantha]
Length=231

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 162/232 (70%), Gaps = 29/232 (13%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++LGKITVE PK+EV+H  A YE+R+ PP V AEVTY P + +G++DGGFT+LANYIG
Sbjct  1    MGIVLGKITVEMPKHEVVHTGAGYEVRKSPPCVAAEVTYDPAEMKGDRDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssse------------EIAMTAPVVTKGG------  565
            ALG PQN KPEKI MTAPVIT     S               IAMTAPV+TK G      
Sbjct  61   ALGRPQNTKPEKIDMTAPVITSGEPESIAMTAPVITSGEPESIAMTAPVITKAGEPEPVA  120

Query  564  ----------GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSG  415
                      GG+   K + MQF+LPSKY++AEEAP+P DERV ++E GERKYGVV+FSG
Sbjct  121  MTAPVITADEGGKAGGKMI-MQFLLPSKYSKAEEAPRPTDERVVLREVGERKYGVVRFSG  179

Query  414  TATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
               DKVV+EK E LK  LE+DG+ + G F L RYNPP+TLPPL+TNE+MIPV
Sbjct  180  LTGDKVVKEKAEWLKAALEKDGFAVKGPFVLARYNPPFTLPPLRTNEIMIPV  231



>emb|CDX93337.1| BnaC04g45590D [Brassica napus]
Length=237

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 165/237 (70%), Gaps = 23/237 (10%)
 Frame = -1

Query  897  LHNILN-SFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG  721
            + N+   ++ MGM+ GKI VETPKY V  +   YE+R+YPPAV AEVTY P++F+G+KDG
Sbjct  1    MGNVFGKTYIMGMVFGKIVVETPKYTVAKSGDGYEVREYPPAVSAEVTYDPSEFKGDKDG  60

Query  720  GFTLLANYIGALGNPQNAK-----------PEKIAMTAPVITRessssseE---------  601
            GF +LA YIG  G P+N K            EKIAMT+PVIT+E    +           
Sbjct  61   GFQVLAKYIGVFGKPENQKIAMASPVVATEGEKIAMTSPVITKEGEKIAMTSPVITKEGE  120

Query  600  -IAMTAPVVTKG-GGGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVV  427
             IAMT+PVVTK  GGGE + K VTMQF+LP  Y RAE+AP+P DERV I+E G RKYGVV
Sbjct  121  KIAMTSPVVTKEVGGGERKKKTVTMQFLLPEMYKRAEDAPRPTDERVVIREEGGRKYGVV  180

Query  426  KFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             FSGTA + VV EKV+ L   LERDG+KI+GEF L RYNPPWTLPP +TNEV+IPVE
Sbjct  181  TFSGTAGEGVVSEKVKKLTNDLERDGFKIVGEFVLARYNPPWTLPPFRTNEVLIPVE  237



>emb|CBH32522.1| SOUL heme-binding domain containing protein,expressed [Triticum 
aestivum]
Length=220

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 154/217 (71%), Gaps = 14/217 (6%)
 Frame = -1

Query  864  MILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGAL  685
            ++LGKI VETPK+EV+H    YEIR+YPP V AEVTY P + +G++DGGF +LANYIGA 
Sbjct  4    LMLGKIIVETPKHEVLHTGDGYEIRKYPPCVAAEVTYDPKEMKGDRDGGFQVLANYIGAF  63

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTK--------------GGGGEGES  547
            G PQN KPE IAMTAPVIT      +E IAMTAPV+T                 G E ++
Sbjct  64   GKPQNTKPEAIAMTAPVITSSGGGEAEPIAMTAPVITSSEPEPVAMTVPVITAEGREEKA  123

Query  546  KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKR  367
              VTMQF+LPSKY +AEEAP+P DERV ++E GERKY VV F G A DKVV EK E LK 
Sbjct  124  SKVTMQFLLPSKYTKAEEAPRPTDERVVLREVGERKYAVVTFGGLAGDKVVAEKAEGLKA  183

Query  366  CLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             LE+DG+ + G F L RYNPPWTLPPL+TNEVM PV+
Sbjct  184  ALEKDGHAVTGPFVLSRYNPPWTLPPLRTNEVMFPVK  220



>ref|XP_010509244.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Camelina sativa]
Length=249

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 160/226 (71%), Gaps = 21/226 (9%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF +LA
Sbjct  28   KTYIMGMVFGKIVVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQVLA  87

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG--------------  565
             YIG  G P+N KPE IAMTAPVIT+E       IAMTAPV+TK                
Sbjct  88   KYIGVFGKPENEKPETIAMTAPVITKEGEK----IAMTAPVITKESEKIEMTSPVVTKEE  143

Query  564  ---GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVV  394
                G G+ K VTMQF+LPSKY +AEEAP+P DERV I+E G RKYGVVKFSGT ++ VV
Sbjct  144  GDGHGGGKKKMVTMQFLLPSKYTKAEEAPRPTDERVVIREEGGRKYGVVKFSGTTSESVV  203

Query  393  EEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             EKV+ L   LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  204  SEKVKKLTSDLEKDGFKITGDFVLARYNPPWTLPPFRTNEVMIPVE  249



>ref|XP_010505403.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Camelina sativa]
 ref|XP_010505406.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010505407.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X2 [Camelina sativa]
Length=247

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 162/225 (72%), Gaps = 20/225 (9%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF +LA
Sbjct  27   KTYIMGMVFGKIVVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQVLA  86

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG--------------  565
             YIG  G P+N KPE IAMTAPVIT+E       IAMTAPV+TK                
Sbjct  87   KYIGVFGKPENEKPETIAMTAPVITKEGEK----IAMTAPVITKESEKIEMTSPVVTKEE  142

Query  564  --GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVE  391
              GG G++K VTMQF+LPSKY +AEEAP+P DERV I+E G RKYGVVKFSGT ++ VV 
Sbjct  143  GGGGGGKTKMVTMQFLLPSKYTKAEEAPRPTDERVVIREEGGRKYGVVKFSGTTSESVVS  202

Query  390  EKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            +KV+ L   LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  203  DKVKKLTSDLEKDGFKITGDFVLARYNPPWTLPPFRTNEVMIPVE  247



>ref|XP_010509243.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Camelina sativa]
Length=249

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 160/226 (71%), Gaps = 21/226 (9%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF +LA
Sbjct  28   KTYIMGMVFGKIVVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQVLA  87

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG--------------  565
             YIG  G P+N KPE IAMTAPVIT+E       IAMTAPV+TK                
Sbjct  88   KYIGVFGKPENEKPETIAMTAPVITKEGEK----IAMTAPVITKESEKIEMTSPVVTKEE  143

Query  564  ---GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVV  394
                G G+ K VTMQF+LPSKY +AEEAP+P DERV I+E G RKYGVVKFSGT ++ VV
Sbjct  144  GDGHGGGKKKMVTMQFLLPSKYTKAEEAPRPTDERVVIREEGGRKYGVVKFSGTTSESVV  203

Query  393  EEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             EKV+ L   LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  204  SEKVKKLTSDLEKDGFKITGDFILARYNPPWTLPPFRTNEVMIPVE  249



>gb|KFK36697.1| hypothetical protein AALP_AA4G157400 [Arabis alpina]
Length=227

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 165/229 (72%), Gaps = 17/229 (7%)
 Frame = -1

Query  897  LHNIL-NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG  721
            + NI   ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AE+TY P++F+G+KDG
Sbjct  1    MGNIFGKTYIMGMVFGKIVVETPKYTVTKSNDGYEIREYPPAVAAELTYDPSEFKGDKDG  60

Query  720  GFTLLANYIGALGNPQNAK----PEKIAMTAPVITRes----------sssseEIAMTAP  583
            GF +LA YIG  G P+N K     EKIAMTAPVIT+E           +  SE+I MT+P
Sbjct  61   GFQVLAKYIGVFGKPENEKITKEGEKIAMTAPVITKECEKIAMTSPVITKESEKIEMTSP  120

Query  582  VVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATD  403
            VVTK GGG    K VTMQF+LP  Y +AE+AP+P DERVKI+E   RKYGVVKFSGTA +
Sbjct  121  VVTKEGGGG--KKMVTMQFLLPEIYKKAEDAPRPTDERVKIREEEGRKYGVVKFSGTAAE  178

Query  402  KVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             VV EKV+ L   LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPVE
Sbjct  179  TVVSEKVKKLSSDLEKDGFKITGDFILARYNPPWTLPPFRTNEVMIPVE  227



>gb|ACG28868.1| hypothetical protein [Zea mays]
Length=225

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 160/220 (73%), Gaps = 18/220 (8%)
 Frame = -1

Query  864  MILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGAL  685
            M+LGKI VETPK+EV+H  A YEIR+YPP++ AE+TY P + RG+ DGGFT+LANYIG L
Sbjct  7    MVLGKIPVETPKHEVLHTGAGYEIRKYPPSIAAELTYDPKEMRGDPDGGFTVLANYIGVL  66

Query  684  GNPQNAKPEKIAMTAPVITRessssse--EIAMTAPVVTKGGGGEGESKA----------  541
            G PQN KPEKIAMTAPVIT  S S  +  +IAMTAPV+T GGG E E  A          
Sbjct  67   GKPQNTKPEKIAMTAPVITTGSGSGGDGEKIAMTAPVITTGGG-EPEPIAMTAPVITDDQ  125

Query  540  -----VTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEM  376
                 VTMQF+LPSKY R EEAP+P DERV I+E  ERK+GV +FSG ATD+ V EK + 
Sbjct  126  QAPGKVTMQFLLPSKYTRVEEAPRPTDERVVIREVPERKFGVARFSGVATDRTVREKAKG  185

Query  375  LKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            LK  LE+DGY I G F L RYNP +TLPPL+TNEVM PVE
Sbjct  186  LKAALEKDGYTIKGPFVLARYNPSFTLPPLRTNEVMFPVE  225



>ref|NP_001142199.1| uncharacterized protein LOC100274367 [Zea mays]
 gb|ACF87870.1| unknown [Zea mays]
 gb|AFW84572.1| hypothetical protein ZEAMMB73_663614 [Zea mays]
Length=225

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 161/222 (73%), Gaps = 18/222 (8%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            +GM+LGKI VETPK+EV+H  A YEIR+YPP++ AE+TY P + RG+ DGGFT+LANYIG
Sbjct  5    LGMVLGKIPVETPKHEVLHTGAGYEIRKYPPSIAAELTYDPKEMRGDPDGGFTVLANYIG  64

Query  690  ALGNPQNAKPEKIAMTAPVITRessssse--EIAMTAPVVTKGGGGEGESKA--------  541
             LG PQN KPEKIAMTAPVIT  S S  +  +IAMTAPV+T GGG E E  A        
Sbjct  65   VLGKPQNTKPEKIAMTAPVITTGSGSGGDGEKIAMTAPVITTGGG-EPEPIAMTAPVITD  123

Query  540  -------VTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
                   VTMQF+LPSKY R EEAP+P DERV I+E  ERK+GV +FSG ATD+ V EK 
Sbjct  124  DQQAPGKVTMQFLLPSKYTRVEEAPRPTDERVVIREVPERKFGVARFSGVATDRTVREKA  183

Query  381  EMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            + LK  LE+DGY I   F L RYNP +TLPPL+TNEVM PVE
Sbjct  184  KGLKAALEKDGYTIKVPFVLARYNPSFTLPPLRTNEVMFPVE  225



>ref|XP_010528657.1| PREDICTED: fructokinase-like 1, chloroplastic [Tarenaya hassleriana]
Length=654

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 160/205 (78%), Gaps = 8/205 (4%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETP+Y+V+ +   YE+R+YPPAV+AE TY P++F+GNKDGGFT+LANYIG
Sbjct  1    MGMVFGKIGVETPEYKVVKSGDGYEVREYPPAVVAEFTYDPSEFKGNKDGGFTVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG P N KPEKIAMTAPVIT+E       I MTAPVVTK GGG    K VTMQF+LP+K
Sbjct  61   ALGKPHNEKPEKIAMTAPVITKEGEK----IEMTAPVVTKEGGG----KTVTMQFVLPAK  112

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y  AEEAP+P +ERV IK  G R+YGVV+FSG AT+ VV+EK E L+  LER+G K+ G+
Sbjct  113  YKTAEEAPRPTEERVVIKAEGGRRYGVVRFSGVATEAVVKEKAEKLRTDLEREGVKVTGD  172

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
              L RYNPPWTLP  +TNEVMIP++
Sbjct  173  LVLARYNPPWTLPWCRTNEVMIPIQ  197



>ref|XP_010517079.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Camelina sativa]
Length=248

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 160/225 (71%), Gaps = 21/225 (9%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YEIR+YPPAV AEVTY  ++F+G+KDGGF +LA
Sbjct  27   KTYIMGMVFGKIVVETPKYTVTKSGDGYEIREYPPAVAAEVTYDASEFKGDKDGGFQVLA  86

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG--------------  565
             YIG  G P+N KPE IAMTAPVIT+E       IAMTAPV+TK                
Sbjct  87   KYIGVFGKPENEKPETIAMTAPVITKEGEK----IAMTAPVITKESEKIEMTSPVVTKEE  142

Query  564  ---GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVV  394
               GG G+ K VTMQF+LPSKY +AEEAP+P DERV I+E G RKYGVVKFSGT ++ VV
Sbjct  143  GGGGGGGKKKMVTMQFLLPSKYTKAEEAPRPTDERVVIREEGGRKYGVVKFSGTTSESVV  202

Query  393  EEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
             EKV+ L   LE+DG+KI G+F L RYNPPWTLPP +TNEVMIPV
Sbjct  203  SEKVKKLTSDLEKDGFKITGDFILARYNPPWTLPPFRTNEVMIPV  247



>ref|XP_003564620.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Brachypodium distachyon]
Length=225

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 155/221 (70%), Gaps = 21/221 (10%)
 Frame = -1

Query  864  MILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGAL  685
            M+LGKI VETPK+EV+H  A YEIR+YPP V AEV Y P   +G+ DGGF +LA YIG  
Sbjct  8    MMLGKIVVETPKHEVLHTGAGYEIRKYPPCVAAEVVYDPKDMKGDPDGGFQVLAAYIGVF  67

Query  684  GNPQNAKPEKIAMTAPVITRessssseE------------------IAMTAPVVTKGGGG  559
            G PQN KPEKIAMT+PVIT  SS   +                   +AMTAPV+T  GG 
Sbjct  68   GKPQNTKPEKIAMTSPVITSASSGPGKAEEISMTAPVITSSVEPEPVAMTAPVITADGG-  126

Query  558  EGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVE  379
               +  VTMQF+LPSKY++AEEAPKP DERV +++ GERKYGVV FSG A +KVV EK E
Sbjct  127  --NNNKVTMQFLLPSKYSKAEEAPKPTDERVVLRDVGERKYGVVTFSGLAGEKVVAEKAE  184

Query  378  MLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             LK  LE+DG+ + G F L RYNPPWTLPPL+TNEVMIPVE
Sbjct  185  GLKAALEKDGHVVKGPFVLSRYNPPWTLPPLRTNEVMIPVE  225



>gb|ACF86103.1| unknown [Zea mays]
Length=225

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 160/222 (72%), Gaps = 18/222 (8%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            +GM+LGKI VETPK+EV+H  A YEIR+YPP++ AE+TY P + RG+ DGGFT+LANYIG
Sbjct  5    LGMVLGKIPVETPKHEVLHTGAGYEIRKYPPSIAAELTYDPKEMRGDPDGGFTVLANYIG  64

Query  690  ALGNPQNAKPEKIAMTAPVITRessssse--EIAMTAPVVTKGGGGEGESKA--------  541
             LG PQN KPEKIAMTAPVIT  S S  +  +IAMTAPV+T  GGGE E  A        
Sbjct  65   VLGKPQNTKPEKIAMTAPVITTGSGSGGDGEKIAMTAPVITT-GGGEPEPIAMTAPVITD  123

Query  540  -------VTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
                   VTMQF+LPSKY R EEAP+P DERV I+E  ERK GV +FSG ATD+ V EK 
Sbjct  124  DQQAPGKVTMQFLLPSKYTRVEEAPRPTDERVVIREVPERKSGVARFSGVATDRTVREKA  183

Query  381  EMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            + LK  LE+DGY I   F L RYNP +TLPPL+TNEVM PVE
Sbjct  184  KGLKAALEKDGYTIKVPFVLARYNPSFTLPPLRTNEVMFPVE  225



>gb|KDP24508.1| hypothetical protein JCGZ_25072 [Jatropha curcas]
Length=425

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 157/190 (83%), Gaps = 5/190 (3%)
 Frame = -1

Query  825  EVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAKPEKIAM  646
            E+I  + EYEIR+YPP V+AE TY P+Q +GNKDGGF +LANYIGA+GNP N+KPEKIAM
Sbjct  241  EIIQTSTEYEIRKYPPQVLAEYTYDPSQLKGNKDGGFMVLANYIGAVGNPHNSKPEKIAM  300

Query  645  TAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLDERV  466
            TAPVIT+ SS     IAMTAPVVTK  G E   K VTMQF+LP+KY +AEEAPKP D+RV
Sbjct  301  TAPVITKTSSEK---IAMTAPVVTKESGEE--KKMVTMQFLLPAKYKKAEEAPKPTDDRV  355

Query  465  KIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPL  286
             IKE GERKYGVVKF G AT+KVVEEKVE LK+ LERDGYK+IGEF L RYNPPWTLPP 
Sbjct  356  VIKEEGERKYGVVKFGGVATEKVVEEKVEKLKKSLERDGYKVIGEFVLARYNPPWTLPPC  415

Query  285  KTNEVMIPVE  256
            +TNEVMIP+E
Sbjct  416  RTNEVMIPIE  425


 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 155/184 (84%), Gaps = 5/184 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG+ILGKITVETPKYE+I  + EYEIR+YPP V+AE TY P+Q +GNKDGGF +LANYIG
Sbjct  1    MGLILGKITVETPKYEIIQTSTEYEIRKYPPQVLAEYTYDPSQLKGNKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A+GNP N+KPEKIAMTAPVIT+   +SSE+IAMTAPVVTK  G   E K VTMQF+LP+K
Sbjct  61   AVGNPHNSKPEKIAMTAPVITK---TSSEKIAMTAPVVTKESG--EEKKMVTMQFLLPAK  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AEEAPKP D+RV IKE GERKYGVVKF G AT+KVVEEKVE LK+ LERDGYK+IGE
Sbjct  116  YKKAEEAPKPTDDRVVIKEEGERKYGVVKFGGVATEKVVEEKVEKLKKSLERDGYKVIGE  175

Query  330  FELG  319
            F L 
Sbjct  176  FVLA  179



>emb|CDY18413.1| BnaA04g21740D [Brassica napus]
Length=265

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 166/265 (63%), Gaps = 51/265 (19%)
 Frame = -1

Query  897  LHNIL-NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG  721
            + N+   ++ MGM+ GKI VETPKY V  +   YE+RQYPPAV AEVTY P++F+G++DG
Sbjct  1    MGNVFGKTYIMGMVFGKIVVETPKYTVSKSGDGYEVRQYPPAVSAEVTYDPSEFKGDRDG  60

Query  720  GFTLLANYIGALGNPQNAK-----------PEKIAMTAPVITRessssseE---------  601
            GF +LA YIG  G P+N K            EKIAMT+PVIT+E    +           
Sbjct  61   GFQVLAKYIGVFGKPENQKIAMTAPVVTTEGEKIAMTSPVITKEGEKIAMTSPVITKKGE  120

Query  600  -IAMTAPVVTKGG-----------------------------GGEGESKAVTMQFILPSK  511
             IAMT+PV+TK G                             GGE + K VTMQF+LP  
Sbjct  121  KIAMTSPVITKEGEKIEMTSPVITKEGEKIAMTSPVATKEVGGGERKKKTVTMQFLLPEM  180

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y RAE+AP+P DERV I+E G RKYGVV FSGTA + VV EKV+ L+  LERDG+KI+GE
Sbjct  181  YKRAEDAPRPTDERVVIREEGGRKYGVVTFSGTAGESVVSEKVKKLRSDLERDGFKIVGE  240

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPP +TNEVMIPVE
Sbjct  241  FVLARYNPPWTLPPFRTNEVMIPVE  265



>gb|EYU41820.1| hypothetical protein MIMGU_mgv1a014154mg [Erythranthe guttata]
Length=199

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 149/205 (73%), Gaps = 6/205 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPKY+V+ +  +YEIRQYPPAV+AE+TY P Q + +KD GF +LANYIG
Sbjct  1    MGMVFGKIGVETPKYDVVSSNNDYEIRQYPPAVVAEITYDPAQLKNDKDAGFPILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A G  QN K E IAMT PVIT+    S + IAMT PVVTK GG     + VTM FILPS 
Sbjct  61   AFGKAQNTKAESIAMTTPVITKAPPPSEK-IAMTVPVVTKSGG-----ELVTMGFILPST  114

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y +AE+AP+P+DERV I+E   +KY VV FSG A +KVV EKV+ L   LERDG K  G+
Sbjct  115  YVKAEDAPRPVDERVVIREEEGKKYAVVTFSGVAGEKVVAEKVKKLTEFLERDGCKAAGD  174

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            F L RYNPPWTLPP + NEV IPVE
Sbjct  175  FVLARYNPPWTLPPFRKNEVRIPVE  199



>ref|XP_009141708.1| PREDICTED: uncharacterized protein LOC103865641 [Brassica rapa]
Length=297

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 169/283 (60%), Gaps = 65/283 (23%)
 Frame = -1

Query  909  SRSLLHNIL-NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRG  733
            +RS + N+   ++ MGM+ GKI VETPKY V  +   YE+RQYPPAV AEVTY P++F+G
Sbjct  15   NRSTMGNVFGKTYIMGMVFGKIVVETPKYTVSKSGNGYEVRQYPPAVSAEVTYDPSEFKG  74

Query  732  NKDGGFTLLANYIGALGNPQNAK-------------------------PEKIAMTAPVIT  628
            ++DGGF +LA YIG  G P+N K                          EKIAMT+PVIT
Sbjct  75   DRDGGFQVLAKYIGVFGKPENQKIAMTAPVVTTEGEKITMTSPVITKEGEKIAMTSPVIT  134

Query  627  RessssseE------------------------IAMTAPVVTK---------------GG  565
            +E    S                          IAMT+PV+TK               GG
Sbjct  135  KEGEKISMTSPVITKEGEKIAMTPPVITKEGEKIAMTSPVITKEGEKIAMTSPVVTKEGG  194

Query  564  GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEK  385
            GGE + K VTMQF+L  KY RAE+AP+P DERV I+E G RKYGVV FSGTA + VV EK
Sbjct  195  GGERKKKTVTMQFLLREKYKRAEDAPRPTDERVVIREEGGRKYGVVTFSGTAGESVVSEK  254

Query  384  VEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            V+ L   LERDG+KI+GEF L RYNPPWTLPP +TNEVMIPVE
Sbjct  255  VKKLTSDLERDGFKIVGEFVLARYNPPWTLPPFRTNEVMIPVE  297



>ref|XP_003604820.1| Heme-binding-like protein [Medicago truncatula]
 gb|AES87017.1| SOUL heme-binding family protein [Medicago truncatula]
Length=201

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 158/206 (77%), Gaps = 6/206 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ G+ + ETPKYE++     Y IR+Y P+++AE+TY P+ F+G+KDGGF +L +YIG
Sbjct  1    MGLVFGRFSAETPKYEILKTTQNYVIRKYAPSLVAEITYDPSTFKGDKDGGFKVLVDYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
              G PQN K EKI+MT PVIT+E+ SSSE+IAMT PVVT       ++K VTMQF LPS 
Sbjct  61   IFGKPQNTKTEKISMTTPVITKENKSSSEKIAMTVPVVT-----NEKNKMVTMQFTLPSM  115

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y + EE PKP+DERV I+E G +KYGVV F G A+D+VV+EKVE L+ CLE+DG+K+IG+
Sbjct  116  YLKVEEVPKPIDERVVIREEGGKKYGVVTFGGVASDEVVKEKVEKLRLCLEKDGFKVIGD  175

Query  330  FELGRYNPP-WTLPPLKTNEVMIPVE  256
            F LGRYNPP  T+P  +TNEV+IPVE
Sbjct  176  FLLGRYNPPAITIPMFRTNEVLIPVE  201



>ref|XP_006410997.1| hypothetical protein EUTSA_v10017151mg [Eutrema salsugineum]
 gb|ESQ52450.1| hypothetical protein EUTSA_v10017151mg [Eutrema salsugineum]
Length=247

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 157/229 (69%), Gaps = 28/229 (12%)
 Frame = -1

Query  882  NSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLA  703
             ++ MGM+ GKI VETPKY V  +   YE+R+YPPAV AE+TY P++F+G+KDGGF +LA
Sbjct  27   KTYIMGMVFGKIAVETPKYTVTKSGDGYEVREYPPAVAAELTYDPSEFKGDKDGGFQVLA  86

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGES--------  547
             YIG  G P+N KPE IAMTAPVIT+E       IAMTAPV+TK    EGE         
Sbjct  87   KYIGVFGKPENEKPETIAMTAPVITKEGEK----IAMTAPVITK----EGEKIEMTSPVV  138

Query  546  ------------KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATD  403
                        K VT+QF+LP+ Y +AEEAP+P D RV I+E G RKYGVV FSG A +
Sbjct  139  TKEGGGGEGGKKKMVTIQFLLPAMYKKAEEAPRPTDARVVIREEGGRKYGVVTFSGRAGE  198

Query  402  KVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             VV EKV+ L   LERDG+KI G+F L R+NPPWTLPP +TNEVMIPVE
Sbjct  199  SVVSEKVKKLTSDLERDGFKITGDFVLARFNPPWTLPPFRTNEVMIPVE  247



>ref|NP_001235669.1| uncharacterized protein LOC100499762 [Glycine max]
 gb|ACU13542.1| unknown [Glycine max]
Length=206

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 164/211 (78%), Gaps = 11/211 (5%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG++ GKI+VET KYEVI + +EYEIR+Y P+V+AEVTY P+QF+GNKDGGF +LANYIG
Sbjct  1    MGLVFGKISVETAKYEVIKSTSEYEIRKYAPSVVAEVTYDPSQFKGNKDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRess-ssseEIAMTAPVVTKGGGGEGESKA-----VTMQ  529
            A+G PQN KPEKIAMTAPVIT++S     E IAMTAPVVTK GGGEGE        VTMQ
Sbjct  61   AVGKPQNTKPEKIAMTAPVITKDSVGGDGETIAMTAPVVTKEGGGEGEEGNKNNKMVTMQ  120

Query  528  FILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG  349
            F+LP+ Y +AEEAPKP DERV I+E GERKYGVVKF G A+++VV EKVE L+  LE+DG
Sbjct  121  FVLPAVYGKAEEAPKPTDERVVIREEGERKYGVVKFGGVASEQVVREKVEELRESLEKDG  180

Query  348  YKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            +K++GE +    N       ++TNEVMIPVE
Sbjct  181  FKVVGEVQSSLDN-----SCVQTNEVMIPVE  206



>gb|ABK26183.1| unknown [Picea sitchensis]
Length=212

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 154/213 (72%), Gaps = 9/213 (4%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFR-GNKDGGFTLLANYI  694
            MG +LG+I VET KYEVI   ++YEIR+Y P+V+AEVTY PTQ + G KDGGF +LANYI
Sbjct  1    MGTVLGRIGVETAKYEVIFKGSDYEIREYQPSVVAEVTYDPTQMKKGGKDGGFMILANYI  60

Query  693  GALGNPQNAKPE------KIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKA-VT  535
            GA+GNP N KPE      KIAMTAPV T ESS  S+ I MTAPV+T     + ESK  VT
Sbjct  61   GAVGNPCNIKPESQIEGEKIAMTAPVFTHESSPQSQPIVMTAPVMTAEQTTDDESKKLVT  120

Query  534  MQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLER  355
            MQF+LPS Y   E  P+P+D  V +KE   RKYGVV FSG A + +V+  V+ L++ LE 
Sbjct  121  MQFVLPSDYT-MENVPRPIDPSVSVKEVPARKYGVVTFSGVADEALVQTMVQKLRKSLED  179

Query  354  DGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             GY++ G++ LGRYNPPWTLP L+TNEVM+PVE
Sbjct  180  GGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPVE  212



>ref|XP_001755534.1| predicted protein [Physcomitrella patens]
 gb|EDQ79594.1| predicted protein [Physcomitrella patens]
Length=211

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 152/210 (72%), Gaps = 7/210 (3%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG+ILGKITVETPKY+ +    + EIR+Y PAV+AEV+Y P   +  +DGGF +LA YIG
Sbjct  1    MGIILGKITVETPKYKSVEKKGDIEIREYEPAVVAEVSYDPKSMKSGRDGGFMILARYIG  60

Query  690  ALGNPQNAKP----EKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKA-VTMQF  526
            A+G P N K     EKIAMTAPVIT+E   + + I+MTAPV+TK G G+ E+K+ VTMQF
Sbjct  61   AIGTPYNKKGSEPGEKIAMTAPVITQEHGGAEK-ISMTAPVITKDGEGDNENKSMVTMQF  119

Query  525  ILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGY  346
            +LP+ Y   E AP P D+RVK+KE   + YGV+ FSGT   K+ E++V+ LK  LE DGY
Sbjct  120  VLPASYT-LETAPTPTDDRVKLKEFPSKTYGVITFSGTVNPKLEEQQVQKLKTSLESDGY  178

Query  345  KIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            KI+G+  L RYNPPWT   LKTNEVMIPVE
Sbjct  179  KIMGDHLLARYNPPWTPWFLKTNEVMIPVE  208



>ref|XP_002973807.1| hypothetical protein SELMODRAFT_442225 [Selaginella moellendorffii]
 gb|EFJ24762.1| hypothetical protein SELMODRAFT_442225 [Selaginella moellendorffii]
Length=197

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 143/205 (70%), Gaps = 8/205 (4%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKI+VETPKYE++     +E+R Y P ++AEV+Y P + R  +DGGF++LA+YIG
Sbjct  1    MGMVLGKISVETPKYELVTKENGFEVRDYAPRIVAEVSYDPAEMRSGRDGGFSILADYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG P+N   +KIAMTAPVIT++SSS        APV+     G      VTMQF+LPS 
Sbjct  61   ALGKPKNEPAQKIAMTAPVITKQSSSGDAI--ANAPVIESKSDGR-----VTMQFVLPSG  113

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
                E  P+P+DERV++    ++K+GV+ F+G A D +V+ KVE+L++ L   GYKI G+
Sbjct  114  LT-MESIPRPVDERVRVIPLPQQKFGVLGFTGVAGDDLVKNKVELLRKNLAAAGYKIAGD  172

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWT   L+TNEVM+P+E
Sbjct  173  YILARYNPPWTPGFLRTNEVMLPLE  197



>emb|CBI30446.3| unnamed protein product [Vitis vinifera]
Length=674

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 133/206 (65%), Gaps = 54/206 (26%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+ GKI VETPK++VI ++A+YEIR+YPP VIAEVTY P+QFRG+KDGGFTLLANYIG
Sbjct  1    MGMVFGKICVETPKFQVIQSSADYEIRKYPPTVIAEVTYDPSQFRGDKDGGFTLLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG-GGEGESKAVTMQFILPS  514
            ALGNPQN KPEKI MTAPV+T+ +      IAMTAPVVTK G GGEG++           
Sbjct  61   ALGNPQNTKPEKIEMTAPVVTKYAEK----IAMTAPVVTKSGEGGEGKT-----------  105

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
                                                  VV  KVE L++ LERDG+K+IG
Sbjct  106  --------------------------------------VVGAKVESLEKSLERDGFKLIG  127

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
            EF L RYNPPWTLP  +TNEVMIP+E
Sbjct  128  EFVLARYNPPWTLPAFRTNEVMIPIE  153



>ref|XP_002983590.1| hypothetical protein SELMODRAFT_445583 [Selaginella moellendorffii]
 gb|EFJ15491.1| hypothetical protein SELMODRAFT_445583 [Selaginella moellendorffii]
Length=197

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 143/205 (70%), Gaps = 8/205 (4%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LGKI+VETPKYE++     +E+R Y P +IAEV+Y P + R  +DGGF++LA+YIG
Sbjct  1    MGMVLGKISVETPKYELVRKEDGFEVRDYAPRIIAEVSYDPAEMRSGRDGGFSILADYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG P+N   +KIAMTAPVIT++SSS        APV+     G      VTMQF+LPS 
Sbjct  61   ALGKPKNEPAQKIAMTAPVITKQSSSGGAI--ANAPVIESKSDGR-----VTMQFVLPSG  113

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
                E  P+P+DERV++    ++K+GV+ F+G A D +V+ KVE+L++ L   GY++ G+
Sbjct  114  LT-MESIPRPMDERVRVIPLPQQKFGVLGFTGVAGDDLVKNKVELLRKNLAAAGYQVAGD  172

Query  330  FELGRYNPPWTLPPLKTNEVMIPVE  256
            + L RYNPPWT   L+TNEVM+P+E
Sbjct  173  YILARYNPPWTPGFLRTNEVMLPLE  197



>gb|AIL90544.1| hypothetical protein POPTRDRAFT_735696, partial [Populus ussuriensis]
Length=126

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 112/128 (88%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK GGGEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGGGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90558.1| hypothetical protein POPTRDRAFT_735696, partial [Populus deltoides]
Length=126

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +  +SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGASEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90531.1| hypothetical protein POPTRDRAFT_735696, partial [Populus tremuloides]
 gb|AIL90534.1| hypothetical protein POPTRDRAFT_735696, partial [Populus alba]
 gb|AIL90536.1| hypothetical protein POPTRDRAFT_735696, partial [Populus hopeiensis]
 gb|AIL90537.1| hypothetical protein POPTRDRAFT_735696, partial [Populus grandidentata]
 gb|AIL90548.1| hypothetical protein POPTRDRAFT_735696, partial [Populus adenopoda]
Length=126

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90533.1| hypothetical protein POPTRDRAFT_735696, partial [Populus balsamifera]
 gb|AIL90538.1| hypothetical protein POPTRDRAFT_735696, partial [Populus szechuanica]
 gb|AIL90539.1| hypothetical protein POPTRDRAFT_735696, partial [Populus simonii]
 gb|AIL90541.1| hypothetical protein POPTRDRAFT_735696, partial [Populus talassica]
 gb|AIL90542.1| hypothetical protein POPTRDRAFT_735696, partial [Populus laurifolia]
 gb|AIL90543.1| hypothetical protein POPTRDRAFT_735696, partial [Populus suaveolens]
 gb|AIL90546.1| hypothetical protein POPTRDRAFT_735696, partial [Populus nigra]
 gb|AIL90549.1| hypothetical protein POPTRDRAFT_735696, partial [Populus przewalskii]
 gb|AIL90557.1| hypothetical protein POPTRDRAFT_735696, partial [Populus koreana]
 gb|AIL90559.1| hypothetical protein POPTRDRAFT_735696, partial [Populus cathayana]
Length=126

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90530.1| hypothetical protein POPTRDRAFT_735696, partial [Populus davidiana]
Length=126

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGXITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90554.1| hypothetical protein POPTRDRAFT_735696, partial [Salix raddeana]
 gb|AIL90556.1| hypothetical protein POPTRDRAFT_735696, partial [Salix triandra]
Length=126

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETPKYEVI ++ +YEIR+Y  +V+AEVTY P+QF GN+DGGF +LANYIG
Sbjct  1    MGMVLGRITVETPKYEVIQSSNDYEIRKYASSVLAEVTYDPSQFDGNRDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEG+ K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGK-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YNKAEEAP  126



>gb|AIL90532.1| hypothetical protein POPTRDRAFT_735696, partial [Populus tomentosa]
Length=126

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF  LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMXLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90535.1| hypothetical protein POPTRDRAFT_735696, partial [Populus tremula]
Length=126

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMILANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMT PVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTXPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90551.1| hypothetical protein POPTRDRAFT_735696, partial [Populus pruinosa]
Length=126

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEV Y P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVXYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGXGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90555.1| hypothetical protein POPTRDRAFT_735696, partial [Populus euphratica]
Length=126

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEA  490
            Y +AEEA
Sbjct  119  YKKAEEA  125



>gb|AIL90552.1| hypothetical protein POPTRDRAFT_735696, partial [Salix babylonica]
Length=126

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+I+VETPKYEVI ++ +YEIR+Y  +V+AEVTY P+QF GN+DGGF +LANYIG
Sbjct  1    MGMVLGRISVETPKYEVIQSSNDYEIRKYASSVLAEVTYDPSQFDGNRDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEG+ K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGK-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YNKAEEAP  126



>gb|AIL90540.1| hypothetical protein POPTRDRAFT_735696, partial [Populus pamirica]
Length=126

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ TVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRXTVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90547.1| hypothetical protein POPTRDRAFT_735696, partial [Populus afghanica]
Length=126

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K  TMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMETMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90545.1| hypothetical protein POPTRDRAFT_735696, partial [Populus lasiocarpa]
Length=126

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YE+I ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYELIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEG+ K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGK-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90550.1| hypothetical protein POPTRDRAFT_735696, partial [Populus trichocarpa]
Length=126

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETP+YEVI ++ +YEIR+Y P+V+AEVTY P+QF G KDGGF +LANYIG
Sbjct  1    MGMVLGRITVETPEYEVIQSSNDYEIRKYAPSVLAEVTYDPSQFDGKKDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALG PQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVTK G GEGE K VTMQF+LP+K
Sbjct  61   ALGXPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTKEGSGEGE-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YKKAEEAP  126



>gb|AIL90553.1| hypothetical protein POPTRDRAFT_735696, partial [Salix arbutifolia]
Length=126

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MGM+LG+ITVETPKYEVI ++ +YEIR+Y  +V+AEVTY P+QF GN+DGGF +LANYIG
Sbjct  1    MGMVLGRITVETPKYEVIQSSNDYEIRKYASSVLAEVTYDPSQFDGNRDGGFMVLANYIG  60

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            ALGNPQN KPEKIAMTAPVIT+ +   SE+IAMTAPVVT  G GEG+ K VTMQF+LP+K
Sbjct  61   ALGNPQNTKPEKIAMTAPVITK-TGGGSEKIAMTAPVVTTEGSGEGK-KMVTMQFVLPAK  118

Query  510  YARAEEAP  487
            Y +AEEAP
Sbjct  119  YNKAEEAP  126



>ref|XP_005535065.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM78779.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=249

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 132/253 (52%), Gaps = 53/253 (21%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEV----TYHPTQFRGNK--DGGFTL  709
            MG +LGKI VETP++E++     YEIR+Y P V AEV     +   + +GNK    GF L
Sbjct  1    MGSVLGKIAVETPQFELLKRTDSYEIRKYGPLVAAEVRASEVFAGQEHKGNKLDSTGFRL  60

Query  708  LANYIGALGNPQNA------------------KPEKIAMTAPVITRessssseEIAMTAP  583
            LA+YIGA+G P N                   +PEKIAMTAPV++R        +AMTAP
Sbjct  61   LASYIGAIGKPANVAVSGERAESIAMTSPVVNQPEKIAMTAPVVSRAEK-----VAMTAP  115

Query  582  VVTK----------GGGGEGESKAV------TMQFILPSKYARAEEAPKPLDERVKIKEG  451
            VVT            GG  G+S A+       M F LPSKY+  E APKPLDERV + + 
Sbjct  116  VVTSDTTESGSRSSAGGLRGQSGAMKTEEGGVMAFYLPSKYSSVESAPKPLDERVHLVQI  175

Query  450  GERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE--------FELGRYNPPWTL  295
              RK  V  FSG    +    + E L   L+ D  ++ G+        + L RYNPPW+L
Sbjct  176  PPRKVAVAIFSGNTDMRRSRTQAEELFAALKVDQIRMKGDPASLDDAVWWLARYNPPWSL  235

Query  294  PPLKTNEVMIPVE  256
            P  K NEV I +E
Sbjct  236  PWTKRNEVHIELE  248



>gb|AFK47803.1| unknown [Lotus japonicus]
Length=137

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 106/137 (77%), Gaps = 8/137 (6%)
 Frame = -1

Query  648  MTAPVITRessssseEIAMTAPVVTKGGGGEGE-------SKAVTMQFILPSKYARAEEA  490
            MTAPVIT++     + IAMTAPVVTK GGG G         K VTMQFILPS Y +AEEA
Sbjct  1    MTAPVITKDGGGGEK-IAMTAPVVTKEGGGGGGGDGGEGVKKMVTMQFILPSCYEKAEEA  59

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            PKP DERV I+E GERK+GVVKF G A+++VV+EKV+ L+ CLERDG+K++GEF L RYN
Sbjct  60   PKPTDERVVIREEGERKFGVVKFGGVASEEVVKEKVKKLRGCLERDGFKVVGEFLLARYN  119

Query  309  PPWTLPPLKTNEVMIPV  259
            PPWT+P  +TNEVMIPV
Sbjct  120  PPWTIPMFRTNEVMIPV  136



>gb|ACH60736.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60738.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60740.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQF+LPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSTDDESGHAKKLVTMQFVLPSDYT-MENVPRPTDSRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60737.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQFILPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSTDDESGNAKKLVTMQFILPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60728.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60729.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60733.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60735.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60744.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQF+LPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSTDDESGHAKKLVTMQFVLPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60726.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60742.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQF+LPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSTDDESGHARKLVTMQFVLPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60731.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQFILPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSIDDESGNAKKLVTMQFILPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>ref|XP_002499422.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60680.1| predicted protein [Micromonas sp. RCC299]
Length=209

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 118/217 (54%), Gaps = 18/217 (8%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAE--YEIRQYPPAVIAEVTYHPTQ--FRGNKDGGFTLLA  703
            MG +LGKIT E P+++V+  AA   YEIR+Y PAV+AE +Y  ++  F G++ G F  LA
Sbjct  1    MGSVLGKITEELPRHDVVKKAASGFYEIRRYAPAVVAETSYRTSRGMFEGDQGGSFMRLA  60

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEG---ESKAVTM  532
             YIG +  PQN     I+MTAPV+    +          PV    G  EG   E+    M
Sbjct  61   KYIGVMAKPQNDTTTAISMTAPVLMSRGAGD----GADTPV----GASEGSHPETTTYKM  112

Query  531  QFILP-SKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLER  355
             F +P S++++A +APKP +  V I++   R   V  FSG      + E+ E L+R LE 
Sbjct  113  AFFMPASRFSKASDAPKPTNPDVTIRDVPARTLAVHTFSGNLRQAAIAERGERLRRALEA  172

Query  354  DGY--KIIGEFELGRYNPPWTLPPLKTNEVMIPVE*M  250
            DG   K   E     YNPPWT   LKTNEVM+ V  M
Sbjct  173  DGVAAKEGAEVMAAGYNPPWTPWFLKTNEVMLEVSGM  209



>gb|ACH60725.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60734.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60739.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQF+LPS Y+  E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSIDDESGHARKLVTMQFVLPSDYS-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60730.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60732.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60741.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60743.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60746.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQF+LPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSIDDESGHARKLVTMQFVLPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60727.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
 gb|ACH60745.1| SOUL heme-binding family protein [Pseudotsuga menziesii]
Length=125

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMTAPV+T     + ES    K VTMQF+LPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTAPVITAEQSTDDESGHARKLVTMQFVLPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ +++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKIRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>gb|ACH60747.1| SOUL heme-binding family protein [Pseudotsuga macrocarpa]
Length=125

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 81/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  600  IAMTAPVVTKGGGGEGES----KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYG  433
            IAMT PV+T     + ES    K VTMQF+LPS Y   E  P+P D RV +KE   RKYG
Sbjct  8    IAMTGPVITAEQSTDDESGHARKLVTMQFVLPSDYT-MENVPRPTDPRVSVKEAPVRKYG  66

Query  432  VVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            VV FSG A D VV+  V+ L++ LE  GY++ G++ LGRYNPPWTLP L+TNEVM+PV
Sbjct  67   VVTFSGVADDAVVQTMVQKLRKSLEDGGYQVTGDYVLGRYNPPWTLPFLRTNEVMLPV  124



>ref|XP_005706202.1| SOUL heme-binding protein [Galdieria sulphuraria]
 gb|EME29682.1| SOUL heme-binding protein [Galdieria sulphuraria]
Length=408

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 129/215 (60%), Gaps = 25/215 (12%)
 Frame = -1

Query  873  EMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRG---NKD---GGFT  712
            +MG ++GK++VE P YE+    +EYEIR+YP   +AEV  + ++ +G   N D     F 
Sbjct  210  DMGSVVGKVSVEQPLYEIEKKTSEYEIRKYPSLRVAEV--YRSELKGETSNYDFESQAFR  267

Query  711  LLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTK-GGGGEGESKAVT  535
            +LA+YIG  G P+N              +++S+   +I+MTAPV++K     E  S   +
Sbjct  268  ILASYIGVFGEPKN--------------KDNSNQQVKISMTAPVLSKPIEALETRSSGNS  313

Query  534  MQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVE-EKVEMLKRCLE  358
            M FILP +Y+  +E P+P+D RV ++    RK  VV F GT   + +E E+ E     L+
Sbjct  314  MAFILPKEYSEQKEPPEPVDSRVHLRVVPPRKVAVVTFRGTVNRETLEAERAERFMEQLK  373

Query  357  RDGYKII-GEFELGRYNPPWTLPPLKTNEVMIPVE  256
            +DGY+++  E+EL RYNPP+T PPL+ NE+++ V+
Sbjct  374  KDGYRLLSSEWELARYNPPFTPPPLRRNEILVQVD  408



>ref|XP_005770291.1| hypothetical protein EMIHUDRAFT_209880 [Emiliania huxleyi CCMP1516]
 ref|XP_005771117.1| hypothetical protein EMIHUDRAFT_75645 [Emiliania huxleyi CCMP1516]
 gb|EOD17862.1| hypothetical protein EMIHUDRAFT_209880 [Emiliania huxleyi CCMP1516]
 gb|EOD18688.1| hypothetical protein EMIHUDRAFT_75645 [Emiliania huxleyi CCMP1516]
Length=216

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 129/221 (58%), Gaps = 18/221 (8%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGG-FTLLANYI  694
            MGM+LG+I+ E P + V+  A+ YE+R+Y  +V+AE +Y    + G  DG  F  LA YI
Sbjct  1    MGMVLGRISEEMPAHTVLARASTYEVRRYARSVVAECSYGAGGWGGGDDGSPFGALARYI  60

Query  693  GALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILP-  517
            G  G PQN K EKIAMTAPV+      + E IAMTAPV+    G EG++   TM F+LP 
Sbjct  61   GVFGKPQNDK-EKIAMTAPVLV-----TPEPIAMTAPVLV-SPGAEGQATH-TMAFVLPA  112

Query  516  SKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKII  337
            SKY+   +APKPLD RV +++  ER   V  FS     +  ++ +++L   L +DG   +
Sbjct  113  SKYSSIADAPKPLDPRVTLRQLPERVQAVRTFSWNFRPEAAKKNLDILLDDLAKDGCWAV  172

Query  336  -------GEFELGRYNPPWTLPPLKTNEVMIPVE*MNLNAP  235
                     ++   YNPP+ LP +K NEV++ V+  N N P
Sbjct  173  ERGADGQPRWQAAGYNPPFALPFMKRNEVLVDVQ-PNPNCP  212



>emb|CBN74963.1| conserved unknown protein [Ectocarpus siliculosus]
Length=227

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 120/221 (54%), Gaps = 25/221 (11%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG ++GK +   P+Y+V+   A YE+R Y   V+AEV        G++D  F  LA YIG
Sbjct  1    MGGVVGKGSTPVPEYDVLGHGASYELRAYDGYVVAEVE---NSGEGSEDDRFRTLAKYIG  57

Query  690  ALGNPQN-----AKPEKIAMTAPVIT-RessssseEIAMTAPVVTKGGGGEGESKAVTMQ  529
              GNP N        E IAMTAPV+T   +  S ++I+MTAPVV   G G G S   TMQ
Sbjct  58   VFGNPANKVAGGDAGENIAMTAPVVTGDPTPDSGKKISMTAPVVV--GPGTGTS---TMQ  112

Query  528  FILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGT-----ATDKVVE-EKVEMLKR  367
            FI+P ++ R  + P P D RV ++E  E  Y V +FSG        D + E E++  +++
Sbjct  113  FIMPKQFKRISDLPTPTDSRVSLREVPEAVYLVHQFSGNMGRGDGHDAIAERERIVAVEK  172

Query  366  CLERDG-----YKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
                 G          +F + RY+PPWTLP L+TNE+  PV
Sbjct  173  VASEGGAFSEYVSADSKFLVARYDPPWTLPFLRTNELWFPV  213



>ref|WP_015421378.1| SOUL heme-binding protein [beta proteobacterium CB]
 ref|YP_007502509.1| SOUL heme-binding protein [beta proteobacterium CB]
 gb|AGG33774.1| SOUL heme-binding protein [beta proteobacterium CB]
Length=189

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 111/199 (56%), Gaps = 12/199 (6%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E PKY ++  +  +E+R Y P ++AEV           + GF L+A YI      +N
Sbjct  1    MATEEPKYLLLEKSEPFELRAYAPLIVAEVKVD-GDLDTASNQGFRLIAAYIFG----KN  55

Query  669  AKPEKIAMTAPV-ITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
               EKIAMTAPV I     + S +IAMTAPV  +  G +      T+ F++PS+Y  A  
Sbjct  56   QVSEKIAMTAPVGIESSEQNKSTKIAMTAPVGIESTGNQW-----TVSFVMPSEYTLAS-  109

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRY  313
             PKPLD +VKI+E    K  V+ FSG   ++ V+EK + L+  ++       GE +  RY
Sbjct  110  LPKPLDPQVKIRELPAEKKAVITFSGFYNEEKVKEKTQALRDWMKSRNLNSTGESQFARY  169

Query  312  NPPWTLPPLKTNEVMIPVE  256
            NPPWTLP ++ NEV+I ++
Sbjct  170  NPPWTLPFMRRNEVLIQIQ  188



>gb|KHG20344.1| Lactate utilization B [Gossypium arboreum]
Length=139

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 99/143 (69%), Gaps = 4/143 (3%)
 Frame = +2

Query  269  ITSFVFNGGSVHGGLYLPNSNSPIILYPSLSKHlfsistfssttlsVAVPLNFTTPYFLS  448
            +TS V   G VHGGLYL N N PI LYPSLSK  F  STFSSTTLSVA P NFTTPYFLS
Sbjct  1    MTSLVLKAGKVHGGLYLANKNWPITLYPSLSKLFFRFSTFSSTTLSVATPPNFTTPYFLS  60

Query  449  PPSLIFTRsssgfgassaLAYFDGRMNCIVTAllspspppplVTTGAVIAISSDDDEDSL  628
            P S I T SS GFGASSA+ Y  G  NC+VT         P VTTGAV+ I S      L
Sbjct  61   PSSFITTLSSKGFGASSAVLYVAGNRNCMVT----MLLLSPFVTTGAVMGIFSLLFPGDL  116

Query  629  VITGAVMAIFSGFAFWGLPSAPM  697
            VITGAV+AIFSGFAFWGLP APM
Sbjct  117  VITGAVIAIFSGFAFWGLPKAPM  139



>dbj|GAF52734.1| hypothetical protein JCM18900_11264 [Psychrobacter sp. JCM 18900]
Length=197

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 112/203 (55%), Gaps = 19/203 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            +  E PKY V+    ++E+R+Y   ++A+     T   G++D     GF +LA+YI    
Sbjct  1    MATEEPKYTVLTQVDDFELRRYDEQLVAQ-----TWVSGDQDSASREGFKILADYIFGNN  55

Query  681  NPQNAKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
               +    KI+MTAPV      ++S + S++IAMTAPV  +   G+       +QF +PS
Sbjct  56   TASSGDSSKISMTAPVTMQADNKKSDNESQKIAMTAPVSMQQDDGKWR-----VQFTMPS  110

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            KY   +  PKP +  V+I E   + YGV+KFS  A +  V EK E L+  ++       G
Sbjct  111  KYT-MQTLPKPNNPNVEIIEVPAQTYGVIKFSWLAGEDKVAEKTEALQTWMQDQNLTPTG  169

Query  333  EFELGRYNPPWTLPPLKTNEVMI  265
            E EL RYNPPWTLP L+ NEVMI
Sbjct  170  EPELARYNPPWTLPFLRRNEVMI  192



>dbj|GAF58381.1| hypothetical protein JCM18902_1162 [Psychrobacter sp. JCM 18902]
Length=216

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 108/199 (54%), Gaps = 11/199 (6%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E P Y V+    ++E+R+Y   ++A+      Q   +++G F +LA+YI        
Sbjct  20   MATEEPNYTVLSQMDDFELRRYDKQLVAQTLVSGDQDSASREG-FKMLADYIFGNNTAPT  78

Query  669  AKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
                KI+MTAPV      ++S   S++IAMTAPV  +   G+       +QF +PSKY  
Sbjct  79   GGSSKISMTAPVTMQPENKKSVDESQKIAMTAPVSMQQDDGKWR-----VQFTMPSKYT-  132

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             +  PKP +  + I E   + YGV+KFSG A  K V  K E L+  ++     I GE EL
Sbjct  133  MQTLPKPNNPNITITELPAQTYGVIKFSGLAGSKKVATKTEELQSWMQTQNLTITGEPEL  192

Query  321  GRYNPPWTLPPLKTNEVMI  265
             RYNPPWTLP L+ NEVMI
Sbjct  193  ARYNPPWTLPFLRRNEVMI  211



>ref|WP_014547368.1| SOUL heme-binding protein [Francisella tularensis]
 ref|YP_005823083.1| hypothetical protein FN3523_0029 [Francisella cf. tularensis 
subsp. novicida 3523]
 gb|AEB27886.1| hypothetical protein FN3523_0029 [Francisella cf. tularensis 
subsp. novicida 3523]
Length=207

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 113/198 (57%), Gaps = 17/198 (9%)
 Frame = -1

Query  840  ETP--KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQN  670
            +TP  KY  I     + +R Y P   A+VT   + ++   + GF  L  YI GA     N
Sbjct  24   DTPQAKYTNIKKDDNFSVRVYAPLTEAQVTVEDSNYKSAINKGFGYLFKYITGA-----N  78

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               + I MTAPV   +   SS++I MTAPV+ KG     +SKA T+ F+LP++Y   E A
Sbjct  79   IAKQDIQMTAPV---KIEQSSQKIQMTAPVIIKG-----DSKAWTIAFVLPAEYTL-ENA  129

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            PKP +++VK+ E  E K  V+ FSG      ++     L+  ++ + Y+I+G+ E   YN
Sbjct  130  PKPTNDKVKLVEKPETKMAVITFSGFLDKDTIDANTTKLETWIKANNYEIVGQPEAAGYN  189

Query  309  PPWTLPPLKTNEVMIPVE  256
            PPWT+P L+TNEVMIP++
Sbjct  190  PPWTIPFLRTNEVMIPIK  207



>ref|WP_011903253.1| SOUL heme-binding protein [Polynucleobacter necessarius]
 ref|YP_001156192.1| SOUL heme-binding protein [Polynucleobacter necessarius subsp. 
asymbioticus QLW-P1DMWA-1]
 gb|ABP34628.1| SOUL heme-binding protein [Polynucleobacter necessarius subsp. 
asymbioticus QLW-P1DMWA-1]
Length=187

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 113/201 (56%), Gaps = 20/201 (10%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKD----GGFTLLANYIGALG  682
            + +E PKY V+     +E+R Y P ++AEV     Q  G+ D     GF L+A YI    
Sbjct  1    MAIEEPKYTVLEKTIPFELRSYAPMILAEV-----QVDGDLDEASSQGFRLIAAYIFG--  53

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
              QN   EKIAMTAPV   E S SS+ IAMTAPV  +G  G+      T+ F++PS+Y  
Sbjct  54   --QNRVSEKIAMTAPVAIEEQSVSSK-IAMTAPVNIEGNSGQW-----TVSFVMPSEYT-  104

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  PKPL+ +V +++    K  VV+FSG   +  + E+   L+  ++    + IG  + 
Sbjct  105  MESIPKPLNSKVVLRQIPTVKRAVVQFSGFYNNAKIAERTVELEEWMKTKDLQAIGVPKF  164

Query  321  GRYNPPWTLPPLKTNEVMIPV  259
             RYNPPWTLP L+ NE+MI V
Sbjct  165  ARYNPPWTLPFLRRNEIMIDV  185



>ref|WP_034733695.1| heme-binding protein [Idiomarina sp. MCCC 1A10513]
Length=189

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 110/199 (55%), Gaps = 18/199 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGG----FTLLANYIGALG  682
            +  E PKY+V+    ++E+RQY P ++AEVT      RG+ D      F +LA+YI    
Sbjct  1    MATEEPKYDVLKQDGDFELRQYAPMMVAEVT-----VRGSMDNASGKAFRVLADYIFGNN  55

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
                    +IAMT PV     ++ +E+IAMT+PV  +   G     A  M F++PS+Y  
Sbjct  56   RVPGGTNTEIAMTTPVT---MTAQAEKIAMTSPVTMQASDG-----AWRMHFMMPSQY-N  106

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P+P +  + I+E   + Y V++FSG A +  V EK   L+  LE +  +  GE EL
Sbjct  107  METLPQPNNPNITIRELPSQHYAVIRFSGFAGEAKVAEKTTALRDWLEANNIRPSGEPEL  166

Query  321  GRYNPPWTLPPLKTNEVMI  265
             RY+PPWTLP L+ NEV I
Sbjct  167  ARYDPPWTLPFLRRNEVKI  185



>ref|XP_003078259.1| SOUL heme-binding family protein (ISS) [Ostreococcus tauri]
 emb|CAL52999.1| SOUL haem-binding protein [Ostreococcus tauri]
Length=208

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 112/215 (52%), Gaps = 29/215 (13%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAE--YEIRQYPPAVIAEVTYHPTQ--FRGNKDGGFTLLA  703
            MG  LG+I  E P+YEV+HA A   YE+R Y    + E +Y   +   RG++ G F  LA
Sbjct  1    MGSALGRIAEEQPRYEVMHALARAAYELRAYEACCVVETSYESARGMVRGDQGGSFMRLA  60

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFI  523
             +IG +  P N + EKIAMT+PV                        GE  +    MQF+
Sbjct  61   KFIGVMSAPANDRREKIAMTSPVFMSPE-------------------GEDGAGRYVMQFV  101

Query  522  LP-SKY-ARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG  349
            LP SK+   A EAP P  + V +++   R   V +FSG   + +V E+++ L+  L  DG
Sbjct  102  LPKSKFPGGASEAPAPTSDGVVVRDLPARYMAVRRFSGRMNEDLVMEEMKKLREALRADG  161

Query  348  YKII-GEF---ELGRYNPPWTLPPLKTNEVMIPVE  256
              ++ GE    +   YNPPWT  P++TNEVM+ ++
Sbjct  162  VLLVNGESTPTQYAGYNPPWTPGPMRTNEVMVEID  196



>gb|KFZ28043.1| heme-binding protein [Idiomarina sp. MCCC 1A10513]
Length=210

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 113/206 (55%), Gaps = 21/206 (10%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGG----FTLLA  703
            MG ++     E PKY+V+    ++E+RQY P ++AEVT      RG+ D      F +LA
Sbjct  18   MGTVMA---TEEPKYDVLKQDGDFELRQYAPMMVAEVT-----VRGSMDNASGKAFRVLA  69

Query  702  NYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFI  523
            +YI            +IAMT PV     ++ +E+IAMT+PV  +   G     A  M F+
Sbjct  70   DYIFGNNRVPGGTNTEIAMTTPVT---MTAQAEKIAMTSPVTMQASDG-----AWRMHFM  121

Query  522  LPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYK  343
            +PS+Y   E  P+P +  + I+E   + Y V++FSG A +  V EK   L+  LE +  +
Sbjct  122  MPSQY-NMETLPQPNNPNITIRELPSQHYAVIRFSGFAGEAKVAEKTTALRDWLEANNIR  180

Query  342  IIGEFELGRYNPPWTLPPLKTNEVMI  265
              GE EL RY+PPWTLP L+ NEV I
Sbjct  181  PSGEPELARYDPPWTLPFLRRNEVKI  206



>dbj|GAF54507.1| LOW QUALITY PROTEIN: hypothetical protein JCM18901_81 [Psychrobacter 
sp. JCM 18901]
Length=216

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            +  E PKY V+    ++E+R+Y   ++A+     T   G++D     GF +LA+YI    
Sbjct  20   MATEEPKYTVLTQVDDFELRRYDEQLVAQ-----TWVSGDQDSASREGFKVLADYIFGNN  74

Query  681  NPQNAKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
               +    KI+MT PV      +ES + S++IAMTAPV  +   G+       +QF +PS
Sbjct  75   TAPSGDSSKISMTVPVTMQADNKESDNESQKIAMTAPVSMQQDNGKWR-----VQFTMPS  129

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            KY   +  PKP +  V+I E   + YGV+KFS  A    V EK E L+  ++      IG
Sbjct  130  KYT-MQTLPKPNNPNVEIIEVPAQTYGVIKFSWLAGKDKVAEKTEALQTWMQNQNLTPIG  188

Query  333  EFELGRYNPPWTLPPLKTNEVMI  265
            E EL RYNPPWTLP L+ NEVMI
Sbjct  189  EPELARYNPPWTLPFLRRNEVMI  211



>dbj|GAF60565.1| hypothetical protein JCM18903_488 [Psychrobacter sp. JCM 18903]
Length=216

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 113/203 (56%), Gaps = 19/203 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E P Y V+    ++E+R+Y   ++A+      Q   +++G F +LA+YI   GN  N
Sbjct  20   MATEEPNYTVLSQMDDFELRRYDKQLVAQTLVSGDQDSASREG-FKVLADYI--FGN--N  74

Query  669  AKP----EKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
              P     KI+MTAPV      ++S S S++IAMTAPV  +   G+       +QF +PS
Sbjct  75   TAPTDGSSKISMTAPVTMQPNNKKSDSESQKIAMTAPVSMQQDDGKWR-----VQFTMPS  129

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            +Y   +  PKP +  + I E   + YGV+KFSG A  K V  K E L+  ++     I G
Sbjct  130  QYT-MQTLPKPNNPNITITEVPAQTYGVIKFSGLAGSKKVATKTEELQSWMQIQNLTITG  188

Query  333  EFELGRYNPPWTLPPLKTNEVMI  265
            E EL RYNPPWTLP L+ NEVMI
Sbjct  189  EPELARYNPPWTLPFLRRNEVMI  211



>ref|WP_003038078.1| SOUL heme-binding protein [Francisella novicida]
 ref|YP_005824948.1| hypothetical protein [Francisella cf. novicida Fx1]
 gb|EDN38552.1| hypothetical protein FTDG_01371 [Francisella novicida GA99-3548]
 gb|EDZ90366.1| soul heme-binding protein [Francisella novicida FTG]
 gb|AEB26988.1| hypothetical protein FNFX1_0040 [Francisella cf. novicida Fx1]
Length=208

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APKP +
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMIKGDTNN----EWTIAFVLPAQYT-LENAPKPTN  135

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            ++VK+ E  E K  V+ FSG      ++     LK  ++ + Y+IIG+ E   YNPPWT+
Sbjct  136  DKVKLVEKTETKMAVITFSGFLDKDTIDSNTTKLKAWIKANNYQIIGQPEAAGYNPPWTI  195

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  196  PFLRTNEVMIPIK  208



>ref|WP_003032660.1| SOUL heme-binding protein [Francisella novicida]
 gb|EDN35417.1| hypothetical protein FTCG_01171 [Francisella novicida GA99-3549]
 gb|KFJ68594.1| hypothetical protein DR83_99 [Francisella tularensis subsp. novicida]
Length=208

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APKP +
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMIKGDTNN----EWTIAFVLPAQYT-LENAPKPTN  135

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            ++VK+ E  E K  V+ FSG      ++     LK  ++ + Y+IIG+ E   YNPPWT+
Sbjct  136  DKVKLVEKPETKMAVITFSGFLDKDTIDSNTTKLKAWIKANNYQIIGQPEAAGYNPPWTI  195

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIPV+
Sbjct  196  PFLRTNEVMIPVK  208



>ref|WP_003040829.1| SOUL heme-binding protein [Francisella novicida]
 ref|YP_897697.1| hypothetical protein FTN_0032 [Francisella tularensis subsp. 
novicida U112]
 gb|ABK88943.1| protein of unknown function [Francisella novicida U112]
 gb|EDX19335.1| soul heme-binding protein [Francisella tularensis subsp. novicida 
FTE]
Length=208

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKKDDNFSIRIYAPLTQAQVTVQDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APKP +
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMIKGDTNNQW----TIAFVLPAQYT-LENAPKPTN  135

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            ++VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  136  DKVKLVEKPETKMAVITFSGFLDKDTIDSNTTKLKAWIKANNYQIVGQPEAAGYNPPWTI  195

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  196  PFLRTNEVMIPIK  208



>ref|XP_002947806.1| hypothetical protein VOLCADRAFT_57321 [Volvox carteri f. nagariensis]
 gb|EFJ51339.1| hypothetical protein VOLCADRAFT_57321 [Volvox carteri f. nagariensis]
Length=225

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 116/224 (52%), Gaps = 21/224 (9%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHA---AAEYEIRQYPPAVIAEVTYHPTQFRGNKDG---GFTL  709
            M  I G ITVETPKY V+ A   A+  E+R+Y P V AEV Y      G  DG    F  
Sbjct  1    MSSIFGSITVETPKYSVVKALAGASGAELRKYCPQVRAEVLYDIAPNHGIMDGLNAPFRA  60

Query  708  LANYIGALGNPQNAKPEKIAMTAPVI--TRessssseEIAMTAPVVTKGG---------G  562
            LA  +     P   +  ++AMTAPV+  T  +   SE+IAMTAPVV + G         G
Sbjct  61   LAGRVCKRAVPCLLQSAQVAMTAPVVMQTGATEGPSEKIAMTAPVVMQTGTTEAAGASEG  120

Query  561  GEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
              G +K V M FI+PS+Y    + P P D RV++ E  ER +  ++F G  T  V + K 
Sbjct  121  PAGGNKRV-MSFIMPSQYKSVVDLPAPKDPRVRLFEVPERTFAAIRFHGRMTQAVAKVKE  179

Query  381  EMLKRCLERDGYKIIGE---FELGRYNPPWTLPPLKTNEVMIPV  259
            + L+    +   K+  E    +   YNPPW LP   TN+++IPV
Sbjct  180  QELRAAAAKADVKLSDEPHAVQYCAYNPPWCLPWFATNDILIPV  223



>ref|WP_025650520.1| MULTISPECIES: heme-binding protein [Psychrobacter]
Length=197

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 110/203 (54%), Gaps = 19/203 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            +  E P Y V+     +E+R Y   ++A+     T   G++D     GF +LA+YI    
Sbjct  1    MATEEPTYTVLTKTKSFELRHYDAQLVAQ-----TWVMGDQDAASRAGFKILADYIFGNN  55

Query  681  NPQNAKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
                    KI+MTAPV      ++S   S++IAMTAPV  +   G+       +QF +PS
Sbjct  56   TAPTGGSRKISMTAPVTMQPNNKKSDGDSQKIAMTAPVSMQQADGKWR-----VQFTMPS  110

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            +Y   +  PKP +  ++IK+   + YGV+KFSG A  K V EK + L+  ++    K+ G
Sbjct  111  QYT-LQTLPKPNNPNIEIKKVPAQTYGVIKFSGLAGSKKVAEKTDELQTWMQSQNLKVTG  169

Query  333  EFELGRYNPPWTLPPLKTNEVMI  265
              EL RYNPPWTLP ++ NEVMI
Sbjct  170  VPELARYNPPWTLPFMRRNEVMI  192



>ref|WP_020443801.1| SOUL heme-binding protein [Psychrobacter sp. G]
 ref|YP_008163624.1| SOUL heme-binding protein [Psychrobacter sp. G]
 gb|AGP49265.1| SOUL heme-binding protein [Psychrobacter sp. G]
Length=220

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 112/202 (55%), Gaps = 11/202 (5%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E PKY V+     +E+R+Y   ++A+      Q   ++  GF +LA+YI       +
Sbjct  24   MATEEPKYTVLSQTENFELRRYDEQLVAQTWVSGDQNTASR-AGFKVLADYIFGNNTAPS  82

Query  669  AKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
             +  KI+MTAPV      + SS  S++IAMTAPV  +   G+       +QFI+PS+Y  
Sbjct  83   GESSKISMTAPVTMQSENKNSSDESQKIAMTAPVSMQQNDGKWR-----VQFIMPSQYT-  136

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             +  PKP +  ++I +   + YG++KFSG A  + V  K   L+  ++    K+ GE EL
Sbjct  137  LQTLPKPNNSNIEIVKVPAKTYGIIKFSGLAGSEKVAAKTAELQFWMQAQKLKMTGEPEL  196

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             RYNPPWTLP ++ NE+MI  E
Sbjct  197  ARYNPPWTLPFMRRNEIMITYE  218



>gb|ABE26685.1| SOUL domain protein [Francisella tularensis subsp. mediasiatica]
Length=208

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APKP +
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMVKGDTNN----EWTIAFVLPAQYT-LENAPKPTN  135

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            ++VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  136  DKVKLVEKPETKIAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTI  195

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  196  PFLRTNEVMIPIK  208



>ref|XP_004039332.1| soul heme-binding protein, putative [Ichthyophthirius multifiliis]
 gb|EGR34028.1| soul heme-binding protein, putative [Ichthyophthirius multifiliis]
Length=219

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 120/225 (53%), Gaps = 31/225 (14%)
 Frame = -1

Query  903  SLLHNILNSFEM-GMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNK  727
            +LL++  N F+M G I G   V+ P+Y +I     Y+IR+Y   VIA++         NK
Sbjct  16   TLLYH-FNVFQMIGQIFGFNGVKEPQYSLIQKTP-YQIRKYESYVIAKIAMK----EDNK  69

Query  726  DGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGES  547
            D  F  LA YIG  G P+N + + + MT PV+          + MTAPV+ + G      
Sbjct  70   DQAFRALARYIGVFGKPENTQNQSLVMTVPVLQEPVK-----MEMTAPVIFENG------  118

Query  546  KAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKR  367
                M F+LP KY + E++P+PL++ + +++  E+   V++FSG   ++   +K+E L +
Sbjct  119  ---YMSFVLPEKYKQVEQSPQPLNKEISLEKVDEKNIAVLQFSGYGKNEDFNQKLEELIQ  175

Query  366  CLERDGYKIIGE--------FELGRYNPPWTLPPLKTNEVMIPVE  256
             +++D  K I E         +  RYNPP+ +P  + NEV I +E
Sbjct  176  LMKKD--KHIKENAKQEDLNVQFARYNPPFCIPMFRRNEVWINME  218



>ref|WP_003022600.1| SOUL heme-binding protein [Francisella tularensis]
 ref|YP_170559.1| hypothetical protein FTT_1651 [Francisella tularensis subsp. 
tularensis SCHU S4]
 ref|YP_667692.1| hypothetical protein FTF1651 [Francisella tularensis subsp. tularensis 
FSC198]
 ref|YP_001122728.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis WY96-3418]
 ref|YP_005306226.1| SOUL heme-binding protein [Francisella tularensis subsp. tularensis 
TIGB03]
 ref|YP_005318679.1| SOUL heme-binding protein [Francisella tularensis subsp. tularensis 
TI0902]
 ref|YP_005831781.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis NE061598]
 gb|AAV29837.1| NT02FT0503 [synthetic construct]
 emb|CAG46284.1| conserved hypothetical protein [Francisella tularensis subsp. 
tularensis SCHU S4]
 gb|ABE26684.1| SOUL domain protein [Francisella tularensis subsp. tularensis]
 emb|CAL09667.1| conserved hypothetical protein [Francisella tularensis subsp. 
tularensis FSC198]
 gb|ABO47608.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis WY96-3418]
 gb|EDN35191.1| conserved hypothetical protein [Francisella tularensis subsp. 
tularensis FSC033]
 gb|EET19972.1| conserved hypothetical protein [Francisella tularensis subsp. 
tularensis MA00-2987]
 gb|ADA79301.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis NE061598]
 gb|AFB81190.1| SOUL heme-binding protein [Francisella tularensis subsp. tularensis 
TI0902]
 gb|AFB79646.1| SOUL heme-binding protein [Francisella tularensis subsp. tularensis 
TIGB03]
 gb|EKM84529.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 831]
 gb|EKM84627.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis AS_713]
 gb|EKM85049.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 80700075]
 gb|EKM89725.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 70102010]
 gb|EKM89987.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 80700103]
 gb|EKT88940.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 70001275]
 gb|EMI58576.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 3571]
 gb|EOA41063.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 80700069]
 gb|EOA41226.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 79201237]
 gb|EOA41380.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 80700075]
 gb|EOA46394.1| putative SOUL heme-binding protein [Francisella tularensis subsp. 
tularensis 1378]
 gb|EZK39157.1| hypothetical protein P250_03946 [Francisella tularensis subsp. 
tularensis str. SCHU S4 substr. FSC043]
 gb|EZK41166.1| hypothetical protein P251_03944 [Francisella tularensis subsp. 
tularensis str. SCHU S4 substr. FTS-634/635]
 gb|EZK44400.1| hypothetical protein P248_03946 [Francisella tularensis subsp. 
tularensis str. SCHU S4 substr. NR-643]
 gb|EZK46040.1| hypothetical protein P249_03952 [Francisella tularensis subsp. 
tularensis str. SCHU S4 substr. SL]
 gb|EZK47708.1| hypothetical protein P247_03951 [Francisella tularensis subsp. 
tularensis str. SCHU S4 substr. NR-10492]
 gb|EZK49744.1| hypothetical protein P246_03946 [Francisella tularensis subsp. 
tularensis str. SCHU S4 substr. NR-28534]
 gb|KFJ39432.1| hypothetical protein DR85_619 [Francisella tularensis]
 gb|KFJ40231.1| hypothetical protein DR87_1851 [Francisella tularensis]
 gb|KFJ44418.1| hypothetical protein DR79_1735 [Francisella tularensis]
 gb|KFJ59733.1| hypothetical protein DR80_1701 [Francisella tularensis]
 gb|KFJ70499.1| hypothetical protein DR84_1779 [Francisella tularensis]
 gb|KFJ74006.1| hypothetical protein DR86_1009 [Francisella tularensis]
Length=208

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 105/193 (54%), Gaps = 14/193 (7%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APKP +
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMVKGDTNN----EWTIAFVLPAQYT-LENAPKPTN  135

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
             +VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  136  NKVKLVEKPETKMAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTI  195

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  196  PFLRTNEVMIPIK  208



>ref|WP_004286807.1| SOUL heme-binding protein [Francisella philomiragia]
 gb|EET20559.1| SOUL domain-containing protein [Francisella philomiragia subsp. 
philomiragia ATCC 25015]
Length=207

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + +R Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKTDDNFSVRVYAPLTEAQVTVEDSDYKSAVNKGFGFLFRYITGA-----NITKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+       G+ K+ T+ F+LP++Y   + APKP  
Sbjct  84   IQMTAPV---KIEKSSQKIQMTAPVMI-----AGDDKSWTIAFVLPAQYT-LQNAPKPTS  134

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            +++K+ E  E K  VV FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  135  DKIKLVEKPETKMAVVTFSGFLDKDSIDSNTTKLKTWIKANDYEIVGQPEAAGYNPPWTI  194

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  195  PFLRTNEVMIPIK  207



>ref|WP_035737326.1| SOUL heme-binding protein [Francisella philomiragia]
 gb|KFJ42726.1| SOUL heme-binding family protein [Francisella philomiragia]
Length=207

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + +R Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKTDDNFSVRVYAPLTEAQVTVEDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+       G+ K+ T+ F+LP++Y   + APKP  
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMI-----AGDDKSWTIAFVLPAQYT-LQNAPKPTS  134

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            ++VK+ E  E K  VV FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  135  DKVKLVEKPETKMAVVTFSGFLDKDSIDSNTTKLKTWIKANNYEIVGQPEAAGYNPPWTI  194

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  195  PFLRTNEVMIPIK  207



>ref|WP_003017595.1| SOUL heme-binding protein [Francisella tularensis]
 gb|ABE26683.1| SOUL domain protein [Francisella tularensis subsp. holarctica]
 gb|EDO65560.1| hypothetical protein FTAG_01305 [Francisella tularensis subsp. 
holarctica FSC022]
 gb|AHH45635.1| SOUL heme-binding protein [Francisella tularensis subsp. holarctica 
PHIT-FT049]
Length=208

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 103/192 (54%), Gaps = 12/192 (6%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAKPEKI  652
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI       N   + I
Sbjct  29   KYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITR----ANIAKQDI  84

Query  651  AMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLDE  472
             MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APKP ++
Sbjct  85   QMTAPV---KIEQSSQKIQMTAPVMVKGDTNN----EWTIAFVLPAQYT-LENAPKPTND  136

Query  471  RVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLP  292
            +VK+ E  E K  V+ FSG      +      LK  ++ + Y+I+G+ E   YNPPWT+P
Sbjct  137  KVKLVEKPETKMAVITFSGFLDKDTINSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTIP  196

Query  291  PLKTNEVMIPVE  256
             L+TNEVMIP++
Sbjct  197  FLRTNEVMIPIK  208



>ref|WP_006272355.1| heme-binding protein [Asticcacaulis biprosthecium]
 gb|EGF93163.1| SOUL heme-binding family protein [Asticcacaulis biprosthecum 
C19]
Length=219

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 116/201 (58%), Gaps = 22/201 (11%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKD----GGFTLLANYIGALG  682
            + +E P ++ + +  ++ +R Y   + AEV     +  G+++     GF L+A+YI   G
Sbjct  25   MAIEEPAFKTVRSDGDFALRDYDAMIAAEV-----RVEGDRNQAINSGFRLIADYI--FG  77

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
            N  N +  K+AMTAPV     S++SE+IAMTAPV   G GG     A T++FI+P++Y  
Sbjct  78   N--NRQKSKVAMTAPV---TQSAASEKIAMTAPVTQSGEGG-----AWTVRFIMPARYT-  126

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P+P D RVK+     +++ VV+FSG A +  + E+   LK  +  +     GE  L
Sbjct  127  METLPEPNDARVKLVPVPAQRFAVVRFSGLAGESDIAERTTQLKAWVAAEKLVAEGEVTL  186

Query  321  GRYNPPWTLPPLKTNEVMIPV  259
             RY+PPWTL  L+ NE+MIPV
Sbjct  187  ARYDPPWTLWFLRRNELMIPV  207



>ref|WP_010200210.1| SOUL heme-binding protein [Psychrobacter sp. PAMC 21119]
Length=216

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 112/203 (55%), Gaps = 19/203 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            +  E P Y V+    ++E+R+Y   ++A+     T   G++D     GF +LA+YI    
Sbjct  20   MATEEPNYTVLSQMDDFELRRYDKQLVAQ-----TWVSGDQDSASREGFKVLADYIFGNN  74

Query  681  NPQNAKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
            N  + +  KI+MTAPVI    T+  S  S+EIAMTAPV  +   G+       +QF +PS
Sbjct  75   NAPSGESSKISMTAPVIMQPETKADSDESQEIAMTAPVSMQQTDGKWR-----VQFTMPS  129

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            +Y   +  PKP + +V+I E   + YGV+KFS  A +  V  K   L+  ++       G
Sbjct  130  QYT-IQTLPKPNNPKVEIVEVPAQIYGVIKFSWLAGEDKVATKTAELQTWMQTQNLTATG  188

Query  333  EFELGRYNPPWTLPPLKTNEVMI  265
            + EL RYNPPWTLP ++ NEVMI
Sbjct  189  KPELARYNPPWTLPFMRRNEVMI  211



>ref|WP_011514027.1| SOUL heme-binding protein [Psychrobacter cryohalolentis]
 ref|YP_580963.1| SOUL heme-binding protein [Psychrobacter cryohalolentis K5]
 gb|ABE75479.1| SOUL heme-binding protein [Psychrobacter cryohalolentis K5]
Length=220

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 110/199 (55%), Gaps = 11/199 (6%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E PKY V+     +E+R+Y   ++A+      Q   ++  GF +LA+YI       +
Sbjct  24   MATEEPKYTVLSQTEHFELRRYDEQLVAQTWVSGDQNTASR-AGFKVLADYIFGNNTAPS  82

Query  669  AKPEKIAMTAPVI----TRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
             +  KI+MTAPV      + SS  S++IAMTAPV  +   G+       +QF +PS+Y  
Sbjct  83   GESSKISMTAPVTMQSENKNSSDESQKIAMTAPVSMQQNDGKWR-----VQFTMPSQYT-  136

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             +  PKP +  ++I +   + YGV+KFSG A  + V  K   L+  ++    K+ GE EL
Sbjct  137  LQTLPKPNNSNIEIVKVPAKTYGVIKFSGLAGSEKVAAKTAELQSWMQAQKLKMSGEPEL  196

Query  321  GRYNPPWTLPPLKTNEVMI  265
             RYNPPWTLP ++ NE+MI
Sbjct  197  ARYNPPWTLPFMRRNEIMI  215



>ref|WP_037233137.1| heme-binding protein [Rhodomicrobium udaipurense]
 gb|KAI96120.1| heme-binding protein [Rhodomicrobium udaipurense JA643]
Length=218

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 102/193 (53%), Gaps = 11/193 (6%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            VE P + +     + E+R Y P + AE      Q R   + GF L+A YI     P+   
Sbjct  29   VEQPDFRIEKQDGDVEVRAYGPLIAAEAEVK-GQRREAINEGFRLIAAYIFGANQPKA--  85

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPK  484
              KI MTAPV         ++IAMTAPV  +GGG     ++ T++FI+P  +   E  P 
Sbjct  86   --KIEMTAPV-----EQQKQKIAMTAPVTQQGGGARDGDESWTVRFIMPKAWT-METLPT  137

Query  483  PLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPP  304
            P D RV+++    R++  ++FSG A D  + EK + L+R  E  G  I GE  L  Y+PP
Sbjct  138  PTDSRVRLEPIPPRRFLAIRFSGFAGDDAIREKTDELRRYAETHGLAIKGEPVLAFYDPP  197

Query  303  WTLPPLKTNEVMI  265
            WTLP ++ NEVM 
Sbjct  198  WTLPFMRRNEVMF  210



>ref|XP_002180141.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48332.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=231

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 112/215 (52%), Gaps = 16/215 (7%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAE--YEIRQYPPAVIAEVTYHPTQFRGNKDGG-FTLLAN  700
            MG I GK TV  P +EV++   +  YEIR+Y     A      T    N D   F  LA 
Sbjct  1    MGTIFGKQTVAEPAFEVLYRQTQQAYEIRRYATRFAAS-----TSTDANSDSAPFNALAR  55

Query  699  YIGALGNPQNAKPEKIAMTAPVITRessssse--EIAMTAPVVTKGGGGEGESKAVTMQF  526
            YIG  G P+N     I+MTAPV+  ESS SS+   +AMTAPVV       GE+  V M+F
Sbjct  56   YIGVFGTPENQGRTAISMTAPVVKEESSGSSQPEAMAMTAPVVKTPSDPNGEAGMV-MKF  114

Query  525  ILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGY  346
            ILP+ Y   E+ P+P + RV I+E       V ++SG+  D V   K   L + L  DG 
Sbjct  115  ILPAAYDSMEKIPQPTNPRVHIEEIPPAVGAVHRYSGSFDDTVSRNKARWLAQQLREDGV  174

Query  345  KI-----IGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             I     +  ++   YNPP+TLP  + NEV I ++
Sbjct  175  DITEDYAVEHYQFWGYNPPFTLPMFRRNEVWIELD  209



>gb|AAW50048.1| hypothetical protein FTT1651 [synthetic construct]
Length=243

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 108/203 (53%), Gaps = 14/203 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GAL  685
            I+G       KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA 
Sbjct  45   IVGINNTPQAKYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-  103

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYA  505
                N   + I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y 
Sbjct  104  ----NIAKQDIQMTAPV---KIEQSSQKIQMTAPVMVKGDTNN----EWTIAFVLPAQYT  152

Query  504  RAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFE  325
              E APKP + +VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E
Sbjct  153  -LENAPKPTNNKVKLVEKPETKMAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPE  211

Query  324  LGRYNPPWTLPPLKTNEVMIPVE  256
               YNPPWT+P L+TNEVMIP++
Sbjct  212  AAGYNPPWTIPFLRTNEVMIPIK  234



>ref|XP_002180145.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48336.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=231

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 112/215 (52%), Gaps = 16/215 (7%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAE--YEIRQYPPAVIAEVTYHPTQFRGNKDGG-FTLLAN  700
            MG I GK TV  P +EV++   +  YEIR+Y     A      T    N D   F  LA 
Sbjct  1    MGTIFGKQTVAEPAFEVLYRQTQQAYEIRRYATRFAAS-----TSTDANSDSAPFNALAR  55

Query  699  YIGALGNPQNAKPEKIAMTAPVITRessssse--EIAMTAPVVTKGGGGEGESKAVTMQF  526
            YIG  G P+N     I+MTAPV+  ESS SS+   +AMTAPVV       GE+  V M+F
Sbjct  56   YIGVFGTPENQGRTAISMTAPVVKEESSGSSQPEAMAMTAPVVKTPSDPNGEAGMV-MKF  114

Query  525  ILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGY  346
            ILP+ Y   E+ P+P + RV I+E       V ++SG+  D V   K   L + L  DG 
Sbjct  115  ILPAAYDSMEKIPQPTNPRVHIEEIPPAVGAVHRYSGSFDDAVSRNKARWLAQQLREDGV  174

Query  345  KI-----IGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             I     +  ++   YNPP+TLP  + NEV I ++
Sbjct  175  DITEDYAVEHYQFWGYNPPFTLPMFRRNEVWIELD  209



>ref|XP_001416988.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95281.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=200

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 108/210 (51%), Gaps = 27/210 (13%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            MG  LG+I+ E P+Y+V  A   YE+R Y    + E TY P + R  +   F  LA YIG
Sbjct  1    MGSALGRISEEQPRYDVARACDGYEVRTYEACCVIETTYDPRE-RDEQGKSFMRLAKYIG  59

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILP-S  514
             L  P+NA+ EKIAMTAPV           +   A   T+            MQF+LP S
Sbjct  60   VLSKPRNARDEKIAMTAPVF----------MTPDATAATR----------YVMQFVLPKS  99

Query  513  KYAR-AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKII  337
            K+   A +AP+ LD  V +K+   R     +FSG    + +E + E LK+ L+  G ++ 
Sbjct  100  KFPEGAAQAPRALDPEVAVKDVPARTMAARRFSGRMRKEEIEAQTEALKKALKAAGVQLA  159

Query  336  -GE---FELGRYNPPWTLPPLKTNEVMIPV  259
             GE    +   YNPPWT   ++TNEV++ +
Sbjct  160  HGEKTVVQYAGYNPPWTPGIMRTNEVLVEI  189



>ref|WP_029415390.1| heme-binding protein [Brevundimonas bacteroides]
Length=208

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 116/224 (52%), Gaps = 26/224 (12%)
 Frame = -1

Query  915  PHSRSLLHNILNSFEMGMILGKI-----TVETPKYEVIHAAAEYEIRQYPPAVIAEVTYH  751
            P SR +L  +L       ILG +       E P + ++     +E+R Y P V+AEVT  
Sbjct  4    PMSRLILCIVL-------ILGTLGTPAMATEEPAFTLVLRDGPFEVRDYGPTVVAEVTVA  56

Query  750  PTQFRGNKDGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTK  571
             +Q R +  G F +LA YI   G   N + + IAMTAPV     + +SE IAMTAPV   
Sbjct  57   GSQNRASSQG-FQILAGYI--FGG--NTRRQSIAMTAPV---AQNRTSETIAMTAPVTQT  108

Query  570  GGGGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVE  391
              G         ++FI+PS+Y  A   P P D RV ++E    +  VV+FSG A  + VE
Sbjct  109  ASGDRW-----AVRFIMPSEYTMAT-LPVPNDRRVTLREEPAHRMAVVRFSGIADARQVE  162

Query  390  EKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
             + + L + L   G +  G   L +Y+PPWTL  L+ NEVM PV
Sbjct  163  RREQELDQQLAARGMRRTGPITLAQYDPPWTLWFLRRNEVMAPV  206



>ref|WP_012280210.1| SOUL heme-binding protein [Francisella philomiragia]
 ref|YP_001677506.1| hypothetical protein Fphi_0784 [Francisella philomiragia subsp. 
philomiragia ATCC 25017]
 gb|ABZ87005.1| conserved hypothetical protein [Francisella philomiragia subsp. 
philomiragia ATCC 25017]
Length=207

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + +R Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKTDDNFSVRVYAPLTEAQVTVEDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+       G+ K+ T+ F+LP++Y   + APKP  
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMI-----AGDDKSWTIAFVLPAQYT-LQNAPKPTS  134

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            +++K+ E  E K  VV FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  135  DKIKLVEKPETKMAVVTFSGFLDKDSIDSNTTKLKTWIKANHYEIVGQPEAAGYNPPWTI  194

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  195  PFLRTNEVMIPIK  207



>ref|WP_028818386.1| heme-binding protein [beta proteobacterium SCGC AAA027-C02]
Length=188

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 111/201 (55%), Gaps = 19/201 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            + +E PKY +I  A  +E+R Y P ++AEV  +     G+ D     GF L+A YI    
Sbjct  1    MAIEEPKYSIIEKAEPFELRLYAPMIVAEVKVN-----GDLDDASSQGFRLIAGYIFG--  53

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
              QN   EKIAMT+PV   E S+ S +IAMTAPV       E  ++   + F++PS Y  
Sbjct  54   --QNQVTEKIAMTSPVAIEEQSTKSTKIAMTAPV-----SIEPNAEQWVVSFVMPSAYT-  105

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
                PKPL+ RV+++E    K  V++FSG  + + V +K   L++ ++    +     + 
Sbjct  106  LNSLPKPLNPRVQLREIPAVKRAVIQFSGFNSAQKVADKTLELEQWMKAQNLQATSAPKF  165

Query  321  GRYNPPWTLPPLKTNEVMIPV  259
             RYNPPW+LP ++ NEVMI V
Sbjct  166  ARYNPPWSLPFMRRNEVMIDV  186



>ref|WP_013921824.1| SOUL heme-binding protein [Francisella sp. TX077308]
 ref|YP_004646561.1| SOUL heme-binding protein [Francisella sp. TX077308]
 gb|AEI34961.1| SOUL heme-binding protein [Francisella sp. TX077308]
Length=207

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I    ++ +R Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  29   KYTNIKTDDDFSVRVYAPLTEAQVTVEDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  83

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+       G+ K+ T+ F+LP++Y   + APKP  
Sbjct  84   IQMTAPV---KIEQSSQKIQMTAPVMI-----AGDDKSWTIAFVLPAQYT-LQNAPKPTS  134

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            +++K+ E  E K  VV FSG      ++     LK  ++ + Y+I G+ E   YNPPWT+
Sbjct  135  DKIKLVEKPETKMAVVTFSGFLDKDSIDSNTTKLKTWIKANSYEIDGQPEAAGYNPPWTI  194

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  195  PFLRTNEVMIPIK  207



>ref|WP_027129553.1| SOUL heme-binding protein [Francisella tularensis]
Length=200

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 109/203 (54%), Gaps = 14/203 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GAL  685
            I+G       KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA 
Sbjct  11   IVGINNTPQAKYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-  69

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYA  505
                N   + I MTAPV   +   SS++I MTAPV+ KG      +   T+ F+LP++Y 
Sbjct  70   ----NIAKQDIQMTAPV---KIEQSSQKIQMTAPVMVKGD----TNNEWTIAFVLPAQYT  118

Query  504  RAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFE  325
              E APK  +++VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E
Sbjct  119  -LENAPKSTNDKVKLVEKPETKIAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPE  177

Query  324  LGRYNPPWTLPPLKTNEVMIPVE  256
               YNPPWT+P L+TNEVMIP++
Sbjct  178  AAGYNPPWTIPFLRTNEVMIPIK  200



>ref|WP_032734259.1| SOUL heme-binding protein [Francisella tularensis]
 gb|KHS52859.1| SOUL heme-binding protein [Francisella tularensis subsp. holarctica]
Length=214

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 105/193 (54%), Gaps = 14/193 (7%)
 Frame = -1

Query  831  KYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAKPEK  655
            KY  I     + IR Y P   A+VT   + ++   + GF  L  YI GA     N   + 
Sbjct  35   KYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYLFRYITGA-----NIAKQD  89

Query  654  IAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLD  475
            I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y   E APK  +
Sbjct  90   IQMTAPV---KIEQSSQKIQMTAPVMVKGDTNN----EWTIAFVLPAQYT-LENAPKSTN  141

Query  474  ERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTL  295
            ++VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+
Sbjct  142  DKVKLVEKPETKIAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTI  201

Query  294  PPLKTNEVMIPVE  256
            P L+TNEVMIP++
Sbjct  202  PFLRTNEVMIPIK  214



>ref|WP_007223851.1| hypothetical protein [marine gamma proteobacterium HTCC2143]
 gb|EAW32477.1| hypothetical protein GP2143_14516 [marine gamma proteobacterium 
HTCC2143]
Length=206

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 117/222 (53%), Gaps = 21/222 (9%)
 Frame = -1

Query  909  SRSLLHNILNSFEMGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGN  730
            S+ +L  +++    G I+    +E PKYEV+  A ++E+R Y P ++AE     T   G+
Sbjct  2    SKQILVTLISLLFSGQIMA---IEEPKYEVLEVAGDFELRAYNPMIVAE-----TIVDGS  53

Query  729  KDG----GFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGG  562
             D     GF  +A YI      +  + EK+ MTAPV  +  +     I+MT PV  K   
Sbjct  54   MDDASSQGFRRIAGYIFGDNTSKAGEIEKVNMTAPVTIQPKAEK---ISMTTPVTLKEEK  110

Query  561  GEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
            G        + F++PS+Y   +  P P +  V ++E   +K+ V+ FSG A ++ V  K 
Sbjct  111  GSWR-----IHFVMPSEYT-MDTLPTPDEANVTLREVPAQKFAVIIFSGFAGEEKVALKT  164

Query  381  EMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
            +ML + L   G +  G+ +L RYNPPWTLP  + NEVMI ++
Sbjct  165  QMLLQWLAEKGIRQQGKPQLARYNPPWTLPFFRRNEVMIAIK  206



>ref|WP_022951274.1| SOUL heme-binding protein [Leucothrix mucor]
Length=214

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 103/193 (53%), Gaps = 9/193 (5%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            +E P Y VI  +  +E+R Y P +IAEVT   +  +   + GF ++A YI      Q   
Sbjct  29   IEEPTYSVIEKSGAFELRAYEPKIIAEVTVSGS-MKQASNKGFKMIAGYIFGGNTSQQGD  87

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPK  484
             EKI+MT PV    S S    I+MTAPV+ + G  +       + F++PSKY  A   PK
Sbjct  88   AEKISMTTPVTMEPSGSEK--ISMTAPVMMQQGDSQWR-----VHFVMPSKYTMAT-LPK  139

Query  483  PLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPP  304
            P +  V ++E  ++ Y V++FSG A  + V      L++ L        G+ EL RY+PP
Sbjct  140  PNNSEVTLREIPKQNYAVIRFSGLAGPQKVANMTASLEKWLATKNITPTGKPELSRYDPP  199

Query  303  WTLPPLKTNEVMI  265
            WT+P  + NEVM+
Sbjct  200  WTIPLFRRNEVMV  212



>ref|XP_005715111.1| unnamed protein product [Chondrus crispus]
 emb|CDF35292.1| unnamed protein product [Chondrus crispus]
Length=204

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 103/214 (48%), Gaps = 30/214 (14%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQF----RGNKDGGFTLLA  703
            MG   G    ETP + V+     YE+ +YP +V A V     Q     R  +D  F+LLA
Sbjct  1    MGGTHGIARTETPAHTVLQGGGRYEVWRYPSSVAAVVRVTDVQRAATDRAFRDAAFSLLA  60

Query  702  NYIGALGNPQNA----KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVT  535
             YIG    P NA    +PEKIAMT+PV                 V+T G       +  +
Sbjct  61   RYIGVFSRPHNATVGNRPEKIAMTSPV-----------------VMTPGA----HERTHS  99

Query  534  MQFILPSKYARAEEAPKPLDERVKIKEG-GERKYGVVKFSGTATDKVVEEKVEMLKRCLE  358
            M+F+LPS+Y   EEAP P D  VK++     R   V++FSG     V  ++   L R LE
Sbjct  100  MRFLLPSRYRSVEEAPAPTDAAVKLEMAPAGRVEAVLRFSGNMDMGVAAQRAAELGRLLE  159

Query  357  RDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
             DG K  G +    Y+PP+  P +K NEV  P++
Sbjct  160  EDGLKPTGAWIACAYDPPFMPPMMKRNEVHFPLD  193



>gb|AIT09539.1| SOUL heme-binding protein [Francisella sp. FSC1006]
Length=207

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 108/203 (53%), Gaps = 15/203 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GAL  685
            I G   V   KY+ I     + +R Y P   A+VT   + ++   + GF  L  YI GA 
Sbjct  19   IFGINNVPEAKYKDIKKDDNFSVRLYAPLTEAQVTVEDSNYKSAVNKGFNYLFKYITGA-  77

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYA  505
                N   + I MT PV   +    S++I MTAPV+       G+  + T+ F+LP++Y 
Sbjct  78   ----NISKQDIQMTTPV---KIEQESQKIQMTAPVMI-----AGDDNSWTIAFVLPAQYT  125

Query  504  RAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFE  325
              + AP P +++VKI E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E
Sbjct  126  -LKNAPTPTNDKVKIVEKPEAKMAVITFSGFLDKDTIDSNTTKLKTWIKSNNYEIVGQPE  184

Query  324  LGRYNPPWTLPPLKTNEVMIPVE  256
               YNPPWT+P ++TNEVMIP++
Sbjct  185  AAGYNPPWTIPFMRTNEVMIPIK  207



>ref|XP_007511227.1| SOUL heme-binding protein [Bathycoccus prasinos]
 emb|CCO66787.1| SOUL heme-binding protein [Bathycoccus prasinos]
Length=204

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 106/206 (51%), Gaps = 18/206 (9%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            I GKI  E+P + ++   AEYEIR+Y  A+  E +Y      G +   F  LA YIG + 
Sbjct  7    IFGKINEESPHFSLLKKTAEYEIRRYAQAIAVETSYEAEHVLGGQGKSFMSLAKYIGVMS  66

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
             P+N + EKI+MTAPV              +   V +   G+ E +   M+F LP+   +
Sbjct  67   KPENEREEKISMTAPV--------------SMGKVVEAPKGDKEQQRYNMRFFLPASEIK  112

Query  501  AE-EAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD-GYKIIGE-  331
            ++ EAP+P  E V++ +  ER   V  FSG      V+E  + L   L  D   K + E 
Sbjct  113  SKSEAPQPSKENVRVVDVPERTVAVRTFSGYFRKANVDENTKALLESLRGDEEVKNVKED  172

Query  330  -FELGRYNPPWTLPPLKTNEVMIPVE  256
              E+  +NPPWT+  L+TNEV++P +
Sbjct  173  HVEVFGWNPPWTISFLRTNEVLVPCD  198



>ref|WP_012429035.1| SOUL heme-binding protein [Francisella tularensis]
 ref|YP_001890916.1| soul domain-containing protein [Francisella tularensis subsp. 
mediasiatica FSC147]
 gb|ACD30138.1| soul domain protein [Francisella tularensis subsp. mediasiatica 
FSC147]
Length=208

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 107/203 (53%), Gaps = 14/203 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GAL  685
            I+G       KY  I     + IR Y P   A+VT   + ++   + GF     YI GA 
Sbjct  19   IIGINNTPQAKYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYPFRYITGA-  77

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYA  505
                N   + I MTAPV   +   SS++I MTAPV+ KG          T+ F+LP++Y 
Sbjct  78   ----NIAKQDIQMTAPV---KIEQSSQKIQMTAPVMVKGDTNN----EWTIAFVLPAQYT  126

Query  504  RAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFE  325
              E APKP + +VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E
Sbjct  127  -LENAPKPTNNKVKLVEKPETKMAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPE  185

Query  324  LGRYNPPWTLPPLKTNEVMIPVE  256
               YNPPWT+P L+TNEVMIP++
Sbjct  186  AAGYNPPWTIPFLRTNEVMIPIK  208



>ref|XP_002291840.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90691.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=202

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 107/212 (50%), Gaps = 20/212 (9%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVI---HAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLAN  700
            MG + GK TV  P ++V+   + A  YE+R+Y     A  TY       + D  F  LA 
Sbjct  1    MGSVFGKETVAEPHFDVLLERNTATTYEVRKYGERFAATCTYEANASGDSMDSPFRTLAQ  60

Query  699  YIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGG-GGEGESKAVTMQFI  523
            YIG  G PQN     I+MTAPV T     S   I MTAPV T+   GG+       M+F+
Sbjct  61   YIGVFGTPQNEGGRSISMTAPVAT-----SGTLIDMTAPVTTENTVGGQK-----VMKFM  110

Query  522  LPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYK  343
            LP++Y   ++ PKP +  + I++   +   V +F+G   D+   E    L R L +DG K
Sbjct  111  LPAEYDSLDKIPKPTNPAITIEDIPPQTGAVHRFNGAFDDEHNREMALKLGRQLMQDGVK  170

Query  342  IIGE------FELGRYNPPWTLPPLKTNEVMI  265
             I E      ++   YNPPWTLP  + NEV I
Sbjct  171  NITEAAVLESYQSFGYNPPWTLPFFRRNEVWI  202



>ref|WP_009022254.1| soul heme-binding protein [gamma proteobacterium NOR5-3]
 gb|EED32876.1| soul heme-binding protein [gamma proteobacterium NOR5-3]
Length=190

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 106/195 (54%), Gaps = 10/195 (5%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            + ++ P Y V+  + + E+R Y P ++AE T  P       + GF L+A YI    + ++
Sbjct  1    MAIDEPSYTVLEKSGDVELRAYDPMIVAE-TLVPGAMDSASNQGFRLIAGYIFGKNSARS  59

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
             + EKI+MTAPV  +        I MT PV T+  G +       + F++PS+Y+  +  
Sbjct  60   GEAEKISMTAPVTLQAVPEK---IDMTTPVTTEKVGEQWR-----VHFVMPSEYS-MDTL  110

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P P +  V+++E  +  Y V++FSG   +K    K+  L++ L+      +G  EL RYN
Sbjct  111  PVPDNPAVRLREVPQAHYAVLRFSGLVNEKKRAAKIAELRQWLKARNITAVGAPELARYN  170

Query  309  PPWTLPPLKTNEVMI  265
            PPWTLP L+ NE+MI
Sbjct  171  PPWTLPFLRRNEIMI  185



>ref|WP_010932797.1| hypothetical protein [Chlorobaculum tepidum]
 ref|NP_662010.1| hypothetical protein CT1119 [Chlorobium tepidum TLS]
 gb|AAM72352.1| lipoprotein, putative [Chlorobium tepidum TLS]
Length=215

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 105/202 (52%), Gaps = 13/202 (6%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            +LGK     P YE++     +E+R+Y P VIAE       +      GF  LA YI    
Sbjct  18   VLGKREAAEPPYELLKHDGAFEVRRYGPMVIAETILDEKSYSAASGKGFNRLAGYIFG--  75

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
              +N     I+MTAPV+   SS     I+MTAPV+ +   G       +M F+LP  +  
Sbjct  76   --KNRSKTSISMTAPVLQERSSEK---ISMTAPVLQQPQKG-----GWSMAFVLPEGFT-  124

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             + AP+PLD  VK++E       VV FSG  +   +E+    L+  L++ GY+ + E +L
Sbjct  125  LQSAPEPLDPEVKLRELPPSTIAVVTFSGLHSAANLEKYSRQLQAWLKKQGYRALSEPKL  184

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
              Y+PPWT+P L+ NEV I +E
Sbjct  185  ASYDPPWTIPFLRRNEVQIRIE  206



>ref|WP_012475749.1| SOUL heme-binding protein [Chlorobium phaeobacteroides]
 ref|YP_001960768.1| SOUL heme-binding protein [Chlorobium phaeobacteroides BS1]
 gb|ACE05287.1| SOUL heme-binding protein [Chlorobium phaeobacteroides BS1]
Length=205

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 104/201 (52%), Gaps = 14/201 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            +LGK T + P Y ++     +EIR+Y   +IAE T     +R     GF+ LA YI    
Sbjct  18   VLGKRTADEPGYSIVKKDGAFEIREYDAMIIAE-TLLDGSYRSTSGKGFSKLAKYIFG--  74

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
               N   EKIAMTAPV+          I+MTAPV+ +  G + +     M F++P++Y  
Sbjct  75   --SNVGSEKIAMTAPVLQEAEGEK---ISMTAPVIQEKAGTKWK-----MAFVMPAEYT-  123

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             +  PKP+D  + I+E   RK   V++SG  ++K +      L   LE+ G K +     
Sbjct  124  LQNLPKPVDPDILIREVPARKVASVRYSGLHSEKNIANWSAKLTEWLEKQGVKAVSVPRS  183

Query  321  GRYNPPWTLPPLKTNEVMIPV  259
              Y+PPWT+P L+ NE+ I V
Sbjct  184  ASYDPPWTIPFLRRNEIHIDV  204



>ref|WP_006975652.1| SOUL heme-binding protein [Plesiocystis pacifica]
 gb|EDM75199.1| SOUL heme-binding protein [Plesiocystis pacifica SIR-1]
Length=234

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 10/200 (5%)
 Frame = -1

Query  858  LGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGN  679
            L +  VETP YEVI +   +E+R+Y P ++AEV    T      + GF +LA++I   GN
Sbjct  36   LARGRVETPAYEVIASFDAFEVRRYAPRLVAEVEVQGTG-PAASNAGFRVLADFI--FGN  92

Query  678  PQNAKPEKIAMTAPVITRessssseEIAMTAPV-VTKGGGGEGESKAVTMQFILPSKYAR  502
              N+   ++AMTAPV  R +++ SE I MTAPV  T+   GEG+ K V + F +PSKY R
Sbjct  93   --NSANTEVAMTAPV-DRTAAARSEAIDMTAPVDRTQVADGEGKPKWV-VAFTMPSKYTR  148

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG-EFE  325
             +  P P D RV I+   ER    V+FSG   +  V+ K+  L   ++ +G    G E  
Sbjct  149  -DTLPTPNDPRVHIRVVPERVVAAVRFSGAPAEAAVQNKMAALVAAVDAEGLTRDGSEPT  207

Query  324  LGRYNPPWTLPPLKTNEVMI  265
              RY+PPWT   L+ NE+M+
Sbjct  208  YARYDPPWTPGVLRRNEIMV  227



>dbj|BAP88785.1| SOUL domain heme-binding protein [Burkholderiales bacterium GJ-E10]
Length=233

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 112/224 (50%), Gaps = 21/224 (9%)
 Frame = -1

Query  909  SRSLLHNILNSFEMGMILGKI-------TVETPKYEVIHAAAEYEIRQYPPAVIAEVTYH  751
            +R     IL    +G I+ +         VE P ++ +     +EIR YP  V+AEVT  
Sbjct  22   ARHYAGRILKGIVLGAIVTRTLLGGPAAAVEEPAFQSVVRDGAFEIRDYPALVVAEVTVT  81

Query  750  PTQFRGNKDGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTK  571
              Q    + G F LLA YI   G   N + + IAMTAPV       + E+IAMTAPV   
Sbjct  82   GEQKEAARKG-FRLLAAYI--FGG--NGRKQGIAMTAPV---TQEMTGEKIAMTAPVTQT  133

Query  570  GGGGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVE  391
            G  GE       ++F +PS+Y+  E  PKP D RV+++     +  V++FSG A    V 
Sbjct  134  GTDGEW-----IVRFTMPSRYS-LETLPKPNDARVRLRVTPPVRVAVIRFSGLAQPDDVA  187

Query  390  EKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
             K   L   ++R      G   L +YNPPWTL  L+ NEVMIP+
Sbjct  188  AKTAELTEWMQRRHLHRAGPASLAQYNPPWTLWFLRRNEVMIPI  231



>ref|XP_004305335.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=270

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 111/201 (55%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET KY+V+    +YEIR+  P  IAE T    T F  N     F +LA Y+      +N
Sbjct  74   LETVKYKVLSRRDQYEIREVEPYFIAEATMPGKTGFDFNGASQSFNVLAEYLFG----KN  129

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
             K EK+ MT PV TR++ S  E++ MT PV+TK    E + K   M F++PSKY      
Sbjct  130  TKQEKMEMTTPVFTRKAQSDGEKMEMTTPVITKRVEDEDKWK---MSFVMPSKYG--ANL  184

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  VK+KE   +   VV FSG  TD+V++++   L+  LE D    + E    E+ 
Sbjct  185  PLPKDPSVKVKEVPRKLVAVVAFSGFVTDEVIKQRESKLREALENDRQFQVKEGTAVEVA  244

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  245  QYNPPFTLPFQRRNEISLEVE  265



>ref|WP_008106880.1| hypothetical protein [Methylophilales bacterium HTCC2181]
 gb|EAV47027.1| hypothetical protein MB2181_03100 [Methylophilales bacterium 
HTCC2181]
Length=205

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 96/197 (49%), Gaps = 11/197 (6%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E P++ +IH    +EIR+YPP  IA+V      F      GF  LANYI    N   
Sbjct  19   MATEEPEFTLIHKENNFEIREYPPRFIAQVNVS-GDFDEASSKGFKALANYIFG-NNTLV  76

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
                KIAMTAPV+     +    IAMT PV+ +    +       + F++P +Y   +  
Sbjct  77   DGSHKIAMTAPVLAEPKLNK---IAMTTPVLAQSVNNDW-----LITFVMPKEYT-FKNL  127

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            PKP +  VKI E    KY VV FSG   +    EK  +L   +  +     G   + RYN
Sbjct  128  PKPNNSEVKILELPVEKYAVVVFSGLVRESSYNEKAVLLNDFVISNQLNTDGPIMIARYN  187

Query  309  PPWTLPPLKTNEVMIPV  259
            PPWTLP  + NE+MI V
Sbjct  188  PPWTLPFFRRNELMIKV  204



>ref|WP_012506689.1| SOUL heme-binding protein [Prosthecochloris aestuarii]
 ref|YP_002016805.1| SOUL heme-binding protein [Prosthecochloris aestuarii DSM 271]
 gb|ACF47158.1| SOUL heme-binding protein [Prosthecochloris aestuarii DSM 271]
Length=206

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 103/201 (51%), Gaps = 14/201 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            ++GK T   P Y V H   ++EIR Y P ++A    + + +    +  F  LA YI    
Sbjct  19   VIGKRTAAEPPYSVEHRDGDFEIRSYGPVIVASTVVNGS-YGQTSNKAFGRLAGYIFG--  75

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
              +N   +KI+MTAPVI          IAMTAPV+        E  A  M+F++P +Y  
Sbjct  76   --RNIGKQKISMTAPVIQEAEGEK---IAMTAPVIQAK-----EGSAWRMEFVMPEEYT-  124

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  PKPLD  + I+E   RK   V+++G  + + ++     L   L+++GY+ I     
Sbjct  125  METLPKPLDPEISIREIAPRKVASVRYTGLHSARNIDRWSAKLTAWLDQEGYRAISPPRA  184

Query  321  GRYNPPWTLPPLKTNEVMIPV  259
              Y+PPWT+P L+ NE+ I V
Sbjct  185  ASYDPPWTIPFLRRNEIHIDV  205



>ref|WP_023459644.1| hypothetical protein [Asticcacaulis sp. AC466]
 gb|ESQ82301.1| hypothetical protein AEAC466_18310 [Asticcacaulis sp. AC466]
Length=211

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 116/217 (53%), Gaps = 27/217 (12%)
 Frame = -1

Query  879  SFEMGMIL------GKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNK---  727
            SF + M L        + VE P ++++   ++ EIR YP  + AE         G++   
Sbjct  9    SFYLSMALVALSAGSAMAVEEPAFKLVTKDSDIEIRDYPALIAAEA-----HVSGDRQPA  63

Query  726  -DGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGE  550
             + GF L+A+YI   GN  N +  K+AMTAPV   +S+S  E+IAMTAPV   G G    
Sbjct  64   INEGFRLIADYI--FGN--NRQKSKVAMTAPVT--QSASGGEKIAMTAPVTQAGDG----  113

Query  549  SKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLK  370
             K   ++FI+PS+Y  A   P+P + RV +     ++  V++FSG A +  +  + + LK
Sbjct  114  -KTWVVRFIMPSRYTMAT-LPQPNNARVSLVTIAPQRVAVIRFSGLAGETDITTRTQQLK  171

Query  369  RCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
              L        G+  L RY+PPWTL  L+ NE++IP+
Sbjct  172  AWLNARHLTTEGDVTLARYDPPWTLWFLRRNELLIPI  208



>ref|XP_009627513.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Nicotiana tomentosiformis]
Length=299

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 110/202 (54%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGG---FTLLANYIGALGNPQ  673
            +ET K+ V+  + +YEIR+  P  +AE T  P ++  + +G    F  LA Y+      +
Sbjct  104  LETVKFNVLKRSDQYEIREVEPYFVAEATM-PGKYGFDFNGASQSFNTLAEYLFG----K  158

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N K E +AMT PVITR + S  E + MT PV+TK    +G+ +   M F++PSKY    +
Sbjct  159  NTKKESMAMTTPVITRRTQSDGERMEMTTPVITKRVEDQGKWR---MSFVMPSKY--GSD  213

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG---YKIIGEFEL  322
             P P D  V IKE   +   VV FSG  TD+ V+ +   L+  L+ D     K     E+
Sbjct  214  LPLPKDSSVTIKEVPRKTVAVVAFSGFVTDEEVKARESRLRAALKGDAEFRVKDGASIEV  273

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  274  AQYNPPFTLPFTRRNEISLEVE  295



>gb|KHD88266.1| heme-binding protein [Bdellovibrio sp. ArHS]
Length=186

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 111/200 (56%), Gaps = 18/200 (9%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQ  673
            + +E P+Y+V    A YE+RQY P V+AE T   + F    +  F +LA YI GA     
Sbjct  1    MAIEEPEYKVESIGAHYEVRQYKPLVVAETTIE-SDFESAGNQAFRILAAYIFGA-----  54

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVV-TKGGGGEGESKAVTMQFILPSKYARAE  496
            N    KIAMTAPV      + SE+I MTAPV  T+   G        +QF +P KY+ A 
Sbjct  55   NKSKTKIAMTAPV---NQQAVSEKIEMTAPVTQTRNATG------FLVQFTMPKKYSLAT  105

Query  495  EAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGR  316
              P+P D RV +++   RK  V  +SG+ ++   +EK+++L+  L++ G +  GE  L R
Sbjct  106  -LPEPDDSRVHLRQLPARKVAVYTYSGSWSESRYQEKLKILQESLKKAGLETAGEPVLAR  164

Query  315  YNPPWTLPPLKTNEVMIPVE  256
            YN P+ L  L+ NE+ I ++
Sbjct  165  YNSPFQLWFLRRNEIWIEIK  184



>emb|CDS53917.1| hypothetical protein [Polaromonas sp. CG9_12]
Length=206

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 114/212 (54%), Gaps = 24/212 (11%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            + VE P+++V+     YE+R+Y P ++AE     T   G+ D     GF L+A+YI   G
Sbjct  3    MAVEEPRFDVLTQDGSYEVRRYAPVIVAE-----TLVDGDMDAASSKGFRLIADYI--FG  55

Query  681  N-------PQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVT---M  532
            N        +NA  EKIAMTAPV T E  + S +IAMTAPV  +    +      +   +
Sbjct  56   NNTLAATGAENAS-EKIAMTAPV-TLEPVARSAKIAMTAPVTAEPVAADASMATASQWRI  113

Query  531  QFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD  352
             F++P +Y+  +  PKP++  V ++E   R + V+ +SG  T   V++K + L   +   
Sbjct  114  HFVMPGQYSM-QTLPKPVNAAVSLRELPARTFAVLGYSGLNTASKVQQKTDELAAWMRSR  172

Query  351  GYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
              + +G   L RY+PPWTLP  + NE+ + V+
Sbjct  173  QLQPVGAPLLARYDPPWTLPMWRRNEIQVEVK  204



>ref|WP_019954950.1| hypothetical protein [Loktanella vestfoldensis]
Length=187

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 107/197 (54%), Gaps = 14/197 (7%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +++E PK+ +     ++EIR Y  +V+AEVT    Q   +  G F LLA YI   G   N
Sbjct  1    MSIEEPKFTLALKDGDFEIRDYAASVVAEVTVTGDQTTASSTG-FRLLAGYI--FGG--N  55

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
            A  +KIAMTAPV     +   E+IAMTAPV    G G+       ++F +P++YA A+  
Sbjct  56   ASRQKIAMTAPV---TKTPKGEKIAMTAPVTVIAGTGDW-----LVRFTMPARYALAD-L  106

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P P D  V ++     ++ V++FSG + +  V  +   L   +   G + +G   + RYN
Sbjct  107  PVPNDPAVTLRSVPAARFAVLRFSGFSAETKVAAETGRLLEIVRARGLRPVGPVSIARYN  166

Query  309  PPWTLPPLKTNEVMIPV  259
            PPWT   L+ NEVM+PV
Sbjct  167  PPWTPWFLRRNEVMLPV  183



>ref|WP_036809541.1| hypothetical protein [Polaromonas sp. CG9_12]
Length=214

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 114/212 (54%), Gaps = 24/212 (11%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            + VE P+++V+     YE+R+Y P ++AE     T   G+ D     GF L+A+YI   G
Sbjct  11   MAVEEPRFDVLTQDGSYEVRRYAPVIVAE-----TLVDGDMDAASSKGFRLIADYI--FG  63

Query  681  N-------PQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVT---M  532
            N        +NA  EKIAMTAPV T E  + S +IAMTAPV  +    +      +   +
Sbjct  64   NNTLAATGAENAS-EKIAMTAPV-TLEPVARSAKIAMTAPVTAEPVAADASMATASQWRI  121

Query  531  QFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD  352
             F++P +Y+  +  PKP++  V ++E   R + V+ +SG  T   V++K + L   +   
Sbjct  122  HFVMPGQYSM-QTLPKPVNAAVSLRELPARTFAVLGYSGLNTASKVQQKTDELAAWMRSR  180

Query  351  GYKIIGEFELGRYNPPWTLPPLKTNEVMIPVE  256
              + +G   L RY+PPWTLP  + NE+ + V+
Sbjct  181  QLQPVGAPLLARYDPPWTLPMWRRNEIQVEVK  212



>ref|WP_036772511.1| hypothetical protein [Polaromonas glacialis]
Length=204

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 112/207 (54%), Gaps = 14/207 (7%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            + VE PK+EV       E+R+Y P ++AE TY           GF L+A+YI   GN Q 
Sbjct  1    MAVEEPKFEVTVKDGNCEVRRYAPVIVAE-TYVEGDMDAASRQGFKLIADYI--FGNNQL  57

Query  669  A------KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVT---MQFILP  517
            A        EKIAMTAPV T E  ++S +IAMTAPV  +         + T   + F++P
Sbjct  58   AGTAPDKASEKIAMTAPV-TAEPVAASGKIAMTAPVTVEPVAAAASMASATQWRIHFVMP  116

Query  516  SKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKII  337
            S+Y+  +  PKP +E VK++    R + V+ +SG  T   V+EK + L   ++    + +
Sbjct  117  SQYS-MQTLPKPNNEAVKLRAVPARTFAVLSYSGFNTASRVQEKTDELALWMKSKNLQAV  175

Query  336  GEFELGRYNPPWTLPPLKTNEVMIPVE  256
               +L RY+PPWTLP  + NE+ + ++
Sbjct  176  SVPQLARYDPPWTLPMWRRNEIQMEIK  202



>gb|ESQ73595.1| hypothetical protein ABAC402_18400 [Asticcacaulis sp. AC402]
Length=195

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 110/202 (54%), Gaps = 22/202 (11%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKD----GGFTLLANYIGALG  682
            + +E P ++ + +   + +R Y   + AEV     +  G++D     GF+L+A+YI   G
Sbjct  10   MAIEEPAFKTVRSEGAFALRDYDAMIAAEV-----RVEGSRDKAINAGFSLIADYI--FG  62

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
            N  N K  KIAMT PV     +  SE+IAMTAPV   G G        T++FI+P++Y  
Sbjct  63   N--NRKKSKIAMTTPV---TQAPVSEKIAMTAPVTQSGEGSSW-----TVRFIMPARYT-  111

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P+P D RV +     +++ VV+FSG A++  + E+   L+  +        G   L
Sbjct  112  METLPQPNDSRVTLVPLPAQRFAVVRFSGLASEAEITERTAQLQAWIVVQKLNPEGAPTL  171

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             RY+PPWTL  L+ NE++IPV+
Sbjct  172  ARYDPPWTLWFLRRNELLIPVK  193



>ref|WP_031236083.1| heme-binding protein [Asticcacaulis sp. AC402]
Length=210

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 110/202 (54%), Gaps = 22/202 (11%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKD----GGFTLLANYIGALG  682
            + +E P ++ + +   + +R Y   + AEV     +  G++D     GF+L+A+YI   G
Sbjct  25   MAIEEPAFKTVRSEGAFALRDYDAMIAAEV-----RVEGSRDKAINAGFSLIADYI--FG  77

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
            N  N K  KIAMT PV     +  SE+IAMTAPV   G G        T++FI+P++Y  
Sbjct  78   N--NRKKSKIAMTTPV---TQAPVSEKIAMTAPVTQSGEGSSW-----TVRFIMPARYT-  126

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P+P D RV +     +++ VV+FSG A++  + E+   L+  +        G   L
Sbjct  127  METLPQPNDSRVTLVPLPAQRFAVVRFSGLASEAEITERTAQLQAWIVVQKLNPEGAPTL  186

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             RY+PPWTL  L+ NE++IPV+
Sbjct  187  ARYDPPWTLWFLRRNELLIPVK  208



>ref|XP_004029760.1| hypothetical protein IMG5_173800 [Ichthyophthirius multifiliis]
 gb|EGR28524.1| hypothetical protein IMG5_173800 [Ichthyophthirius multifiliis]
Length=211

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 110/210 (52%), Gaps = 29/210 (14%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIG  691
            +G I G    + P+++++     Y+IR+    +IA+V         N++  F +LANYIG
Sbjct  8    IGQIFGFNGSKEPQFQLLKQQP-YQIRKIQSYIIAKVQIK----NKNENQAFRILANYIG  62

Query  690  ALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSK  511
            A G P N K + +AMTAPV+          I MT PV+ +            + F+LP +
Sbjct  63   AFGKPFNTKSKSLAMTAPVLKEPIK-----IQMTTPVLNQNE---------FLSFVLPFE  108

Query  510  YARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE  331
            Y++ ++ P+P D+ +  ++  E+   V +FSG   DK+ + K+E L + ++ D +  I E
Sbjct  109  YSQIDQVPEPNDKEIVFEKVDEQVVAVCQFSGITNDKIFKSKLEELYKQIKNDRF--INE  166

Query  330  --------FELGRYNPPWTLPPLKTNEVMI  265
                    ++  RYNPP+ +P ++ NEV I
Sbjct  167  EENIEQLNYQFARYNPPFCIPFMRRNEVWI  196



>ref|XP_002882654.1| soul heme-binding family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58913.1| soul heme-binding family protein [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 110/206 (53%), Gaps = 24/206 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET ++ V+    +YEIRQ  P  +AE T        F G     F +LA Y+      +
Sbjct  122  LETMEFRVVSRTDKYEIRQVEPYFVAETTMPGETGFDFYG-ASKSFNVLAEYLFG----K  176

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N + EK+ MT PV+TR++ S  E++ MT PV+T     + + +   M F++PSKY     
Sbjct  177  NTRKEKMEMTTPVVTRKAQSVGEKMEMTTPVITTKAKDQTQWR---MSFVMPSKYG--SN  231

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLE-------RDGYKIIG  334
             P P D  VKI E   +   VV FSG  TD+ +E + + L+R L+       RDG  +  
Sbjct  232  LPLPKDSSVKILEVPRKIVAVVAFSGYVTDEEIERREQELRRALQNDKKFRVRDGVSV--  289

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
              E+ +YNPP+TLP ++ NEV + VE
Sbjct  290  --EVAQYNPPFTLPFMRRNEVSLEVE  313



>ref|WP_027458263.1| hypothetical protein [Dechloromonas agitata]
Length=216

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 104/201 (52%), Gaps = 22/201 (11%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            +  E PK+E +      EIR+Y P ++AE     T   G+ D     GF  +A+YI   G
Sbjct  21   MATEEPKFESLRQEDNIEIRRYVPVIVAE-----TFVDGDMDSATRRGFQRIADYI--FG  73

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKA----VTMQFILPS  514
            N      E+IAMT PV+      + + IAMT PV  +         A      + F++PS
Sbjct  74   NN-----ERIAMTVPVVAEPQDKAEK-IAMTVPVSIEPQEAAATRMAGAQRWRIHFVMPS  127

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            +Y  A   PKPL+  + ++E   R Y V+ +SG+ T   V+E+ + L   L+  G   IG
Sbjct  128  QYTLAT-LPKPLNPAIGLREIPARTYAVLTYSGSNTASTVQERTDQLLAWLQAQGIAPIG  186

Query  333  EFELGRYNPPWTLPPLKTNEV  271
            + +L RYNPPWTLP L+ NE+
Sbjct  187  QPQLARYNPPWTLPFLRRNEI  207



>ref|XP_010543498.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=253

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 107/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+    +YEIR+  P  +AE T        F G     F +LA Y+      +
Sbjct  57   LETVNFRVLSRTDKYEIREVEPYFVAETTMPGKGGFDFYG-ASKSFNVLAEYLFG----K  111

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR + S  E++ MT PV+TK GG +   +   M F++PSKY     
Sbjct  112  NTMTEKMEMTTPVVTRRTQSEGEKMEMTTPVITKRGGDQAHWR---MSFVMPSKY--GAN  166

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD-GYKII--GEFEL  322
             P P D  V+I+E   +   VV FSG  TD+ VE     L+  L+RD  Y++      E+
Sbjct  167  LPSPKDPSVRIQEVPRKIVAVVSFSGYVTDEEVERMERELRHALKRDRKYRVKNGASVEV  226

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  227  AQYNPPFTLPFTRRNEVSLEVE  248



>gb|EXJ14184.1| hypothetical protein D779_2855 [Thiorhodococcus sp. AK35]
Length=195

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 106/198 (54%), Gaps = 8/198 (4%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            + +E P YEV      +E+RQY P ++AE T     F    +  F +LA+YI   GN  N
Sbjct  1    MAIEEPSYEVTRTYPMFELRQYAPYLVAE-TEVGDDFDEAGNRAFRILADYI--FGN--N  55

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
                K+ MTAPV  R +    E+I MTAPV  + G  EG+S    + F++PS Y+  E  
Sbjct  56   RSKTKMEMTAPVNQRPAEDQGEKIRMTAPVSQQAG--EGKSGTYVVSFVMPSGYS-LETL  112

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P P D RV ++E   +   V ++SG  T K  EE + +L+  +   G +  GE    RYN
Sbjct  113  PTPNDSRVNLREEPAKLMAVRRYSGRWTRKNYEENLGVLRLAIREAGLETTGEPVYARYN  172

Query  309  PPWTLPPLKTNEVMIPVE  256
            PP+T   ++ NEVM+ ++
Sbjct  173  PPFTPWFMRRNEVMLEID  190



>ref|XP_003055781.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61033.1| predicted protein [Micromonas pusilla CCMP1545]
Length=177

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 94/208 (45%), Gaps = 36/208 (17%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTY--HPTQFRGNKDGGFTLLANY  697
            MG +LGKI+ E P++EV+   A YEIR+Y P V+AE TY      F G++ G F  LA Y
Sbjct  1    MGSVLGKISEELPRHEVLAKTAAYEIRRYAPCVVAETTYVSRDGMFSGDQGGSFMKLAKY  60

Query  696  IGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILP  517
            IG +  PQNA+   IAMT+PV+   +                  G         M F LP
Sbjct  61   IGVMAKPQNAEAAPIAMTSPVLMERAPGGGGGSGGGGGSGDGDHG-------FKMCFFLP  113

Query  516  -SKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKI  340
             S++ +A +AP P    V I++   R      FSG                         
Sbjct  114  ASRFRKAADAPTPTSPEVAIRDVPARVMATKTFSGNLC----------------------  151

Query  339  IGEFELGRYNPPWTLPPLKTNEVMIPVE  256
                +   YNPPWT   LKTNEVM+ V+
Sbjct  152  ----QAAGYNPPWTPWFLKTNEVMLEVQ  175



>ref|WP_011473650.1| heme-binding protein [Rhodopseudomonas palustris]
 ref|YP_533080.1| SOUL heme-binding protein [Rhodopseudomonas palustris BisB18]
 gb|ABD88761.1| SOUL heme-binding protein [Rhodopseudomonas palustris BisB18]
Length=214

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 116/223 (52%), Gaps = 25/223 (11%)
 Frame = -1

Query  900  LLHNILNSFEMGMILGKITV-------ETPKYEVIHAAAE-YEIRQYPPAVIAEVTYHPT  745
            +L ++  SF   ++ G I++       E P+Y+VI    +  EIR YP  + AE T   +
Sbjct  1    MLQSVF-SFLQSVVFGMISIFGINLGTEQPRYDVIARLGDTIEIRHYPARLAAETTVAGS  59

Query  744  QFRGNKDGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPV-VTKG  568
              +   +  F ++A YI    N Q    +KIAMT+PV   E SS   +IAMT PV V K 
Sbjct  60   SSKARGEA-FRIVAGYIFGANNGQ----QKIAMTSPV---EISSPGSKIAMTTPVEVGKA  111

Query  567  GGGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEE  388
              G      + M+F +PS+Y+R E+ P+P D RV++ E        ++FSG+  D  V  
Sbjct  112  DDG------LVMRFFMPSEYSR-EQLPQPSDPRVRLVERPAATVAALRFSGSTGDAAVAA  164

Query  387  KVEMLKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            +   L   L    ++  GE     YNPPWTLP L+ NEV++P+
Sbjct  165  RSAELVHALAATDWRAAGEVTALFYNPPWTLPFLRRNEVVVPL  207



>ref|WP_033155441.1| heme-binding protein [Methylomonas sp. LW13]
Length=205

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 107/202 (53%), Gaps = 14/202 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            ++G  +   P+Y+++    + +IRQYPP +IAE T     +    + GF  LA YI   G
Sbjct  18   VMGIRSSAEPQYQLLSEQGDVQIRQYPPLLIAE-TVIDADYAQAGNIGFNRLAGYIFG-G  75

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
            N Q    +++AMTAPV    +      IAMTAPV+ +    +      TM F++P  Y+ 
Sbjct  76   NQQK---QQMAMTAPVFRENAGEH---IAMTAPVLQQAVDNKW-----TMAFVMPDGYS-  123

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P P+D +V IK    +K  V+++SG+ T + + EK  +L   +E+     +     
Sbjct  124  LETLPTPIDPQVTIKALPAKKVAVLRYSGSLTLEKINEKSRLLMAWIEQQQLTALSAARS  183

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
              Y+PPWTLP L+ NE+ I +E
Sbjct  184  AAYDPPWTLPALRRNEIHIDIE  205



>ref|XP_010543497.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=306

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 107/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+    +YEIR+  P  +AE T        F G     F +LA Y+      +
Sbjct  110  LETVNFRVLSRTDKYEIREVEPYFVAETTMPGKGGFDFYG-ASKSFNVLAEYLFG----K  164

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR + S  E++ MT PV+TK GG +   +   M F++PSKY     
Sbjct  165  NTMTEKMEMTTPVVTRRTQSEGEKMEMTTPVITKRGGDQAHWR---MSFVMPSKY--GAN  219

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD-GYKII--GEFEL  322
             P P D  V+I+E   +   VV FSG  TD+ VE     L+  L+RD  Y++      E+
Sbjct  220  LPSPKDPSVRIQEVPRKIVAVVSFSGYVTDEEVERMERELRHALKRDRKYRVKNGASVEV  279

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  280  AQYNPPFTLPFTRRNEVSLEVE  301



>ref|XP_010486603.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Camelina sativa]
Length=315

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 111/202 (55%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET +++V+    +YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  120  LETMEFKVLSKTDKYEIREVEPYFVAETTMSGENGFDFYG-PSKSFNVLAEYLFG----K  174

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T     + + +   M F++PSKY    +
Sbjct  175  NTIKEKMEMTTPVVTRKVQSVGEKMEMTTPVITSKAKDQNQWR---MSFVMPSKYG--SD  229

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  VKI+E   +   VV FSG  TD+ +E + + L+R L+ D    + +    E+
Sbjct  230  LPLPKDPSVKIQEVPRKIVAVVAFSGYVTDEEIERREQELRRALQNDKKFRVKDGVSVEV  289

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP ++ NEV + VE
Sbjct  290  AQYNPPFTLPFMRRNEVSLEVE  311



>gb|KFK38401.1| hypothetical protein AALP_AA3G108200 [Arabis alpina]
Length=304

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 110/206 (53%), Gaps = 24/206 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K++V+    +YEIR+     +AE T    +   F G     F +LA Y+      +
Sbjct  109  LETMKFKVLSRTDKYEIREVESYFVAETTMPGGNGFDFYG-ASRSFNVLAEYLFG----K  163

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T+ G  + + +   M F++PSKY     
Sbjct  164  NTIKEKMEMTTPVVTRKVQSVGEKMEMTTPVITRKGKDQTQWR---MSFVMPSKYG--SN  218

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLE-------RDGYKIIG  334
             P P D  +KI+E   +   VV FSG  TD+ +E + + LKR L+       RDG  +  
Sbjct  219  LPLPKDSSIKIQEVPRKIVAVVAFSGYVTDEEIERREQELKRALQNDWKFRVRDGVSV--  276

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
              E+ +YNPP+TLP  + NEV   VE
Sbjct  277  --EVAQYNPPFTLPFTRRNEVSFEVE  300



>ref|XP_001693693.1| SOUL heme-binding protein [Chlamydomonas reinhardtii]
 gb|EDP08947.1| SOUL heme-binding protein [Chlamydomonas reinhardtii]
Length=235

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 115/225 (51%), Gaps = 23/225 (10%)
 Frame = -1

Query  870  MGMILGKITVETPKYEVIH--AAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG---GFTLL  706
            M  I G ITVETPKY V+     +  E+R+Y P V AEVTY   +     DG    F  L
Sbjct  1    MSSIFGSITVETPKYTVLKTLGTSGAELRKYAPQVRAEVTYDMPEAAPIMDGLNNPFRSL  60

Query  705  ANYIGALGNP---QNAKPEKIAMTAPVITRessssseE-----IAMTAPVVTK-----GG  565
            A +I   GN      A  EK+AMTAPV+ ++ ++S        IAMTAPVV +      G
Sbjct  61   AGFI--FGNNTARSGAGNEKVAMTAPVVMQQPAASGASGASEKIAMTAPVVMQQPAGAEG  118

Query  564  GGEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEK  385
            G    +K   M FI+PSKY   E+ P P D RV++    ER +  + F G  +  V   +
Sbjct  119  GEAAGTKQRVMAFIMPSKYHSPEDLPAPKDPRVRLVAVPERTFAALTFRGGMSAAVAARR  178

Query  384  VEMLKRCLERDGYKI---IGEFELGRYNPPWTLPPLKTNEVMIPV  259
               L+     +G  +    G+ + G +NPPW L   KTNEV+IPV
Sbjct  179  EAELRAAAAAEGVALNSDKGQVQFGAFNPPWCLRWFKTNEVLIPV  223



>ref|WP_010920406.1| heme-binding protein [Caulobacter vibrioides]
 ref|NP_421352.1| hypothetical protein CC_2549 [Caulobacter crescentus CB15]
 ref|YP_002518005.1| SOUL domain heme-binding protein [Caulobacter crescentus NA1000]
 gb|AAK24520.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gb|ACL96097.1| SOUL domain heme-binding protein [Caulobacter crescentus NA1000]
Length=208

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 113/219 (52%), Gaps = 16/219 (7%)
 Frame = -1

Query  909  SRSLLHNILNSFEMGMILGKIT--VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFR  736
            S +L    + +    + LG +   VE P ++V+    ++++R YP  V+AEVT    Q +
Sbjct  2    SMTLRRMAMTAVFAAVFLGTVAMAVEEPVFKVVLHEGDFDVRDYPALVVAEVTVSGDQ-K  60

Query  735  GNKDGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGE  556
               + GF LLA YI   G   N   + IAMTAPV     + + + IAMTAPV      G+
Sbjct  61   QAANRGFRLLAGYI--FGG--NRTRQSIAMTAPV---AQAPAGQTIAMTAPVTQTQSAGQ  113

Query  555  GESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEM  376
                   ++F +PS+Y+  E  P+P D +VK++     +  V++FSG A    VE K   
Sbjct  114  W-----VVRFTMPSRYS-LEALPEPNDPQVKLRLIPPSRLAVLRFSGLAGADTVEVKTAD  167

Query  375  LKRCLERDGYKIIGEFELGRYNPPWTLPPLKTNEVMIPV  259
            LK+ L     +  G   L +YN PWT   ++ NEVMIPV
Sbjct  168  LKKRLSAHQLQATGPATLAQYNTPWTPWFMRRNEVMIPV  206



>ref|WP_009031667.1| heme-binding protein [Bradyrhizobium sp. ORS 375]
 emb|CCD96789.1| putative heme-binding protein, SOUL family [Bradyrhizobium sp. 
ORS 375]
Length=203

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 100/194 (52%), Gaps = 22/194 (11%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNA  667
            VE P+Y+V+    E+EIR Y P +IA+      + +   + GF ++  YI GA     N 
Sbjct  27   VEHPRYDVVKRDGEFEIRAYAPMIIAQADVQGAR-KAAIEEGFRIIGGYIFGA-----NQ  80

Query  666  KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAP  487
               KIAMTAPV               A V T   G  G+  +V+  F++PS ++  +  P
Sbjct  81   AKAKIAMTAPV------------QQQAAVATPADGVAGDRWSVS--FVMPSSWS-LDTLP  125

Query  486  KPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNP  307
             P D R+K+     ++   + FSG+ +D ++ EK   L+   +R+G  + G   L  YNP
Sbjct  126  PPADSRIKLTPMPAQRMVAITFSGSYSDGILAEKTRELRDYAQRNGLAVTGTPLLAFYNP  185

Query  306  PWTLPPLKTNEVMI  265
            PWTLP L+ NEVM+
Sbjct  186  PWTLPMLRRNEVML  199



>ref|WP_026604007.1| heme-binding protein [Methylomonas sp. 11b]
Length=205

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 109/202 (54%), Gaps = 14/202 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            ++G  +   P+Y+++    + +IRQYPP +IAE T     +    + GF  LA YI   G
Sbjct  18   VMGIRSSAEPQYQLLSEQGDVQIRQYPPLLIAE-TVIDADYAQAGNIGFNRLAGYIFG-G  75

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
            N Q    +++AMTAPV    +      IAMTAPV+ +  G +      TM F++P+ Y+ 
Sbjct  76   NQQK---QQMAMTAPVFRENAGEQ---IAMTAPVLQQAVGNKW-----TMAFVMPAGYS-  123

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P P+D +V IK    +K  V+++SG+   + + EK ++L   +E+     +     
Sbjct  124  LETLPTPIDPQVTIKVLPAKKVAVLRYSGSLNLEKIHEKSQLLLAWIEQQQLTPLTAPRS  183

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
              Y+PPWTLP L+ NE+ I +E
Sbjct  184  AAYDPPWTLPALRRNEIHIDIE  205



>ref|XP_008387000.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Malus domestica]
Length=302

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 111/201 (55%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K++V+    +YEIR+  P +IAE T    T F  N     F +LA Y+      +N
Sbjct  107  LETVKFKVLSKRDQYEIREIEPYIIAETTMPGKTGFDFNGASQSFNVLAEYLFG----KN  162

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PV TR+  S  E++ MT PV+TK  G + + +   M F++PSKY      
Sbjct  163  TTKEKMEMTTPVYTRKVQSDGEKMEMTTPVITKRLGDQDKWQ---MSFVIPSKYG--ANV  217

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V+I+E   +   VV FSG  T++ V+++   L+  L+ DG   + E    E+ 
Sbjct  218  PLPKDPSVRIEEVPRKVVAVVAFSGFVTNEEVKKRESKLREALKNDGQFQVKEGTSVEVA  277

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  278  QYNPPFTLPFQRRNEISLEVE  298



>ref|XP_009336949.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Pyrus x bretschneideri]
Length=302

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 111/201 (55%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K++V+    +YEIR+  P +IAE T    T F  N     F +LA Y+      +N
Sbjct  107  LETVKFKVLSRRDQYEIREIEPYIIAETTMPGKTGFDFNGASQSFNVLAEYLFG----KN  162

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PV TR+  S  E++ MT PV+TK  G + + +   M F++PSKY      
Sbjct  163  TTKEKMEMTTPVYTRKVQSDGEKMEMTTPVITKRLGDQDKWQ---MSFVIPSKYG--ANT  217

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V+I+E   +   VV FSG  T++ V+++   L+  L+ DG   + E    E+ 
Sbjct  218  PLPKDPSVRIEEVPRKVVAVVAFSGFVTNEEVKKRESKLREALKNDGQFQVKEGTSVEVA  277

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  278  QYNPPFTLPFQRRNEISLEVE  298



>ref|XP_009374712.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Pyrus x bretschneideri]
Length=302

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 111/201 (55%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K++V+    +YEIR+  P +IAE T    T F  N     F +LA Y+      +N
Sbjct  107  IETVKFKVLSRRDQYEIREIEPYIIAETTMPGKTGFDFNGASQSFNVLAEYLFG----KN  162

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PV TR+  S  E++ MT PV+TK  G + + +   M F++PSKY      
Sbjct  163  TTKEKMEMTTPVYTRKVQSDGEKMEMTTPVITKRLGDQDKWQ---MSFVIPSKYG--ANT  217

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V+I+E   +   VV FSG  T++ V+++   L+  L+ DG   + E    E+ 
Sbjct  218  PLPKDPSVRIEEVPRKVVAVVAFSGFVTNEEVKKRESKLREALKNDGQFQVKEGTSVEVA  277

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  278  QYNPPFTLPFQRRNEISLEVE  298



>emb|CBI30300.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 108/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K++V+    +YEIR+  P  IAE T    +   F G+    F +LA Y+      +
Sbjct  57   LETVKFKVLSRKDQYEIREVEPYFIAETTMPGKNGFDFNGSSQS-FNVLAEYLFG----K  111

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR   S  +++ MT PV+TK    + + +   M F++P+KY    +
Sbjct  112  NTTKERMEMTTPVFTRRDQSDGKKMEMTTPVITKKLQDQDKWQ---MSFVMPAKYG--AD  166

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D+ V+IKE   +   VV FSG  TD+ V+ +   L+  L  D    + E    E+
Sbjct  167  LPLPKDQSVRIKEVPRKIVAVVAFSGFVTDEEVKLRESKLRSALRNDKQFQVKEGAPVEV  226

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  227  AQYNPPFTLPFTRRNEVALEVE  248



>ref|XP_001772875.1| predicted protein [Physcomitrella patens]
 gb|EDQ62277.1| predicted protein, partial [Physcomitrella patens]
Length=242

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 111/201 (55%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYH-PTQFRGNKDG-GFTLLANYIGALGNPQN  670
            +ET  Y+++   A+YEIR   P V+AE T    + F     G  F  LA Y+      +N
Sbjct  41   LETIPYDLVRREADYEIRDVRPHVVAETTMSGRSGFDFASSGQAFNTLAAYLFG----KN  96

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
            ++  +++MT PVIT    S  E++ MT PV+ + G G+ + +   M F+LP+KY    +A
Sbjct  97   SRRSEMSMTTPVITNRGQSRGEKMEMTTPVIQQRGSGDEQWR---MSFVLPAKYN--NDA  151

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD---GYKIIGEFELG  319
            P P D  V I+    +K  V+ FSG  TD  V+ + + L+R L +D     K   + E+ 
Sbjct  152  PVPEDLSVSIRNIPGKKVAVMVFSGFVTDDEVKRREQALRRALLKDPVVRVKANAQPEVA  211

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP ++ NE+ + +E
Sbjct  212  QYNPPFTLPFMRRNELALEIE  232



>ref|XP_010480740.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Camelina sativa]
Length=319

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 110/202 (54%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  ++V+    +YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  124  LETMDFKVLSKTDKYEIREVEPYFVAETTMPGENGFDFYG-PSKSFNVLAEYLFG----K  178

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T     + + +   M F++PSKY     
Sbjct  179  NTIKEKMEMTTPVVTRKVQSVGEKMEMTTPVITSKAKDQNQWR---MSFVMPSKYG--SN  233

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  VKI+E   +   +V FSG  TD+ +E++ + L+R L+ D    + +    E+
Sbjct  234  LPLPKDPSVKIQEVPRKIVALVAFSGYVTDEEIEKREQELRRALQNDKKFRVKDGVSVEV  293

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP ++ NEV + VE
Sbjct  294  AQYNPPFTLPFMRRNEVSLEVE  315



>ref|WP_011341075.1| SOUL domain heme-binding protein [Pelobacter carbinolicus]
 ref|YP_006717069.1| SOUL domain heme-binding protein [Pelobacter carbinolicus DSM 
2380]
 gb|ABA88598.1| SOUL domain heme-binding protein, putative [Pelobacter carbinolicus 
DSM 2380]
Length=211

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 104/196 (53%), Gaps = 13/196 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            V+ P Y+V   A  YE+RQY   ++AE    P+        GF +L +YI       NA 
Sbjct  29   VKEPGYKVERKANGYEVRQYESYLLAEARI-PSGVDDPLREGFRMLFDYISG----ANAG  83

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPK  484
             +KI MTAPV+    ++    I MT PV++       E     + F+LP+ Y   +  P 
Sbjct  84   SQKIKMTAPVLQEGGAAEK--IPMTKPVLSLR-----EQNVSVVSFVLPADYT-LQTTPL  135

Query  483  PLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPP  304
            P +  ++I E   R+  V++FSG A+D++++++ + L   L RDG K  G F    YNPP
Sbjct  136  PENPGIQICEIASRRVAVIRFSGYASDEIIDKQSKRLISFLMRDGLKTKGAFMAAYYNPP  195

Query  303  WTLPPLKTNEVMIPVE  256
            WT P ++ NEVM+ +E
Sbjct  196  WTPPFMRRNEVMVDLE  211



>emb|CDP15419.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 112/202 (55%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGG---FTLLANYIGALGNPQ  673
            +ET  ++V+    +YEIR+     IAE T  P +   + +G    F +LA Y+      +
Sbjct  78   IETLNFKVLSRNDQYEIREVESYFIAETT-MPGKSGFDLNGASKSFNVLAEYLFG----K  132

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N K EK+ MT PV T +S S  E++ MT PV+TK   G+ + K   M F++PSKY     
Sbjct  133  NTKKEKMEMTTPVFTSKSQSEGEKMDMTTPVITKKVAGQDKWK---MSFVMPSKYG--SN  187

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG-YKII--GEFEL  322
             P P D  V+IKE  ++   V+ FSG  +D+ VE +   L+  L++D  Y++      E+
Sbjct  188  LPLPKDPSVRIKEVPKKIVAVIAFSGFVSDEEVERRESTLREALKKDTEYRVKNGASAEV  247

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  248  AQYNPPFTLPFTRRNEVALEVE  269



>emb|CAN62765.1| hypothetical protein VITISV_021815 [Vitis vinifera]
Length=252

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 107/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K++V+    +YEIR+  P  IAE T    +   F G+    F +LA Y+      +
Sbjct  57   LETVKFKVLSRKDQYEIREVEPYFIAETTMPGKNGFDFNGSSQS-FNVLAEYLFG----K  111

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR   S   ++ MT PV+TK    + + +   M F++P+KY    +
Sbjct  112  NTTKERMEMTTPVFTRRDQSDGXKMEMTTPVITKKLQDQDKWQ---MSFVMPAKYG--AD  166

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D+ V+IKE   +   VV FSG  TD+ V+ +   L+  L  D    + E    E+
Sbjct  167  LPLPKDQSVRIKEVPRKIVAVVAFSGFVTDEEVKLRESKLRSALRNDKQFQVKEGAPVEV  226

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  227  AQYNPPFTLPFARRNEVALEVE  248



>ref|XP_008442843.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Cucumis melo]
Length=305

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 111/199 (56%), Gaps = 10/199 (5%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            +ET K++V+    EYEIR+  P  IAE T  P +  G   GG +   N + A    +N  
Sbjct  110  LETLKFKVLSRRDEYEIREVEPYFIAETT-MPGK-SGFDFGGASQSFNVLAAYLFGKNKA  167

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPK  484
             EK+ MT PV+T +  S  E++ MT PV+TK   G+ + K   M F++PSKY   +  P 
Sbjct  168  REKMEMTTPVLTSQYKSDGEKMDMTTPVITKNVDGKDQWK---MSFVIPSKY--GQNIPV  222

Query  483  PLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG-YKI-IGEF-ELGRY  313
            P D  V+I+E   +   VV FSG  TD  ++ +   L+  L+ D  +++  G F E+ +Y
Sbjct  223  PQDTSVRIQEVPRKILAVVAFSGFVTDDEIKRRESRLRDALKNDKEFQVKAGSFVEVAQY  282

Query  312  NPPWTLPPLKTNEVMIPVE  256
            NPP+TLP  + NE+ + VE
Sbjct  283  NPPFTLPFQRRNEIALEVE  301



>ref|XP_010464672.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X1 [Camelina sativa]
Length=317

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 108/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  ++V+    +YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  122  LETMDFKVLSKTDKYEIREVEPYFVAETTMPGENGFDFYG-PSKSFNVLAEYLFG----K  176

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T     + + +   M F++PSKY     
Sbjct  177  NTIKEKMDMTTPVVTRKVQSVGEKMDMTTPVITSKAKDQNQWR---MSFVMPSKYG--SN  231

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  VKI E   +   VV FSG  TD+ +E + + L+R L+ D    + +    E+
Sbjct  232  LPLPKDPSVKILEVPRKIVAVVAFSGYVTDEEIERREQELRRALQNDKKFRVKDGVSVEV  291

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP ++ NEV + VE
Sbjct  292  AQYNPPFTLPFMRRNEVSLEVE  313



>ref|XP_010464673.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X2 [Camelina sativa]
Length=315

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 108/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  ++V+    +YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  120  LETMDFKVLSKTDKYEIREVEPYFVAETTMPGENGFDFYG-PSKSFNVLAEYLFG----K  174

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T     + + +   M F++PSKY     
Sbjct  175  NTIKEKMDMTTPVVTRKVQSVGEKMDMTTPVITSKAKDQNQWR---MSFVMPSKYG--SN  229

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  VKI E   +   VV FSG  TD+ +E + + L+R L+ D    + +    E+
Sbjct  230  LPLPKDPSVKILEVPRKIVAVVAFSGYVTDEEIERREQELRRALQNDKKFRVKDGVSVEV  289

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP ++ NEV + VE
Sbjct  290  AQYNPPFTLPFMRRNEVSLEVE  311



>ref|XP_010654092.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X1 [Vitis vinifera]
Length=287

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 108/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K++V+    +YEIR+  P  IAE T    +   F G+    F +LA Y+      +
Sbjct  92   LETVKFKVLSRKDQYEIREVEPYFIAETTMPGKNGFDFNGSSQS-FNVLAEYLFG----K  146

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR   S  +++ MT PV+TK    + + +   M F++P+KY    +
Sbjct  147  NTTKERMEMTTPVFTRRDQSDGKKMEMTTPVITKKLQDQDKWQ---MSFVMPAKYG--AD  201

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D+ V+IKE   +   VV FSG  TD+ V+ +   L+  L  D    + E    E+
Sbjct  202  LPLPKDQSVRIKEVPRKIVAVVAFSGFVTDEEVKLRESKLRSALRNDKQFQVKEGAPVEV  261

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  262  AQYNPPFTLPFTRRNEVALEVE  283



>ref|WP_020485405.1| hypothetical protein [Methylomonas sp. MK1]
Length=205

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 108/202 (53%), Gaps = 14/202 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            ++G  +   P+Y+++    + +IRQYPP +IAE T     +    + GF  LA YI   G
Sbjct  18   VMGIRSSAEPQYQLLSERGDVQIRQYPPLLIAE-TVIDADYAQAGNIGFNRLAGYIFG-G  75

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
            N Q    +++AMTAPV    +      I MTAPV+ +  G +      TM F++P+ Y+ 
Sbjct  76   NQQK---QQMAMTAPVFRENAGEQ---IEMTAPVLQQAVGNKW-----TMAFVMPAGYS-  123

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P P+D +V IK    +K  V+++SG+   + + +K ++L   LE+     +     
Sbjct  124  LETLPTPIDPQVTIKVLPAKKVAVLRYSGSLNLEQINDKSQLLLAWLEQQQLTPLSAPRS  183

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
              Y+PPWTLP L+ NE+ I +E
Sbjct  184  AAYDPPWTLPALRRNEIHIDIE  205



>ref|XP_002282544.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X2 [Vitis vinifera]
Length=285

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 108/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K++V+    +YEIR+  P  IAE T    +   F G+    F +LA Y+      +
Sbjct  90   LETVKFKVLSRKDQYEIREVEPYFIAETTMPGKNGFDFNGSSQS-FNVLAEYLFG----K  144

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR   S  +++ MT PV+TK    + + +   M F++P+KY    +
Sbjct  145  NTTKERMEMTTPVFTRRDQSDGKKMEMTTPVITKKLQDQDKWQ---MSFVMPAKYG--AD  199

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D+ V+IKE   +   VV FSG  TD+ V+ +   L+  L  D    + E    E+
Sbjct  200  LPLPKDQSVRIKEVPRKIVAVVAFSGFVTDEEVKLRESKLRSALRNDKQFQVKEGAPVEV  259

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  260  AQYNPPFTLPFTRRNEVALEVE  281



>ref|WP_011664427.1| heme-binding protein [Rhodopseudomonas palustris]
 ref|YP_781930.1| SOUL heme-binding protein [Rhodopseudomonas palustris BisA53]
 gb|ABJ06950.1| SOUL heme-binding protein [Rhodopseudomonas palustris BisA53]
Length=225

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 94/193 (49%), Gaps = 16/193 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            VE P Y V  +    EIR Y P + AE      + +   + GF L+A YI     P+   
Sbjct  45   VEQPDYTVEVSDGAIEIRAYAPMIAAEAVVE-GERKDAINQGFRLIAAYIFGANQPK---  100

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPK  484
              KI MTAPV         E IAMTAPV  +G G        T++FI+P  +   +  P 
Sbjct  101  -AKIEMTAPV-----QQQKETIAMTAPVSQQGSG-----SGWTVRFIMPKNWT-MQTLPA  148

Query  483  PLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPP  304
            P DERV +     R++  V+FSG  TD  +  + + L+R          GE  L  YNPP
Sbjct  149  PNDERVSLNPIPARRFVAVRFSGFTTDAAIATRTDELRRYAADHKLSTTGEPVLAFYNPP  208

Query  303  WTLPPLKTNEVMI  265
            WTLP L+ NEV++
Sbjct  209  WTLPFLRCNEVLL  221



>ref|XP_010683730.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=290

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 105/202 (52%), Gaps = 17/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  ++V+    +YEIR+  P  IAE T        F G     F +LA Y+     P 
Sbjct  94   IETVNFKVLSRRNQYEIREVEPYFIAETTMPGKEGFDFFG-ASQSFNVLAEYLFGKNRPN  152

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
                +K+ MT PVITR +S   + + MT PV+TK  G E   K   M F++PSKY     
Sbjct  153  ----DKMEMTTPVITRRTSDGEK-MEMTTPVITKRAGDEVNWK---MSFVMPSKYG--SN  202

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD---GYKIIGEFEL  322
             P P D  V+I E  ++   V  FSG  TD+ V+++   L+  L+ D     K+  E E+
Sbjct  203  LPVPKDSSVRITEVPKKIVAVAAFSGIVTDEEVKQRESKLRDALKNDLEFKVKVGAEIEV  262

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NEV + VE
Sbjct  263  AQYNPPFTLPFNRRNEVALEVE  284



>ref|XP_004952646.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Setaria italica]
Length=291

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 105/202 (52%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+   A+YEIR+     +AE T        F G+    F +LA+Y+      +
Sbjct  94   LETVPFRVLKREADYEIREVESYFVAETTMPGRSGLDFNGSSQS-FNVLASYLFG----K  148

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR+   SSE + MT PV+TK   GE + K   M F++P+KY     
Sbjct  149  NTASEQMEMTTPVFTRKGEPSSETMEMTTPVITKKSAGENKWK---MSFVMPAKY--GSN  203

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG---YKIIGEFEL  322
             P+P D  V IKE   +   V  FSG  TD  + ++   L+  L++D     K     E+
Sbjct  204  LPRPKDPSVTIKEVPSKIVAVAAFSGLVTDDDISQRESKLRESLQKDAEFRVKHDSAVEV  263

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  264  AQYNPPFTLPFTRRNEIALEVE  285



>ref|XP_003625826.1| Heme-binding-like protein [Medicago truncatula]
 gb|AES82044.1| SOUL heme-binding family protein [Medicago truncatula]
Length=296

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 104/205 (51%), Gaps = 16/205 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  ++V+    +YEIR+  P  +AE T        FRG+    F +LA Y+      +
Sbjct  101  LETVNFKVLTIRDQYEIREIEPYFVAETTMPGKSGFDFRGSSQS-FNVLAEYLFG----K  155

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N K EK+ MT PV T +  S   ++ MT PV+T     + E K   M F++PSKY     
Sbjct  156  NTKKEKMEMTTPVFTTKKQSDGVKMDMTTPVLTTKTVDKDEWK---MSFVMPSKYG--AN  210

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  V IKE   +   VV FSG   D+ V+ +   L+  L+ DG   I E    E+
Sbjct  211  LPLPKDSSVAIKEVARKTVAVVSFSGFVNDEEVKRRELKLREALKNDGQFKIKEGTSIEI  270

Query  321  GRYNPPWTLPPLKTNEVMIPVE*MN  247
             +YNPP+ LP  + NE+ + VE  N
Sbjct  271  AQYNPPFALPFQRRNEIALEVEWKN  295



>ref|XP_008787765.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Phoenix dactylifera]
Length=300

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 107/201 (53%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K+ ++    +Y+IR+  P  IAE T    T F  N     F +LA+Y+      +N
Sbjct  105  LETVKFRILKRTEQYDIREVEPYFIAEATMPGKTGFDFNGSSQAFNVLASYLFG----KN  160

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               E++ MT PV TR+  S  E++ MT PV+TK  G +G+ +   M F++PSKY      
Sbjct  161  TASEQMEMTTPVFTRKVQSGGEKMDMTTPVITKQSGDQGKWQ---MSFVMPSKY--GANL  215

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V IKE   +   V+ FSG  TD+ V+ +   L+  L  D    + E    E+ 
Sbjct  216  PLPKDPSVTIKEVPRKIVAVMAFSGFVTDEDVKHRESKLREALRSDTQFQVKEDALVEVA  275

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            ++NPP+TLP  + NE+ + VE
Sbjct  276  QFNPPFTLPFTRRNEITLEVE  296



>ref|XP_009761730.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=299

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 104/202 (51%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K+ V+  +  YEIRQ  P   AE T    +   F G     F  LA Y+      +
Sbjct  104  LETVKFNVLKRSDLYEIRQVEPYFAAEATMLGKYGFDFNGASQS-FNTLAEYLFG----K  158

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N K E +AMT PVITR + S  E++ MT  V+TK    +G+ +   M F++PSKY    +
Sbjct  159  NTKKESMAMTTPVITRRTQSDGEKMEMTTSVITKRVEDQGKWR---MSFVMPSKY--GSD  213

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG---YKIIGEFEL  322
             P P D  V IKE   +   VV FSG  TD+ V+ +   L   L+ D     K     E+
Sbjct  214  LPLPKDSSVTIKEVPRKTVAVVAFSGFVTDEEVKARESRLCAALKGDAEFRVKDGASIEV  273

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  274  AQYNPPFTLPFTRRNEISLEVE  295



>ref|WP_009852476.1| soul heme-binding protein [beta proteobacterium KB13]
 gb|EDZ64485.1| soul heme-binding protein [beta proteobacterium KB13]
Length=206

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 106/198 (54%), Gaps = 11/198 (6%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            +  E P++++I    E++IR+Y P +IA+V      F      GF LLA+YI    N  +
Sbjct  20   MATEEPEFKLISEEGEFQIREYDPKIIAQVEVE-GDFDEASSRGFKLLADYIFG-NNLLD  77

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               +KI+MT PV   E S  +E + MT+ ++      +       + F++P +++  +  
Sbjct  78   GGSKKISMTTPV---EMSPMAENLLMTSSILDDQVNNKW-----LINFVMPQEFS-LDTL  128

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            PKP + +V I E  + KY V+ FSG   +    EK E+L   L  +G K  G  ++ RYN
Sbjct  129  PKPNNFQVNIIEVPKEKYAVIVFSGLVRESSYAEKAELLFNYLVENGLKQQGAIKIARYN  188

Query  309  PPWTLPPLKTNEVMIPVE  256
            PPWTLP  + NE+M+ ++
Sbjct  189  PPWTLPFFRRNELMVRID  206



>ref|WP_007041304.1| heme-binding protein [Thiorhodococcus drewsii]
 gb|EGV30632.1| SOUL heme-binding protein [Thiorhodococcus drewsii AZ1]
Length=192

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 104/197 (53%), Gaps = 8/197 (4%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            + +E P YEV      +E+RQY P ++AE       F    +  F +LA+YI   GN  N
Sbjct  1    MAIEEPSYEVTRTYPMFELRQYAPYLVAETAVG-DDFDEAGNQAFRILADYI--FGN--N  55

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
                K+ MTAPV  R +   SE+I MTAPV  + G  EG+     + F++PS Y+  +  
Sbjct  56   RSKTKMDMTAPVNQRPAEDQSEKIRMTAPVSQQAG--EGKPGTYVVSFVMPSGYS-LDTL  112

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P P D RV ++E   +   V ++SG  T    E+ + +L+  +   G + +GE    RYN
Sbjct  113  PTPNDARVHLREEPAKLMAVRRYSGRWTRDNYEKNLGILRSAIREAGLETVGEPVYARYN  172

Query  309  PPWTLPPLKTNEVMIPV  259
            PP+T   ++ NEVM+ +
Sbjct  173  PPFTPWFMRRNEVMLEI  189



>gb|EEC73327.1| hypothetical protein OsI_07524 [Oryza sativa Indica Group]
Length=226

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 115/230 (50%), Gaps = 24/230 (10%)
 Frame = -1

Query  888  ILNSFEMGMILGKIT--------VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQ  742
            +  SFE     GK          +ET  + V+   AEYEIR+     +AE T        
Sbjct  6    VQESFEFSFHAGKTDMALHLVPDLETVPFRVLKREAEYEIREVESYYVAETTMPGRSGFD  65

Query  741  FRGNKDGGFTLLANYIGALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGG  562
            F G+    F +LA+Y+      +N   E++ MT PV TR+     E++ MT PV+TK   
Sbjct  66   FNGSSQS-FNVLASYLFG----KNTTSEQMEMTTPVFTRKGEPDGEKMDMTTPVITKKSA  120

Query  561  GEGESKAVTMQFILPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKV  382
             E + K   M F++PSKY    + P P D  V IKE   +   V  FSG  TD  + ++ 
Sbjct  121  NENKWK---MSFVMPSKY--GPDLPLPKDPSVTIKEVPAKIVAVAAFSGLVTDDDISQRE  175

Query  381  EMLKRCLERDG-YKIIGE--FELGRYNPPWTLPPLKTNEVMIPVE*MNLN  241
              L+  L++D  +++  +   E+ +YNPP+TLP  + NE+ + V+ ++ N
Sbjct  176  SRLRETLQKDSQFRVKDDSVVEIAQYNPPFTLPFTRRNEIALEVKRLDAN  225



>ref|XP_010271648.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Nelumbo nucifera]
Length=298

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 107/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET K+ V+    EYEIR+  P  +AE T        F G+    F +LA Y+      +
Sbjct  103  LETVKFNVLKRTDEYEIREVEPYFVAETTMPGKTGFDFSGSSQS-FNILAEYLFG----K  157

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV T+++ S  E++ MT PV+T+    +G+ +   M F++PSKY     
Sbjct  158  NTVSEKMEMTTPVFTQKTQSGGEKMEMTTPVITRQSEDQGKWQ---MSFLMPSKYG--AN  212

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  V+IKE   +   V  FSG  TD  V+++   L+  L  DG   + E    E+
Sbjct  213  LPLPKDSSVRIKEVPRKIVAVAAFSGFVTDDEVKQRESKLRDALRNDGQFQVKEDALVEV  272

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + V+
Sbjct  273  AQYNPPFTLPFNRRNEISLEVK  294



>gb|KDP37298.1| hypothetical protein JCGZ_06752 [Jatropha curcas]
Length=302

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 108/202 (53%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPT---QFRGNKDGGFTLLANYIGALGNPQ  673
            +ET +Y+V+    +YEIR+  P  IAE T   T    F G     F +LA Y+      +
Sbjct  107  LETVEYKVLSRRDQYEIREVEPYFIAETTMPGTSGFDFNG-ASQSFNVLAEYLFG----K  161

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV TR+S S  E + MT PV+ K    + + +   M F++PSKY    +
Sbjct  162  NTTKEKMEMTTPVFTRKSQSDGERMEMTTPVIAKKVEDQDKWQ---MSFVMPSKYG--AD  216

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D +VKIKE   +   VV FSG  TD+ V+ +   L+  L+ D    + E    E+
Sbjct  217  LPFPKDPKVKIKEVPRKIVAVVAFSGFVTDEDVKRRELKLRNALKNDMQFRVKEGASVEV  276

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  277  AQYNPPFTLPFTRRNEIALEVE  298



>emb|CDY60166.1| BnaAnng16600D [Brassica napus]
Length=304

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 108/206 (52%), Gaps = 24/206 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+     YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  109  LETMNFRVLSRTDRYEIREVEPYYVAETTMPGGNGFDFYG-ASRSFNVLAEYLFG----K  163

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EKI MT PV+TR+  S  E++ MT PV+T+    + + +   M F++PSKY    +
Sbjct  164  NTVNEKIEMTTPVVTRKVQSVGEKMEMTTPVITRKAKDQTQWQ---MSFVMPSKYG--SD  218

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLE-------RDGYKIIG  334
             P P D  VKI+E   +   V+ FSG  TD+  E++ + L+R L        RDG  +  
Sbjct  219  LPLPKDPSVKIQEVPRKIVAVLAFSGYVTDEETEKREQELRRALRNDKKFRVRDGVSV--  276

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
              E+ +YNPP+TLP  + NEV + VE
Sbjct  277  --EVAQYNPPFTLPFTRRNEVSLEVE  300



>ref|WP_007233951.1| heme-binding protein [marine gamma proteobacterium HTCC2080]
 gb|EAW42079.1| SOUL heme-binding protein [marine gamma proteobacterium HTCC2080]
Length=201

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 99/202 (49%), Gaps = 34/202 (17%)
 Frame = -1

Query  858  LGKITVETPKYEVIHAAAE--YEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGAL  685
            L    +E P Y ++ +  E   EIR Y P ++A      T+    ++ GF +LA YI   
Sbjct  20   LTATAIEEPVYSLVESWDEPAVEIRHYEPRILAL-----TEMAAGENSGFRVLAGYI--F  72

Query  684  GNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYA  505
            G   NA+ E+IAMTAPV              T P V              M F+LP++Y 
Sbjct  73   GG--NAEEEEIAMTAPV------------QRTMPGV----------DGAQMAFVLPAEY-  107

Query  504  RAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFE  325
               E PKP D RV+ +E       V++FSG ATD  V+E+ E+L   L        G   
Sbjct  108  EITELPKPDDSRVRFQEEPAYHAAVIRFSGRATDSRVDEQWELLTAFLAAQNISTTGRPT  167

Query  324  LGRYNPPWTLPPLKTNEVMIPV  259
            L +YNPPWTLP ++ NE+++P+
Sbjct  168  LNQYNPPWTLPFMRRNEIIVPI  189



>ref|XP_004149204.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004161228.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Cucumis sativus]
 gb|KGN59135.1| hypothetical protein Csa_3G776950 [Cucumis sativus]
Length=305

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 111/199 (56%), Gaps = 10/199 (5%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            +ET K++V+    EYEIR+  P  IAE T  P +  G   GG +   N + A    +N  
Sbjct  110  LETLKFKVLSRRDEYEIREVEPYFIAETT-MPGK-SGFDFGGASQSFNVLAAYLFGKNKA  167

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPK  484
             EK+ MT PV+T +  S  E++  T PV+TK   G+ + K   M F++PSKY   +  P 
Sbjct  168  REKMEMTTPVLTSQYKSDGEKMDTTTPVITKNVDGKDQWK---MSFVIPSKYG--QNFPV  222

Query  483  PLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG-YKI-IGEF-ELGRY  313
            P D  V+I+E   +   VV FSG  TD  V+++   L+  L+ D  +++  G F E+ +Y
Sbjct  223  PQDTSVRIQEVPRKILAVVAFSGFVTDDEVKKRESRLRDALKNDKEFQVKAGSFVEVAQY  282

Query  312  NPPWTLPPLKTNEVMIPVE  256
            NPP+TLP  + NE+ + VE
Sbjct  283  NPPFTLPFQRRNEIALEVE  301



>ref|XP_003575075.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Brachypodium distachyon]
Length=298

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 14/204 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFR-GNKDGGFTLLANYIGALGNPQN  670
            +ET ++ V+    +YEIR+     IAE T    T F  G     F +LA+Y+      +N
Sbjct  95   LETVQFRVLKREEDYEIREVESYYIAETTMPGRTGFDFGGSSRSFNVLASYLFG----EN  150

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
             + E++ MT PV+TR++   SE++ MT PV+TK    E + K   M F++PSKY    + 
Sbjct  151  TRSEQMEMTTPVLTRKAEIGSEKMDMTTPVITKKSADENKWK---MSFVMPSKY--GPDL  205

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            PK  D  V IKE   +   VV F G  TD  + ++   L++ L++D    + E    E+ 
Sbjct  206  PKAKDPSVTIKEVPRKIVAVVAFPGLVTDDDISQRESRLRQALQKDTQYRVKEDSVVEVA  265

Query  318  RYNPPWTLPPLKTNEVMIPVE*MN  247
            +YNPP+TLP  + NEV + VE ++
Sbjct  266  QYNPPFTLPFTRRNEVALEVERLD  289



>ref|XP_010101558.1| hypothetical protein L484_015382 [Morus notabilis]
 gb|EXB88697.1| hypothetical protein L484_015382 [Morus notabilis]
Length=277

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 108/201 (54%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET  + V+    +YEIR+  P  IAE T    T F  N     F +LA Y+      +N
Sbjct  82   LETVNFRVLSRTDQYEIREVEPYFIAETTMPGRTGFDFNGASQSFNVLAEYLFG----KN  137

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PVITR++  + E++ MT PV+TK    + + +   M F++PSKY    + 
Sbjct  138  TTREKMEMTTPVITRKAQPNGEKMEMTTPVITKRVEDQDKWQ---MSFVMPSKYG--GDL  192

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V+IKE   +   VV FSG  TD+ V ++   L+  L+ D    + E    E+ 
Sbjct  193  PLPKDPSVRIKEVPRKTIAVVAFSGFVTDEEVRQRENKLREALKNDRKFQVKEGTSVEVA  252

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  253  QYNPPFTLPFQRRNEIALEVE  273



>gb|EKD24354.1| hypothetical protein ACD_81C00040G0004 [uncultured bacterium]
Length=214

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 106/198 (54%), Gaps = 13/198 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            VE   Y VI    +YEIR+YP  ++A+ T     +  + + GF+++A YI   G   N K
Sbjct  27   VEQADYTVIKKMDDYEIREYPSHIVAQTTV-TGPYGESLESGFSIVAGYI--FGG--NTK  81

Query  663  PEKIAMTAPVITRessssse--EIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
             E+IAMTAPV+ ++ + + E   IAMTAPVV      EG+ +  T+ F +P  Y   E  
Sbjct  82   KERIAMTAPVVAQKETETKEGENIAMTAPVVATT---EGDVQ--TISFGMPRSYT-LETL  135

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P P D RVKI     ++Y V++FS   +D  ++   E L   L RDG    G      YN
Sbjct  136  PTPDDSRVKIVMMPTKQYAVMEFSWYRSDARIKRMQEKLSVSLTRDGVVAQGSVAYAGYN  195

Query  309  PPWTLPPLKTNEVMIPVE  256
             PWT P +  NEV++ ++
Sbjct  196  APWTPPWMVRNEVLVEIK  213



>ref|WP_039718725.1| hypothetical protein [Scytonema millei]
 gb|KIF12815.1| hypothetical protein QH73_48795 [Scytonema millei VB511283]
Length=212

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 102/194 (53%), Gaps = 13/194 (7%)
 Frame = -1

Query  840  ETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNAK  664
            + P + V+ +    EIR Y P ++AEV        G  + GF  LA YI GA  + Q+  
Sbjct  26   DEPPHTVVRSEGPIEIRDYAPMILAEVEVS-GSMAGAGNAGFRPLAGYIFGANTSRQSHG  84

Query  663  PEKIAMTAPVITRessssseEIAMTAPVV-TKGGGGEGESKAVTMQFILPSKYARAEEAP  487
             ++IAMT+PVI     + SEEIAMT PV  T+G  G+       + F++P ++   +  P
Sbjct  85   SDEIAMTSPVI----QTRSEEIAMTTPVTQTRGPAGQWR-----VAFVMPPEWT-MDTLP  134

Query  486  KPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNP  307
             P D RV + E   R+   ++FSG       EE    L   L R+GY+I+GE    RY+P
Sbjct  135  IPDDPRVTLSEMPARRMAAIRFSGGPNMARFEEMTGELTEFLAREGYEIVGEPVYARYDP  194

Query  306  PWTLPPLKTNEVMI  265
            PW   P + NEVMI
Sbjct  195  PWVPTPFRRNEVMI  208



>ref|WP_013419593.1| heme-binding protein [Rhodomicrobium vannielii]
 ref|YP_004012306.1| SOUL heme-binding protein [Rhodomicrobium vannielii ATCC 17100]
 gb|ADP71207.1| SOUL heme-binding protein [Rhodomicrobium vannielii ATCC 17100]
Length=219

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 103/194 (53%), Gaps = 12/194 (6%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAK  664
            VE P + +     + E+R Y P + AE      Q R   + GF L+A YI     P+   
Sbjct  29   VEQPDFRIEKQDGDVEVRAYGPLIAAEAEVK-GQRREAINEGFRLIAAYIFGANQPKA--  85

Query  663  PEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESK-AVTMQFILPSKYARAEEAP  487
              KI MTAPV         ++IAMTAPV  +GGG  GE   + T++FI+P  +   E  P
Sbjct  86   --KIEMTAPV-----EQQKQKIAMTAPVTQQGGGARGEGGESWTVRFIMPKAWT-METLP  137

Query  486  KPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNP  307
             P D RV+++    R++  ++FSG A D  + E+ + L+R  E  G  I GE  L  Y+P
Sbjct  138  TPSDSRVRLEPIPPRRFLAIRFSGFAGDDAIRERTDELRRYAETHGLAIKGEPVLAFYDP  197

Query  306  PWTLPPLKTNEVMI  265
            PWTLP ++ NEVM 
Sbjct  198  PWTLPFMRRNEVMF  211



>ref|XP_010059784.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Eucalyptus grandis]
 gb|KCW90550.1| hypothetical protein EUGRSUZ_A02662 [Eucalyptus grandis]
Length=311

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 109/201 (54%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K++V+    +YEIR+  P  IAE T    T F  N     F +LA Y+      +N
Sbjct  116  LETVKFKVLSRRDQYEIREVEPYYIAETTMPGKTGFDLNGASQSFNVLAEYLFG----KN  171

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               E++ MT PV TR+S S  + + MT PV+TK    EG+ +   M F++PSKY      
Sbjct  172  TTKEQMEMTTPVYTRKSPSDGKRMEMTTPVITKKVENEGKWQ---MSFVMPSKYG--ANI  226

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V++KE   +   VV FSG  TD+ V ++   L+  L+ DG   + E    E+ 
Sbjct  227  PSPRDPSVRVKEVPGKIVAVVAFSGFVTDEEVIQRELKLRDALKSDGEFRVKEGASVEVA  286

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NEV + VE
Sbjct  287  QYNPPFTLPFTRRNEVALEVE  307



>ref|XP_008243573.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Prunus mume]
Length=302

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 107/201 (53%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K++V+    +YEIR+  P  +AE T    T F  N     F +LA Y+      +N
Sbjct  107  LETVKFKVLSRRDQYEIREVEPYFLAETTMPGKTGFDFNGASQSFNVLAEYLFG----KN  162

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PV TR++ S   ++ MT PV+TK    + + +   M F++PSKY     +
Sbjct  163  TTKEKMEMTTPVFTRKAQSDGVKMEMTTPVITKRLEDQDKWQ---MSFVIPSKYG--ANS  217

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V+I E   +    V FSG  TD  V+ +   L+  L++DG   + E    E+ 
Sbjct  218  PLPKDPSVRITEVPRKTVAAVAFSGFVTDDEVKRQESKLREALKKDGQFQVKEGTSVEVA  277

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  278  QYNPPFTLPFQRRNEISLEVE  298



>ref|WP_008196859.1| SOUL heme-binding protein [Labrenzia alexandrii]
 gb|EEE47680.1| SOUL heme-binding protein [Labrenzia alexandrii DFL-11]
Length=220

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 100/195 (51%), Gaps = 13/195 (7%)
 Frame = -1

Query  840  ETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNAKP  661
            E P Y+V+ +    EIRQY     AEVT    +    +   F +L  YI       N   
Sbjct  38   EQPSYKVLSSDGPIEIRQYKDMAAAEVTVAGDRSAATRKA-FRILFRYISG----DNQGS  92

Query  660  EKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKP  481
             KI MTAPV      ++  EIAMTAPV T+   G GE +   + F LPS+Y     AP+P
Sbjct  93   NKIEMTAPV---SQQAAPAEIAMTAPV-TQQPVGNGEWR---VAFYLPSEYT-VRTAPRP  144

Query  480  LDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPW  301
             D R++I     +K   ++FSG  TD+     ++ L++ L ++G K+ G      +N P+
Sbjct  145  DDNRIRIVNVKGKKVAAIRFSGMWTDRNFNRHLQTLEQHLSKNGLKVAGAPIFAYFNAPF  204

Query  300  TLPPLKTNEVMIPVE  256
            TLPP + NEV IP+ 
Sbjct  205  TLPPFRRNEVQIPLS  219



>emb|CDY00906.1| BnaC05g42940D [Brassica napus]
Length=297

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 109/206 (53%), Gaps = 24/206 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+     YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  102  LETMNFRVLSRTDRYEIREVEPYYVAETTMPGGNGFDFYG-ASRSFNVLAEYLFG----K  156

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T+    + + +   M F++PSKY    +
Sbjct  157  NTVNEKMEMTTPVVTRKVQSVGEKMEMTTPVITRKAKDQTQWQ---MSFVMPSKYG--SD  211

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLE-------RDGYKIIG  334
             P P D  VKI+E   +   V+ FSG  TD+ +E + + L+R L+       RDG  +  
Sbjct  212  LPLPKDPSVKIQEVPRKIVAVLAFSGYVTDEEIERREQELRRALQNDKKFRVRDGVSV--  269

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
              E+ +YNPP+TLP  + NEV + VE
Sbjct  270  --EVAQYNPPFTLPFTRRNEVSLEVE  293



>ref|WP_011734075.1| heme-binding protein [Pelobacter propionicus]
 ref|YP_899819.1| SOUL heme-binding protein [Pelobacter propionicus DSM 2379]
 gb|ABK97761.1| SOUL heme-binding protein [Pelobacter propionicus DSM 2379]
Length=189

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 107/198 (54%), Gaps = 16/198 (8%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPT-QFRGNKDGGFTLLANYIGALGNPQ  673
            + +E   Y V+ A+  +E+R Y P ++AE     T +  GNK   F  L NYI    + +
Sbjct  1    MAIEEAPYTVVKASGIFEVRDYDPHILAETLIDGTLEDAGNK--AFRRLFNYISGANHSR  58

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            ++    IAMTAPV      S  E+IAMTAPV     G +  S    + F++P+ Y  A  
Sbjct  59   SS----IAMTAPV---SQESKGEKIAMTAPV-----GQQRSSGTWAVSFMMPASYTLAT-  105

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRY  313
             P P D  + +++   R+   V++SGT ++K   +  E L+  +  +G++I GE    RY
Sbjct  106  LPVPDDNSITVRQVPARRMAAVRYSGTWSEKNYLDYKERLENWIRENGFQISGEAVWARY  165

Query  312  NPPWTLPPLKTNEVMIPV  259
            NPP++L  L+ NE++IPV
Sbjct  166  NPPFSLWFLRRNEILIPV  183



>ref|WP_005141531.1| heme-binding protein [Mycobacterium rhodesiae]
 gb|EHB59310.1| SOUL heme-binding protein [Mycobacterium rhodesiae JS60]
Length=210

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 107/204 (52%), Gaps = 17/204 (8%)
 Frame = -1

Query  870  MGMILG-KITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI  694
            +G I+G ++  E P Y V       EIR+Y P V AE      +    ++ GF LLA YI
Sbjct  16   VGNIVGIRLGTEEPAYTVERQIGGVEIRRYGPRVAAETAIGADE-ESARNQGFRLLARYI  74

Query  693  -GALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILP  517
             GA     NA  +KIAMTAPV  + S      IAMTAPV T+       S    ++F +P
Sbjct  75   FGA-----NAGGDKIAMTAPVAQQPSEK----IAMTAPVATQ----RRPSGEWVIRFFMP  121

Query  516  SKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKII  337
            SKY   +  P P D+RV++ +  E    V++F+G+     V E+ E L   L R+G +  
Sbjct  122  SKYT-LDTLPTPADDRVRLVKVPEETVAVLRFTGSIGPAAVGERTEQLLNVLYRNGIEPT  180

Query  336  GEFELGRYNPPWTLPPLKTNEVMI  265
            G+     Y+PPWTLP  + NEV+I
Sbjct  181  GDPLAWFYDPPWTLPCRRRNEVVI  204



>ref|XP_007202476.1| hypothetical protein PRUPE_ppa010378mg [Prunus persica]
 gb|EMJ03675.1| hypothetical protein PRUPE_ppa010378mg [Prunus persica]
Length=252

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 107/201 (53%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYH-PTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K++V+    +YEIR+  P  IAE T    T F  N     F +LA Y+      +N
Sbjct  57   LETVKFKVLSRRDQYEIREVEPYFIAETTMSGKTGFDFNGASQSFNVLAEYLFG----KN  112

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PV TR++ S   ++ MT PV+T     + + +   M F++PSKY     +
Sbjct  113  TTKEKMEMTTPVFTRKAQSDGVKMEMTTPVITTRLEDQDKWQ---MSFVIPSKYG--ANS  167

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V+I E   +    V FSG  TD+ V+ +   L+  L++DG   + E    E+ 
Sbjct  168  PLPKDPSVRITEVPRKIVAAVAFSGFVTDEEVKRRESKLREALKKDGQFQVEEGTSVEVA  227

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + VE
Sbjct  228  QYNPPFTLPFQRRNEISLEVE  248



>ref|XP_006339129.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=294

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 109/202 (54%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGG---FTLLANYIGALGNPQ  673
            +ET K++V+    +YEIR+  P  +AE T  P +   + +G    F  LA ++      +
Sbjct  99   LETVKFKVLKLTDQYEIREVEPYFVAEAT-MPGKSGFDLNGASQSFNTLAEFLFG----K  153

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N K E +AMT PVITR + S  E++ MT PV+TK    + + +   M F++PSKY    +
Sbjct  154  NTKKESMAMTTPVITRRTQSDGEKMEMTTPVITKRAEDQEKWR---MSFVMPSKY--GSD  208

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FEL  322
             P P D  V IKE   +   VV FSG   D+ V+ +   L+  L+ D    + +    E+
Sbjct  209  LPLPKDSSVTIKEVPRKTLAVVAFSGFVNDEEVKARESRLRTALKGDAEFQVKDGALVEV  268

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  269  AQYNPPFTLPFTRRNEISLEVE  290



>ref|XP_010931138.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Elaeis guineensis]
Length=300

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 106/201 (53%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET K+ V+    +YEIR+  P  IA+ T    T F  N     F +LA+Y+      +N
Sbjct  105  LETVKFRVLKRTEQYEIREVEPYFIAKTTMPGKTGFDFNGSSQAFNVLASYLFG----KN  160

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               E++ MT PV TR+  S  E + MT PV+TK  G +G+ +   M F++PSKY      
Sbjct  161  TAGEQMEMTTPVFTRKVQSGGENMDMTTPVITKQSGDQGKWQ---MSFVMPSKY--GANL  215

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  + IKE   +   V+ FSG  TD+ V+ +   L+  L  D    + E    E+ 
Sbjct  216  PLPKDPSIAIKEVPSKIVAVMAFSGFVTDEDVKHRESKLREALRSDTQFQVKEDALVEVA  275

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            ++NPP+TLP  + NE+ + VE
Sbjct  276  QFNPPFTLPFTRRNEITLEVE  296



>ref|NP_001147650.1| SOUL heme-binding protein [Zea mays]
 gb|ACG28255.1| SOUL heme-binding protein [Zea mays]
Length=292

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 106/202 (52%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+   AEYEIR+     +AE T        F G+    F +LA+Y+      +
Sbjct  95   LETVPFRVLKREAEYEIREVESYFVAETTMPGRSGFDFNGSSQS-FNVLASYLFG----K  149

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR+  S+ + + MT PV+TK   G  + K   M F++P+KY     
Sbjct  150  NTASEQMEMTTPVFTRKGESNGQSMDMTTPVITKKSAGTNKWK---MSFVMPAKYG--SN  204

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG-YKIIGE--FEL  322
             P+P D  V IKE   +   V  FSG  TD  + ++   L+  L +D  +++  +   E+
Sbjct  205  LPRPKDPSVTIKEVPSKIVAVAAFSGLVTDDDINQRESKLRESLRKDATFRVKDDSVVEV  264

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  265  AQYNPPFTLPFTRRNEIALEVE  286



>ref|XP_009146872.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic 
[Brassica rapa]
Length=304

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 108/206 (52%), Gaps = 24/206 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+     YEIR+  P  +AE T    +   F G     F +LA Y+      +
Sbjct  109  LETMNFRVLSRTDRYEIREVEPYYVAETTMPGGNGFDFYG-ASRSFNVLAEYLFG----K  163

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   EK+ MT PV+TR+  S  E++ MT PV+T+    + + +   M F++PSKY    +
Sbjct  164  NTVNEKMEMTTPVVTRKVQSVGEKMEMTTPVITRKAKDQTQWQ---MSFVMPSKYG--SD  218

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLE-------RDGYKIIG  334
             P P D  VKI+E   +   V+ FSG  TD+  E++ + L+R L        RDG  +  
Sbjct  219  LPLPKDPSVKIQEVPRKIVAVLAFSGYVTDEETEKREQELRRALRNDKKFRVRDGVSV--  276

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
              E+ +YNPP+TLP  + NEV + VE
Sbjct  277  --EVAQYNPPFTLPFTRRNEVSLEVE  300



>ref|WP_012045868.1| heme-binding protein [Bradyrhizobium sp. BTAi1]
 ref|YP_001241823.1| heme-binding protein [Bradyrhizobium sp. BTAi1]
 gb|ABQ37917.1| Putative heme-binding protein, SOUL family [Bradyrhizobium sp. 
BTAi1]
Length=204

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (51%), Gaps = 21/194 (11%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNA  667
            VE PKY+ +    ++EIR Y P +IAE      + +   + GF ++  YI GA     N 
Sbjct  27   VEHPKYDTVSRDGDFEIRAYAPMIIAEAEVQGAR-KPAIEEGFRIIGGYIFGA-----NQ  80

Query  666  KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAP  487
               KIAMTAPV         +  A+ AP      G E  S    + F++PS ++  +  P
Sbjct  81   GRMKIAMTAPV-------QQQAAALPAP------GDETGSDRWKVSFVMPSSWS-LDTLP  126

Query  486  KPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNP  307
             P D R+K+     ++   + FSG+ +D ++ EK   L+   +R G  + G   L  YNP
Sbjct  127  PPADTRIKLNSLPAQRMVAITFSGSYSDGIIAEKTRELRDYAQRKGLTVTGSPLLAFYNP  186

Query  306  PWTLPPLKTNEVMI  265
            PWTLP L+ NEVM+
Sbjct  187  PWTLPMLRRNEVML  200



>ref|WP_037561492.1| heme-binding protein [Spirochaeta sp. JC202]
 gb|KGM43721.1| heme-binding protein [Spirochaeta sp. JC202]
Length=185

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 104/198 (53%), Gaps = 14/198 (7%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQN  670
            + +E  KY+++ +  ++EIRQY P ++AE T     F    + GF  L +YI   GN  N
Sbjct  1    MAIEKAKYDIVASDPDFEIRQYGPQIVAE-TLVEGDFEKVGNEGFRRLYDYI--TGN--N  55

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
             K + IAMTAPV     S     IAMTAPV       +       + F++PS ++  E+ 
Sbjct  56   RKKQSIAMTAPVTQEVGSVE---IAMTAPVSQVKMDNKWR-----ITFMMPSDFS-MEDL  106

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P PLD RV++K    R    +K+SGT +    E K + L   L + G K  GE    RY+
Sbjct  107  PDPLDPRVRLKREPGRIAAALKYSGTWSKSRYEAKKKTLGDLLSKRGLKPAGEPVWARYD  166

Query  309  PPWTLPPLKTNEVMIPVE  256
            PP+    L+ NEV+IPVE
Sbjct  167  PPFMPWFLRRNEVLIPVE  184



>ref|WP_013645082.1| SOUL heme-binding protein [Methanobacterium lacus]
 ref|YP_004290703.1| SOUL heme-binding protein [Methanobacterium lacus]
 gb|ADZ09731.1| SOUL heme-binding protein [Methanobacterium lacus]
Length=200

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 107/208 (51%), Gaps = 22/208 (11%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNA-  667
            VET  YEV      +EIR+Y   ++A V      F    + GF++LANYI   GN + + 
Sbjct  2    VETLAYEVESKDGNFEIRKYGDHILAHVDIE-APFNEAMNMGFSVLANYIFG-GNKKRSS  59

Query  666  ------------KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFI  523
                        K EKI MTAPV T ES   SE+I MT PV  +  G         + F+
Sbjct  60   IEMTAPVEEEKRKSEKIPMTAPV-TEESLKESEKIKMTTPVTEEENGN-----IHRISFV  113

Query  522  LPSKYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYK  343
            +PSKY   E  P+P DER+K +E  E K  V+KF G   +K+  EK+E +KR L+ +  +
Sbjct  114  MPSKYT-MEALPEPEDERIKFEEIKEEKMAVLKFKGRVKEKLAAEKIEEMKRWLKENNIQ  172

Query  342  IIGEFELGRYNPPWTLPPLKTNEVMIPV  259
                F + +YN P     L+ NE+M+ +
Sbjct  173  PESNFVVAQYNHPAVPGFLRRNEIMVEI  200



>ref|WP_024447602.1| heme-binding protein [Mycobacterium iranicum]
Length=204

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 103/203 (51%), Gaps = 22/203 (11%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYI  694
            + G  TVE P +       + EIR+Y   + AE T       G+KD     GF  LA+YI
Sbjct  18   VAGIRTVEEPHFIGRPLTDDVEIREYGSRIAAETTVT-----GDKDAALNAGFRRLASYI  72

Query  693  GALGNPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPS  514
                N    +  ++AMTAPV    S   SE IAMTAPV   G   +G     T++F +PS
Sbjct  73   FGANN----RKAEVAMTAPV----SQQRSESIAMTAPVAQTGSAAQG----WTVRFFMPS  120

Query  513  KYARAEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIG  334
            K++  E  P+P D  V++       + V++FSG  + K V EK + L R L  +G +  G
Sbjct  121  KWS-METLPQPDDPDVRLVAVPRETFAVLRFSGDRSPKAVSEKTDQLLRTLRDNGIEPRG  179

Query  333  EFELGRYNPPWTLPPLKTNEVMI  265
            E     Y+PPWTLP  + NEV +
Sbjct  180  EAVAWFYDPPWTLPFRRRNEVAV  202



>ref|WP_012509421.1| SOUL heme-binding protein [Pelodictyon phaeoclathratiforme]
 ref|YP_002019570.1| SOUL heme-binding protein [Pelodictyon phaeoclathratiforme BU-1]
 gb|ACF44953.1| SOUL heme-binding protein [Pelodictyon phaeoclathratiforme BU-1]
Length=206

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 104/202 (51%), Gaps = 14/202 (7%)
 Frame = -1

Query  861  ILGKITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALG  682
            +LGK T   P ++V+    + E+RQY   ++AE T     +      GF+ LA YI    
Sbjct  19   VLGKRTASEPPFKVLEQHGDIEVRQYGEMIVAE-TVIEGAYGQTGAPGFSRLAGYIFG--  75

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
              +N   EK++MTAPV+  + S     I+MTAPV+      E    A  M F++P   + 
Sbjct  76   --KNRSKEKLSMTAPVLQEQVSEK---ISMTAPVLQ-----EKRGSAWVMAFVMPEG-ST  124

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P PLD  VK++    +K GV+ +SG  ++  +      L   LE+  ++++ +   
Sbjct  125  LESLPVPLDPAVKLRSVQGKKVGVICYSGLHSESNLRNYAGKLTEWLEKKRFRVLSQPRA  184

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
              Y+PPWTLP L+ NEV I +E
Sbjct  185  ASYDPPWTLPFLRRNEVHIDIE  206



>ref|WP_009800641.1| hypothetical protein [Oceanicaulis sp. HTCC2633]
 gb|EAP88919.1| hypothetical protein OA2633_01184 [Oceanicaulis alexandrii HTCC2633]
Length=206

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 100/201 (50%), Gaps = 21/201 (10%)
 Frame = -1

Query  849  ITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDG----GFTLLANYIGALG  682
            +  E P Y ++      EIR YP  + AEVT      RG++      GF  LANYI    
Sbjct  20   MAAEEPSYTLVERVGSIEIRDYPGLIHAEVT-----VRGDRQTATRRGFQPLANYIFGGN  74

Query  681  NPQNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYAR  502
             P+    E IAMTAPV     S SS+ IAMTAPV T    GEGE     + FI+PS++  
Sbjct  75   QPR----EDIAMTAPVTA---SRSSQSIAMTAPV-TSEPAGEGE---WVVSFIMPSEWT-  122

Query  501  AEEAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFEL  322
             E  P   D  V+++E   R+  V++FSG   ++  E  +E L+  L   G   +G    
Sbjct  123  METLPVANDPDVRLREAPPRRGAVIQFSGVMNERRAERHLEELEAFLSERGLSALGAPTF  182

Query  321  GRYNPPWTLPPLKTNEVMIPV  259
              YNPPW   P + NE+ I V
Sbjct  183  AAYNPPWIPGPFRRNEIWIEV  203



>ref|WP_006613316.1| heme-binding protein [Bradyrhizobium sp. ORS 285]
 emb|CCD87975.1| putative heme-binding protein, SOUL family [Bradyrhizobium sp. 
ORS 285]
Length=204

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 101/195 (52%), Gaps = 23/195 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYI-GALGNPQNA  667
            VE PKY+V+    +YEIR Y P +IA+      + R   + GF ++  YI GA     N 
Sbjct  27   VEHPKYDVVSRDGDYEIRAYAPMIIAQAEVQGAR-RPAIEEGFRIIGGYIFGA-----NQ  80

Query  666  KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEG-ESKAVTMQFILPSKYARAEEA  490
               KIAMTAPV  + S       A TAP        +G  S   ++ F++PS +   +  
Sbjct  81   AKAKIAMTAPVQQQAS-------AATAP-------ADGVASDRWSVSFVMPSNWT-LDTL  125

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYN  310
            P P D+R+K+     ++   + FSG+ +D ++ +K   L+   +R G  + G   L  YN
Sbjct  126  PPPADDRIKLTPMPAQRMVALTFSGSYSDGILADKTRELRDYAQRKGLAVSGAPLLAFYN  185

Query  309  PPWTLPPLKTNEVMI  265
            PPWTLP L+ NEVM+
Sbjct  186  PPWTLPMLRRNEVML  200



>ref|XP_002528755.1| protein with unknown function [Ricinus communis]
 gb|EEF33667.1| protein with unknown function [Ricinus communis]
Length=297

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 110/201 (55%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET +Y+V+    +YEIR+  P  IAE T    T F  N     F +LA Y+      +N
Sbjct  102  LETVEYKVLSRRDQYEIREVEPYFIAETTMPGKTGFDLNGASQSFNVLAEYLFG----KN  157

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PV TR+  S  E++ MT PV+TK    + + +   M F++PSKY    + 
Sbjct  158  VTKEKMEMTTPVFTRKVQSDGEKMEMTTPVITKKVEDQDKWQ---MSFVMPSKYG--ADL  212

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD---GYKIIGEFELG  319
            P P D+ VKIKE  ++   VV FSG  TD+ V+++   L+  L+ D     K     E+ 
Sbjct  213  PLPKDKTVKIKEVPKKVVAVVAFSGFVTDEDVKQRELKLRNALKNDPLFRVKKGASMEVA  272

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ I +E
Sbjct  273  QYNPPFTLPFTRRNEIAIEIE  293



>ref|WP_007042718.1| heme-binding protein [Thiorhodococcus drewsii]
 gb|EGV28170.1| SOUL heme-binding protein [Thiorhodococcus drewsii AZ1]
Length=212

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 109/197 (55%), Gaps = 22/197 (11%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNK----DGGFTLLANYIGALGNP  676
            VETP+Y V+     +EIR YPP V+AEVT      +G++      GF+ LA YI A    
Sbjct  29   VETPEYRVVERDEPFEIRDYPPLVVAEVTR-----KGDRQTALSAGFSPLAGYIFA----  79

Query  675  QNAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAE  496
            +  + +++AMTAPV  + +      IAMTAPV T+     GE    +++FI+P++Y  A 
Sbjct  80   KEREGDRVAMTAPVTQQPAER----IAMTAPV-TQSSTEPGEW---SVRFIMPARYDLAS  131

Query  495  EAPKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGR  316
              P P    V++++   R+  VV+FSG  TD ++ E+   L+  +   G + +GE     
Sbjct  132  -LPAPARGDVRLEQIPARRTAVVRFSGRTTDTLIGEQERALRDWIAARGLQSVGEPVYAY  190

Query  315  YNPPWTLPPLKTNEVMI  265
            YN P+T   L+ NEVMI
Sbjct  191  YNDPFTPGFLRRNEVMI  207



>ref|XP_006648692.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like 
[Oryza brachyantha]
Length=244

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 108/206 (52%), Gaps = 14/206 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTYH-PTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET  + V+   AEYEIR+     +AE T    T F  N     F +LA+Y+      +N
Sbjct  47   LETVPFRVLKREAEYEIREVESYYVAETTMPGRTGFDFNGSSQSFNVLASYLFG----KN  102

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               E++ MT PV TR+   + E++ MT PV+T+    E + K   M F+LPSKY    + 
Sbjct  103  TNSEQMEMTTPVFTRKGEPNGEKMDMTTPVITRKSANENKWK---MSFVLPSKYG--PDL  157

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE---FELG  319
            P P D  V IKE   +   V  FSG  TD  + ++   L+  L++D    + +    E+ 
Sbjct  158  PVPKDPSVTIKEVPSKIVAVAAFSGLVTDDDISKRESRLREALQKDTQFQVKDDSVVEIA  217

Query  318  RYNPPWTLPPLKTNEVMIPVE*MNLN  241
            +YNPP+TLP  + NE+ + V+ ++ N
Sbjct  218  QYNPPFTLPFTRRNEIALEVKRLDAN  243



>ref|WP_011457331.1| SOUL heme-binding protein [Francisella tularensis]
 ref|YP_512849.1| hypothetical protein FTL_0041 [Francisella tularensis subsp. 
holarctica LVS]
 emb|CAJ78482.1| conserved hypothetical protein [Francisella tularensis subsp. 
holarctica LVS]
Length=123

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = -1

Query  648  MTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAPKPLDER  469
            MTAPV   +   SS++I MTAPV+ KG      +   T+ F+LP++Y   E APKP +++
Sbjct  1    MTAPV---KIEQSSQKIQMTAPVMVKGDT----NNEWTIAFVLPAQYT-LENAPKPTNDK  52

Query  468  VKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRYNPPWTLPP  289
            VK+ E  E K  V+ FSG      ++     LK  ++ + Y+I+G+ E   YNPPWT+P 
Sbjct  53   VKLVEKPETKIAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTIPF  112

Query  288  LKTNEVMIPVE  256
            L+TNEVMIP++
Sbjct  113  LRTNEVMIPIK  123



>ref|WP_005575513.1| SOUL heme-binding protein [Natronobacterium gregoryi]
 ref|YP_007176975.1| SOUL heme-binding protein [Natronobacterium gregoryi SP2]
 gb|AFZ72526.1| SOUL heme-binding protein [Natronobacterium gregoryi SP2]
 gb|ELY74399.1| SOUL heme-binding protein [Natronobacterium gregoryi SP2]
Length=218

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 99/197 (50%), Gaps = 20/197 (10%)
 Frame = -1

Query  846  TVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQNA  667
            T ET  Y V+  A  +E+R+YPP V+AE T        +    F  L  YIG     +N 
Sbjct  35   TTETVPYTVVDRAGGFELRRYPPTVLAETTAD------SDRKAFRRLFRYIGG----ENE  84

Query  666  KPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEAP  487
              E ++MT PV   E  + S++I+MTAPV T       +   V M F LP ++   E AP
Sbjct  85   SAESVSMTTPV---ELGTRSQKISMTAPVET----ASSDDGTVRMAFYLPQEHD-LESAP  136

Query  486  KPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGE-FELGRYN  310
            +P  E V++    ER   V +FSG  TD  V  + E L   LER G     E F +G Y+
Sbjct  137  QPTSEEVELVAAPERLLAVRRFSGRRTDDRVTRESERLLASLERAGLTAAREPFYMG-YD  195

Query  309  PPWTLPPLKTNEVMIPV  259
             PWTLP L+ NEV   V
Sbjct  196  APWTLPFLRRNEVATRV  212



>gb|KHG26870.1| hypothetical protein F383_03442 [Gossypium arboreum]
Length=300

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 109/201 (54%), Gaps = 14/201 (7%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY-HPTQFRGN-KDGGFTLLANYIGALGNPQN  670
            +ET +++V++ A +YEIR+  P  IAE T    T F  N     F +LA Y+      +N
Sbjct  105  LETVRFKVLNRADKYEIREVEPYFIAETTMPGKTGFDFNGSSQSFNVLAEYLFG----KN  160

Query  669  AKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEEA  490
               EK+ MT PVIT  + S  E + MT  V+TK    + + +   M F++PSKY      
Sbjct  161  TSKEKMEMTTPVITSRTRSDGERMEMTTSVITKKVENQDKWQ---MSFVMPSKYGST--L  215

Query  489  PKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD-GYKII--GEFELG  319
            P P D  V+IKE   +   VV FSG  TD+ V+ +   L+  L+ D G+++      E+ 
Sbjct  216  PLPKDPSVRIKEVPRKVVAVVAFSGFVTDEEVKRRELRLRDALKNDSGFRVKEGTSVEVS  275

Query  318  RYNPPWTLPPLKTNEVMIPVE  256
            +YNPP+TLP  + NE+ + +E
Sbjct  276  QYNPPFTLPFTRRNEIALELE  296



>gb|ACN33800.1| unknown [Zea mays]
 gb|AFW71684.1| SOUL heme-binding protein [Zea mays]
Length=292

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 106/202 (52%), Gaps = 16/202 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+   AEYEIR+     +AE T        F G+    F +LA+Y+      +
Sbjct  95   LETVPFRVLKREAEYEIREVESYFVAETTMPGRSGFDFNGSSQS-FNVLASYLFG----K  149

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR+  S+ + + MT PV+TK   G  + K   M F++P+KY     
Sbjct  150  NTASEQMEMTTPVFTRKGESNGQSMDMTTPVITKKSAGTNKWK---MSFVMPAKY--GSN  204

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERD-GYKIIGE--FEL  322
             P+P D  V IKE   +   V  FSG  TD  + ++   L+  L +D  +++  +   E+
Sbjct  205  LPRPKDPSVIIKEVPSKIVAVAAFSGLVTDDDINQRESKLRESLRKDTTFRVKDDSVVEV  264

Query  321  GRYNPPWTLPPLKTNEVMIPVE  256
             +YNPP+TLP  + NE+ + VE
Sbjct  265  AQYNPPFTLPFTRRNEIALEVE  286



>ref|XP_006407606.1| hypothetical protein EUTSA_v10021175mg [Eutrema salsugineum]
 gb|ESQ49059.1| hypothetical protein EUTSA_v10021175mg [Eutrema salsugineum]
Length=313

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 106/206 (51%), Gaps = 24/206 (12%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+    +YEIRQ  P  +AE T        F G     F +LA Y+      +
Sbjct  118  LETMNFRVLSRTDKYEIRQVEPYYVAETTMPGETGFDFYG-ASRSFNVLAEYLFG----K  172

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV+TR+  S  E++ MT PV+T     + + +   M F++PSKY     
Sbjct  173  NTVNEQMEMTTPVVTRKVQSVGEKMEMTTPVITSKAKDQSQWR---MSFVMPSKYG--SN  227

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLE-------RDGYKIIG  334
             P P D  VKI+E   +   VV FSG   D+ VE + + L+R L+       RDG  +  
Sbjct  228  LPFPKDPSVKIQEVPGKVVAVVAFSGYVNDEEVERREQELRRALQYDNKFRARDGVSV--  285

Query  333  EFELGRYNPPWTLPPLKTNEVMIPVE  256
              E+ +YNPP+TLP  + NEV + VE
Sbjct  286  --EVAQYNPPFTLPFTRRNEVSLEVE  309



>ref|WP_007170167.1| heme-binding protein [Mycobacterium parascrofulaceum]
 gb|EFG79072.1| SOUL heme-binding protein [Mycobacterium parascrofulaceum ATCC 
BAA-614]
Length=215

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 98/199 (49%), Gaps = 11/199 (6%)
 Frame = -1

Query  852  KITVETPKYEVIHAAAEYEIRQYPPAVIAEVTYHPTQFRGNKDGGFTLLANYIGALGNPQ  673
            ++  E PKY     A   EIR Y P + AE      + R  +D GF  LA YI   G   
Sbjct  22   RVGTEEPKYTHRPLAGSVEIRSYGPRIAAETLVDADENRA-RDVGFRRLARYI--FGG--  76

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E I+MTAPV  R +    + IAMTAPV        G      ++F +P K+   E 
Sbjct  77   NRSDESISMTAPVGQRSTGGGEQ-IAMTAPVAQSADAENG----YAIRFFMPEKWT-MET  130

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDGYKIIGEFELGRY  313
             P P D++V++         V++FSG  + + V  + E L + L   G ++ G+ E   Y
Sbjct  131  LPAPDDDQVRLVTVPPVTVAVLRFSGDRSPRAVASRTEELLKLLRDKGIQVTGKAEAWFY  190

Query  312  NPPWTLPPLKTNEVMIPVE  256
            +PPWTLP  + NEV +P++
Sbjct  191  DPPWTLPMRRRNEVAVPID  209



>ref|NP_001047029.1| Os02g0533200 [Oryza sativa Japonica Group]
 dbj|BAD28427.1| SOUL heme-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD29282.1| SOUL heme-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF08943.1| Os02g0533200 [Oryza sativa Japonica Group]
Length=287

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 16/207 (8%)
 Frame = -1

Query  843  VETPKYEVIHAAAEYEIRQYPPAVIAEVTY---HPTQFRGNKDGGFTLLANYIGALGNPQ  673
            +ET  + V+   AEYEIR+     +AE T        F G+    F +LA+Y+      +
Sbjct  90   LETVPFRVLKREAEYEIREVESYYVAETTMPGRSGFDFNGSSQS-FNVLASYLFG----K  144

Query  672  NAKPEKIAMTAPVITRessssseEIAMTAPVVTKGGGGEGESKAVTMQFILPSKYARAEE  493
            N   E++ MT PV TR+     E++ MT PV+TK    E + K   M F++PSKY    +
Sbjct  145  NTTSEQMEMTTPVFTRKGEPDGEKMDMTTPVITKKSANENKWK---MSFVMPSKY--GPD  199

Query  492  APKPLDERVKIKEGGERKYGVVKFSGTATDKVVEEKVEMLKRCLERDG-YKIIGE--FEL  322
             P P D  V IKE   +   V  FSG  TD  + ++   L+  L++D  +++  +   E+
Sbjct  200  LPLPKDPSVTIKEVPAKIVAVAAFSGLVTDDDISQRESRLRETLQKDSQFRVKDDSVVEI  259

Query  321  GRYNPPWTLPPLKTNEVMIPVE*MNLN  241
             +YNPP+TLP  + NE+ + V+ ++ N
Sbjct  260  AQYNPPFTLPFTRRNEIALEVKRLDAN  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3145178720708