BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85606_g1_i1 len=323 path=[1:0-322]

Length=323
                                                                      Score     E

ref|XP_009601634.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       70.5    9e-12   
ref|XP_009779614.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       70.1    1e-11   
ref|XP_002283935.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            67.8    1e-10   Vitis vinifera
emb|CDO99138.1|  unnamed protein product                              66.2    3e-10   
gb|KHN10089.1|  3-ketoacyl-CoA synthase 11                            65.9    3e-10   
ref|XP_011091085.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            65.5    6e-10   
ref|XP_007034926.1|  3-ketoacyl-CoA synthase                          65.1    8e-10   
ref|XP_010091264.1|  3-ketoacyl-CoA synthase 11                       64.7    1e-09   
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       64.3    1e-09   
ref|XP_004498007.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       64.3    2e-09   
ref|XP_007143888.1|  hypothetical protein PHAVU_007G110500g           64.3    2e-09   
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       63.9    2e-09   
ref|XP_002453517.1|  hypothetical protein SORBIDRAFT_04g007190        63.9    2e-09   Sorghum bicolor [broomcorn]
gb|KDP40263.1|  hypothetical protein JCGZ_02261                       63.9    2e-09   
gb|KHG21958.1|  3-ketoacyl-CoA synthase 11 -like protein              63.5    2e-09   
gb|AGK29988.1|  3-ketoacyl-CoA synthase 1                             63.5    2e-09   
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                  63.5    3e-09   
ref|NP_001151591.1|  fatty acid elongase                              63.2    3e-09   Zea mays [maize]
gb|ACR36808.1|  unknown                                               63.2    3e-09   Zea mays [maize]
gb|AGK29989.1|  3-ketoacyl-CoA synthase 2                             63.2    3e-09   
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       62.8    5e-09   
ref|XP_004247624.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       62.8    6e-09   
ref|XP_003637542.1|  Beta-ketoacyl-CoA synthase                       62.8    6e-09   
gb|AFK39024.1|  unknown                                               62.4    6e-09   
ref|XP_007145927.1|  hypothetical protein PHAVU_007G279500g           62.4    6e-09   
ref|XP_006362163.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       62.4    7e-09   
gb|KHG17042.1|  3-ketoacyl-CoA synthase 17 -like protein              62.0    1e-08   
ref|XP_003637030.1|  Beta-ketoacyl-CoA synthase                       62.0    1e-08   
gb|EAY84941.1|  hypothetical protein OsI_06307                        61.2    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       61.2    2e-08   
ref|NP_001046250.1|  Os02g0205500                                     61.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008368384.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       60.8    2e-08   
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       60.8    2e-08   
gb|ABV60087.1|  beta-ketoacyl-CoA synthase                            60.8    2e-08   Gossypium hirsutum [American cotton]
ref|XP_004495403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       60.8    2e-08   
ref|XP_004951508.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       61.2    2e-08   
gb|ACC60973.1|  beta-ketoacyl-CoA synthase                            60.8    2e-08   Helianthus annuus
ref|XP_008362037.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       58.2    3e-08   
ref|XP_002517035.1|  acyltransferase, putative                        60.5    3e-08   Ricinus communis
ref|XP_009595982.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       60.5    3e-08   
ref|XP_006647059.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       60.1    5e-08   
gb|EYU34550.1|  hypothetical protein MIMGU_mgv1a004667mg              59.7    6e-08   
gb|EMT24470.1|  3-ketoacyl-CoA synthase 11                            59.7    6e-08   
gb|EMS65062.1|  3-ketoacyl-CoA synthase 11                            59.3    7e-08   
dbj|BAJ93555.1|  predicted protein                                    59.3    7e-08   
ref|NP_001057996.1|  Os06g0598800                                     58.9    9e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01557.1|  hypothetical protein OsI_23590                        58.9    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003571537.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            58.9    1e-07   
emb|CDO99137.1|  unnamed protein product                              58.2    2e-07   
ref|XP_009767720.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       58.2    2e-07   
ref|XP_009804708.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       58.2    2e-07   
gb|AGT15995.1|  fatty acid elongase                                   58.2    2e-07   
ref|XP_006420077.1|  hypothetical protein CICLE_v10004736mg           58.2    2e-07   
ref|XP_006489489.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       57.8    2e-07   
ref|NP_001105135.1|  fatty acid elongase1                             57.8    2e-07   Zea mays [maize]
ref|XP_006656205.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.8    2e-07   
gb|AFW87109.1|  putative fatty acid elongase isoform 1                57.8    2e-07   
ref|XP_002437234.1|  hypothetical protein SORBIDRAFT_10g023290        57.8    2e-07   Sorghum bicolor [broomcorn]
ref|NP_001266579.1|  fatty acid elongase                              57.8    2e-07   
gb|AAP74370.1|  FAE3                                                  57.8    2e-07   Marchantia polymorpha
ref|XP_004965965.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.8    3e-07   
ref|XP_010925263.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.8    3e-07   
ref|XP_008650048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.4    3e-07   
ref|XP_007222815.1|  hypothetical protein PRUPE_ppa004243mg           57.4    3e-07   
gb|AAC49186.1|  beta-ketoacyl-CoA synthase                            57.4    4e-07   Simmondsia chinensis [goatnut]
ref|XP_006854931.1|  hypothetical protein AMTR_s00052p00130070        57.4    4e-07   
ref|XP_010670713.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.4    4e-07   
ref|XP_010918127.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.0    4e-07   
gb|KDO53945.1|  hypothetical protein CISIN_1g009935mg                 57.0    4e-07   
gb|KCW57450.1|  hypothetical protein EUGRSUZ_H00229                   57.0    4e-07   
ref|XP_010025860.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.4    4e-07   
gb|AAO48425.1|  beta-ketoacyl-CoA-synthase                            57.0    4e-07   Marchantia polymorpha
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       57.0    4e-07   
ref|XP_008224439.1|  PREDICTED: 3-ketoacyl-CoA synthase 19            56.6    5e-07   
ref|XP_010313709.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  56.6    6e-07   
ref|XP_004251585.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  56.6    6e-07   
gb|EYU21941.1|  hypothetical protein MIMGU_mgv1a004813mg              56.2    7e-07   
ref|XP_002312562.1|  hypothetical protein POPTR_0008s15990g           56.2    7e-07   Populus trichocarpa [western balsam poplar]
gb|EYU41418.1|  hypothetical protein MIMGU_mgv1a008516mg              55.8    8e-07   
ref|XP_004296609.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like       56.2    8e-07   
ref|XP_009601391.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  56.2    8e-07   
ref|XP_009601390.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  56.2    9e-07   
ref|XP_011027418.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       56.2    9e-07   
ref|XP_010025862.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.8    1e-06   
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.8    1e-06   
ref|XP_009592818.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       55.8    1e-06   
ref|XP_008792115.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.1    2e-06   
ref|XP_008785403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.1    2e-06   
ref|XP_010914942.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.1    2e-06   
gb|EPS63750.1|  hypothetical protein M569_11032                       54.7    2e-06   
gb|EYU41423.1|  hypothetical protein MIMGU_mgv1a004579mg              54.7    3e-06   
ref|XP_002529366.1|  acyltransferase, putative                        54.7    3e-06   Ricinus communis
dbj|BAJ94420.1|  predicted protein                                    54.7    3e-06   
ref|XP_002284986.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            54.7    3e-06   Vitis vinifera
ref|XP_010533183.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...  54.7    3e-06   
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                            54.3    3e-06   
ref|XP_002284751.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            54.3    3e-06   Vitis vinifera
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  54.3    3e-06   
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g           54.3    3e-06   
ref|XP_009786610.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       54.3    3e-06   
ref|XP_004241809.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    3e-06   
emb|CBI28145.3|  unnamed protein product                              54.3    3e-06   
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                            54.3    4e-06   
ref|XP_009607438.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    4e-06   
ref|XP_006353644.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    4e-06   
gb|AGK29991.1|  3-ketoacyl-CoA synthase 7                             54.3    4e-06   
gb|EAY99126.1|  hypothetical protein OsI_21086                        54.3    4e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001056391.1|  Os05g0574600                                     54.3    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    4e-06   
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            54.3    4e-06   
gb|AFY98637.1|  beta-ketoacyl-CoA synthase II                         53.9    4e-06   
gb|AAP74371.1|  FAE1                                                  53.9    4e-06   Marchantia polymorpha
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    5e-06   
gb|AGK29990.1|  3-ketoacyl-CoA synthase 11                            53.9    5e-06   
ref|XP_004146292.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    5e-06   
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    5e-06   
ref|XP_004170552.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    5e-06   
ref|XP_006356047.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       53.9    5e-06   
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    5e-06   
ref|XP_007013326.1|  3-ketoacyl-CoA synthase                          53.9    5e-06   
gb|AFK48523.1|  unknown                                               53.9    5e-06   
gb|AHX25587.1|  3-ketoacyl-CoA synthase 11                            53.9    5e-06   
gb|ACJ85761.1|  unknown                                               53.5    6e-06   Medicago truncatula
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    6e-06   
gb|EPS57140.1|  hypothetical protein M569_17681                       53.5    6e-06   
gb|KHG01499.1|  3-ketoacyl-CoA synthase 11 -like protein              53.5    6e-06   
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                  53.5    6e-06   
emb|CDO99135.1|  unnamed protein product                              53.5    6e-06   
ref|XP_007013801.1|  3-ketoacyl-CoA synthase                          53.5    6e-06   
ref|XP_004239114.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       53.1    8e-06   
emb|CDP03396.1|  unnamed protein product                              53.1    8e-06   
gb|EMT15934.1|  3-ketoacyl-CoA synthase 11                            53.1    8e-06   
ref|XP_009801870.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.1    8e-06   
ref|XP_008464980.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            53.1    9e-06   
ref|XP_007154946.1|  hypothetical protein PHAVU_003G160400g           53.1    1e-05   
ref|XP_010557584.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...  53.1    1e-05   
ref|XP_010557583.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...  53.1    1e-05   
ref|XP_010274236.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.8    1e-05   
ref|XP_004961143.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.8    1e-05   
ref|XP_004241035.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       52.8    1e-05   
ref|XP_010024057.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.8    1e-05   
dbj|BAF98214.1|  CM0216.300.nc                                        52.4    1e-05   Lotus japonicus
emb|CDP04806.1|  unnamed protein product                              52.4    1e-05   
ref|XP_011030605.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       52.4    2e-05   
ref|XP_009381261.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.4    2e-05   
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            52.0    2e-05   
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.0    2e-05   
ref|XP_009792392.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    2e-05   
ref|XP_002324276.1|  hypothetical protein POPTR_0018s01300g           51.6    3e-05   Populus trichocarpa [western balsam poplar]
gb|ACC95444.1|  beta-ketoacyl-CoA synthase                            51.6    3e-05   Helianthus annuus
ref|XP_008361241.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            51.6    3e-05   
ref|XP_001758798.1|  predicted protein                                51.6    3e-05   
ref|XP_009374066.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            51.6    3e-05   
ref|XP_006398946.1|  hypothetical protein EUTSA_v10013296mg           51.6    3e-05   
gb|AES91419.2|  3-ketoacyl-CoA synthase-like protein                  51.6    3e-05   
ref|XP_008385932.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            51.6    3e-05   
ref|XP_009348198.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    3e-05   
ref|XP_009347466.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    3e-05   
ref|XP_011015110.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    3e-05   
ref|XP_011026502.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    3e-05   
ref|XP_003609222.1|  Beta-ketoacyl-coa synthase family protein        51.6    3e-05   
ref|XP_002878994.1|  hypothetical protein ARALYDRAFT_901443           51.2    3e-05   
gb|ACY78677.1|  fatty acid elongase                                   51.2    3e-05   Pistacia chinensis [Chinese pistachio]
gb|ABK94954.1|  unknown                                               51.2    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010417808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            51.2    4e-05   
ref|XP_006378367.1|  hypothetical protein POPTR_0010s09000g           51.2    4e-05   
ref|NP_180232.1|  3-ketoacyl-CoA synthase 11                          51.2    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242707.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            51.2    4e-05   
ref|XP_007204837.1|  hypothetical protein PRUPE_ppa004269mg           51.2    4e-05   
ref|XP_004287376.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.2    4e-05   
ref|XP_004508544.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  50.8    5e-05   
ref|XP_010473048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  50.8    5e-05   
ref|XP_006293527.1|  hypothetical protein CARUB_v10024547mg           50.8    5e-05   
ref|XP_003549787.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    5e-05   
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg           50.8    5e-05   
ref|XP_004508545.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  50.8    5e-05   
ref|XP_011019752.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            50.8    5e-05   
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    5e-05   
ref|XP_002305431.1|  hypothetical protein POPTR_0004s16290g           50.8    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    5e-05   
ref|XP_006348760.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.4    6e-05   
ref|XP_010098974.1|  3-ketoacyl-CoA synthase 11                       50.8    6e-05   
ref|XP_003524525.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    6e-05   
gb|KDO80366.1|  hypothetical protein CISIN_1g008975mg                 50.8    6e-05   
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        50.4    7e-05   
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947            50.4    7e-05   
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    7e-05   
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692           50.4    7e-05   
ref|XP_006378369.1|  hypothetical protein POPTR_0010s09020g           50.4    7e-05   
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                            50.1    9e-05   
ref|XP_008219888.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.1    1e-04   
gb|KDP32347.1|  hypothetical protein JCGZ_13272                       50.1    1e-04   
ref|XP_008796426.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.1    1e-04   
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg           49.7    1e-04   
ref|XP_009407649.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       49.7    1e-04   
ref|XP_006378373.1|  hypothetical protein POPTR_0010s09040g           49.7    1e-04   
ref|XP_002308642.1|  hypothetical protein POPTR_0006s26530g           49.7    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006451013.1|  hypothetical protein CICLE_v10007916mg           49.7    1e-04   
ref|XP_010049954.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            49.3    1e-04   
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg           49.3    1e-04   
emb|CAN68997.1|  hypothetical protein VITISV_033594                   49.3    2e-04   Vitis vinifera
ref|XP_010069189.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       49.3    2e-04   
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        49.3    2e-04   
ref|XP_006350730.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       49.3    2e-04   
gb|KCW55362.1|  hypothetical protein EUGRSUZ_I01277                   48.9    2e-04   
gb|KCW75690.1|  hypothetical protein EUGRSUZ_D00054                   48.9    2e-04   
gb|KEH23437.1|  3-ketoacyl-CoA synthase                               49.3    2e-04   
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        48.9    2e-04   
gb|AGK29992.1|  3-ketoacyl-CoA synthase 19                            48.9    2e-04   
ref|XP_001757962.1|  predicted protein                                48.9    2e-04   
ref|XP_006378377.1|  hypothetical protein POPTR_0010s09060g           48.9    2e-04   
gb|EPS60765.1|  hypothetical protein M569_14036                       48.9    2e-04   
ref|XP_001753229.1|  predicted protein                                48.5    3e-04   
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             48.5    3e-04   
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                          48.5    3e-04   
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        48.5    3e-04   
ref|XP_010254814.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        48.5    3e-04   
ref|XP_006387086.1|  hypothetical protein POPTR_1902s002002g          47.4    3e-04   
emb|CDX98800.1|  BnaC09g50350D                                        48.1    4e-04   
gb|EAZ22163.1|  hypothetical protein OsJ_05826                        48.1    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009122553.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            48.1    4e-04   
ref|XP_009394797.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       48.1    4e-04   
ref|XP_010692792.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       48.1    4e-04   
ref|XP_008805392.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        48.1    4e-04   
ref|XP_006366859.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       48.1    4e-04   
gb|KDP38510.1|  hypothetical protein JCGZ_04435                       48.1    4e-04   
ref|XP_006846574.1|  hypothetical protein AMTR_s00018p00245180        47.8    5e-04   
gb|AGK29996.1|  3-ketoacyl-CoA synthase 18                            47.8    5e-04   
ref|XP_010683564.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       47.8    6e-04   
ref|XP_010248169.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        47.4    7e-04   
ref|XP_010243778.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             47.4    7e-04   
ref|XP_006350729.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       47.4    8e-04   
ref|XP_006387707.1|  hypothetical protein POPTR_0658s00200g           47.4    8e-04   
ref|XP_002510394.1|  acyltransferase, putative                        47.0    8e-04   Ricinus communis
ref|XP_009780138.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       47.0    9e-04   
ref|XP_011030604.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       47.0    9e-04   
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g           47.0    0.001   Populus trichocarpa [western balsam poplar]
ref|XP_001756180.1|  predicted protein                                47.0    0.001   
dbj|BAJ94797.1|  predicted protein                                    47.0    0.001   
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        47.0    0.001   



>ref|XP_009601634.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana tomentosiformis]
Length=517

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+HVMYL  VP+LGAVS H            W+ +K NL  ++ C++ +VFL
Sbjct  34   VKLGYHYLISHVMYLCLVPILGAVSVHLSTLTVEEVVQLWNQLKFNLVTVILCSALMVFL  93

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  94   ATLYFMTRPRKVYL  107



>ref|XP_009779614.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana sylvestris]
Length=518

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+HVMYL  VP+LGAVS H            W  +K NL  +L C++ +VFL
Sbjct  35   VKLGYHYLISHVMYLCLVPILGAVSVHLSTLTVEEVVQLWYQLKFNLVTVLLCSALMVFL  94

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  95   ATLYFMTRPRKVYL  108



>ref|XP_002283935.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Vitis vinifera]
Length=521

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL VPLLG  +AH            W+ +K NL  ++ C++ +VFL
Sbjct  39   VKLGYHYLISHGMYLLLVPLLGVAAAHLSTLTIKDFLQLWNHLKFNLVTVILCSALMVFL  98

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR VYL
Sbjct  99   ATLYFMSRPRKVYL  112



>emb|CDO99138.1| unnamed protein product [Coffea canephora]
Length=521

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYL+ +PLLG VS H            W  ++ NL  ++ C++ +VFL
Sbjct  39   VKLGYHYLISHAMYLMVIPLLGVVSVHLSTVTVEDLVLLWEQLRFNLVSVILCSALMVFL  98

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  99   GTLYFMTRPRKVYL  112



>gb|KHN10089.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=433

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYL+ +PL+G  SAH            W  +K +L  +  C+S +VFL
Sbjct  35   VKLGYHYVISNAMYLMLIPLIGTASAHLSTISMKELVRLWENLKFDLVSVTLCSSLMVFL  94

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  95   GTLYFMSRPRGVYL  108



>ref|XP_011091085.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Sesamum indicum]
Length=524

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYL  VPLLG +S H            W  +K NL  ++ C++ +VFL
Sbjct  43   VKLGYHYLISHAMYLFLVPLLGILSVHLSTITTDDLVLLWDQLKFNLVSVVICSALIVFL  102

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  103  GTLYFMTRPRKVYL  116



>ref|XP_007034926.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY05852.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=524

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ VPLLG  +AH            W  +K NL  +  C+  LVFL
Sbjct  41   VKLGYHYLISNAMYLMLVPLLGIAAAHLSTLTFLDFVQLWDQLKFNLVSVTLCSGLLVFL  100

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR VYL
Sbjct  101  ATLYFMSRPRKVYL  114



>ref|XP_010091264.1| 3-ketoacyl-CoA synthase 11 [Morus notabilis]
 gb|EXB44185.1| 3-ketoacyl-CoA synthase 11 [Morus notabilis]
Length=518

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LIT+ MY+L +PLL   SAH            W+ +K NL  ++ C+S LVFL
Sbjct  34   VKLGYHYLITNAMYILLIPLLAISSAHLSTLKPQDFLQLWNHLKFNLVSVILCSSLLVFL  93

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  94   ATLYFMTRPRKVYL  107



>ref|XP_003519009.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
 gb|KHN15393.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=521

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYLL +PLLG  SAH            W  +K NL  +  C+S  VFL
Sbjct  39   VKLGYHYVISNAMYLLLIPLLGIASAHLSTLSIKDFLQLWENLKFNLVSVTLCSSLTVFL  98

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  99   ATLYFMTRPRGVYL  112



>ref|XP_004498007.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Cicer arietinum]
Length=502

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ +PLLG VS H            W  +K N   +  C+S +VFL
Sbjct  20   VKLGYHYLISNAMYLVLIPLLGVVSTHLATFSLKDLIQLWEILKFNFVSVTLCSSLIVFL  79

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR++YL
Sbjct  80   ATLYFMSRPRSIYL  93



>ref|XP_007143888.1| hypothetical protein PHAVU_007G110500g [Phaseolus vulgaris]
 gb|ESW15882.1| hypothetical protein PHAVU_007G110500g [Phaseolus vulgaris]
Length=516

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYLL +PL+G  SAH            W  +K NL  +  C+S +VFL
Sbjct  34   VKLGYHYLISNAMYLLLIPLIGVASAHLSTLSYQDVAQLWENLKFNLVSVTVCSSLIVFL  93

Query  282  AKLYSNNRPRNVYL  323
               Y  +RPR VYL
Sbjct  94   VTFYFMSRPRGVYL  107



>ref|XP_003536202.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Glycine max]
 gb|KHN30556.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=517

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYLL +PLLG  SAH            W  +K NL  +  C+S +VFL
Sbjct  35   VKLGYHYLISNAMYLLLIPLLGVASAHLSTISYQDVVQLWENLKFNLVSVTLCSSLIVFL  94

Query  282  AKLYSNNRPRNVYL  323
               Y  +RPR VYL
Sbjct  95   VTFYFMSRPRGVYL  108



>ref|XP_002453517.1| hypothetical protein SORBIDRAFT_04g007190 [Sorghum bicolor]
 gb|EES06493.1| hypothetical protein SORBIDRAFT_04g007190 [Sorghum bicolor]
Length=524

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+ H            W+ ++LNL  ++AC++ LVFL
Sbjct  40   VKLGYHYLISHGMYLLLTPLMVLVAVHLSTLSPRDVADLWAHLRLNLISVVACSTLLVFL  99

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  100  GTVYFLTRPRPVYL  113



>gb|KDP40263.1| hypothetical protein JCGZ_02261 [Jatropha curcas]
Length=527

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYLL +PLL   SAH            W+ +K NL  +  C+ F+VFL
Sbjct  41   VKLGYHYLISNAMYLLLIPLLAISSAHLSTITIEDLVQLWNHLKFNLVSVTLCSGFVVFL  100

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  101  ATLYFTSRPRKIYL  114



>gb|KHG21958.1| 3-ketoacyl-CoA synthase 11 -like protein [Gossypium arboreum]
Length=533

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ VPLL   SAH            W  +K NL  +  C+  LVFL
Sbjct  43   VKLGYHYLISNAMYLMLVPLLAIASAHLSTLTVLDFVQLWDQLKFNLVSVTLCSGLLVFL  102

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR VYL
Sbjct  103  ATLYFMSRPRKVYL  116



>gb|AGK29988.1| 3-ketoacyl-CoA synthase 1 [Gossypium raimondii]
Length=533

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ VPLL   SAH            W  +K NL  +  C+  LVFL
Sbjct  43   VKLGYHYLISNAMYLMLVPLLAIASAHLSTLTVLDLVQLWDQLKFNLVSVTLCSGLLVFL  102

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR VYL
Sbjct  103  ATLYFMSRPRKVYL  116



>gb|KEH42797.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=516

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+  MYLL +PL GA SAH            +  +K NL  +  CTS +VFL
Sbjct  32   VKLGYHYLISKAMYLLLIPLFGAASAHLSTISYHDIIQLYENLKFNLVSVTLCTSLMVFL  91

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  92   VTLYFMSRPRGVYL  105



>ref|NP_001151591.1| fatty acid elongase [Zea mays]
 gb|ACG43464.1| fatty acid elongase [Zea mays]
Length=517

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V+           A  W+ ++LNL  +LAC++ LVFL
Sbjct  33   VKLGYHYLITHGMYLLLTPLMVLVAVYLSTLSPRDVADLWAHLRLNLISVLACSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
               Y   RPR VYL
Sbjct  93   GTAYFLTRPRPVYL  106



>gb|ACR36808.1| unknown [Zea mays]
 gb|AFW71390.1| fatty acid elongase [Zea mays]
Length=517

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V+           A  W+ ++LNL  +LAC++ LVFL
Sbjct  33   VKLGYHYLITHGMYLLLTPLMVLVAVYLSTLSPRDVADLWAHLRLNLISVLACSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
               Y   RPR VYL
Sbjct  93   GTAYFLTRPRPVYL  106



>gb|AGK29989.1| 3-ketoacyl-CoA synthase 2 [Gossypium raimondii]
Length=529

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYL+ VPLLG  S H            W  +K NL  +  C+  LVFL
Sbjct  43   VKLGYHYVISNAMYLMLVPLLGIASVHLSTLTILDFVRLWDQLKFNLVSVTLCSGLLVFL  102

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR VYL
Sbjct  103  ATLYFMSRPRKVYL  116



>ref|XP_003536489.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYL+ +PL+G  SAH            W  +K +L  +  C+S +VFL
Sbjct  35   VKLGYHYVISNAMYLMLIPLIGTASAHLSTISMKELVRLWENLKFDLVSVTLCSSLMVFL  94

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  95   GTLYFMSRPRGVYL  108



>ref|XP_004247624.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum lycopersicum]
Length=513

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYL  +P+L A+ AH            W+ +K NL  ++ C++ +VFL
Sbjct  30   VKLGYHYLISHAMYLFLIPILMALFAHLSTITMEDMVQLWNQLKFNLVTVILCSALIVFL  89

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  90   ATLYFMTRPRKVYL  103



>ref|XP_003637542.1| Beta-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH41035.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=521

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ +PLLG  S H            +  +K N   +L CTS +VFL
Sbjct  38   VKLGYHYLISNAMYLVLIPLLGVASVHLSTFSIKDLIQIYENLKFNFVSMLICTSLVVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  98   ATLYFMSRPRGIYL  111



>gb|AFK39024.1| unknown [Medicago truncatula]
Length=521

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ +PLLG  S H            +  +K N   +L CTS +VFL
Sbjct  38   VKLGYHYLISNAMYLVLIPLLGVASVHLSTFSIKDLIQIYENLKFNFVSMLICTSLVVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  98   ATLYFMSRPRGIYL  111



>ref|XP_007145927.1| hypothetical protein PHAVU_007G279500g [Phaseolus vulgaris]
 gb|ESW17921.1| hypothetical protein PHAVU_007G279500g [Phaseolus vulgaris]
Length=519

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYL+ +PL G  S H            W  +K NL  +  C+S +VFL
Sbjct  37   VKLGYHYVISNAMYLMLIPLFGIASTHLTTLSIKDFLQLWENLKFNLVSVTVCSSLMVFL  96

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  97   ATLYFMTRPRGVYL  110



>ref|XP_006362163.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum tuberosum]
Length=521

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYL  +P+L A+ AH            W+ +K NL  ++ C++ +VFL
Sbjct  38   VKLGYHYLISHAMYLFLIPILIALFAHLSTITMEDMVQLWNQLKFNLVTVILCSALIVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  98   ATLYFMTRPRKVYL  111



>gb|KHG17042.1| 3-ketoacyl-CoA synthase 17 -like protein [Gossypium arboreum]
Length=528

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYL+ VPLLG  S H            W+ +K NL  +  C+  LVFL
Sbjct  42   VKLGYHYVISNAMYLMLVPLLGIASVHLSTLTLLDFVRLWNQLKFNLVSVTLCSGLLVFL  101

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR  YL
Sbjct  102  ATLYFMSRPRKAYL  115



>ref|XP_003637030.1| Beta-ketoacyl-CoA synthase [Medicago truncatula]
Length=565

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL+ +PLLG  S H            +  +K N   +L CTS +VFL
Sbjct  38   VKLGYHYLISNAMYLVLIPLLGVASVHLSTFSIKDLIQIYENLKFNFVSMLICTSLVVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  98   ATLYFMSRPRGIYL  111



>gb|EAY84941.1| hypothetical protein OsI_06307 [Oryza sativa Indica Group]
Length=519

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LIT+ +YLL  PL+  V+ H            WS ++ NL  ++ACT+ LVFL
Sbjct  32   VKLGYHYLITNGVYLLLTPLIALVAVHLSTLTAGDVAGLWSHLRFNLVSVVACTTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +    RPR VYL
Sbjct  92   STVRFLTRPRPVYL  105



>ref|XP_003555524.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYLL +PLLG  SA+            W  +K NL  +  C+S +VFL
Sbjct  35   VKLGYHYLISNAMYLLLIPLLGVASAYLSTISYQDVVQLWENLKFNLLSVTLCSSLIVFL  94

Query  282  AKLYSNNRPRNVYL  323
               Y  +RPR VYL
Sbjct  95   VTFYFMSRPRGVYL  108



>ref|NP_001046250.1| Os02g0205500 [Oryza sativa Japonica Group]
 dbj|BAD16019.1| putative beta-ketoacyl-CoA-synthase [Oryza sativa Japonica Group]
 dbj|BAD38439.1| putative beta-ketoacyl-CoA-synthase [Oryza sativa Japonica Group]
 dbj|BAF08164.1| Os02g0205500 [Oryza sativa Japonica Group]
 dbj|BAG90658.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LIT+ +YLL  PL+  V+ H            WS ++ NL  ++ACT+ LVFL
Sbjct  32   VKLGYHYLITNGVYLLLTPLIALVAVHLSTLTAGDVAGLWSHLRFNLVSVVACTTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +    RPR VYL
Sbjct  92   STVRFLTRPRPVYL  105



>ref|XP_008368384.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Malus domestica]
Length=521

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++V+YLL VPL+ A SAH            W  +K N   +  C+  +VFL
Sbjct  38   VKLGYHYLISNVIYLLLVPLIAAASAHLSTLTANDFLHLWQQLKFNFVSVTLCSGLMVFL  97

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  98   TTVYFTTRPRKVYL  111



>ref|XP_009348991.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Pyrus x bretschneideri]
Length=521

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++V+YLL VPL+ A SAH            W  +K N   +  C+  +VFL
Sbjct  38   VKLGYHYLISNVIYLLLVPLIAAASAHLSTLTADDFLHLWQKLKFNFVSVTLCSGLMVFL  97

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  98   TTVYFTTRPRKVYL  111



>gb|ABV60087.1| beta-ketoacyl-CoA synthase [Gossypium hirsutum]
Length=529

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G +++I++ MYL+ VPLLG  S H            W  +K NL  +  C+  LVFL
Sbjct  43   VKLGYYYVISNAMYLMLVPLLGIASVHLSTLTIQDFVRLWDQLKFNLVSVTLCSGLLVFL  102

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR VYL
Sbjct  103  ATLYFMSRPRKVYL  116



>ref|XP_004495403.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cicer arietinum]
Length=514

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+  MYL  +PL GA SAH            +  +K NL  +  C+S +VFL
Sbjct  33   VKLGYHYLISKAMYLFLIPLFGAASAHLSTISYHDVVHLYENLKFNLVSVTLCSSLMVFL  92

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  93   VTLYFMSRPRGVYL  106



>ref|XP_004951508.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Setaria italica]
Length=885

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL +PL+  V+ H            W+ ++LNL  +LAC++ LVFL
Sbjct  401  VKLGYHYLISHGMYLLLMPLMSLVAVHLSTLSPRDVADLWAHLRLNLISVLACSTLLVFL  460

Query  282  AKLYSNNRPRNVYL  323
            A  Y   RPR VYL
Sbjct  461  ATAYFLTRPRPVYL  474



>gb|ACC60973.1| beta-ketoacyl-CoA synthase [Helianthus annuus]
Length=498

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL +PLL  VS H            W  ++ NL  ++ C++ +VFL
Sbjct  16   VKLGYHYLISHFMYLLLIPLLAVVSVHLSTLTSQDLINLWHHLRFNLLTVIICSTLIVFL  75

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RP  VYL
Sbjct  76   ATLYFMSRPNKVYL  89



>ref|XP_008362037.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Malus domestica]
Length=203

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSA-----------HFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++V+YLL VPL+ A SA           H W  +K N   +  C+  +VFL
Sbjct  38   VKLGYHYLISNVIYLLLVPLIAAASAHLSTLTANDFLHLWQQLKFNFVSVTLCSGLMVFL  97

Query  282  AKLYSNNRPRNVYL  323
              +Y    PR VYL
Sbjct  98   TTVYFTTXPRKVYL  111



>ref|XP_002517035.1| acyltransferase, putative [Ricinus communis]
 gb|EEF45198.1| acyltransferase, putative [Ricinus communis]
Length=526

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYLL VPLLG  SA             W+ +K N   +  C+  +VFL
Sbjct  40   VKLGYHYLISNAMYLLLVPLLGIASAQLSTLKIEDLVQLWNHLKFNFVSVTLCSGLIVFL  99

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  100  ATLYFMSRPRKIYL  113



>ref|XP_009595982.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana tomentosiformis]
Length=523

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MY+  VP+LG +S H            W  +K NL  ++ C++ +VFL
Sbjct  42   VKLGYHYLISNAMYVCLVPILGVLSVHLMTISVEDLVQLWDKLKFNLVTVIFCSALVVFL  101

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  102  GTLYFMTRPRKVYL  115



>ref|XP_006647059.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Oryza brachyantha]
Length=526

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ +YLL  PL+  V+ H            W+ ++ NL  ++AC++ LVFL
Sbjct  39   VKLGYHYLISNGVYLLLTPLIVPVAVHLTTLSAGDVADLWAHLRFNLISVVACSTLLVFL  98

Query  282  AKLYSNNRPRNVYL  323
            A +Y   RPR VYL
Sbjct  99   ATVYFLTRPRPVYL  112



>gb|EYU34550.1| hypothetical protein MIMGU_mgv1a004667mg [Erythranthe guttata]
Length=516

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYLL +PLL   S H            W  +K NL  +L C++  VFL
Sbjct  34   VKLGYHYLISNAMYLLLIPLLAISSVHLSTLTTQDLTLLWDQLKFNLVSVLVCSTLTVFL  93

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR +YL
Sbjct  94   CTLYFMTRPRKIYL  107



>gb|EMT24470.1| 3-ketoacyl-CoA synthase 11 [Aegilops tauschii]
Length=524

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  ++ H            W+ ++ NL  ++AC++ LVFL
Sbjct  41   VKLGYHYLITHGMYLLLTPLIVLIAVHLSTLSPGDVADLWTHLRFNLLSVIACSTLLVFL  100

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR+VYL
Sbjct  101  STVYFLTRPRSVYL  114



>gb|EMS65062.1| 3-ketoacyl-CoA synthase 11 [Triticum urartu]
Length=509

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  ++ H            W+ ++ NL  ++AC++ LVFL
Sbjct  40   VKLGYHYLITHGMYLLLTPLIVLIAVHLSTLSPGDVADLWTHLRFNLLSVIACSTLLVFL  99

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR+VYL
Sbjct  100  STVYFLTRPRSVYL  113



>dbj|BAJ93555.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  ++ H            W+ ++ NL  ++AC++ LVFL
Sbjct  39   VKLGYHYLITHGMYLLLTPLIVLIAVHLSTLSPGDVADLWTHLRFNLLSVIACSTLLVFL  98

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR+VYL
Sbjct  99   STVYFLTRPRSVYL  112



>ref|NP_001057996.1| Os06g0598800 [Oryza sativa Japonica Group]
 dbj|BAD32939.1| putative beta-ketoacyl-CoA synthase [Oryza sativa Japonica Group]
 dbj|BAF19910.1| Os06g0598800 [Oryza sativa Japonica Group]
 gb|EAZ37545.1| hypothetical protein OsJ_21873 [Oryza sativa Japonica Group]
Length=519

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  36   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPGDIADLWEQLRFNLLSVVACSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  96   STLYFLTRPRPVYL  109



>gb|EAZ01557.1| hypothetical protein OsI_23590 [Oryza sativa Indica Group]
Length=519

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  36   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPGDIADLWEQLRFNLLSVVACSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  96   STLYFLTRPRPVYL  109



>ref|XP_003571537.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Brachypodium distachyon]
Length=519

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V+ H            W+ ++ NL  ++AC++ LVFL
Sbjct  36   VKLGYHYLITHGMYLLLTPLIVLVAVHLSTLSPGEVADLWAHLRFNLVSVVACSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  96   STVYFLTRPRPVYL  109



>emb|CDO99137.1| unnamed protein product [Coffea canephora]
Length=523

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ +YL+ + LLG +S H            W  ++LNL  ++ C++ +VFL
Sbjct  42   VKLGYHYLISNALYLMLISLLGVLSVHLSTVSVIDLVLLWEQLRLNLVSVVLCSTLMVFL  101

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  102  CTLYFMARPRKVYL  115



>ref|XP_009767720.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana sylvestris]
Length=523

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LIT+ MY+  VP+LGA+               W  +K NL  ++ C++ +VFL
Sbjct  42   VKLGYHYLITNAMYVCLVPILGALLVQLMTISVEDLVQLWDKLKFNLVTVIFCSALVVFL  101

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  102  GTLYFMTRPRKVYL  115



>ref|XP_009804708.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=511

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V AH            W  ++ NL  +++C++ +VF+
Sbjct  30   VKLGYHYLITHGMYLLLTPLVAIVVAHMSTLTPHDLSELWDNLQYNLISVISCSTLIVFV  89

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  90   STIYFLTRPRPVYL  103



>gb|AGT15995.1| fatty acid elongase [Saccharum hybrid cultivar R570]
Length=515

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  32   VKLGYHYLISHGMYLLLSPLMALVTVQLSTVSPRDLADLWEQLRFNLLSVVACSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  92   STVYFLTRPRPVYL  105



>ref|XP_006420077.1| hypothetical protein CICLE_v10004736mg [Citrus clementina]
 gb|ESR33317.1| hypothetical protein CICLE_v10004736mg [Citrus clementina]
Length=522

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ +YLL VP+L   SAH            W+ ++ NL  +  C+S +VFL
Sbjct  37   VKLGYHYLISNALYLLLVPILIISSAHLSTLSVQDIVQLWNQLRYNLVTVTVCSSLMVFL  96

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  97   GTLYFMSRPRKVYL  110



>ref|XP_006489489.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Citrus sinensis]
Length=522

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ +YLL VP+L   SAH            W+ ++ NL  +  C+S +VFL
Sbjct  37   VKLGYHYLISNALYLLLVPILIISSAHLSTLSVQDIVQLWNQLRYNLVTVTVCSSLMVFL  96

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  97   GTLYFMSRPRKVYL  110



>ref|NP_001105135.1| fatty acid elongase1 [Zea mays]
 emb|CAC01441.1| putative fatty acid elongase [Zea mays]
Length=513

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  32   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPHDLADLWEQLRFNLLSVVACSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  92   STVYFLTRPRPVYL  105



>ref|XP_006656205.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Oryza brachyantha]
Length=519

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  36   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPGDLADLWEQLRFNLLSVVACSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  96   STVYFLTRPRPVYL  109



>gb|AFW87109.1| putative fatty acid elongase isoform 1 [Zea mays]
 gb|AFW87110.1| putative fatty acid elongase isoform 2 [Zea mays]
Length=515

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  32   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPHDLADLWEQLRFNLLSVVACSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  92   STVYFLTRPRPVYL  105



>ref|XP_002437234.1| hypothetical protein SORBIDRAFT_10g023290 [Sorghum bicolor]
 gb|EER88601.1| hypothetical protein SORBIDRAFT_10g023290 [Sorghum bicolor]
Length=516

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  33   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPRDLADLWEQLRFNLLSVVACSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  93   STVYFLTRPRPVYL  106



>ref|NP_001266579.1| fatty acid elongase [Zea mays]
 gb|ACG36525.1| fatty acid elongase [Zea mays]
Length=515

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  32   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPHDLADLWEQLRFNLLSVVACSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  92   STVYFLTRPRPVYL  105



>gb|AAP74370.1| FAE3 [Marchantia polymorpha]
Length=529

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH------------FWSTIKLNLAPLLACTS  266
            N   VK G H+LITH M+LL +P    V+A              W+ + LNL  ++AC+S
Sbjct  48   NMKYVKLGYHYLITHAMFLLTLPAFFLVAAEIGRLGHERIYRELWTHLHLNLVSIMACSS  107

Query  267  FLVFLAKLYSNNRPRNVYL  323
             LV  A LY  +RPR VYL
Sbjct  108  ALVAGATLYFMSRPRPVYL  126



>ref|XP_004965965.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Setaria italica]
Length=521

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYLL  PL+  V+           A  W  ++ NL  ++AC++ LVFL
Sbjct  38   VKLGYHYLISHGMYLLLSPLMALVAVQLSTVSPRDLADLWEQLRFNLLSVVACSTLLVFL  97

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  98   STVYFLTRPRPVYL  111



>ref|XP_010925263.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Elaeis guineensis]
Length=507

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PLL  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  26   VKLGYHYLITHAMYLFLTPLLVLVAAQLSTFSVQDLHDLWDHLRFNLVSVILCSTLLVFL  85

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  86   STLYLLTRPRPVYL  99



>ref|XP_008650048.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Zea mays]
 gb|AFW79281.1| hypothetical protein ZEAMMB73_177765 [Zea mays]
Length=509

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H LI+H  YLL  PL G V+AH            W +++ NLA +L  T+ LV  
Sbjct  27   VKLGYHHLISHGAYLLLAPLPGLVAAHLSTFTARDLAELWQSLQYNLASVLVATTALVVT  86

Query  282  AKLYSNNRPRNVYL  323
            A  Y+  RPR VYL
Sbjct  87   ATAYALTRPRPVYL  100



>ref|XP_007222815.1| hypothetical protein PRUPE_ppa004243mg [Prunus persica]
 gb|EMJ24014.1| hypothetical protein PRUPE_ppa004243mg [Prunus persica]
Length=521

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 38/74 (51%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ +Y L VPL+   SAH            W  +K N   +  C+  LVFL
Sbjct  37   VKLGYHYLISNAVYFLLVPLMAVASAHLSTLTLEDFVQLWHQLKFNFVSVTLCSGLLVFL  96

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  97   TTLYFTTRPRKVYL  110



>gb|AAC49186.1| beta-ketoacyl-CoA synthase [Simmondsia chinensis]
Length=521

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N H VK G H+LI++ ++L+F+PLLG  SAH            +  ++ NL P++ C+  
Sbjct  34   NLHHVKLGYHYLISNALFLVFIPLLGLASAHLSSFSAHDLSLLFDLLRRNLLPVVVCSFL  93

Query  270  LVFLAKLYSNNRPRNVYL  323
             V LA L+   RPRNVYL
Sbjct  94   FVLLATLHFLTRPRNVYL  111



>ref|XP_006854931.1| hypothetical protein AMTR_s00052p00130070 [Amborella trichopoda]
 gb|ERN16398.1| hypothetical protein AMTR_s00052p00130070 [Amborella trichopoda]
Length=528

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PLL  V AH            W  ++ NL  ++ C++ LVFL
Sbjct  44   VKLGYHYLITHAMYLFLSPLLIIVIAHLSSLTIQDFHVLWEHLRYNLVSVVVCSALLVFL  103

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  104  STLYFLTRPRPVYL  117



>ref|XP_010670713.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010670714.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Beta vulgaris subsp. 
vulgaris]
Length=515

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHAMYLFLSPLIVVVVAQLSTFSPHDVYVLWERLRFNLISVIVCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            A LY   RPR VYL
Sbjct  91   ATLYFLTRPRPVYL  104



>ref|XP_010918127.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Elaeis guineensis]
Length=514

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H++ITH MYL  +P L  ++AH            W  ++ NL  ++ C++ LVFL
Sbjct  34   VKLGYHYVITHGMYLFLLPFLVLIAAHMSTFSVQDLHVLWKHLRFNLISVIVCSTLLVFL  93

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR+VYL
Sbjct  94   TTLYFLTRPRSVYL  107



>gb|KDO53945.1| hypothetical protein CISIN_1g009935mg [Citrus sinensis]
Length=522

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ +YLL VP+L   SAH            W+ ++ NL  +  C+S +VFL
Sbjct  37   VKLGYHYIISNALYLLLVPILIISSAHLSTLSVQDIVQLWNQLRYNLVTVTVCSSLMVFL  96

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  97   GTLYFMSRPRKVYL  110



>gb|KCW57450.1| hypothetical protein EUGRSUZ_H00229 [Eucalyptus grandis]
Length=483

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+  +YLL VPLLG  SAH            W  ++ NL  ++ C++ +VFL
Sbjct  48   VKLGYHYLISKAIYLLLVPLLGISSAHLSALTARDLAQLWDQLRFNLITVVLCSTIMVFL  107

Query  282  AKLYSNNRPRNVYL  323
              LY    PR VYL
Sbjct  108  VTLYFMTLPRKVYL  121



>ref|XP_010025860.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW57448.1| hypothetical protein EUGRSUZ_H00226 [Eucalyptus grandis]
Length=541

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+  +YLL VPLLG  SAH            W+ ++ NL  ++ C++ +VFL
Sbjct  48   VKLGYHYLISKAIYLLLVPLLGISSAHLSALTARDLAQLWNQLRFNLITVVLCSTLMVFL  107

Query  282  AKLYSNNRPRNVYL  323
              LY    PR VYL
Sbjct  108  VTLYFMTLPRKVYL  121



>gb|AAO48425.1| beta-ketoacyl-CoA-synthase [Marchantia polymorpha]
Length=537

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSF  269
            N   VK G H++ITH +YLL VPLL  V+A F           W  ++ NL  +L C+  
Sbjct  52   NLKYVKLGYHYVITHALYLLMVPLLMVVAAEFGRLGHEDFGQLWEQLQFNLVSVLVCSGT  111

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   LY  +RP  VYL
Sbjct  112  LVFGGTLYFMSRPHPVYL  129



>ref|XP_010254302.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nelumbo nucifera]
Length=511

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL +P +G ++A             W  ++ NL   + C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLLIMPTVGIIAAQLSTFSFQDLYLLWDHLRFNLISAILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  91   STVYFVTRPRPVYL  104



>ref|XP_008224439.1| PREDICTED: 3-ketoacyl-CoA synthase 19 [Prunus mume]
Length=506

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ +Y L VP++   SAH            W  +K N   +  C+  LVFL
Sbjct  37   VKLGYHYLISNAVYFLLVPMMAVASAHLSTLTLEDFVQLWHQLKFNFVSVTLCSGLLVFL  96

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  97   TTLYFTTRPRKVYL  110



>ref|XP_010313709.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V+AH            W  ++ NL  +++C++ +V +
Sbjct  31   VKLGYHYLITHGMYLLLTPLVAVVAAHMSTITPQDLSELWDNLQYNLISVISCSTLIVIV  90

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  91   LTVYVVTRPRPVYL  104



>ref|XP_004251585.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X2 [Solanum 
lycopersicum]
Length=500

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V+AH            W  ++ NL  +++C++ +V +
Sbjct  20   VKLGYHYLITHGMYLLLTPLVAVVAAHMSTITPQDLSELWDNLQYNLISVISCSTLIVIV  79

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  80   LTVYVVTRPRPVYL  93



>gb|EYU21941.1| hypothetical protein MIMGU_mgv1a004813mg [Erythranthe guttata]
Length=509

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PLL  V+A             WS ++ NL  ++ C++ LVFL
Sbjct  29   VKLGYHYLITHGMYLFLSPLLVIVAAQISTFSLQDISVLWSHLRFNLISVIVCSALLVFL  88

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  89   STVYFLTRPRPVYL  102



>ref|XP_002312562.1| hypothetical protein POPTR_0008s15990g [Populus trichocarpa]
 gb|EEE89929.1| hypothetical protein POPTR_0008s15990g [Populus trichocarpa]
Length=520

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+  MYLL VPLL   SAH            W+ +K N   +  C+  +VFL
Sbjct  38   VKLGYHYLISSAMYLLLVPLLFIASAHLSTLTIRDFVQLWNHLKFNFVSVTLCSGLVVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR ++L
Sbjct  98   ATLYFMSRPRKIFL  111



>gb|EYU41418.1| hypothetical protein MIMGU_mgv1a008516mg [Erythranthe guttata]
Length=371

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 12/75 (16%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWST------------IKLNLAPLLACTSFLVF  278
            VK G H+LI++ MYLL +PLL AV+A+  ++            ++ N   +LACTS +  
Sbjct  29   VKLGFHYLISNAMYLLTIPLLLAVAANLSTSDLQHALEASNYHLRYNTLTVLACTSLVAV  88

Query  279  LAKLYSNNRPRNVYL  323
            LA  Y  +RPR VYL
Sbjct  89   LATAYFMSRPRAVYL  103



>ref|XP_004296609.1| PREDICTED: 3-ketoacyl-CoA synthase 17-like [Fragaria vesca subsp. 
vesca]
Length=529

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MY+L VPLL    AH            W  +K N   +  C+  +VFL
Sbjct  45   VKLGYHYLISNAMYILLVPLLMVAFAHLSTLTVEDLANLWDQLKFNFVSVTVCSGLIVFL  104

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  105  TTVYFTTRPRKVYL  118



>ref|XP_009601391.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X2 [Nicotiana 
tomentosiformis]
Length=511

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  + AH            W  ++ NL  +++C++ +VF+
Sbjct  30   VKLGYHYLITHGMYLLLTPLVVIIVAHMSTLTPQDLSELWDNLQYNLISVISCSTLIVFV  89

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  90   STIYFLTRPRPVYL  103



>ref|XP_009601390.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X1 [Nicotiana 
tomentosiformis]
Length=523

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  + AH            W  ++ NL  +++C++ +VF+
Sbjct  42   VKLGYHYLITHGMYLLLTPLVVIIVAHMSTLTPQDLSELWDNLQYNLISVISCSTLIVFV  101

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  102  STIYFLTRPRPVYL  115



>ref|XP_011027418.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Populus euphratica]
Length=520

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+L++  MYLL VPL+   SAH            W+ +K N   +  C+  LVFL
Sbjct  38   VKLGYHYLVSSAMYLLLVPLIFIASAHLSTLTIRDLVQLWNHLKFNFVSVTLCSGLLVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR ++L
Sbjct  98   ATLYFMSRPRKIFL  111



>ref|XP_010025862.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW57449.1| hypothetical protein EUGRSUZ_H00227 [Eucalyptus grandis]
Length=541

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+  +YLL VPL G  SAH            W  ++ NL  ++ C++ +VFL
Sbjct  48   VKLGYHYLISKAIYLLLVPLFGISSAHLSALTARDLAQLWDQLRFNLITVVLCSTLMVFL  107

Query  282  AKLYSNNRPRNVYL  323
              LY    PR VYL
Sbjct  108  VTLYFMTLPRKVYL  121



>ref|XP_004513574.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cicer arietinum]
Length=510

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHAMYLFLSPLVVLIAAQLSTFSLKDVYDIWENLQYNLVSVIICSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYFMTRPRPVYL  103



>ref|XP_009592818.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana tomentosiformis]
Length=492

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKL-----NLAPLLACTSFLVFLAKLYSN  299
            VK G H+LI++ +YLL VP+L A+  H  ST+ L     NLA L + ++ +VFLA LY  
Sbjct  26   VKLGYHYLISNAIYLLIVPILVAIGLHL-STLTLEDLITNLAMLKSYSTLVVFLATLYFM  84

Query  300  NRPRNVYL  323
            +RPRNVYL
Sbjct  85   SRPRNVYL  92



>ref|XP_008792115.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Phoenix dactylifera]
Length=506

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  26   VKLGYHYLITHGMYLFLTPLVVLVAAQLSTFSVQDLHDLWDHLRFNLISVILCSTLLVFL  85

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  86   STLYFLTRPRPVYL  99



>ref|XP_008785403.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Phoenix dactylifera]
 ref|XP_008785411.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Phoenix dactylifera]
Length=506

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+              W  ++ NL   + C++ LVFL
Sbjct  26   VKLGYHYLITHGMYLFLTPLVALVAGQLSTLSVQDLHDLWDHLRFNLVSAILCSTLLVFL  85

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  86   STLYFLTRPRPVYL  99



>ref|XP_010914942.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Elaeis guineensis]
Length=506

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  26   VKLGYHYLITHGMYLFLTPLVVLVAAQLSTFSVQDLHDLWDHLRFNLISVILCSTLLVFL  85

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  86   STLYFLTRPRPVYL  99



>gb|EPS63750.1| hypothetical protein M569_11032, partial [Genlisea aurea]
Length=505

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H MYL  +PLL   S H            W  +K NL  ++ C++ +VFL
Sbjct  25   VKLGYHYLISHAMYLFLLPLLAISSVHLTTITAHDFALLWDQLKFNLLTVVVCSTLIVFL  84

Query  282  AKLYSNNRPRNVYL  323
              +Y   RP  V+L
Sbjct  85   GTVYFMTRPTKVFL  98



>gb|EYU41423.1| hypothetical protein MIMGU_mgv1a004579mg [Erythranthe guttata]
Length=519

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 12/75 (16%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWST------------IKLNLAPLLACTSFLVF  278
            VK G H+LI++ MYLL +PLL AV+A+  ++            ++ N+  +  CTS +  
Sbjct  37   VKLGCHYLISNAMYLLTIPLLLAVAANLSTSHVHRILETCNYHLRYNVLAVTVCTSLMAV  96

Query  279  LAKLYSNNRPRNVYL  323
            LA +Y  +RPR VYL
Sbjct  97   LATVYFMSRPRTVYL  111



>ref|XP_002529366.1| acyltransferase, putative [Ricinus communis]
 gb|EEF33033.1| acyltransferase, putative [Ricinus communis]
Length=498

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHAMYLFLSPLVVVIAAQLSTFSMQDLYTLWEHLQFNLISVIVCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   FTLYFMTRPRPVYL  104



>dbj|BAJ94420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93057.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H LI+H MYLL  PL+  V+           A  W  ++ NL  ++ C++ LVFL
Sbjct  38   VKLGYHHLISHGMYLLLSPLMALVAVQLSTVSPSDLADLWEQLRFNLVSVVVCSTLLVFL  97

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  98   STVYFLTRPRPVYL  111



>ref|XP_002284986.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Vitis vinifera]
 emb|CAN67313.1| hypothetical protein VITISV_014119 [Vitis vinifera]
Length=511

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLQDLHDLWDHLRFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  91   STLYFLTRPRPVYL  104



>ref|XP_010533183.1| PREDICTED: 3-ketoacyl-CoA synthase 11 isoform X1 [Tarenaya hassleriana]
 ref|XP_010533184.1| PREDICTED: 3-ketoacyl-CoA synthase 11 isoform X2 [Tarenaya hassleriana]
Length=511

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVVVAAQISTFSIQDLYNLWEHLQYNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  91   STLYFMTRPRPVYL  104



>gb|KHN46008.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=500

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ +VFL
Sbjct  20   VKLGYHYLITHGMYLFLSPLVVLIAAQLSSFSLEDLHVIWENLQYNLISVIVCSTLIVFL  79

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  80   STLYIMTRPRPVYL  93



>ref|XP_002284751.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Vitis vinifera]
Length=511

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  +K NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLIVLIAAQLSTFSLQDLHDLWENLKFNLISVILCSALLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + L+   RPR VYL
Sbjct  91   STLFVLTRPRPVYL  104



>ref|XP_003522916.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform 1 [Glycine 
max]
Length=510

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ +VFL
Sbjct  30   VKLGYHYLITHGMYLFLSPLVVLIAAQLSSFSLEDLHVIWENLQYNLISVIVCSTLIVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYIMTRPRPVYL  103



>ref|XP_007138322.1| hypothetical protein PHAVU_009G199000g [Phaseolus vulgaris]
 gb|ESW10316.1| hypothetical protein PHAVU_009G199000g [Phaseolus vulgaris]
Length=510

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ +VFL
Sbjct  30   VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLKDLRDIWENLQYNLISVILCSTMIVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYIMTRPRPVYL  103



>ref|XP_009786610.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana sylvestris]
 gb|AHX25586.1| 3-ketoacyl-CoA synthase 19 [Nicotiana tabacum]
Length=492

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKL-----NLAPLLACTSFLVFLAKLYSN  299
            VK G H+LI++ +YL  VP+L A+  H  ST+ L     NLA L + ++ +VFLA LY  
Sbjct  26   VKLGYHYLISNAIYLFIVPILVAIGLHL-STLTLEDLITNLAMLKSYSTLVVFLATLYFM  84

Query  300  NRPRNVYL  323
            +RPRNVYL
Sbjct  85   SRPRNVYL  92



>ref|XP_004241809.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=513

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  33   VKLGYHYLITHGMYLFLSPLVIVLAAQISTFSLSDLYVLWEQLRFNLISVIICSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  93   STLYFLTRPRPVYL  106



>emb|CBI28145.3| unnamed protein product [Vitis vinifera]
Length=581

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  137  VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLQDLHDLWDHLRFNLISVILCSTLLVFL  196

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  197  STLYFLTRPRPVYL  210



>gb|KHN13761.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=500

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ +VFL
Sbjct  20   VKLGYHYLITHGMYLFLSPLVVLIAAQLSSFSLEDLHVIWENLQYNLISVIVCSTLIVFL  79

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  80   STLYIMTRPRPVYL  93



>ref|XP_009607438.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana tomentosiformis]
Length=512

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  32   VKLGYHYLITHGMYLFLSPLVVVLAAQLSTFSLSDLYILWEQLRFNLISVVICSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  92   STLYFLTRPRPVYL  105



>ref|XP_006353644.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum tuberosum]
Length=513

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  33   VKLGYHYLITHGMYLFLSPLVIVLAAQISTFSPSDLYILWEQLRFNLISVIICSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  93   STLYFLTRPRPVYL  106



>gb|AGK29991.1| 3-ketoacyl-CoA synthase 7 [Gossypium raimondii]
Length=510

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLFLTPLVVVIAAQLSTFSVKDLFDLWEHLQYNLISVIICSALLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYFLTRPRPVYL  103



>gb|EAY99126.1| hypothetical protein OsI_21086 [Oryza sativa Indica Group]
Length=520

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH  YLL  PL G V+AH            W  ++ NL  +L C++ LV +
Sbjct  37   VKLGYHYLITHGAYLLLAPLPGLVAAHLSTFTLGDLADLWQNLQYNLVSVLLCSTLLVLV  96

Query  282  AKLYSNNRPRNVYL  323
            +  Y   RPR VYL
Sbjct  97   STAYFLTRPRPVYL  110



>ref|NP_001056391.1| Os05g0574600 [Oryza sativa Japonica Group]
 gb|AAT69586.1| putative beta-ketoacyl synthase [Oryza sativa Japonica Group]
 dbj|BAF18305.1| Os05g0574600 [Oryza sativa Japonica Group]
 dbj|BAG92126.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64780.1| hypothetical protein OsJ_19636 [Oryza sativa Japonica Group]
Length=520

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH  YLL  PL G V+AH            W  ++ NL  +L C++ LV +
Sbjct  37   VKLGYHYLITHGAYLLLAPLPGLVAAHLSTFTLGDLADLWQNLQYNLVSVLLCSTLLVLV  96

Query  282  AKLYSNNRPRNVYL  323
            +  Y   RPR VYL
Sbjct  97   STAYFLTRPRPVYL  110



>ref|XP_009385808.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLFLTPLVFLVAAQLSTFSLDDLHDLWDHLRFNLVSVILCSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  90   STVYFLTRPRPVYL  103



>ref|XP_011081914.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Sesamum indicum]
Length=511

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVVIAAQVSTFSLQDLYVLWDHLRFNLISVIVCSALLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  91   STVYFLTRPRPVYL  104



>gb|AFY98637.1| beta-ketoacyl-CoA synthase II [Phaseolus vulgaris]
Length=510

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ +VFL
Sbjct  30   VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLKDLRDIWENLQYNLISVILCSTMIVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYIMTRPRPVYL  103



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSA-----------HFWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ LLF+PLL AV+              W  ++ NL  +L C++ 
Sbjct  44   NLKYVKLGYHYLITHLVILLFIPLLLAVTLEVGRMGPEEMWQLWVNLQFNLVSVLICSAL  103

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   +Y  +RPR VYL
Sbjct  104  LVFGVTVYVMSRPRPVYL  121



>ref|XP_011086329.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Sesamum indicum]
Length=509

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLCLSPLVVVVAAQLSTFSRQDLSILWEHLRFNLLSVIVCSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR+VYL
Sbjct  90   LTVYFLRRPRSVYL  103



>gb|AGK29990.1| 3-ketoacyl-CoA synthase 11 [Gossypium raimondii]
Length=510

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLFLSPLVVVITAQLSTFSILDLYDLWEHLQYNLISVIICSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYFLTRPRPVYL  103



>ref|XP_004146292.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cucumis sativus]
 gb|KGN65407.1| hypothetical protein Csa_1G418240 [Cucumis sativus]
Length=513

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  33   VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLQDLYEVWGHLQYNLVSVILCSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  93   STLYFLTRPRPVYL  106



>ref|XP_010048253.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW80459.1| hypothetical protein EUGRSUZ_C01804 [Eucalyptus grandis]
Length=511

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   P++  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLTPIVAVIAAQLSTFSIKDLYDLWDHLRFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RP+ VYL
Sbjct  91   STLYFLTRPQPVYL  104



>ref|XP_004170552.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cucumis sativus]
Length=513

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  33   VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLQDLYEVWGHLQYNLVSVILCSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  93   STLYFLTRPRPVYL  106



>ref|XP_006356047.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum tuberosum]
Length=519

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWS-----------TIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL  VP+LG +  H  +            +K NL  ++ C++ +VFL
Sbjct  36   VKLGYHYLISNAMYLFLVPVLGLLCVHVMTISVDDLIQLLDKLKFNLVTVILCSALVVFL  95

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  96   GTLYFMTRPRKVYL  109



>ref|XP_009614092.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana tomentosiformis]
Length=510

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+   +A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLTAAQLSTFSLNDHYVLWDQLRFNLISVVICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  91   STLYFFTRPRPVYL  104



>ref|XP_007013326.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY30945.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=514

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  34   VKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSIQDLYDLWEHLQYNLISVIICSTLLVFL  93

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  94   STLYFLTRPRPVYL  107



>gb|AFK48523.1| unknown [Medicago truncatula]
Length=511

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLIAAQLSTFSLNDIYDIWENLQYNLVSVIICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            +  Y   RPR VYL
Sbjct  91   STFYFMTRPRPVYL  104



>gb|AHX25587.1| 3-ketoacyl-CoA synthase 11 [Nicotiana tabacum]
Length=512

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+   +A             W  ++ NL  ++ C++ LVFL
Sbjct  32   VKLGYHYLITHGMYLFLSPLVVLTAAQLSTFSLNDLYVLWDQLRFNLISVVICSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  92   STLYFFTRPRPVYL  105



>gb|ACJ85761.1| unknown [Medicago truncatula]
Length=511

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLIAAQLSTFSLNDIYDIWENLQYNLVSVIICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            +  Y   RPR VYL
Sbjct  91   STFYFMTRPRPVYL  104



>ref|XP_004234025.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=519

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWS-----------TIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MYL  VP+LG +  H  +            +K NL  ++ C++ +VFL
Sbjct  36   VKLGYHYLISNAMYLFLVPVLGVLCVHVMTISVEDLIQLLDKLKFNLITVILCSAVVVFL  95

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  96   GTLYFMTRPRKVYL  109



>gb|EPS57140.1| hypothetical protein M569_17681, partial [Genlisea aurea]
Length=494

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  14   VKLGYHYLITHGMYLFISPLVVLVAAQLTTFSPQDLYLLWDHLRFNLISVVVCSALLVFL  73

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  74   STVYILTRPRPVYL  87



>gb|KHG01499.1| 3-ketoacyl-CoA synthase 11 -like protein [Gossypium arboreum]
Length=510

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLFLTPLVVIIAAQLSTFSVKDLFDLWEHLQYNLISVIICSALLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYFLTRPRPVYL  103



>gb|KEH37969.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=511

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLIAAQLSTFSLNDIYDIWENLQYNLVSVIICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            +  Y   RPR VYL
Sbjct  91   STFYFMTRPRPVYL  104



>emb|CDO99135.1| unnamed protein product [Coffea canephora]
Length=505

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 38/74 (51%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G  +LI+++ YL+ VPLLG VS H            W     N    + C++F VFL
Sbjct  39   VKLGYCYLISNLRYLIIVPLLGVVSFHLSTVTIKDFDLLWGPFTFNFVATVFCSAFFVFL  98

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  99   GTLYCVTRPRKVYL  112



>ref|XP_007013801.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY31420.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=505

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+L+TH MY+   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  25   VKLGYHYLMTHGMYIFLTPLVVVIAAQLSTFSLQDLHELWDHLRFNLMSVILCSTLLVFL  84

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  85   STLYFLTRPRPVYL  98



>ref|XP_004239114.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum lycopersicum]
Length=493

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKL-----NLAPLLACTSFLVFLAKLYSN  299
            VK G H+LI++ +YL+ VP+L AV  H  ST+ L     NLA L + ++ +VFL  +Y  
Sbjct  27   VKLGYHYLISNAIYLIIVPILVAVGLHL-STLTLEDLMKNLAMLKSYSTLVVFLGTIYFM  85

Query  300  NRPRNVYL  323
            +RPRNVYL
Sbjct  86   SRPRNVYL  93



>emb|CDP03396.1| unnamed protein product [Coffea canephora]
Length=510

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   P +  ++A             W  ++ NL  ++ C+S +VF+
Sbjct  30   VKLGYHYLITHAMYLFITPFVIVIAAQMSTWSLPDLYELWDNLQYNLISVILCSSLIVFI  89

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  90   STIYFLTRPRPVYL  103



>gb|EMT15934.1| 3-ketoacyl-CoA synthase 11 [Aegilops tauschii]
Length=518

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H LI+H  YLL  PL+  V+           A  W  ++ NL  +L C++ LVFL
Sbjct  34   VKLGYHHLISHGTYLLLSPLMALVAVQLSTVSPGDLADLWEQLRFNLVSVLVCSTLLVFL  93

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  94   STVYFLTRPRPVYL  107



>ref|XP_009801870.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=512

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MY+   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  32   VKLGYHYLITHGMYVFLSPLVVVLAAQLSTFSLSDLYILWEQLRFNLISVVICSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  92   STLYFLTRPRPVYL  105



>ref|XP_008464980.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Cucumis melo]
 ref|XP_008464981.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Cucumis melo]
Length=513

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL   ++A             W  ++ NL  ++ C++ LVFL
Sbjct  33   VKLGYHYLITHGMYLFLSPLAVVIAAQLSTFSLQDLYEVWGHLQYNLVSVILCSTLLVFL  92

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  93   STLYFLTRPRPVYL  106



>ref|XP_007154946.1| hypothetical protein PHAVU_003G160400g [Phaseolus vulgaris]
 gb|ESW26940.1| hypothetical protein PHAVU_003G160400g [Phaseolus vulgaris]
Length=510

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLCLTPLVVLIAAQLSTFSFQDFYDIWEHLQYNLISVILCSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYFLTRPRPVYL  103



>ref|XP_010557584.1| PREDICTED: 3-ketoacyl-CoA synthase 11 isoform X2 [Tarenaya hassleriana]
 ref|XP_010557585.1| PREDICTED: 3-ketoacyl-CoA synthase 11 isoform X2 [Tarenaya hassleriana]
 ref|XP_010557586.1| PREDICTED: 3-ketoacyl-CoA synthase 11 isoform X2 [Tarenaya hassleriana]
Length=511

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVVIAAQISTFSLQDLRNLWEHLQYNLISVIICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   LTLYFMTRPRPVYL  104



>ref|XP_010557583.1| PREDICTED: 3-ketoacyl-CoA synthase 11 isoform X1 [Tarenaya hassleriana]
Length=516

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  36   VKLGYHYLITHGMYLFLSPLVVVIAAQISTFSLQDLRNLWEHLQYNLISVIICSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  96   LTLYFMTRPRPVYL  109



>ref|XP_010274236.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nelumbo nucifera]
Length=526

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++I++ MYL+ V L   VSAH            W  ++ NL  +++C+S LVFL
Sbjct  38   VKLGYHYVISNAMYLVVVALFLVVSAHLSTLTSDDIIQLWRHLEFNLVTVVSCSSLLVFL  97

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPRNVYL
Sbjct  98   ATLYFMSRPRNVYL  111



>ref|XP_004961143.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Setaria italica]
Length=528

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH  YLL  PL G V+AH            W +++ NL  ++ C++ LV +
Sbjct  44   VKLGYHHLITHGAYLLLAPLPGLVAAHLSTFTLRDLADLWQSLQYNLVFVVVCSTLLVIV  103

Query  282  AKLYSNNRPRNVYL  323
            A  Y   RPR VYL
Sbjct  104  ATAYVLTRPRPVYL  117



>ref|XP_004241035.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum lycopersicum]
Length=486

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKLNL----APLLACTSFLVFLAKLYSNN  302
            VK G H+LI++ +YLL VP+L A+  H  +    +L      L +C+  +VFLA +Y  +
Sbjct  17   VKLGYHYLISNAIYLLIVPILVAMLLHLSALTIEDLMNHFTMLKSCSPLVVFLATVYFMS  76

Query  303  RPRNVYL  323
            RPRNVYL
Sbjct  77   RPRNVYL  83



>ref|XP_010024057.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW60465.1| hypothetical protein EUGRSUZ_H03186 [Eucalyptus grandis]
Length=529

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ MY+  +PLL   SAH            W  +K NL  ++  ++F+VFL
Sbjct  48   VKLGYHYLISNAMYIFLLPLLLVASAHLSTLTADDLTNLWDQLKFNLVAVVLSSAFVVFL  107

Query  282  AKLYSNNRPRNVYL  323
              L+   RPR VYL
Sbjct  108  ITLHFMTRPRRVYL  121



>dbj|BAF98214.1| CM0216.300.nc [Lotus japonicus]
Length=510

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLFLSPLVVLIAAQLSTFSIKDIYDIWDNLQYNLISVIICSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RP+ VYL
Sbjct  90   STLYFLTRPKPVYL  103



>emb|CDP04806.1| unnamed protein product [Coffea canephora]
Length=511

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   PL+  ++A             W  +K NL  +  C++ LVFL
Sbjct  31   VKLGYHYLITHGMFLFLSPLVVVIAAQLSTFSFQDLHALWEHLKFNLISVFLCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  91   STVYFLTRPRAVYL  104



>ref|XP_011030605.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Populus euphratica]
Length=519

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF--------WSTIKLNLAPLLACTSFLVFLAKL  290
            VK G H+L+++ MYL+ +P+L A+ AH         W+  K N   ++  ++ +VF A L
Sbjct  39   VKLGYHYLVSNAMYLMLMPVLCAIFAHLSTFTVDELWNQFKFNFVTVVLSSTSIVFTATL  98

Query  291  YSNNRPRNVYL  323
            Y  +RPR VYL
Sbjct  99   YFMSRPRKVYL  109



>ref|XP_009381261.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Musa acuminata subsp. 
malaccensis]
Length=512

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI+H M+L F PL+  V A             W  ++ NL  ++ C++ LVFL
Sbjct  32   VKLGYHYLISHGMFLFFSPLIAVVVAQLSTLSVKDLHDLWDHLRFNLISVILCSALLVFL  91

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  92   FTVYFLRRPRPVYL  105



>ref|XP_010688098.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688099.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688100.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Beta vulgaris subsp. vulgaris]
Length=518

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   P +  ++A             W  ++ NL  ++ C++ +VFL
Sbjct  38   VKLGYHYLITHAMYLFLTPFVVILAAQLSTFSIEDINLLWKHLQYNLISVIICSTLIVFL  97

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  98   STLYFMTRPRPVYL  111



>ref|XP_010249963.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nelumbo nucifera]
Length=511

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+   +A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLTAAQLSTFSLQDLYVLWDHLRFNLISVVVCSALLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  91   STVYFLTRPRPVYL  104



>ref|XP_009792392.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
 ref|XP_009792393.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=511

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+   +A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHCLITHGMYLFLSPLVVLTAAQLSTFSLNDLYVLWDQLRFNLISVVICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  91   STLYFFTRPRPVYL  104



>ref|XP_002324276.1| hypothetical protein POPTR_0018s01300g [Populus trichocarpa]
 gb|EEF02841.1| hypothetical protein POPTR_0018s01300g [Populus trichocarpa]
Length=512

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   P++  ++A             W  +K NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMFLFLSPIVVVIAAQLSTFSIQDLHDLWDHLKFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   LTLYFLTRPRPVYL  104



>gb|ACC95444.1| beta-ketoacyl-CoA synthase [Helianthus annuus]
Length=514

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   P++  ++A             W  ++ NL  ++ C++ LVF 
Sbjct  34   VKLGYHYLITHGMYLFLSPVVVVLAAQLSTFSLQDVYVLWDHLRFNLISVVVCSTLLVFF  93

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  94   STLYFLTRPRPVYL  107



>ref|XP_008361241.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Malus domestica]
Length=518

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  38   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLKDLXDLWEHLQYNLISVIICSTLLVFL  97

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  98   STVYFVTRPRPVYL  111



>ref|XP_001758798.1| predicted protein [Physcomitrella patens]
 gb|EDQ76304.1| predicted protein [Physcomitrella patens]
Length=519

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLL-------GAVS----AHFWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ LLF+PL+       G +        W  ++ NL  ++ C++ 
Sbjct  35   NLKYVKLGYHYLITHLLTLLFIPLVLTILLEAGRMGPDDLRQLWDNLRFNLVSVITCSAL  94

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   +Y  +RPR+++L
Sbjct  95   LVFGGTVYFMSRPRSIFL  112



>ref|XP_009374066.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Pyrus x bretschneideri]
Length=518

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  38   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLKDLYDLWEHLQYNLISVIICSTLLVFL  97

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  98   STVYFVTRPRPVYL  111



>ref|XP_006398946.1| hypothetical protein EUTSA_v10013296mg [Eutrema salsugineum]
 gb|ESQ40399.1| hypothetical protein EUTSA_v10013296mg [Eutrema salsugineum]
Length=508

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  28   VKLGYHYLITHGMYLFLSPLVLVIAAQVSTFSLKDLANLWEHLQYNLISVVLCSTLLVFL  87

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  88   MTIYFMTRPRPVYL  101



>gb|AES91419.2| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=489

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  20   VKLGYHYLITHGMYLFLSPLVVLIAAQISTFSIQDFYDIWEHLQYNLVSVIFCSTLLVFL  79

Query  282  AKLYSNNRPRNVYL  323
            + LY   RP+ VYL
Sbjct  80   STLYFLTRPKPVYL  93



>ref|XP_008385932.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Malus domestica]
Length=516

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  36   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLKDLYDLWEHLQYNLISVIICSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  96   STVYFVTRPRPVYL  109



>ref|XP_009348198.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Pyrus x bretschneideri]
Length=516

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  36   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLKDLYDLWEHLQYNLISVIICSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  96   STVYFVTRPRPVYL  109



>ref|XP_009347466.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Pyrus x bretschneideri]
Length=516

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  36   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLKDLYDLWEHLQYNLISVIICSTLLVFL  95

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  96   STVYFVTRPRPVYL  109



>ref|XP_011015110.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Populus euphratica]
Length=512

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   P++  ++A             W  +K NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMFLFLSPIVVVIAAQLSTFSIQDLHDLWDHLKFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   FTLYFLTRPRPVYL  104



>ref|XP_011026502.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Populus euphratica]
Length=512

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   P++  ++A             W  +K NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMFLFLSPIVVVIAAQLSTFSIQDLHDLWDHLKFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   FTLYFLTRPRPVYL  104



>ref|XP_003609222.1| Beta-ketoacyl-coa synthase family protein [Medicago truncatula]
Length=500

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  20   VKLGYHYLITHGMYLFLSPLVVLIAAQISTFSIQDFYDIWEHLQYNLVSVIFCSTLLVFL  79

Query  282  AKLYSNNRPRNVYL  323
            + LY   RP+ VYL
Sbjct  80   STLYFLTRPKPVYL  93



>ref|XP_002878994.1| hypothetical protein ARALYDRAFT_901443 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55253.1| hypothetical protein ARALYDRAFT_901443 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C+  LVFL
Sbjct  29   VKLGYHYLITHGMYLFLSPLVLVIAAQISTFSISDIRNLWEHLQYNLISVIVCSMLLVFL  88

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  89   MTIYFMTRPRPVYL  102



>gb|ACY78677.1| fatty acid elongase [Pistacia chinensis]
Length=511

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLIAAQVSTFSLQDPYDLWEHLQYNLIFVIICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  91   STLYFLTRPRPVYL  104



>gb|ABK94954.1| unknown [Populus trichocarpa]
Length=519

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 42/71 (59%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF--------WSTIKLNLAPLLACTSFLVFLAKL  290
            VK G H+L+++ MYL+ +P+L  + AH         W+ +K N   ++  ++ +VF A L
Sbjct  39   VKLGYHYLVSNAMYLMLMPVLCVIFAHLSTFTVDELWNQLKFNFVTVVLSSTSIVFTATL  98

Query  291  YSNNRPRNVYL  323
            Y  +RPR VYL
Sbjct  99   YFMSRPRKVYL  109



>ref|XP_010417808.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Camelina sativa]
Length=509

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C+  LVFL
Sbjct  29   VKLGYHYLITHGMYLFLSPLVLVIAAQISSFSLSDLRNLWEHLQYNLISVIVCSMLLVFL  88

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  89   MTIYFMTRPRPVYL  102



>ref|XP_006378367.1| hypothetical protein POPTR_0010s09000g [Populus trichocarpa]
 gb|ERP56164.1| hypothetical protein POPTR_0010s09000g [Populus trichocarpa]
Length=519

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 42/71 (59%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF--------WSTIKLNLAPLLACTSFLVFLAKL  290
            VK G H+L+++ MYL+ +P+L  + AH         W+ +K N   ++  ++ +VF A L
Sbjct  39   VKLGYHYLVSNAMYLMLMPVLCVIFAHLSTFTVDELWNQLKFNFVTVVLSSTSIVFTATL  98

Query  291  YSNNRPRNVYL  323
            Y  +RPR VYL
Sbjct  99   YFMSRPRKVYL  109



>ref|NP_180232.1| 3-ketoacyl-CoA synthase 11 [Arabidopsis thaliana]
 sp|O48780.1|KCS11_ARATH RecName: Full=3-ketoacyl-CoA synthase 11; Short=KCS-11; AltName: 
Full=Very long-chain fatty acid condensing enzyme 11; Short=VLCFA 
condensing enzyme 11 [Arabidopsis thaliana]
 gb|AAB95298.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AAO41904.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AAO64112.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEC07869.1| 3-ketoacyl-CoA synthase 11 [Arabidopsis thaliana]
Length=509

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C+  LVFL
Sbjct  29   VKLGYHYLITHGMYLFLSPLVLVIAAQISTFSVTDLRSLWEHLQYNLISVVVCSMLLVFL  88

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  89   MTIYFMTRPRPVYL  102



>ref|XP_008242707.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Prunus mume]
Length=519

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  39   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLQDLYDLWEHLQYNLISVIICSTLLVFL  98

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  99   STVYFLTRPRPVYL  112



>ref|XP_007204837.1| hypothetical protein PRUPE_ppa004269mg [Prunus persica]
 gb|EMJ06036.1| hypothetical protein PRUPE_ppa004269mg [Prunus persica]
Length=519

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  39   VKLGYHILITHGMYLFLSPLVVVIAAQISTFSLQDLYDLWEHLQYNLISVIICSTLLVFL  98

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  99   STVYFLTRPRPVYL  112



>ref|XP_004287376.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  35   VKLGYHILITHGMYLFLSPLVIVIAAQLSTFSLQDLYDLWEHLQYNLISVIICSTLLVFL  94

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  95   STVYFLTRPRPVYL  108



>ref|XP_004508544.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X1 [Cicer 
arietinum]
Length=504

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PLL  ++A             W  ++ NL  ++ CT+ LVFL
Sbjct  24   VKLGYHYLITHGMYLFLSPLLILIAAQLSTFSIQDIYDLWEHLQYNLISVIVCTTLLVFL  83

Query  282  AKLYSNNRPRNVYL  323
            + LY   R + VYL
Sbjct  84   STLYFFTRSQPVYL  97



>ref|XP_010473048.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X1 [Camelina 
sativa]
 ref|XP_010473049.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X2 [Camelina 
sativa]
Length=509

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C+  LVFL
Sbjct  29   VKLGYHYLITHGMYLFLSPLVLVIAAQISSFSLSDLRNLWEHLQYNLISVIVCSMLLVFL  88

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  89   MTIYFVTRPRPVYL  102



>ref|XP_006293527.1| hypothetical protein CARUB_v10024547mg [Capsella rubella]
 gb|EOA26425.1| hypothetical protein CARUB_v10024547mg [Capsella rubella]
Length=509

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C+  LVFL
Sbjct  29   VKLGYHYLITHGMYLFLSPLVLVIAAQISTFSLSDLRNLWEHLQYNLISVVVCSMLLVFL  88

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  89   MTIYFMTRPRPVYL  102



>ref|XP_003549787.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=510

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C + LVFL
Sbjct  30   VKLGYHYLITHGMYLCLSPLVVLIAAQLSTFSLRDLYDLWEHLQYNLISVILCLTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  90   STLYFLTRPRPVYL  103



>ref|XP_006450506.1| hypothetical protein CICLE_v10008045mg [Citrus clementina]
 gb|ESR63746.1| hypothetical protein CICLE_v10008045mg [Citrus clementina]
Length=511

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++ITH MYL   PL+  ++A             W  ++ N   ++ C++ LVFL
Sbjct  31   VKLGYHYVITHGMYLFLSPLVALIAAQLSTFSIQDIYDLWEHLRFNFISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RP+ VYL
Sbjct  91   STLYFLTRPQPVYL  104



>ref|XP_004508545.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X2 [Cicer 
arietinum]
Length=504

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PLL  ++A             W  ++ NL  ++ CT+ LVFL
Sbjct  24   VKLGYHYLITHGMYLFLSPLLILIAAQLSTFSIQDIYDLWEHLQYNLISVIVCTTLLVFL  83

Query  282  AKLYSNNRPRNVYL  323
            + LY   R + VYL
Sbjct  84   STLYFFTRSQPVYL  97



>ref|XP_011019752.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Populus euphratica]
Length=512

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   P+   ++A             W  +K NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMFLFLSPIAVVIAAQLSTFSIQDLHDLWDHLKFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   LTLYFLTRPRPVYL  104



>ref|XP_004245214.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
 ref|XP_010325133.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=505

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  25   VKLGYHYLITHGMYLFLSPLVVIIAAQLSTFSPNDFYVLWDQLRFNLISVVICSTLLVFL  84

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RP  VYL
Sbjct  85   STVYFITRPSPVYL  98



>ref|XP_002305431.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
 gb|EEE85942.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
Length=510

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAV----------SAH-FWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ L FVPL+  V            H  W  ++ NL  ++ C+ F
Sbjct  31   NLKYVKLGYHYLITHLLTLCFVPLIAFVIFQASQLNPNDIHQLWLHLQYNLVSVIICSVF  90

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF A +Y   RPR+VYL
Sbjct  91   LVFGATVYIVTRPRSVYL  108



>ref|XP_006483306.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Citrus sinensis]
 gb|KDO61649.1| hypothetical protein CISIN_1g044260mg [Citrus sinensis]
Length=511

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++ITH MYL   PL+  ++A             W  ++ N   ++ C++ LVFL
Sbjct  31   VKLGYHYVITHGMYLFLSPLVALIAAQLSTFSIQDIYDLWEHLRFNFISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RP+ VYL
Sbjct  91   STLYFLTRPQPVYL  104



>ref|XP_006348760.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum tuberosum]
Length=493

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 6/68 (9%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKL-----NLAPLLACTSFLVFLAKLYSN  299
            VK G H+LI++ +YL+ VP+L AV  H  ST+ L     NL  L + ++ +VFL  +Y  
Sbjct  27   VKLGYHYLISNAIYLVIVPILVAVGLHL-STLTLEDLMTNLVMLKSYSTLVVFLGTVYFM  85

Query  300  NRPRNVYL  323
            +RPRNVYL
Sbjct  86   SRPRNVYL  93



>ref|XP_010098974.1| 3-ketoacyl-CoA synthase 11 [Morus notabilis]
 gb|EXB76276.1| 3-ketoacyl-CoA synthase 11 [Morus notabilis]
Length=514

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   PL+  + A             W  ++ NL  ++ C++ LVFL
Sbjct  34   VKLGYHYLITHGMFLFLSPLVVVIVAQLSTFSLQDLYDLWEHLQFNLISVIICSTLLVFL  93

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  94   CTLYFFTRPRPVYL  107



>ref|XP_003524525.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
 gb|KHN27395.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=510

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  30   VKLGYHYLITHGMYLCLSPLVVLIAAQLSTFSLQDLYDLWEHLQYNLISVILCSTLLVFL  89

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR V+L
Sbjct  90   STLYFLTRPRPVFL  103



>gb|KDO80366.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=547

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  67   VKLGYHYLITHGMFLFLSPLVVIVAAQLSTFSFQDLYDLWEHLQYNLISVIICSTLLVFL  126

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  127  LTLYFLTRPRPVYL  140



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ L  +PL+  +               W  +K NL  ++AC++ 
Sbjct  26   NLKYVKLGYHYLITHLLTLCLIPLMSVIIIQVSQMNPQDIHQLWLHLKYNLVSVIACSTI  85

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y   RPR+VYL
Sbjct  86   LVFGSTVYIMTRPRSVYL  103



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPL----------LGAVSAH-FWSTIKLNLAPLLACTSF  269
            N   VK G H+L+TH++ L  VPL          LG    H  W  +K NL  ++ C++ 
Sbjct  50   NLKYVKLGYHYLVTHLITLTLVPLMLGVAIEVGRLGPEDIHQLWIHLKFNLVSVMTCSAL  109

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF A +Y  +RPR+V+L
Sbjct  110  LVFAATVYFMSRPRSVFL  127



>ref|XP_006475774.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Citrus sinensis]
 gb|KDO80367.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=512

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  32   VKLGYHYLITHGMFLFLSPLVVIVAAQLSTFSFQDLYDLWEHLQYNLISVIICSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  92   LTLYFLTRPRPVYL  105



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPL----------LGAVSAH-FWSTIKLNLAPLLACTSF  269
            N   VK G H+L+TH++ L  VPL          LG    H  W  +K NL  ++ C++ 
Sbjct  50   NLKYVKLGYHYLVTHLITLTLVPLMLGVAIEVGRLGPEDIHQLWIHLKFNLVSVMTCSAL  109

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF A +Y  +RPR+V+L
Sbjct  110  LVFAATVYFMSRPRSVFL  127



>ref|XP_006378369.1| hypothetical protein POPTR_0010s09020g [Populus trichocarpa]
 gb|ERP56166.1| hypothetical protein POPTR_0010s09020g [Populus trichocarpa]
Length=519

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF--------WSTIKLNLAPLLACTSFLVFLAKL  290
            VK G H+L+++ MYL+ +P L  + AH         W+ +K N   ++  ++ +VF A L
Sbjct  39   VKLGYHYLVSNAMYLMLMPALCVIFAHLSTFTVDELWNQLKFNFVTVVLSSTSIVFTATL  98

Query  291  YSNNRPRNVYL  323
            Y  +RPR VYL
Sbjct  99   YFMSRPRKVYL  109



>gb|KHN05051.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=471

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 33/62 (53%), Gaps = 11/62 (18%)
 Frame = +3

Query  171  MYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFLAKLYSNNRPRNV  317
            MYLL +PLLG  SA+            W  +K NL  +  C+S +VFL   Y  +RPR V
Sbjct  1    MYLLLIPLLGVASAYLSTISYQDVVQLWENLKFNLVSVTLCSSLIVFLVTFYFMSRPRGV  60

Query  318  YL  323
            YL
Sbjct  61   YL  62



>ref|XP_008219888.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Prunus mume]
Length=515

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 37/74 (50%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL     A             W  ++ NL  ++ C++ LVFL
Sbjct  35   VKLGYHYLITHGMYLFLSPLFVLTVAQLSTFSLQDLHDLWDHLRFNLISVVLCSTLLVFL  94

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  95   LTLYFLTRPRPVYL  108



>gb|KDP32347.1| hypothetical protein JCGZ_13272 [Jatropha curcas]
Length=511

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H++ITH MYL   PL+  ++A             W  ++ NL  ++ C+  LVFL
Sbjct  31   VKLGYHYVITHGMYLFLSPLVVLIAAQISTFSLQDFYSLWEHLQYNLISVVCCSMLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY  +RPR VYL
Sbjct  91   FTLYFMSRPRPVYL  104



>ref|XP_008796426.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Phoenix dactylifera]
Length=514

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++ITH MYL  +P L  ++AH            W  ++ NL   + C++ LVFL
Sbjct  34   VKLGYHYVITHGMYLFLLPFLLLIAAHLSTFSVQDLHALWEHLRFNLISAIVCSALLVFL  93

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR+VYL
Sbjct  94   STLYFLTRPRSVYL  107



>ref|XP_007223150.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica]
 gb|EMJ24349.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica]
Length=515

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 37/74 (50%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL     A             W  ++ NL  ++ C++ LVFL
Sbjct  35   VKLGYHYLITHGMYLFLSPLFVLTVAQLSTFSLQDLHDLWDHLRFNLISVVLCSTLLVFL  94

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  95   LTLYFLTRPRPVYL  108



>ref|XP_009407649.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Musa acuminata subsp. 
malaccensis]
Length=512

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H++ITH MYL F PL+  + A             W  ++ NL   + C++ LVFL
Sbjct  32   VKLGYHYVITHGMYLFFSPLIAVLVAQLSTFSIKDLHDLWDHLRFNLISAVLCSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +Y   R R VYL
Sbjct  92   STVYFLTRRRPVYL  105



>ref|XP_006378373.1| hypothetical protein POPTR_0010s09040g [Populus trichocarpa]
 gb|ERP56170.1| hypothetical protein POPTR_0010s09040g [Populus trichocarpa]
Length=519

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF--------WSTIKLNLAPLLACTSFLVFLAKL  290
            VK G H+L+ + MYL+ +P+L  + AH         W+ +K N   ++  ++ +VF A L
Sbjct  39   VKLGYHYLVYNAMYLMLMPVLCVIFAHLSTFTVDELWNQLKFNFVTVVLSSTSIVFTATL  98

Query  291  YSNNRPRNVYL  323
            Y  +RPR VYL
Sbjct  99   YFMSRPRKVYL  109



>ref|XP_002308642.1| hypothetical protein POPTR_0006s26530g [Populus trichocarpa]
 ref|XP_006382070.1| beta-ketoacyl-CoA synthase family protein [Populus trichocarpa]
 gb|EEE92165.1| hypothetical protein POPTR_0006s26530g [Populus trichocarpa]
 gb|ERP59867.1| beta-ketoacyl-CoA synthase family protein [Populus trichocarpa]
Length=512

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   P+   ++A             W  +K NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMFLFLSPIAVVIAAQLSTFSIQDLHDLWYHLKFNLISVILCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  91   LTLYFLTRPRPVYL  104



>ref|XP_006451013.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
 gb|ESR64253.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
Length=547

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  67   VKLGYHYLITHGMFLFLSPLVVIVAAQLSTFSFQDLYDLWVHLQYNLISVIICSTLLVFL  126

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  127  LTLYFLTRPRPVYL  140



>ref|XP_010049954.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Eucalyptus grandis]
 gb|KCW82783.1| hypothetical protein EUGRSUZ_C04159 [Eucalyptus grandis]
Length=511

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H LITH MYL   P +  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHILITHGMYLFLSPFVVLIAAQLSTFSIKDLHDLWIHLQYNLISVIVCSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  91   STLYFLTRPRPVYL  104



>ref|XP_006451014.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
 gb|ESR64254.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
Length=512

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH M+L   PL+  V+A             W  ++ NL  ++ C++ LVFL
Sbjct  32   VKLGYHYLITHGMFLFLSPLVVIVAAQLSTFSFQDLYDLWVHLQYNLISVIICSTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  92   LTLYFLTRPRPVYL  105



>emb|CAN68997.1| hypothetical protein VITISV_033594 [Vitis vinifera]
Length=405

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSA-----------HFWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ L  +PL+  +               W  ++ NL  ++ C++F
Sbjct  25   NLKYVKLGYHYLITHLLTLCLIPLMALIIVEASQKNPDDIHQLWLHLQYNLVSIIICSAF  84

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y   RPR++YL
Sbjct  85   LVFGSTVYIMTRPRSIYL  102



>ref|XP_010069189.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW57455.1| hypothetical protein EUGRSUZ_H00235 [Eucalyptus grandis]
Length=531

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 38/74 (51%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKLNLAPLLACTSF-----------LVFL  281
            VK G H+LI++ MYLL VPLLG  SAH  +    +LA L     F           +VFL
Sbjct  56   VKLGFHYLISNAMYLLLVPLLGISSAHILTLTARDLAQLSDQLRFNLVTVVLFPAVMVFL  115

Query  282  AKLYSNNRPRNVYL  323
               Y   RPR VYL
Sbjct  116  GTPYFMTRPRKVYL  129



>ref|XP_010028602.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Eucalyptus grandis]
Length=513

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N   VK G H+L+TH + LL VP +  +               W  +K NL  ++ C++F
Sbjct  34   NLKYVKLGYHYLMTHFLTLLLVPSMAVIIVQASQMNPEEINQLWLHLKYNLVSVIICSAF  93

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y  +RPR+VYL
Sbjct  94   LVFGSTVYIMSRPRSVYL  111



>ref|XP_006350730.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum tuberosum]
Length=488

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKLN-----LAPLLACTSFLVFLAKLYSN  299
             K G H+LI++ +YLL VP+L A+  H  ST+ +       A L +C++ +VF A +Y  
Sbjct  20   AKLGYHYLISNAIYLLIVPILVAMLLHL-STLTIEDLMNHFAMLKSCSTLVVFFATVYFM  78

Query  300  NRPRNVYL  323
            +RPRNVYL
Sbjct  79   SRPRNVYL  86



>gb|KCW55362.1| hypothetical protein EUGRSUZ_I01277 [Eucalyptus grandis]
Length=462

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N   VK G H+L+TH + LL VP +  +               W  +K NL  ++ C++F
Sbjct  34   NLKYVKLGYHYLMTHFLTLLLVPSMAVIIVQASQMNPEEINQLWLHLKYNLVSVIICSAF  93

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y  +RPR+VYL
Sbjct  94   LVFGSTVYIMSRPRSVYL  111



>gb|KCW75690.1| hypothetical protein EUGRSUZ_D00054 [Eucalyptus grandis]
Length=379

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 38/74 (51%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKLNLAPLLACTSF-----------LVFL  281
            VK G H+LI++ MYLL VPLLG  SAHF +    +LA L     F           +VFL
Sbjct  52   VKLGYHYLISNAMYLLLVPLLGISSAHFLTLTAQDLAQLSDQLRFNLVTVVLFPAVMVFL  111

Query  282  AKLYSNNRPRNVYL  323
              L    RP  VYL
Sbjct  112  VTLSFVTRPSKVYL  125



>gb|KEH23437.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=762

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYL   PL+  ++A             W  ++ NL  ++ C++ LVFL
Sbjct  31   VKLGYHYLITHGMYLFLSPLVVLIAAQLSTFSLNDIYDIWENLQYNLVSVIICSTLLVFL  90

Query  282  AKLYSNNRPRNVYL  323
            +  Y    PR VYL
Sbjct  91   STFYFMTCPRPVYL  104



>ref|XP_010255306.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=523

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAV-----------SAHFWSTIKLNLAPLLACTSF  269
            N   VK G H+L++H++ L  +PL+  +           +   W  ++ NL  ++ C++F
Sbjct  44   NLKYVKLGYHYLVSHLLTLCLIPLMAMIIVQAGQMNPEDARQLWLHLQYNLVSVIVCSAF  103

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + LY   RPR VYL
Sbjct  104  LVFGSTLYVMTRPRPVYL  121



>gb|AGK29992.1| 3-ketoacyl-CoA synthase 19 [Gossypium raimondii]
Length=512

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+++TH MYL   PL+  ++              W  ++ NL  ++ C+  LVFL
Sbjct  32   VKLGYHYVVTHGMYLFLSPLVVVIAVQLSTFSIQDLHDLWEHLQYNLISVIICSMLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + LY   RPR VYL
Sbjct  92   STLYFLTRPRPVYL  105



>ref|XP_001757962.1| predicted protein [Physcomitrella patens]
 gb|EDQ77204.1| predicted protein [Physcomitrella patens]
Length=516

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLL-------GAVSAH----FWSTIKLNLAPLLACTSF  269
            N   VK G H +I+H MYLL +P L       G +S H     W  ++ NL  +L  +  
Sbjct  30   NLKYVKLGYHIVISHAMYLLMLPALLTIFAEVGRLSHHDVGDLWRQLQYNLVSVLVTSGA  89

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF A LY   RPR VYL
Sbjct  90   LVFGATLYFMTRPRPVYL  107



>ref|XP_006378377.1| hypothetical protein POPTR_0010s09060g [Populus trichocarpa]
 gb|ERP56174.1| hypothetical protein POPTR_0010s09060g [Populus trichocarpa]
Length=519

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF--------WSTIKLNLAPLLACTSFLVFLAKL  290
            VK G H+L+++  YL+ +P+L  + AH         W  +K N   ++  ++ +VF A L
Sbjct  39   VKLGYHYLVSNATYLMLMPVLCVIFAHLSTFTVDELWKQLKFNFVTVVLSSTSIVFTATL  98

Query  291  YSNNRPRNVYL  323
            Y  +RPR VYL
Sbjct  99   YFMSRPRQVYL  109



>gb|EPS60765.1| hypothetical protein M569_14036, partial [Genlisea aurea]
Length=503

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N   VK G H+LI++++ L  VPL+GA+  H            W  +K NL  ++ C++F
Sbjct  25   NLKYVKLGYHYLISNLLALCLVPLIGAIFIHASEMNPDDVLQLWLHLKYNLVSVVICSAF  84

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y    PR VYL
Sbjct  85   LVFGSTVYIMTLPRAVYL  102



>ref|XP_001753229.1| predicted protein [Physcomitrella patens]
 gb|EDQ81858.1| predicted protein [Physcomitrella patens]
Length=532

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 40/78 (51%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAHFWS-----------TIKLNLAPLLACTSF  269
            N   VK G H LITH+  LLF+P+L  +    W             ++ NL  ++ C++ 
Sbjct  45   NLKYVKLGYHHLITHLFTLLFIPMLLGIFLEVWRMSPNDLHSLWMNLQFNLVSVIICSAL  104

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   +Y  +RPR +YL
Sbjct  105  LVFGGTVYVMSRPRTIYL  122



>ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=504

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSA-----------HFWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ L  +PL+  +               W  ++ NL  ++ C++F
Sbjct  25   NLKYVKLGYHYLITHLLTLCLIPLMALIIVEASQKNPDDIHQLWLHLQYNLVSIIICSAF  84

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y   RPR++YL
Sbjct  85   LVFGSTVYIMTRPRSIYL  102



>ref|XP_003606927.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES89124.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=504

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ L  +PL+  +               W  +K NL  ++ C++ 
Sbjct  25   NLKYVKLGYHYLITHLLTLCLIPLMSVIIIQVSQMNPNEIHQLWLHLKYNLVSIITCSAI  84

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + +Y   RPR++YL
Sbjct  85   LVFGSTVYIMTRPRSIYL  102



>ref|XP_011037520.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAV----------SAH-FWSTIKLNLAPLLACTSF  269
            N   VK G H+LITH++ L FVP +  V            H  W  ++ NL  ++ C+ F
Sbjct  31   NLKYVKLGYHYLITHLLTLCFVPSIAFVIFQASQLNPNDIHQLWLHLQYNLVSVIICSVF  90

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF A +Y   RPR+VYL
Sbjct  91   LVFGATVYIVTRPRSVYL  108



>ref|XP_010254814.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=506

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLL-------GAVSA----HFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+L+ H+M L  VP++       G +S+    H W  ++ NL  +  C++ LVF 
Sbjct  31   VKLGYHYLMKHLMTLCLVPIVAMTVDKAGQMSSDDVLHLWLHLQHNLVTVAVCSALLVFG  90

Query  282  AKLYSNNRPRNVYL  323
            A +Y   RPR+VYL
Sbjct  91   ATVYVMTRPRSVYL  104



>ref|XP_006387086.1| hypothetical protein POPTR_1902s002002g, partial [Populus trichocarpa]
 gb|ERP46000.1| hypothetical protein POPTR_1902s002002g, partial [Populus trichocarpa]
Length=217

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAV----------SAH-FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH++ L  VPL+  V            H  W  ++ NL  ++ C++FLVF 
Sbjct  35   VKLGYHYLITHLLTLCLVPLMAFVIFQAFQLNPNDIHQLWLHLQYNLVSVIICSAFLVFG  94

Query  282  AKLYSNNRPRNVYL  323
            A +Y   RPR+++L
Sbjct  95   ATVYIMTRPRSLFL  108



>emb|CDX98800.1| BnaC09g50350D [Brassica napus]
Length=518

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PLL  ++A             W  ++ NL  ++ C++ LVF+
Sbjct  38   VKLGYHYLITHGMYLLLSPLLLLIAAQLSTFSRTDLATLWDHLQYNLISVILCSTLLVFI  97

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  98   TTIYVMTRPRPVYL  111



>gb|EAZ22163.1| hypothetical protein OsJ_05826 [Oryza sativa Japonica Group]
Length=519

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 37/74 (50%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            V  G H+LI    YLL    L     +F           WS ++LNL  ++ACT+ LVFL
Sbjct  32   VNLGYHYLIPKGFYLLLTRFLAFFPFNFSRLTAGDVAGLWSHLRLNLVSVVACTTLLVFL  91

Query  282  AKLYSNNRPRNVYL  323
            + +    RPR VYL
Sbjct  92   STVRFLTRPRPVYL  105



>ref|XP_009122553.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Brassica rapa]
Length=517

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PLL  ++A             W  ++ NL  ++ C++ LVF+
Sbjct  37   VKLGYHYLITHGMYLLLSPLLLLIAAQVSTFSRADLATLWDHLQYNLISVILCSTLLVFI  96

Query  282  AKLYSNNRPRNVYL  323
              +Y   RPR VYL
Sbjct  97   TTIYVMTRPRPVYL  110



>ref|XP_009394797.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Musa acuminata subsp. 
malaccensis]
Length=514

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSF  269
            N   VK G H+L+++ ++LL VPL+ A S H            W  ++ NL  ++  ++ 
Sbjct  28   NVKYVKLGYHYLVSNGLFLLLVPLIAAASMHLSSLTSEDFLLLWDKLRFNLVAVVLSSTL  87

Query  270  LVFLAKLYSNNRPRNVYL  323
            +V L+ +Y   RPR VYL
Sbjct  88   IVSLSTIYFMKRPRPVYL  105



>ref|XP_010692792.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Beta vulgaris subsp. 
vulgaris]
Length=511

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 13/76 (17%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSA-------------HFWSTIKLNLAPLLACTSFLV  275
            VK G H+LI++ +YL+FVP+L  + +             H W  +KLNL  +++  S L+
Sbjct  22   VKLGYHYLISNALYLIFVPILAMIFSAPLPALITNQDFSHLWILLKLNLFAVVSGISLLI  81

Query  276  FLAKLYSNNRPRNVYL  323
            FLA ++  +RP  +YL
Sbjct  82   FLATVHFMSRPPKIYL  97



>ref|XP_008805392.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Phoenix dactylifera]
Length=525

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAV-----------SAHFWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH++ LL +PL+  +               W  ++ NL  +L C++ LVF 
Sbjct  41   VKLGYHYLITHLVTLLLIPLMAMILVEAGRTDPDDIRQLWVHLQYNLVSVLVCSAVLVFG  100

Query  282  AKLYSNNRPRNVYL  323
            + +Y   RPR VYL
Sbjct  101  STVYIMTRPRPVYL  114



>ref|XP_006366859.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum tuberosum]
Length=511

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH MYLL  PL+  V+AH            W  ++ NL  +++C++ +V +
Sbjct  31   VKLGYHYLITHGMYLLLTPLVAVVAAHMSTLTPQDLSELWDNLQYNLISVISCSTLIVIV  90

Query  282  AKLYSNNRPRNVYL  323
              +Y   RP  VYL
Sbjct  91   VTVYIVTRPHPVYL  104



>gb|KDP38510.1| hypothetical protein JCGZ_04435 [Jatropha curcas]
Length=502

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSF  269
            N   VK G H+LI++++ L F+PL+   S            H W  ++ NL  ++ C++F
Sbjct  23   NLKYVKLGYHYLISNLLTLCFIPLIVVTSIEASQMNLDDLRHLWLHLQYNLVSIIICSAF  82

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   +Y   RPR VYL
Sbjct  83   LVFGLTVYIMTRPRPVYL  100



>ref|XP_006846574.1| hypothetical protein AMTR_s00018p00245180 [Amborella trichopoda]
 gb|ERN08249.1| hypothetical protein AMTR_s00018p00245180 [Amborella trichopoda]
Length=539

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLL-GAV------SAH----FWSTIKLNLAPLLACTSFLVFL  281
            VK G  +L++H +YL  +PLL GA+        H    FWS +  +L   + CT  L+F+
Sbjct  54   VKLGYGYLMSHGLYLTVIPLLFGALFQAVRFGRHPVLGFWSNLCFDLVTAMGCTVVLIFV  113

Query  282  AKLYSNNRPRNVYL  323
              LY   RPR VYL
Sbjct  114  LTLYLVKRPRPVYL  127



>gb|AGK29996.1| 3-ketoacyl-CoA synthase 18 [Gossypium raimondii]
Length=515

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSF  269
            N   VK G H+LI++++ L F+PL+  +S              W  ++ NLA ++ C++ 
Sbjct  36   NLKYVKLGYHYLISNLLTLCFIPLIAVISIEASQMNLDDLRQLWVHLQYNLASIIICSAI  95

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   +Y   RPR VYL
Sbjct  96   LVFGLTVYIMTRPRPVYL  113



>ref|XP_010683564.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Beta vulgaris subsp. 
vulgaris]
Length=525

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPL----LGAV--SAHF--------WSTIKLNLAPLLACTSFL  272
            VK G H+LI++  Y + VPL    LG+V  S H            +K NL  +  CT+ L
Sbjct  37   VKLGYHYLISNFFYFMLVPLVLSVLGSVHISTHSVHGLVQLSLDMVKYNLVTVFMCTALL  96

Query  273  VFLAKLYSNNRPRNVYL  323
            VFL  LY  +RPR VYL
Sbjct  97   VFLGTLYFMSRPRKVYL  113



>ref|XP_010248169.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=518

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSA-----------HFWSTIKLNLAPLLACTSF  269
            N   VK G H+L++H++ L  +PL+  +               W  ++ NL  ++ C++F
Sbjct  39   NLKYVKLGYHYLMSHLLTLCLIPLMAVIMVEVGQMNPEDVRQLWLHLQYNLVSVIVCSAF  98

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + LY   RPR VYL
Sbjct  99   LVFGSTLYIMTRPRPVYL  116



>ref|XP_010243778.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nelumbo nucifera]
Length=518

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVSA-----------HFWSTIKLNLAPLLACTSF  269
            N   VK G H+L++H++ L  +PL+  +               W  ++ NL  ++ C++F
Sbjct  39   NLKYVKLGYHYLMSHLLTLCLIPLMAVIMVEVGQMNPEDVRQLWLHLQYNLVSVIVCSAF  98

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF + LY   RPR VYL
Sbjct  99   LVFGSTLYIMTRPRPVYL  116



>ref|XP_006350729.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Solanum tuberosum]
Length=487

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKLN-----LAPLLACTSFLVFLAKLYSN  299
            VK G H+LI++ +YLL VP+L A+  H  ST+ +      LA L +C+  + FL  +Y  
Sbjct  17   VKLGYHYLISNAIYLLIVPVLVAMLLHL-STLTIEDLMNHLAILKSCSIIVFFLTMVYLM  75

Query  300  NRPRNVYL  323
            +RPRNVYL
Sbjct  76   SRPRNVYL  83



>ref|XP_006387707.1| hypothetical protein POPTR_0658s00200g [Populus trichocarpa]
 gb|ERP46621.1| hypothetical protein POPTR_0658s00200g [Populus trichocarpa]
Length=524

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ M+LL +PLL   SAH            W+ +K N   +  C+  LVFL
Sbjct  42   VKLGYHYLISNAMFLLLIPLLFIASAHLSTLTIQDFVQLWNHLKFNFVSVTVCSGLLVFL  101

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  102  ATLYFTSRPRKIYL  115



>ref|XP_002510394.1| acyltransferase, putative [Ricinus communis]
 gb|EEF52581.1| acyltransferase, putative [Ricinus communis]
Length=502

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLLGAVS-----------AHFWSTIKLNLAPLLACTSF  269
            N   VK G H+LI++++ L F+PL+   S            H W  ++ NL  ++ C++F
Sbjct  23   NLKYVKLGYHYLISNLLTLCFIPLIIITSIEASQMNLDDLRHLWLHLQYNLVGIIICSAF  82

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   +Y   RPR VYL
Sbjct  83   LVFGLTVYIMTRPRPVYL  100



>ref|XP_009780138.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana sylvestris]
Length=491

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 4/67 (6%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHFWSTIKLNLAP----LLACTSFLVFLAKLYSNN  302
            VK G H+LI++ +YLL VP+L AV  H  +    NL      L + ++ +V+L  +Y  +
Sbjct  25   VKLGYHYLISNAVYLLIVPILAAVGLHLSTFTLENLMNHPVMLKSFSTLVVYLTTVYFVS  84

Query  303  RPRNVYL  323
            RPRNVYL
Sbjct  85   RPRNVYL  91



>ref|XP_011030604.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Populus euphratica]
Length=524

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAHF-----------WSTIKLNLAPLLACTSFLVFL  281
            VK G H+LI++ M+LL +PLL   SAH            W+ +K N   +  C+  LVFL
Sbjct  42   VKLGYHYLISNAMFLLLIPLLFIASAHLSTLTIQDFVQLWNHLKFNFVSVTVCSGLLVFL  101

Query  282  AKLYSNNRPRNVYL  323
            A LY  +RPR +YL
Sbjct  102  ATLYFTSRPRKIYL  115



>ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
 gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
Length=510

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAV----------SAH-FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH++ L  VPL+  V            H  W  ++ NL  ++ C++FLVF 
Sbjct  35   VKLGYHYLITHLLTLCLVPLMAFVIFQAFQLNPNDIHQLWLHLQYNLVSVIICSAFLVFG  94

Query  282  AKLYSNNRPRNVYL  323
            A +Y   RPR+++L
Sbjct  95   ATVYIMTRPRSLFL  108



>ref|XP_001756180.1| predicted protein [Physcomitrella patens]
 gb|EDQ79046.1| predicted protein [Physcomitrella patens]
Length=524

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 39/78 (50%), Gaps = 11/78 (14%)
 Frame = +3

Query  123  NPHVVKPGSHFLITHVMYLLFVPLL-------GAVSAH----FWSTIKLNLAPLLACTSF  269
            N   VK G H +I+H MYLL +P L       G +S H     W  ++ NL  +L  T  
Sbjct  30   NLKYVKLGYHIVISHAMYLLMLPALLTILAEVGRLSHHDVGDLWRQLQYNLVSVLLTTGA  89

Query  270  LVFLAKLYSNNRPRNVYL  323
            LVF   LY   RPR VYL
Sbjct  90   LVFGFTLYYMTRPRPVYL  107



>dbj|BAJ94797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 38/75 (51%), Gaps = 12/75 (16%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAVSAH-----------FWSTI-KLNLAPLLACTSFLVF  278
            VK G H LITH  YL   PL G V+AH            W+ +   NLA L+AC +F+V 
Sbjct  58   VKLGYHCLITHGAYLAVAPLPGLVAAHLSTFTPSDLAGLWAGVLHHNLAALIACFAFMVA  117

Query  279  LAKLYSNNRPRNVYL  323
                Y   RPR VYL
Sbjct  118  ACTAYLVTRPRPVYL  132



>ref|XP_011048431.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 11/74 (15%)
 Frame = +3

Query  135  VKPGSHFLITHVMYLLFVPLLGAV----------SAH-FWSTIKLNLAPLLACTSFLVFL  281
            VK G H+LITH++ L  VPL+  V            H  W  ++ NL  ++ C++FLVF 
Sbjct  35   VKLGYHYLITHLLTLCLVPLMAFVIFQAFQLNPNDIHQLWLHLQYNLVSVIICSAFLVFG  94

Query  282  AKLYSNNRPRNVYL  323
            A +Y   RPR+++L
Sbjct  95   ATVYIMTRPRSLFL  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506643158204