BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8556_g1_i1 len=997 path=[983:0-823 1807:824-996]

Length=997
                                                                      Score     E

ref|XP_009764788.1|  PREDICTED: cytokinin riboside 5'-monophospha...    383   2e-130   
ref|XP_009587160.1|  PREDICTED: cytokinin riboside 5'-monophospha...    383   3e-130   
gb|KDP29120.1|  hypothetical protein JCGZ_16509                         376   2e-127   
ref|XP_004251148.1|  PREDICTED: cytokinin riboside 5'-monophospha...    376   2e-127   
ref|XP_007027342.1|  Lysine decarboxylase family protein isoform 2      374   6e-127   
ref|XP_003538177.1|  PREDICTED: cytokinin riboside 5'-monophospha...    374   1e-126   
ref|XP_008225924.1|  PREDICTED: cytokinin riboside 5'-monophospha...    373   2e-126   
ref|XP_006428773.1|  hypothetical protein CICLE_v10012707mg             373   3e-126   
ref|XP_010529748.1|  PREDICTED: cytokinin riboside 5'-monophospha...    372   3e-126   
ref|XP_006340180.1|  PREDICTED: cytokinin riboside 5'-monophospha...    373   4e-126   
gb|KHN05674.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    372   8e-126   
ref|XP_009367053.1|  PREDICTED: cytokinin riboside 5'-monophospha...    373   1e-125   
ref|XP_010107529.1|  hypothetical protein L484_024382                   370   2e-125   
ref|XP_009373527.1|  PREDICTED: cytokinin riboside 5'-monophospha...    370   4e-125   
ref|XP_009781791.1|  PREDICTED: cytokinin riboside 5'-monophospha...    369   6e-125   
ref|XP_009788908.1|  PREDICTED: cytokinin riboside 5'-monophospha...    369   6e-125   
ref|XP_010089966.1|  hypothetical protein L484_008044                   369   7e-125   
ref|XP_009342948.1|  PREDICTED: cytokinin riboside 5'-monophospha...    369   9e-125   
ref|XP_008805210.1|  PREDICTED: cytokinin riboside 5'-monophospha...    369   1e-124   
ref|XP_008442685.1|  PREDICTED: cytokinin riboside 5'-monophospha...    368   2e-124   
ref|XP_009103862.1|  PREDICTED: cytokinin riboside 5'-monophospha...    368   2e-124   
ref|XP_009610234.1|  PREDICTED: cytokinin riboside 5'-monophospha...    368   2e-124   
emb|CDY52759.1|  BnaA07g37740D                                          368   2e-124   
ref|XP_004137827.1|  PREDICTED: cytokinin riboside 5'-monophospha...    367   2e-124   
ref|XP_006488072.1|  PREDICTED: cytokinin riboside 5'-monophospha...    368   3e-124   
gb|KGN58962.1|  hypothetical protein Csa_3G739570                       368   3e-124   
ref|XP_009596604.1|  PREDICTED: cytokinin riboside 5'-monophospha...    367   3e-124   
gb|KDP44034.1|  hypothetical protein JCGZ_05501                         367   4e-124   
ref|XP_003539768.1|  PREDICTED: cytokinin riboside 5'-monophospha...    368   4e-124   
gb|AFK33887.1|  unknown                                                 367   6e-124   
gb|KHG18498.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    367   6e-124   
ref|XP_007016779.1|  Lysine decarboxylase family protein, putativ...    367   7e-124   
ref|XP_006354329.1|  PREDICTED: cytokinin riboside 5'-monophospha...    367   8e-124   
ref|XP_008359648.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin ri...    366   8e-124   
ref|XP_002285246.1|  PREDICTED: cytokinin riboside 5'-monophospha...    366   9e-124   Vitis vinifera
ref|XP_008369688.1|  PREDICTED: cytokinin riboside 5'-monophospha...    366   1e-123   
ref|XP_006424548.1|  hypothetical protein CICLE_v10029235mg             366   1e-123   
ref|NP_181258.2|  cytokinin riboside 5'-monophosphate phosphoribo...    366   1e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CBI16329.3|  unnamed protein product                                365   1e-123   
ref|XP_004246656.1|  PREDICTED: cytokinin riboside 5'-monophospha...    366   2e-123   
gb|KFK34594.1|  hypothetical protein AALP_AA5G166100                    365   2e-123   
ref|XP_006403687.1|  hypothetical protein EUTSA_v10010644mg             365   3e-123   
gb|AGE00883.1|  lysine decarboxylase                                    365   3e-123   
gb|AII20186.1|  riboside 5'-monophosphate phosphoribohydrolase          365   3e-123   
ref|XP_010046628.1|  PREDICTED: cytokinin riboside 5'-monophospha...    365   3e-123   
ref|XP_006381447.1|  hypothetical protein POPTR_0006s12920g             365   3e-123   
ref|XP_011048543.1|  PREDICTED: cytokinin riboside 5'-monophospha...    365   5e-123   
ref|XP_006403688.1|  hypothetical protein EUTSA_v10010644mg             366   6e-123   
ref|XP_007027341.1|  Lysine decarboxylase family protein isoform 1      365   7e-123   
ref|XP_007206768.1|  hypothetical protein PRUPE_ppa025305mg             364   7e-123   
ref|XP_002881496.1|  hypothetical protein ARALYDRAFT_482713             364   8e-123   
ref|XP_008385326.1|  PREDICTED: cytokinin riboside 5'-monophospha...    365   8e-123   
ref|XP_010935881.1|  PREDICTED: cytokinin riboside 5'-monophospha...    363   1e-122   
gb|KHG02823.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    363   1e-122   
ref|XP_002276279.2|  PREDICTED: cytokinin riboside 5'-monophospha...    363   1e-122   Vitis vinifera
ref|XP_004291703.1|  PREDICTED: cytokinin riboside 5'-monophospha...    363   2e-122   
ref|XP_010509365.1|  PREDICTED: cytokinin riboside 5'-monophospha...    363   2e-122   
ref|XP_011094655.1|  PREDICTED: cytokinin riboside 5'-monophospha...    362   3e-122   
ref|XP_002323469.2|  hypothetical protein POPTR_0016s09180g             363   3e-122   Populus trichocarpa [western balsam poplar]
ref|XP_011040899.1|  PREDICTED: cytokinin riboside 5'-monophospha...    362   3e-122   
ref|XP_010505298.1|  PREDICTED: cytokinin riboside 5'-monophospha...    362   4e-122   
ref|XP_007132270.1|  hypothetical protein PHAVU_011G080600g             363   4e-122   
ref|XP_009407199.1|  PREDICTED: cytokinin riboside 5'-monophospha...    362   5e-122   
ref|XP_002314282.2|  hypothetical protein POPTR_0009s01600g             362   5e-122   Populus trichocarpa [western balsam poplar]
ref|XP_004145748.1|  PREDICTED: cytokinin riboside 5'-monophospha...    361   9e-122   
gb|ACU19348.1|  unknown                                                 362   1e-121   Glycine max [soybeans]
ref|XP_006294984.1|  hypothetical protein CARUB_v10024052mg             361   1e-121   
ref|XP_003543475.1|  PREDICTED: cytokinin riboside 5'-monophospha...    360   1e-121   
ref|XP_010557341.1|  PREDICTED: cytokinin riboside 5'-monophospha...    361   1e-121   
ref|NP_565668.1|  cytokinin riboside 5'-monophosphate phosphoribo...    361   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044403.1|  PREDICTED: cytokinin riboside 5'-monophospha...    361   1e-121   
ref|NP_001241195.1|  uncharacterized protein LOC100787375               360   1e-121   
ref|XP_006293523.1|  hypothetical protein CARUB_v10024039mg             360   2e-121   
ref|NP_001244911.1|  cytokinin riboside 5'-monophosphate phosphor...    360   2e-121   
ref|XP_006339070.1|  PREDICTED: cytokinin riboside 5'-monophospha...    360   2e-121   
ref|XP_003554380.1|  PREDICTED: cytokinin riboside 5'-monophospha...    360   2e-121   
ref|XP_010253716.1|  PREDICTED: cytokinin riboside 5'-monophospha...    360   2e-121   
ref|XP_008807508.1|  PREDICTED: cytokinin riboside 5'-monophospha...    360   2e-121   
gb|KEH39342.1|  lysine decarboxylase family protein                     360   3e-121   
ref|NP_190913.1|  cytokinin riboside 5'-monophosphate phosphoribo...    360   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880937.1|  hypothetical protein ARALYDRAFT_481677             359   4e-121   
gb|KHN02336.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    361   4e-121   
ref|NP_001240198.1|  uncharacterized protein LOC100791145               359   5e-121   
gb|AAK32797.1|AF361629_1  T3B23.2/T3B23.2                               359   6e-121   Arabidopsis thaliana [mouse-ear cress]
gb|EYU34458.1|  hypothetical protein MIMGU_mgv1a013457mg                359   6e-121   
ref|XP_007144351.1|  hypothetical protein PHAVU_007G148800g             359   6e-121   
ref|XP_007150188.1|  hypothetical protein PHAVU_005G134000g             359   6e-121   
ref|XP_009139409.1|  PREDICTED: cytokinin riboside 5'-monophospha...    359   6e-121   
emb|CDY30875.1|  BnaC04g27300D                                          359   7e-121   
ref|XP_006384915.1|  hypothetical protein POPTR_0004s22210g             359   7e-121   
ref|XP_006592704.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   8e-121   
ref|XP_009116037.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   9e-121   
ref|XP_010264655.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   1e-120   
ref|XP_002519528.1|  carboxy-lyase, putative                            358   1e-120   Ricinus communis
gb|KFK36610.1|  hypothetical protein AALP_AA4G145900                    358   1e-120   
ref|XP_003590484.1|  hypothetical protein MTR_1g064260                  358   1e-120   
ref|XP_004487095.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   2e-120   
ref|XP_002529933.1|  carboxy-lyase, putative                            358   2e-120   Ricinus communis
ref|XP_007162751.1|  hypothetical protein PHAVU_001G177400g             358   2e-120   
ref|XP_004497512.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   3e-120   
ref|XP_009141638.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   3e-120   
ref|XP_010414556.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   3e-120   
ref|XP_010920460.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   3e-120   
ref|XP_011013920.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   3e-120   
gb|KEH17130.1|  cytokinin riboside 5'-monophosphate phosphoribohy...    357   3e-120   
ref|XP_010510645.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   4e-120   
gb|KFK27249.1|  hypothetical protein AALP_AA8G357400                    357   4e-120   
ref|XP_009103669.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   4e-120   
ref|XP_006292903.1|  hypothetical protein CARUB_v10019168mg             357   4e-120   
ref|XP_010906515.1|  PREDICTED: cytokinin riboside 5'-monophospha...    357   5e-120   
ref|XP_003625636.1|  hypothetical protein MTR_7g101290                  358   6e-120   
ref|XP_006409853.1|  hypothetical protein EUTSA_v10017171mg             357   6e-120   
ref|XP_002877920.1|  hypothetical protein ARALYDRAFT_348439             356   7e-120   
emb|CDX77168.1|  BnaC04g39630D                                          356   8e-120   
ref|XP_009140853.1|  PREDICTED: cytokinin riboside 5'-monophospha...    356   9e-120   
gb|KHN09504.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    356   1e-119   
ref|XP_010031982.1|  PREDICTED: cytokinin riboside 5'-monophospha...    356   1e-119   
ref|XP_003606367.1|  hypothetical protein MTR_4g058740                  355   1e-119   
emb|CDX91344.1|  BnaC04g08060D                                          355   1e-119   
ref|XP_004493974.1|  PREDICTED: cytokinin riboside 5'-monophospha...    356   1e-119   
emb|CDX79722.1|  BnaC03g20580D                                          355   1e-119   
emb|CDX71364.1|  BnaC04g15990D                                          355   2e-119   
ref|XP_011077347.1|  PREDICTED: cytokinin riboside 5'-monophospha...    355   2e-119   
emb|CDY04551.1|  BnaA07g13770D                                          355   3e-119   
ref|XP_010043764.1|  PREDICTED: cytokinin riboside 5'-monophospha...    354   4e-119   
ref|XP_010515835.1|  PREDICTED: cytokinin riboside 5'-monophospha...    354   4e-119   
ref|XP_009133130.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   7e-119   
ref|XP_010426993.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   1e-118   
emb|CDP06745.1|  unnamed protein product                                353   2e-118   
gb|AFK40158.1|  unknown                                                 353   2e-118   
ref|XP_006846812.1|  hypothetical protein AMTR_s00148p00076970          352   3e-118   
ref|XP_004976245.1|  PREDICTED: probable cytokinin riboside 5'-mo...    353   3e-118   
ref|XP_010504107.1|  PREDICTED: cytokinin riboside 5'-monophospha...    352   4e-118   
ref|NP_001053328.1|  Os04g0518800                                       353   4e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304438.1|  PREDICTED: cytokinin riboside 5'-monophospha...    352   6e-118   
emb|CAE05626.1|  OSJNBb0061C13.8                                        352   7e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791568.1|  PREDICTED: probable cytokinin riboside 5'-mo...    351   7e-118   
ref|XP_009143522.1|  PREDICTED: cytokinin riboside 5'-monophospha...    350   1e-117   
ref|XP_007016778.1|  Lysine decarboxylase family protein isoform 1      352   1e-117   
ref|NP_001189696.1|  cytokinin riboside 5'-monophosphate phosphor...    351   2e-117   
ref|XP_002446792.1|  hypothetical protein SORBIDRAFT_06g022780          351   3e-117   Sorghum bicolor [broomcorn]
dbj|BAG70979.1|  putative lysine decarboxylase                          349   4e-117   Musa balbisiana [starchy banana]
sp|B9F166.1|LOGL2_ORYSJ  RecName: Full=Probable cytokinin ribosid...    350   6e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009631261.1|  PREDICTED: cytokinin riboside 5'-monophospha...    348   1e-116   
ref|XP_004953163.1|  PREDICTED: probable cytokinin riboside 5'-mo...    349   1e-116   
ref|XP_006653604.1|  PREDICTED: probable cytokinin riboside 5'-mo...    349   1e-116   
ref|XP_006410901.1|  hypothetical protein EUTSA_v10017236mg             347   2e-116   
gb|EAY86771.1|  hypothetical protein OsI_08151                          350   2e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_009392159.1|  PREDICTED: cytokinin riboside 5'-monophospha...    348   2e-116   
ref|XP_006647546.1|  PREDICTED: probable cytokinin riboside 5'-mo...    348   3e-116   
ref|XP_009775949.1|  PREDICTED: cytokinin riboside 5'-monophospha...    347   4e-116   
emb|CDX78180.1|  BnaA09g33750D                                          347   7e-116   
emb|CDP07095.1|  unnamed protein product                                347   9e-116   
ref|XP_008669155.1|  PREDICTED: probable cytokinin riboside 5'-mo...    347   1e-115   
ref|XP_010426991.1|  PREDICTED: cytokinin riboside 5'-monophospha...    345   2e-115   
ref|XP_011013919.1|  PREDICTED: cytokinin riboside 5'-monophospha...    346   2e-115   
ref|XP_010262960.1|  PREDICTED: cytokinin riboside 5'-monophospha...    343   7e-115   
ref|XP_003575405.1|  PREDICTED: probable cytokinin riboside 5'-mo...    344   9e-115   
emb|CDX74979.1|  BnaA05g07250D                                          343   1e-114   
ref|NP_001244912.1|  cytokinin riboside 5'-monophosphate phosphor...    340   7e-114   
gb|KDP36940.1|  hypothetical protein JCGZ_08231                         340   1e-113   
ref|XP_002452481.1|  hypothetical protein SORBIDRAFT_04g026590          341   2e-113   Sorghum bicolor [broomcorn]
ref|XP_004982851.1|  PREDICTED: probable cytokinin riboside 5'-mo...    339   3e-113   
ref|XP_002873247.1|  carboxy-lyase                                      339   5e-113   
ref|XP_006288643.1|  hypothetical protein CARUB_v10001948mg             339   5e-113   
ref|XP_010470104.1|  PREDICTED: cytokinin riboside 5'-monophospha...    340   5e-113   
ref|XP_010414555.1|  PREDICTED: cytokinin riboside 5'-monophospha...    340   6e-113   
ref|NP_001148891.1|  carboxy-lyase                                      338   6e-113   Zea mays [maize]
ref|XP_003581433.2|  PREDICTED: cytokinin riboside 5'-monophospha...    340   7e-113   
ref|XP_007027931.1|  Lysine decarboxylase family protein, putative      338   8e-113   
ref|XP_006399100.1|  hypothetical protein EUTSA_v10014650mg             338   9e-113   
ref|XP_002467072.1|  hypothetical protein SORBIDRAFT_01g019170          337   1e-112   Sorghum bicolor [broomcorn]
ref|NP_196248.3|  cytokinin riboside 5'-monophosphate phosphoribo...    338   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125642.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   1e-112   
ref|XP_006661863.1|  PREDICTED: probable cytokinin riboside 5'-mo...    337   2e-112   
ref|NP_001064868.1|  Os10g0479500                                       337   2e-112   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001169307.1|  hypothetical protein                               337   2e-112   Zea mays [maize]
ref|XP_010246703.1|  PREDICTED: cytokinin riboside 5'-monophospha...    337   2e-112   
ref|XP_006342033.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   2e-112   
ref|XP_004143250.1|  PREDICTED: cytokinin riboside 5'-monophospha...    337   2e-112   
emb|CDY14086.1|  BnaC02g02030D                                          337   3e-112   
dbj|BAK52670.1|  cytokinin riboside 5'-monophosphate phosphoriboh...    337   4e-112   
ref|XP_010906513.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   5e-112   
ref|XP_011074666.1|  PREDICTED: cytokinin riboside 5'-monophospha...    337   6e-112   
ref|XP_004238344.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   7e-112   
ref|XP_008785140.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   1e-111   
ref|XP_011094223.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   1e-111   
ref|XP_002275414.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   1e-111   Vitis vinifera
ref|XP_010104785.1|  hypothetical protein L484_018839                   335   2e-111   
ref|XP_010941274.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   2e-111   
ref|XP_009122236.1|  PREDICTED: cytokinin riboside 5'-monophospha...    334   3e-111   
gb|KDP36133.1|  hypothetical protein JCGZ_08777                         334   3e-111   
ref|XP_006481574.1|  PREDICTED: cytokinin riboside 5'-monophospha...    334   4e-111   
ref|XP_003574067.1|  PREDICTED: probable cytokinin riboside 5'-mo...    333   5e-111   
ref|XP_006649247.1|  PREDICTED: probable cytokinin riboside 5'-mo...    333   5e-111   
ref|XP_009396585.1|  PREDICTED: cytokinin riboside 5'-monophospha...    334   5e-111   
pdb|2A33|A  Chain A, X-Ray Structure Of A Lysine Decarboxylase-Li...    333   7e-111   
ref|XP_006430086.1|  hypothetical protein CICLE_v10013759mg             333   8e-111   
gb|AAD18138.2|  hypothetical protein                                    333   8e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AHZ89694.1|  cytokinin riboside 5'-monophosphate phosphoribohy...    333   8e-111   
ref|XP_006473638.1|  PREDICTED: probable cytokinin riboside 5'-mo...    333   9e-111   
ref|XP_009610925.1|  PREDICTED: cytokinin riboside 5'-monophospha...    333   9e-111   
ref|XP_010060231.1|  PREDICTED: probable cytokinin riboside 5'-mo...    333   1e-110   
ref|XP_009372569.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   2e-110   
ref|XP_008391958.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   2e-110   
emb|CDX73553.1|  BnaC08g24500D                                          331   2e-110   
ref|XP_010242845.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   2e-110   
ref|XP_007202920.1|  hypothetical protein PRUPE_ppa016229mg             332   2e-110   
ref|XP_010558001.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   3e-110   
ref|XP_009783018.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   3e-110   
ref|XP_002530151.1|  carboxy-lyase, putative                            332   3e-110   Ricinus communis
ref|XP_011028989.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   3e-110   
ref|XP_010104436.1|  hypothetical protein L484_016035                   332   5e-110   
ref|XP_002306920.1|  hypothetical protein POPTR_0005s25880g             332   5e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010061042.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   5e-110   
ref|XP_002276775.1|  PREDICTED: probable cytokinin riboside 5'-mo...    331   6e-110   Vitis vinifera
ref|NP_001048706.1|  Os03g0109300                                       330   8e-110   Oryza sativa Japonica Group [Japonica rice]
emb|CDP10616.1|  unnamed protein product                                331   8e-110   
ref|XP_004167905.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   9e-110   
ref|XP_010266115.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   9e-110   
ref|XP_010534395.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   9e-110   
ref|XP_011034907.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   9e-110   
ref|XP_006435156.1|  hypothetical protein CICLE_v10002383mg             331   9e-110   
ref|XP_006854693.1|  hypothetical protein AMTR_s00030p00225360          330   1e-109   
ref|XP_010664090.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   1e-109   
gb|EEC67178.1|  hypothetical protein OsI_34046                          335   1e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_010543825.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   1e-109   
ref|XP_008444787.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   1e-109   
ref|XP_008243464.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   1e-109   
ref|XP_009349185.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   2e-109   
gb|AFW58873.1|  hypothetical protein ZEAMMB73_274984                    331   2e-109   
ref|XP_004303504.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   2e-109   
ref|XP_007017774.1|  Lysine decarboxylase family protein                330   2e-109   
ref|XP_003519126.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   2e-109   
ref|XP_006828985.1|  hypothetical protein AMTR_s00001p00241960          329   2e-109   
ref|NP_001244910.1|  cytokinin riboside 5'-monophosphate phosphor...    329   3e-109   
ref|XP_007017980.1|  Lysine decarboxylase family protein, putativ...    329   3e-109   
gb|KDP36835.1|  hypothetical protein JCGZ_08126                         329   3e-109   
ref|XP_010935044.1|  PREDICTED: cytokinin riboside 5'-monophospha...    329   4e-109   
ref|XP_006386178.1|  hypothetical protein POPTR_0002s02560g             329   5e-109   
ref|XP_002510515.1|  carboxy-lyase, putative                            329   5e-109   Ricinus communis
ref|XP_006828986.1|  hypothetical protein AMTR_s00001p00242250          329   5e-109   
gb|EYU36778.1|  hypothetical protein MIMGU_mgv1a013395mg                329   5e-109   
emb|CDP07311.1|  unnamed protein product                                328   6e-109   
gb|KHN08726.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    328   7e-109   
ref|XP_009801432.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   7e-109   
ref|XP_010558160.1|  PREDICTED: probable cytokinin riboside 5'-mo...    328   9e-109   
ref|XP_010103315.1|  hypothetical protein L484_014355                   328   1e-108   
emb|CBI18877.3|  unnamed protein product                                328   1e-108   
emb|CAN74076.1|  hypothetical protein VITISV_000977                     327   1e-108   Vitis vinifera
ref|XP_004152760.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   1e-108   
ref|XP_009413755.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   1e-108   
ref|XP_008464873.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   2e-108   
emb|CDP07413.1|  unnamed protein product                                327   3e-108   
ref|XP_004144285.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   3e-108   
ref|XP_010920269.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   3e-108   
ref|XP_009341551.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   4e-108   
ref|XP_010094594.1|  hypothetical protein L484_024891                   327   4e-108   
ref|XP_004172206.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   4e-108   
gb|EYU18134.1|  hypothetical protein MIMGU_mgv1a023227mg                326   4e-108   
ref|XP_008348520.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   5e-108   
ref|XP_009607694.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   5e-108   
ref|XP_009611816.1|  PREDICTED: cytokinin riboside 5'-monophospha...    326   5e-108   
ref|XP_006339321.1|  PREDICTED: cytokinin riboside 5'-monophospha...    326   6e-108   
ref|XP_007160679.1|  hypothetical protein PHAVU_001G007800g             325   9e-108   
ref|XP_007017981.1|  Lysine decarboxylase family protein isoform 2      325   2e-107   
gb|EPS70976.1|  hypothetical protein M569_03783                         324   2e-107   
ref|XP_011083519.1|  PREDICTED: cytokinin riboside 5'-monophospha...    325   3e-107   
ref|XP_010910906.1|  PREDICTED: cytokinin riboside 5'-monophospha...    325   3e-107   
ref|XP_009779808.1|  PREDICTED: cytokinin riboside 5'-monophospha...    324   4e-107   
ref|XP_010255159.1|  PREDICTED: cytokinin riboside 5'-monophospha...    324   5e-107   
ref|XP_008807568.1|  PREDICTED: cytokinin riboside 5'-monophospha...    324   5e-107   
ref|XP_006435320.1|  hypothetical protein CICLE_v10002405mg             323   6e-107   
ref|XP_002281839.1|  PREDICTED: cytokinin riboside 5'-monophospha...    324   6e-107   Vitis vinifera
ref|XP_003521489.1|  PREDICTED: cytokinin riboside 5'-monophospha...    323   7e-107   
ref|XP_008447883.1|  PREDICTED: cytokinin riboside 5'-monophospha...    323   1e-106   
ref|XP_008236109.1|  PREDICTED: cytokinin riboside 5'-monophospha...    323   2e-106   
ref|XP_007201230.1|  hypothetical protein PRUPE_ppa010459mg             323   2e-106   
ref|XP_003603739.1|  Carboxy-lyase                                      322   2e-106   
ref|NP_001239732.1|  uncharacterized protein LOC100814612               322   2e-106   
gb|EMT28819.1|  hypothetical protein F775_05789                         323   2e-106   
ref|XP_010935234.1|  PREDICTED: cytokinin riboside 5'-monophospha...    322   2e-106   
ref|XP_004497673.1|  PREDICTED: cytokinin riboside 5'-monophospha...    322   2e-106   
ref|XP_011046883.1|  PREDICTED: cytokinin riboside 5'-monophospha...    322   2e-106   
ref|XP_011099535.1|  PREDICTED: probable cytokinin riboside 5'-mo...    322   3e-106   
ref|XP_004136507.1|  PREDICTED: cytokinin riboside 5'-monophospha...    322   3e-106   
gb|EYU38838.1|  hypothetical protein MIMGU_mgv1a013512mg                322   3e-106   
ref|XP_002510643.1|  carboxy-lyase, putative                            322   3e-106   
gb|ACU19659.1|  unknown                                                 322   3e-106   
ref|XP_002306969.1|  hypothetical protein POPTR_0005s27030g             322   4e-106   
ref|XP_004144937.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   5e-106   
ref|XP_007225794.1|  hypothetical protein PRUPE_ppa011245mg             321   5e-106   
ref|XP_007145804.1|  hypothetical protein PHAVU_007G269400g             321   5e-106   
ref|XP_003553618.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   6e-106   
ref|XP_009386166.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   6e-106   
ref|XP_009383528.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   7e-106   
ref|XP_011045113.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   7e-106   
ref|XP_007041671.1|  Lysine decarboxylase family protein                321   8e-106   
tpg|DAA36911.1|  TPA: hypothetical protein ZEAMMB73_838524              324   8e-106   
ref|XP_009380387.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   9e-106   
gb|KHN33166.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    320   1e-105   
ref|XP_007162957.1|  hypothetical protein PHAVU_001G194400g             320   1e-105   
ref|XP_004500949.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   1e-105   
ref|XP_008382467.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   1e-105   
ref|XP_010667386.1|  PREDICTED: probable cytokinin riboside 5'-mo...    320   2e-105   
ref|XP_010244087.1|  PREDICTED: probable cytokinin riboside 5'-mo...    320   2e-105   
ref|XP_011041266.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   2e-105   
ref|XP_009394077.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   2e-105   
ref|XP_002308442.1|  hypothetical protein POPTR_0006s22120g             319   3e-105   
gb|KFK30159.1|  hypothetical protein AALP_AA7G224700                    319   5e-105   
ref|XP_006422478.1|  hypothetical protein CICLE_v10029210mg             319   6e-105   
gb|KDP40447.1|  hypothetical protein JCGZ_03947                         318   7e-105   
ref|XP_010066319.1|  PREDICTED: cytokinin riboside 5'-monophospha...    319   8e-105   
ref|XP_010558159.1|  PREDICTED: probable cytokinin riboside 5'-mo...    318   8e-105   
ref|XP_008221287.1|  PREDICTED: cytokinin riboside 5'-monophospha...    318   8e-105   
ref|XP_002301929.1|  hypothetical protein POPTR_0002s01390g             319   9e-105   
ref|XP_004291375.1|  PREDICTED: probable cytokinin riboside 5'-mo...    318   1e-104   
ref|XP_006600223.1|  PREDICTED: uncharacterized protein LOC100814...    318   1e-104   
ref|XP_009766234.1|  PREDICTED: cytokinin riboside 5'-monophospha...    318   1e-104   
gb|KFK24779.1|  hypothetical protein AALP_AA8G023700                    317   2e-104   
ref|XP_002525737.1|  carboxy-lyase, putative                            318   2e-104   
gb|KEH41891.1|  lysine decarboxylase family protein                     317   2e-104   
ref|XP_006604650.1|  PREDICTED: cytokinin riboside 5'-monophospha...    317   3e-104   
ref|XP_008781256.1|  PREDICTED: cytokinin riboside 5'-monophospha...    317   3e-104   
ref|XP_003527691.1|  PREDICTED: cytokinin riboside 5'-monophospha...    317   3e-104   
ref|XP_009611418.1|  PREDICTED: cytokinin riboside 5'-monophospha...    317   3e-104   
ref|XP_008350210.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   4e-104   
ref|XP_010423742.1|  PREDICTED: probable cytokinin riboside 5'-mo...    316   4e-104   
gb|EAY88228.1|  hypothetical protein OsI_09680                          317   5e-104   
ref|XP_008813587.1|  PREDICTED: cytokinin riboside 5'-monophospha...    316   5e-104   
gb|EPS64496.1|  hypothetical protein M569_10285                         316   6e-104   
ref|XP_002305546.2|  hypothetical protein POPTR_0004s18850g             316   6e-104   
ref|XP_011046303.1|  PREDICTED: cytokinin riboside 5'-monophospha...    316   6e-104   
ref|XP_003523551.1|  PREDICTED: cytokinin riboside 5'-monophospha...    316   7e-104   
ref|XP_006348482.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   8e-104   
ref|XP_010683613.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   9e-104   
ref|XP_004982850.1|  PREDICTED: probable cytokinin riboside 5'-mo...    316   1e-103   
ref|XP_010452197.1|  PREDICTED: probable cytokinin riboside 5'-mo...    314   1e-103   
ref|XP_006288686.1|  hypothetical protein CARUB_v10001996mg             314   1e-103   
ref|XP_009125489.1|  PREDICTED: probable cytokinin riboside 5'-mo...    314   1e-103   
ref|XP_010935233.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   2e-103   
ref|XP_010437508.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   2e-103   
ref|XP_002301983.1|  hypothetical protein POPTR_0002s02560g             314   2e-103   
emb|CDP14518.1|  unnamed protein product                                315   2e-103   
emb|CDX69118.1|  BnaC01g03350D                                          315   2e-103   
ref|XP_011045291.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   2e-103   
ref|XP_010530287.1|  PREDICTED: cytokinin riboside 5'-monophospha...    314   3e-103   
ref|XP_011044028.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   4e-103   
ref|XP_007136081.1|  hypothetical protein PHAVU_009G016000g             314   4e-103   
emb|CDY44352.1|  BnaC02g03250D                                          313   5e-103   
ref|XP_010432315.1|  PREDICTED: cytokinin riboside 5'-monophospha...    314   5e-103   
ref|XP_009596603.1|  PREDICTED: cytokinin riboside 5'-monophospha...    312   5e-103   
ref|XP_010446965.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   5e-103   
ref|XP_002869102.1|  hypothetical protein ARALYDRAFT_912862             313   6e-103   
ref|XP_002517820.1|  carboxy-lyase, putative                            313   7e-103   
ref|XP_009788914.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   7e-103   
ref|NP_001241594.1|  uncharacterized protein LOC100785143               312   1e-102   
gb|KHG23597.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    313   1e-102   
ref|XP_002274747.1|  PREDICTED: probable cytokinin riboside 5'-mo...    312   1e-102   
gb|KHN39436.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    311   1e-102   
ref|XP_010529749.1|  PREDICTED: cytokinin riboside 5'-monophospha...    310   2e-102   
ref|XP_009381994.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   2e-102   
ref|NP_567978.1|  cytokinin riboside 5'-monophosphate phosphoribo...    312   3e-102   
ref|XP_002313681.2|  hypothetical protein POPTR_0009s14360g             311   3e-102   
ref|XP_010941408.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   4e-102   
ref|XP_011025445.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   4e-102   
gb|EMS59424.1|  hypothetical protein TRIUR3_18970                       312   6e-102   
ref|XP_009105030.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   1e-101   
gb|KHN45916.1|  Putative cytokinin riboside 5'-monophosphate phos...    310   1e-101   
ref|XP_004139951.1|  PREDICTED: cytokinin riboside 5'-monophospha...    310   1e-101   
ref|XP_009108627.1|  PREDICTED: cytokinin riboside 5'-monophospha...    310   2e-101   
ref|XP_010935882.1|  PREDICTED: cytokinin riboside 5'-monophospha...    308   3e-101   
ref|XP_004139950.1|  PREDICTED: cytokinin riboside 5'-monophospha...    310   4e-101   
emb|CDY52642.1|  BnaAnng11570D                                          309   4e-101   
emb|CDX76318.1|  BnaA08g10820D                                          309   4e-101   
ref|XP_006595550.1|  PREDICTED: uncharacterized protein LOC100785...    308   6e-101   
ref|XP_010241256.1|  PREDICTED: cytokinin riboside 5'-monophospha...    308   6e-101   
ref|XP_006412137.1|  hypothetical protein EUTSA_v10026256mg             308   7e-101   
sp|Q9LYV8.2|LOG6_ARATH  RecName: Full=Probable cytokinin riboside...    307   7e-101   
ref|XP_010067863.1|  PREDICTED: cytokinin riboside 5'-monophospha...    308   7e-101   
gb|KDP43483.1|  hypothetical protein JCGZ_16770                         308   7e-101   
ref|XP_006595551.1|  PREDICTED: uncharacterized protein LOC100785...    307   8e-101   
gb|EYU38012.1|  hypothetical protein MIMGU_mgv1a026823mg                308   1e-100   
ref|XP_010908963.1|  PREDICTED: cytokinin riboside 5'-monophospha...    307   1e-100   
ref|XP_004158235.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin ri...    307   2e-100   
ref|XP_009335163.1|  PREDICTED: cytokinin riboside 5'-monophospha...    306   2e-100   
ref|XP_008808561.1|  PREDICTED: cytokinin riboside 5'-monophospha...    307   3e-100   
ref|XP_009139410.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   3e-100   
ref|XP_009139411.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   3e-100   
ref|XP_010109647.1|  hypothetical protein L484_000785                   306   3e-100   
ref|XP_006284478.1|  hypothetical protein CARUB_v10005664mg             306   3e-100   
ref|XP_006296315.1|  hypothetical protein CARUB_v10025487mg             306   3e-100   
ref|XP_010548131.1|  PREDICTED: cytokinin riboside 5'-monophospha...    306   3e-100   
ref|XP_004154594.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   7e-100   
ref|XP_004136120.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   8e-100   
emb|CAN79419.1|  hypothetical protein VITISV_025067                     306   1e-99    
ref|XP_009408737.1|  PREDICTED: probable cytokinin riboside 5'-mo...    305   1e-99    
ref|NP_181143.3|  cytokinin riboside 5'-monophosphate phosphoribo...    305   1e-99    
gb|AES73991.2|  cytokinin riboside 5'-monophosphate phosphoribohy...    305   1e-99    
ref|XP_010505124.1|  PREDICTED: cytokinin riboside 5'-monophospha...    304   1e-99    
ref|XP_010690268.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   2e-99    
ref|XP_007052516.1|  Lysine decarboxylase family protein isoform 2      305   2e-99    
ref|XP_007223924.1|  hypothetical protein PRUPE_ppa011032mg             304   3e-99    
ref|XP_011088679.1|  PREDICTED: cytokinin riboside 5'-monophospha...    304   3e-99    
ref|XP_009389480.1|  PREDICTED: cytokinin riboside 5'-monophospha...    304   3e-99    
ref|XP_009757154.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   4e-99    
ref|XP_009386165.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   4e-99    
ref|XP_009604763.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   4e-99    
ref|XP_008775914.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   5e-99    
emb|CDX76213.1|  BnaA04g04770D                                          303   5e-99    
ref|XP_002313309.1|  hypothetical protein POPTR_0009s06510g             303   5e-99    
ref|XP_010242268.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   6e-99    
ref|XP_008364933.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   6e-99    
ref|XP_008220500.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   7e-99    
ref|XP_009133134.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   7e-99    
gb|AAT68738.1|  hypothetical protein At2g35990                          303   8e-99    
ref|XP_008806983.1|  PREDICTED: cytokinin riboside 5'-monophospha...    302   9e-99    
ref|XP_010509527.1|  PREDICTED: cytokinin riboside 5'-monophospha...    302   1e-98    
ref|XP_002879587.1|  hypothetical protein ARALYDRAFT_482570             301   2e-98    
gb|KDO85042.1|  hypothetical protein CISIN_1g027564mg                   301   2e-98    
ref|XP_008461304.1|  PREDICTED: cytokinin riboside 5'-monophospha...    302   2e-98    
ref|XP_002460610.1|  hypothetical protein SORBIDRAFT_02g031870          302   2e-98    
ref|XP_010088222.1|  hypothetical protein L484_012503                   302   2e-98    
ref|XP_008448322.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin ri...    302   3e-98    
ref|XP_006853880.1|  hypothetical protein AMTR_s00036p00139830          301   3e-98    
gb|AGU16436.1|  L-lysine decarboxylase                                  301   3e-98    
ref|XP_010037306.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   3e-98    
ref|NP_001140786.1|  uncharacterized protein LOC100272861               301   5e-98    
ref|XP_002871020.1|  predicted protein                                  300   6e-98    
ref|XP_010063111.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   6e-98    
emb|CDY40411.1|  BnaA04g21060D                                          300   7e-98    
ref|XP_009362170.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   7e-98    
ref|XP_009141550.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   8e-98    
gb|EYU27046.1|  hypothetical protein MIMGU_mgv1a013397mg                300   1e-97    
ref|XP_010669375.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   1e-97    
ref|XP_004957551.1|  PREDICTED: probable cytokinin riboside 5'-mo...    300   1e-97    
emb|CDY62895.1|  BnaAnng18400D                                          299   1e-97    
ref|XP_011019416.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   2e-97    
ref|XP_009389464.1|  PREDICTED: probable cytokinin riboside 5'-mo...    299   2e-97    
ref|XP_008808563.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   3e-97    
gb|KHG18078.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    298   3e-97    
emb|CDP07790.1|  unnamed protein product                                299   4e-97    
ref|XP_010924975.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   4e-97    
ref|XP_010925070.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   4e-97    
tpg|DAA62658.1|  TPA: hypothetical protein ZEAMMB73_249913              301   5e-97    
ref|XP_011047391.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   5e-97    
ref|XP_010906514.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   8e-97    
gb|AFG28179.1|  lysine decarboxylase 1                                  297   8e-97    
ref|XP_002972215.1|  hypothetical protein SELMODRAFT_412786             297   9e-97    
gb|EMS63334.1|  hypothetical protein TRIUR3_00507                       296   1e-96    
emb|CDY32063.1|  BnaC04g45030D                                          297   1e-96    
ref|XP_004498871.1|  PREDICTED: cytokinin riboside 5'-monophospha...    297   1e-96    
ref|XP_002966818.1|  hypothetical protein SELMODRAFT_230940             297   1e-96    
ref|XP_003576800.1|  PREDICTED: probable cytokinin riboside 5'-mo...    298   1e-96    
ref|XP_011025446.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   2e-96    
ref|XP_006453074.1|  hypothetical protein CICLE_v10009446mg             297   2e-96    
ref|XP_002961184.1|  hypothetical protein SELMODRAFT_73749              296   2e-96    
ref|XP_008393617.1|  PREDICTED: cytokinin riboside 5'-monophospha...    297   2e-96    
ref|XP_006474423.1|  PREDICTED: cytokinin riboside 5'-monophospha...    296   3e-96    
gb|AHZ89695.1|  cytokinin riboside 5'-monophosphate phosphoribohy...    296   3e-96    
gb|EEC77653.1|  hypothetical protein OsI_16664                          297   3e-96    
ref|XP_006661503.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyt...    299   4e-96    
ref|XP_010063110.1|  PREDICTED: cytokinin riboside 5'-monophospha...    296   4e-96    
ref|XP_002309490.1|  lysine decarboxylase family protein                296   5e-96    
ref|XP_004245078.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   6e-96    
gb|EYU29348.1|  hypothetical protein MIMGU_mgv1a013575mg                295   6e-96    
ref|XP_009334741.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   8e-96    
ref|XP_009412390.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   1e-95    
ref|XP_004291058.1|  PREDICTED: cytokinin riboside 5'-monophospha...    294   2e-95    
ref|XP_006410772.1|  hypothetical protein EUTSA_v10017792mg             294   2e-95    
ref|XP_010915294.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   2e-95    
ref|XP_007052515.1|  Lysine decarboxylase family protein isoform 1      295   2e-95    
ref|XP_008452737.1|  PREDICTED: cytokinin riboside 5'-monophospha...    294   2e-95    
ref|XP_003588965.1|  Lysine decarboxylase-like protein                  293   3e-95    
ref|XP_008799432.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   3e-95    
ref|NP_001235198.1|  uncharacterized protein LOC100306704               294   3e-95    
ref|XP_007012319.1|  Lysine decarboxylase family protein, putative      293   4e-95    
ref|XP_011099349.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   4e-95    
ref|XP_008377698.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   5e-95    
ref|XP_006351590.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   5e-95    
ref|XP_002516089.1|  carboxy-lyase, putative                            293   6e-95    
gb|KFK36493.1|  cytokinin riboside 5 -monophosphate phosphoribohy...    293   6e-95    
emb|CDP08287.1|  unnamed protein product                                293   6e-95    
dbj|BAJ96076.1|  predicted protein                                      294   6e-95    
ref|XP_002278305.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   7e-95    
ref|XP_004141324.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   7e-95    
gb|KHN32200.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    292   7e-95    
ref|NP_001043439.1|  Os01g0588900                                       293   9e-95    
ref|XP_004969036.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   1e-94    
ref|XP_011081669.1|  PREDICTED: cytokinin riboside 5'-monophospha...    292   1e-94    
ref|XP_008788743.1|  PREDICTED: cytokinin riboside 5'-monophospha...    292   2e-94    
ref|XP_009125838.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   2e-94    
gb|ACN35675.1|  unknown                                                 292   3e-94    
ref|XP_010419778.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   3e-94    
ref|XP_010491949.1|  PREDICTED: cytokinin riboside 5'-monophospha...    290   4e-94    
ref|XP_008782507.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   4e-94    
ref|XP_003569282.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   4e-94    
ref|XP_006467158.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   4e-94    
emb|CDY65870.1|  BnaAnng21190D                                          290   5e-94    
emb|CDX91185.1|  BnaC02g04120D                                          291   5e-94    



>ref|XP_009764788.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like isoform X1 [Nicotiana sylvestris]
Length=219

 Score =   383 bits (983),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 200/213 (94%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+ KE   + QSKFK+ICVFCGSSPGKK+SYK+AA+ELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEMEKE---MMQSKFKKICVFCGSSPGKKSSYKDAAVELGKELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVYNGGRHVLGVIP+TL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  58   GLVSQAVYNGGRHVLGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVIAWAQLGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGF+ PNARQIFVSA
Sbjct  118  GYGTLEELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFVCPNARQIFVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKELMN+LEEY+P  E +ASK  WEK++L Y
Sbjct  178  PTAKELMNKLEEYSPSQENIASKLNWEKEELEY  210



>ref|XP_009587160.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana tomentosiformis]
Length=219

 Score =   383 bits (983),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 200/213 (94%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+ KE   + QSKFK+ICVFCGSSPGKK+SYK+AA+ELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEMEKE---IMQSKFKKICVFCGSSPGKKSSYKDAAVELGKELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVYNGGRHVLGVIP+TL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  58   GLVSQAVYNGGRHVLGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVIAWAQLGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGF+ PNARQIFVSA
Sbjct  118  GYGTLEELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFVCPNARQIFVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKELMN+LEEY+P  E +ASK  WEK++L Y
Sbjct  178  PTAKELMNKLEEYSPSQENIASKLNWEKEELEY  210



>gb|KDP29120.1| hypothetical protein JCGZ_16509 [Jatropha curcas]
Length=221

 Score =   376 bits (965),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV +  E    SKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEVIEGTEMRPTSKFKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  61   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR IF SA
Sbjct  121  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARNIFASA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY PCHERVASK  WE DQL+Y
Sbjct  181  PTAKELVKKLEEYVPCHERVASKLSWEIDQLDY  213



>ref|XP_004251148.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Solanum lycopersicum]
Length=234

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+   ++ ++QSKFK+ICVFCGSSPGKK+SYKEAA+ELG+ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEIENLEKEMKQSKFKKICVFCGSSPGKKSSYKEAAVELGEELVSRNIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVY+GGRHVLGVIP+TL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  61   GLVSQAVYSGGRHVLGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVIAW+QLGIHDKPVGLLNV+GYYNSLL FIDKAVEEGFI PNARQIFVSA
Sbjct  121  GYGTLEELLEVIAWSQLGIHDKPVGLLNVDGYYNSLLAFIDKAVEEGFICPNARQIFVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQL  777
            P A ELMN+LEEY+P  E VASK  WEK++L
Sbjct  181  PTANELMNKLEEYSPSQENVASKLNWEKEEL  211



>ref|XP_007027342.1| Lysine decarboxylase family protein isoform 2 [Theobroma cacao]
 gb|EOY07844.1| Lysine decarboxylase family protein isoform 2 [Theobroma cacao]
Length=218

 Score =   374 bits (961),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            QQS+F+RICVFCGSS GKK+SY++AAIELG+ELVSRNIDLVYGGGSIGLMGLVSQAV++G
Sbjct  8    QQSRFRRICVFCGSSQGKKSSYQDAAIELGRELVSRNIDLVYGGGSIGLMGLVSQAVHDG  67

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE
Sbjct  68   GRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  127

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+ARQI VSAP AKEL+ +L
Sbjct  128  VITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSAPTAKELVKKL  187

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY PCHERVASK  WE +QL Y
Sbjct  188  EEYVPCHERVASKLSWEMEQLGY  210



>ref|XP_003538177.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform 1 [Glycine max]
 gb|KHN38755.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=220

 Score =   374 bits (960),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +1

Query  154  GKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLV  333
            G+E E  QQS+FKRICVFCGSSPG K+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGLV
Sbjct  3    GEETEMKQQSRFKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLV  62

Query  334  SQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYG  513
            SQAVY GGRHV+GVIPKTL+PREITGETVGEV AVADMHQRKAEMA+HSDAFIALPGGYG
Sbjct  63   SQAVYEGGRHVIGVIPKTLMPREITGETVGEVMAVADMHQRKAEMARHSDAFIALPGGYG  122

Query  514  TLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNA  693
            TLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VSAP+ 
Sbjct  123  TLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSAPST  182

Query  694  KELMNELEEYNPCHERVASKQKWEKDQLNY  783
            KEL+ E+EEY P HERVASK  WE +Q++Y
Sbjct  183  KELVKEMEEYFPQHERVASKLSWETEQIDY  212



>ref|XP_008225924.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Prunus mume]
Length=216

 Score =   373 bits (957),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            EKE ++QSKFKRICVFCGSSPGKK+SYKEAAIELG+ELVS+NIDLVYGGGS+GLMGL+SQ
Sbjct  2    EKE-MKQSKFKRICVFCGSSPGKKSSYKEAAIELGEELVSKNIDLVYGGGSVGLMGLISQ  60

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
            AVY+GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL
Sbjct  61   AVYDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  120

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVI WAQLGIHDKPVGLLNV+G+YNSLL+FIDKAVEEGFISP AR I VSAP AKE
Sbjct  121  EELLEVITWAQLGIHDKPVGLLNVDGFYNSLLSFIDKAVEEGFISPTARHIIVSAPTAKE  180

Query  700  LMNELEEYNPCHERVASKQKWEKDQLNY*LIINV  801
            L+ ++EEY P HERVASK  WE +QL+Y  I ++
Sbjct  181  LVKKMEEYFPRHERVASKLSWEIEQLSYPTICDI  214



>ref|XP_006428773.1| hypothetical protein CICLE_v10012707mg [Citrus clementina]
 ref|XP_006481499.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Citrus sinensis]
 gb|ESR42013.1| hypothetical protein CICLE_v10012707mg [Citrus clementina]
 gb|KDO50694.1| hypothetical protein CISIN_1g027662mg [Citrus sinensis]
Length=220

 Score =   373 bits (957),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV  E   +Q SKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEVQSE---VQLSKFKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  58   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+ARQI VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P  KEL+ +LEEY PCHERVASK  WE +QL Y
Sbjct  178  PTVKELVKKLEEYVPCHERVASKLNWEMEQLGY  210



>ref|XP_010529748.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Tarenaya hassleriana]
Length=215

 Score =   372 bits (956),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 198/213 (93%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV  E E +Q+SKF+RICVFCGSS GKK SY++AA++LGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--EAETMQKSKFRRICVFCGSSQGKKRSYQDAAVDLGKELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+S NARQI VSA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSTNARQIIVSA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHERVASK  WE +++ Y
Sbjct  179  PTAKELVKKLEEYSPCHERVASKLCWEMERIGY  211



>ref|XP_006340180.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Solanum tuberosum]
Length=228

 Score =   373 bits (957),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+ K ++ ++QSKFK+ICVFCGSSPGKK+ YKEAA+ELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEMEKLEKEMKQSKFKKICVFCGSSPGKKSGYKEAAVELGKELVSRNIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVY+GGRHVLGVIP+TL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  61   GLVSQAVYSGGRHVLGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVIAW+QLGIHDKPVGLLNV+GYYNSLL FIDKAVEEGFI PNARQIFVSA
Sbjct  121  GYGTLEELLEVIAWSQLGIHDKPVGLLNVDGYYNSLLAFIDKAVEEGFICPNARQIFVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQL  777
            P AKEL+N+LE+Y P  E VASK  WEK+++
Sbjct  181  PTAKELINKLEDYFPSQENVASKLNWEKEEI  211



>gb|KHN05674.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=220

 Score =   372 bits (954),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  154  GKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLV  333
            G+E E  QQS+FKRICVFCGSSPG K+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGLV
Sbjct  3    GEETEMKQQSRFKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLV  62

Query  334  SQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYG  513
            SQAVY GGRHV+GVIPKTL+PREITGETVGEV AVADMHQRKAEMAKHSDAFIALPGGYG
Sbjct  63   SQAVYEGGRHVIGVIPKTLMPREITGETVGEVMAVADMHQRKAEMAKHSDAFIALPGGYG  122

Query  514  TLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNA  693
            TLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL FIDKAVEEGFISP AR I VSAP+ 
Sbjct  123  TLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVEEGFISPKARHIIVSAPST  182

Query  694  KELMNELEEYNPCHERVASKQKWEKDQLNY  783
            KEL+ ++EEY P HERVASK  WE +Q++Y
Sbjct  183  KELVKKMEEYFPQHERVASKLSWETEQIDY  212



>ref|XP_009367053.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Pyrus x bretschneideri]
Length=274

 Score =   373 bits (958),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 198/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            EKE ++QSKFKRICVFCGSSPG K+SYKEAAIELG+ELVS+NIDLVYGGGS+GLMGL+SQ
Sbjct  60   EKE-MKQSKFKRICVFCGSSPGNKSSYKEAAIELGEELVSKNIDLVYGGGSVGLMGLISQ  118

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
            AVY+GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL
Sbjct  119  AVYDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  178

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VSAP AKE
Sbjct  179  EELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARHIIVSAPTAKE  238

Query  700  LMNELEEYNPCHERVASKQKWEKDQLNY*LIINV  801
            L+ ++EEY P HERVASK  WE +QL Y  I ++
Sbjct  239  LVKKMEEYFPRHERVASKLSWEIEQLGYPTICDI  272



>ref|XP_010107529.1| hypothetical protein L484_024382 [Morus notabilis]
 gb|EXC16211.1| hypothetical protein L484_024382 [Morus notabilis]
Length=218

 Score =   370 bits (950),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E   ++QS+F+RICVFCGSS GKK SY+EAAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEIESE---MKQSRFRRICVFCGSSQGKKTSYQEAAIELGKELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMA+HSDAFIALPG
Sbjct  58   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR I VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY PCHE VASK  WE +QL Y
Sbjct  178  PTAKELVKKLEEYVPCHESVASKLSWETEQLGY  210



>ref|XP_009373527.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Pyrus x bretschneideri]
Length=219

 Score =   370 bits (949),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E E  QQS+F+RICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEI--ESEMQQQSRFRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+AR I +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LE+Y PCHERVA K  W+ +QL Y
Sbjct  179  PTAKELVKKLEDYVPCHERVAPKLNWDVEQLGY  211



>ref|XP_009781791.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Nicotiana sylvestris]
Length=221

 Score =   369 bits (948),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKFKRICVFCGSS GKK+SY++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  13   SKFKRICVFCGSSQGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  72

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELLEVI
Sbjct  73   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVI  132

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR+I VSAP AKEL+ +LEE
Sbjct  133  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNAREIIVSAPTAKELVKKLEE  192

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHERVASK  WE +QL Y
Sbjct  193  YVPCHERVASKLSWEMEQLGY  213



>ref|XP_009788908.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Nicotiana sylvestris]
Length=219

 Score =   369 bits (948),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            +E + ++ SKFKRICVFCGSS GKK+SY++AAI+LGKELVSRNIDLVYGGGSIGLMGLVS
Sbjct  3    RESDVVKVSKFKRICVFCGSSQGKKSSYQDAAIQLGKELVSRNIDLVYGGGSIGLMGLVS  62

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT
Sbjct  63   QAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  122

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI PNAR I VSAP  K
Sbjct  123  LEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPNARHIIVSAPTPK  182

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLNY  783
            EL+ +LEEY PCHERVASK  WE +QL Y
Sbjct  183  ELVKKLEEYVPCHERVASKLSWEMEQLGY  211



>ref|XP_010089966.1| hypothetical protein L484_008044 [Morus notabilis]
 gb|EXB38680.1| hypothetical protein L484_008044 [Morus notabilis]
Length=218

 Score =   369 bits (947),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E    + SKFKRICVFCGSSPGKK SYKEAAIELGKELV+RNIDLVYGGGS+GLM
Sbjct  1    MEIENE---FKLSKFKRICVFCGSSPGKKTSYKEAAIELGKELVARNIDLVYGGGSVGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GL+SQAVY+GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAFIALPG
Sbjct  58   GLISQAVYDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI P+AR I VS+
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPSARHIIVSS  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P+AKEL+ +LEEY P HERVASKQ WE +QL Y
Sbjct  178  PSAKELVKKLEEYFPRHERVASKQSWEIEQLGY  210



>ref|XP_009342948.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Pyrus x bretschneideri]
 ref|XP_009350718.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Pyrus x bretschneideri]
Length=219

 Score =   369 bits (947),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E E  QQS+F+RICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEI--ESEMKQQSRFRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMAKHSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+AR I +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LE+Y PCHERVASK  WE +QL Y
Sbjct  179  PTAKELVKKLEDYVPCHERVASKLNWEMEQLGY  211



>ref|XP_008805210.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Phoenix dactylifera]
Length=218

 Score =   369 bits (946),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            ++ + QSKFKRICVFCGSS GKK+SY++AA+ELGKELVSRNIDLVYGGGS+GLMGLVSQA
Sbjct  4    EQEMGQSKFKRICVFCGSSQGKKSSYQDAAVELGKELVSRNIDLVYGGGSVGLMGLVSQA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLE
Sbjct  64   VHDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGFISP AR I VSAP AKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFISPGARHIIVSAPTAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQLNY  783
            + +LEEY PCHERVASK  WE +QL Y
Sbjct  184  VKKLEEYFPCHERVASKLNWEMEQLGY  210



>ref|XP_008442685.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis melo]
Length=222

 Score =   368 bits (945),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKF+RICVFCGSS GKK SY+++AIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  14   SKFRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  73

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI
Sbjct  74   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  133

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+ARQI VSAP AKELM +LEE
Sbjct  134  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSAPTAKELMKKLEE  193

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHERVAS+  WE +QL Y
Sbjct  194  YVPCHERVASQLSWEIEQLGY  214



>ref|XP_009103862.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4 [Brassica rapa]
Length=215

 Score =   368 bits (945),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 198/213 (93%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P+AKEL+ +LEEY+PCHERVASK  WE +++ Y
Sbjct  179  PSAKELVKKLEEYSPCHERVASKLCWEIERIGY  211



>ref|XP_009610234.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Nicotiana tomentosiformis]
Length=219

 Score =   368 bits (945),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            +E + ++ SKFKRICVFCGSS GKK+SY++AAI+LGKELVSRNIDLVYGGGSIGLMGLVS
Sbjct  3    RESDVVKVSKFKRICVFCGSSQGKKSSYQDAAIQLGKELVSRNIDLVYGGGSIGLMGLVS  62

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT
Sbjct  63   QAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  122

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI PNAR I VSAP  K
Sbjct  123  LEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPNARHIIVSAPTPK  182

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLNY  783
            EL+ +LE+Y PCHERVASK  WE +QL Y
Sbjct  183  ELVKKLEDYVPCHERVASKLSWEMEQLGY  211



>emb|CDY52759.1| BnaA07g37740D [Brassica napus]
Length=215

 Score =   368 bits (944),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 197/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHERVASK  WE +++ Y
Sbjct  179  PTAKELVKKLEEYSPCHERVASKLCWEIERIGY  211



>ref|XP_004137827.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis sativus]
Length=213

 Score =   367 bits (943),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKF+RICVFCGSS GKK SY+++AIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  5    SKFRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  64

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI
Sbjct  65   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  124

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+ARQI VSAP AKELM +LEE
Sbjct  125  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARQIIVSAPTAKELMKKLEE  184

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHERVAS+  WE +QL Y
Sbjct  185  YVPCHERVASQLSWEIEQLGY  205



>ref|XP_006488072.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Citrus sinensis]
 gb|KDO73335.1| hypothetical protein CISIN_1g027287mg [Citrus sinensis]
Length=225

 Score =   368 bits (944),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
             QSKF RICVFCGSS GKK++YK+AAIELGKELV+RNIDLVYGGGS+GLMGL+SQAVY+G
Sbjct  15   NQSKFNRICVFCGSSAGKKSTYKDAAIELGKELVARNIDLVYGGGSVGLMGLISQAVYDG  74

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEVK VADMHQRKAEMAKHSDAFIALPGGYGTLEELLE
Sbjct  75   GRHVIGVIPKTLMPREITGETVGEVKPVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  134

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGFISPNAR I VSAPNAKELMN++
Sbjct  135  VITWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFISPNARHIIVSAPNAKELMNKM  194

Query  715  EEYNPCHERVASKQKWEKDQL  777
            EEY P HERVASK  WE +Q 
Sbjct  195  EEYFPQHERVASKLSWENEQF  215



>gb|KGN58962.1| hypothetical protein Csa_3G739570 [Cucumis sativus]
Length=222

 Score =   368 bits (944),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKF+RICVFCGSS GKK SY+++AIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  14   SKFRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  73

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI
Sbjct  74   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  133

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+ARQI VSAP AKELM +LEE
Sbjct  134  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARQIIVSAPTAKELMKKLEE  193

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHERVAS+  WE +QL Y
Sbjct  194  YVPCHERVASQLSWEIEQLGY  214



>ref|XP_009596604.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X2 [Nicotiana tomentosiformis]
Length=221

 Score =   367 bits (943),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKFKRICVFCGSS GKK+SY++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  13   SKFKRICVFCGSSQGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  72

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELLEVI
Sbjct  73   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVI  132

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR+I VSAP AKEL+ +LEE
Sbjct  133  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNAREIIVSAPTAKELVKKLEE  192

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHE+VASK  WE +QL Y
Sbjct  193  YVPCHEQVASKLSWEMEQLGY  213



>gb|KDP44034.1| hypothetical protein JCGZ_05501 [Jatropha curcas]
Length=216

 Score =   367 bits (942),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QSKFKRICVFCGSSPGKK+SYK+AAIELG+ELVSRNIDLVYGGGSIGLMGL+SQAVY+
Sbjct  5    MRQSKFKRICVFCGSSPGKKSSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYD  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  65   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGFI+P AR I VSAP  KEL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFINPTARHIIVSAPTPKELVKK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HE VASK  WE +QL Y
Sbjct  185  MEEYFPRHEIVASKLSWEIEQLEY  208



>ref|XP_003539768.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Glycine max]
Length=233

 Score =   368 bits (944),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            QQS+FKRICVFCGSSPG K+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY G
Sbjct  23   QQSRFKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYEG  82

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEV AVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE
Sbjct  83   GRHVIGVIPKTLMPREITGETVGEVMAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  142

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL FIDKAVEEGFISP AR I VSAP+ KEL+ ++
Sbjct  143  VITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVEEGFISPKARHIIVSAPSTKELVKKM  202

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HERVASK  WE +Q++Y
Sbjct  203  EEYFPQHERVASKLSWETEQIDY  225



>gb|AFK33887.1| unknown [Lotus japonicus]
Length=218

 Score =   367 bits (941),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QS+FKRICVFCGSSPG K+SYKEAAIELG ELVSRNIDLVYGGGSIGLMGLVSQAVY+
Sbjct  7    MKQSRFKRICVFCGSSPGNKSSYKEAAIELGMELVSRNIDLVYGGGSIGLMGLVSQAVYD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIP+TL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPRTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VSAP+ KEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPQARHIIVSAPSTKELVKK  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HERVASK  WE +QL+Y
Sbjct  187  MEEYIPQHERVASKLSWENEQLDY  210



>gb|KHG18498.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
-like protein [Gossypium arboreum]
Length=218

 Score =   367 bits (941),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPGKK+SYKE+ IELG+ELVSRNIDLVYGGGSIGLMGL+SQAV++
Sbjct  7    MKPSKFKRICVFCGSSPGKKSSYKESTIELGRELVSRNIDLVYGGGSIGLMGLISQAVFD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I VSAP AKEL+  
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVEN  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HERVASK  WE +QL+Y
Sbjct  187  MEEYEPQHERVASKLNWEMEQLSY  210



>ref|XP_007016779.1| Lysine decarboxylase family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY34398.1| Lysine decarboxylase family protein, putative isoform 2 [Theobroma 
cacao]
Length=220

 Score =   367 bits (941),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 194/213 (91%), Gaps = 1/213 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV  + E ++QSKFK ICVFCGSSPGKK+SY+EA IELG+ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEVEMDME-MKQSKFKSICVFCGSSPGKKSSYREATIELGRELVSRNIDLVYGGGSIGLM  59

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GL+SQAV++GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPG
Sbjct  60   GLISQAVFDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPG  119

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI PNAR I VSA
Sbjct  120  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPNARHIIVSA  179

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ ++EEY P HERVASK  WE +QL Y
Sbjct  180  PTAKELVKKMEEYEPQHERVASKLSWEMEQLGY  212



>ref|XP_006354329.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Solanum tuberosum]
Length=218

 Score =   367 bits (941),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 194/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+G +   +  SKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEMGSD---VMVSKFKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMA+HSDAFIALPG
Sbjct  58   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMARHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P A EL+ +LEEY PCHE VASK  WE +QL Y
Sbjct  178  PTATELVEKLEEYVPCHESVASKLNWETEQLGY  210



>ref|XP_008359648.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin riboside 5'-monophosphate 
phosphoribohydrolase LOG3-like [Malus domestica]
Length=219

 Score =   366 bits (940),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E E  QQS+F+RICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEI--ESEMKQQSRFRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMAKHSDAF ALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFXALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+AR I +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LE+Y PCHERVASK  WE +QL Y
Sbjct  179  PTAKELVKKLEDYVPCHERVASKLNWEMEQLGY  211



>ref|XP_002285246.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Vitis vinifera]
Length=218

 Score =   366 bits (940),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 194/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME  KE   ++QSKFKRICVFCGSS GKK+SYK+AAIELG+ELVSRNIDLVYGGGSIGLM
Sbjct  1    MERDKE---MKQSKFKRICVFCGSSQGKKSSYKDAAIELGRELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GL+SQAVY+GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAFIALPG
Sbjct  58   GLISQAVYDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP+AR I VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEDFISPSARHIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P A+ELM +LEEY P HE VASK  WE +QL Y
Sbjct  178  PTARELMKKLEEYFPRHEGVASKLSWETEQLGY  210



>ref|XP_008369688.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Malus domestica]
Length=219

 Score =   366 bits (940),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E E  QQS+F+RICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEI--ESEMQQQSRFRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMAKHSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+AR I +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LE+Y PCHERVA K  WE +QL Y
Sbjct  179  PTAKELVKKLEDYVPCHERVAPKLNWEIEQLGY  211



>ref|XP_006424548.1| hypothetical protein CICLE_v10029235mg [Citrus clementina]
 gb|ESR37788.1| hypothetical protein CICLE_v10029235mg [Citrus clementina]
Length=223

 Score =   366 bits (940),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
             QSKF RICVFCGSS GKK++YK+AAIEL KELV+RNIDLVYGGGS+GLMGL+SQAVY+G
Sbjct  13   NQSKFNRICVFCGSSAGKKSTYKDAAIELSKELVARNIDLVYGGGSVGLMGLISQAVYDG  72

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEVK VADMHQRKAEMAKHSDAFIALPGGYGTLEELLE
Sbjct  73   GRHVIGVIPKTLMPREITGETVGEVKPVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  132

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGFISPNAR I VSAPNAKELMN++
Sbjct  133  VITWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFISPNARHIIVSAPNAKELMNKM  192

Query  715  EEYNPCHERVASKQKWEKDQL  777
            EEY P HERVASK  WE +Q 
Sbjct  193  EEYFPQHERVASKLSWENEQF  213



>ref|NP_181258.2| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Arabidopsis thaliana]
 sp|Q8L8B8.1|LOG3_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3; AltName: Full=Protein LONELY GUY 3 [Arabidopsis 
thaliana]
 gb|AAM76759.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAX55144.1| hypothetical protein At2g37210 [Arabidopsis thaliana]
 gb|AEC09367.1| protein LONELY GUY 3 [Arabidopsis thaliana]
Length=215

 Score =   366 bits (939),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E++Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ESMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHERVA+K  WE +++ Y
Sbjct  186  KKLEEYAPCHERVATKLCWEMERIGY  211



>emb|CBI16329.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   365 bits (938),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QSKFKRICVFCGSS GKK+SYK+AAIELG+ELVSRNIDLVYGGGSIGLMGL+SQAVY+
Sbjct  1    MKQSKFKRICVFCGSSQGKKSSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYD  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  61   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP+AR I VSAP A+ELM +
Sbjct  121  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEDFISPSARHIIVSAPTARELMKK  180

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P HE VASK  WE +QL Y
Sbjct  181  LEEYFPRHEGVASKLSWETEQLGY  204



>ref|XP_004246656.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Solanum lycopersicum]
Length=218

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  10   SKFKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  69

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMA+HSDAFIALPGGYGTLEELLEVI
Sbjct  70   HVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMARHSDAFIALPGGYGTLEELLEVI  129

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI VSAP A EL+ +LEE
Sbjct  130  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIVSAPTATELVEKLEE  189

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHE VASK  WE +QL Y
Sbjct  190  YVPCHESVASKLNWETEQLGY  210



>gb|KFK34594.1| hypothetical protein AALP_AA5G166100 [Arabis alpina]
Length=215

 Score =   365 bits (938),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK SY++AA+ELG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETMQKSKFGRICVFCGSSQGKKTSYQDAAVELGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHE VA+K  WE +++ Y
Sbjct  179  PTAKELVKKLEEYSPCHESVATKLCWEIERIGY  211



>ref|XP_006403687.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
 gb|ESQ45140.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
Length=215

 Score =   365 bits (937),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--NNETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHE VASK  WE +++ Y
Sbjct  179  PTAKELVKKLEEYSPCHESVASKLCWEIERIGY  211



>gb|AGE00883.1| lysine decarboxylase [Cucumis sativus]
Length=215

 Score =   365 bits (937),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKF+RICVFCGSS GKK SY+++AIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  14   SKFRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  73

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT EELLEVI
Sbjct  74   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTPEELLEVI  133

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+ARQI VSAP AKELM +LEE
Sbjct  134  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARQIIVSAPTAKELMKKLEE  193

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y PCHERVAS+  WE +QL Y
Sbjct  194  YVPCHERVASQLSWEIEQLGY  214



>gb|AII20186.1| riboside 5'-monophosphate phosphoribohydrolase [Nicotiana tabacum]
Length=219

 Score =   365 bits (937),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            +E + ++ SKFKRICVFCGSS GKK+SY++AAI+LGKELVSRNIDLVYGGGSIGLM LVS
Sbjct  3    RESDVVKVSKFKRICVFCGSSQGKKSSYQDAAIQLGKELVSRNIDLVYGGGSIGLMVLVS  62

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT
Sbjct  63   QAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  122

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI PNAR I VSAP  K
Sbjct  123  LEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFICPNARHIIVSAPTPK  182

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLNY  783
            EL+ +LEEY PCHERVASK  WE +QL Y
Sbjct  183  ELVKKLEEYVPCHERVASKLSWEMEQLGY  211



>ref|XP_010046628.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Eucalyptus grandis]
 gb|KCW88810.1| hypothetical protein EUGRSUZ_A01146 [Eucalyptus grandis]
Length=218

 Score =   365 bits (936),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV  E   ++ SKF RICVFCGSS GKK+SY++AAIELG+ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEVEGE---IKLSKFGRICVFCGSSQGKKSSYQDAAIELGRELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  58   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+ARQI VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY PCHER  SK  WE +QL+Y
Sbjct  178  PTAKELVKKLEEYVPCHERAISKLNWEVEQLDY  210



>ref|XP_006381447.1| hypothetical protein POPTR_0006s12920g [Populus trichocarpa]
 gb|ERP59244.1| hypothetical protein POPTR_0006s12920g [Populus trichocarpa]
Length=226

 Score =   365 bits (937),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 194/218 (89%), Gaps = 5/218 (2%)
 Frame = +1

Query  145  MEVGKEKEALQQ-----SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGG  309
            ME+ +    LQQ     SKFKRICVFCGSS GKK SY+ AAI+LG ELVSRNIDLVYGGG
Sbjct  1    MEMVETTITLQQQQSMLSKFKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGG  60

Query  310  SIGLMGLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAF  489
            SIGLMGLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAF
Sbjct  61   SIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAF  120

Query  490  IALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQ  669
            IALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+AR 
Sbjct  121  IALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARN  180

Query  670  IFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            I +SAP AKEL+ +LEEY PCHERVASK  WE +QL Y
Sbjct  181  IILSAPTAKELVKKLEEYVPCHERVASKLSWEIEQLGY  218



>ref|XP_011048543.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Populus euphratica]
Length=226

 Score =   365 bits (936),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 193/218 (89%), Gaps = 5/218 (2%)
 Frame = +1

Query  145  MEVGKEKEALQQ-----SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGG  309
            ME+      LQQ     SKFKRICVFCGSS GKK SY+ AAI+LG ELVSRNIDLVYGGG
Sbjct  1    MEMVDTTITLQQQQSMLSKFKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGG  60

Query  310  SIGLMGLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAF  489
            SIGLMGL+SQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAF
Sbjct  61   SIGLMGLISQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAF  120

Query  490  IALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQ  669
            IALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR 
Sbjct  121  IALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARN  180

Query  670  IFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            I +SAP AKEL+ +LEEY PCHERVASK  WE +QL Y
Sbjct  181  IILSAPTAKELVKKLEEYVPCHERVASKLSWEIEQLGY  218



>ref|XP_006403688.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
 gb|ESQ45141.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
Length=260

 Score =   366 bits (939),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  51   ETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  110

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPGGYGTLEE
Sbjct  111  HDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEE  170

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI +SAP AKEL+
Sbjct  171  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISAPTAKELV  230

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY+PCHE VASK  WE +++ Y
Sbjct  231  KKLEEYSPCHESVASKLCWEIERIGY  256



>ref|XP_007027341.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
 gb|EOY07843.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
Length=233

 Score =   365 bits (936),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 193/218 (89%), Gaps = 15/218 (7%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKEL---------------VSRNIDLVYGGG  309
            QQS+F+RICVFCGSS GKK+SY++AAIELG+EL               VSRNIDLVYGGG
Sbjct  8    QQSRFRRICVFCGSSQGKKSSYQDAAIELGRELETLMVFQFFSMPIQEVSRNIDLVYGGG  67

Query  310  SIGLMGLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAF  489
            SIGLMGLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAF
Sbjct  68   SIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAF  127

Query  490  IALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQ  669
            IALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+ARQ
Sbjct  128  IALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQ  187

Query  670  IFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            I VSAP AKEL+ +LEEY PCHERVASK  WE +QL Y
Sbjct  188  IIVSAPTAKELVKKLEEYVPCHERVASKLSWEMEQLGY  225



>ref|XP_007206768.1| hypothetical protein PRUPE_ppa025305mg [Prunus persica]
 ref|XP_008243947.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Prunus mume]
 gb|EMJ07967.1| hypothetical protein PRUPE_ppa025305mg [Prunus persica]
Length=218

 Score =   364 bits (934),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  E   ++QS+F RICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLM
Sbjct  1    MEIESE---MKQSRFGRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMAKHSDAFIALPG
Sbjct  58   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR I +SA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIISA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P A+EL+ +LE+Y PCHERVASK  WE +QL Y
Sbjct  178  PTARELVKKLEDYVPCHERVASKLNWEMEQLGY  210



>ref|XP_002881496.1| hypothetical protein ARALYDRAFT_482713 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57755.1| hypothetical protein ARALYDRAFT_482713 [Arabidopsis lyrata subsp. 
lyrata]
Length=215

 Score =   364 bits (934),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR+I VS+P AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNAREIIVSSPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHE VA+K  WE +++ Y
Sbjct  186  KKLEEYAPCHESVATKLCWEMERIGY  211



>ref|XP_008385326.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Malus domestica]
Length=255

 Score =   365 bits (937),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 193/208 (93%), Gaps = 1/208 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            EKE ++ SKFKRICVFCGSSPG K+SYKEAAIELG+ELVS+NIDLVYGGGS+GLMGL+SQ
Sbjct  45   EKE-MKLSKFKRICVFCGSSPGNKSSYKEAAIELGEELVSKNIDLVYGGGSVGLMGLISQ  103

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
            AVY+GGRHV+GVIPKTL+PREITG+TVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL
Sbjct  104  AVYDGGRHVIGVIPKTLMPREITGDTVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  163

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VSAP AKE
Sbjct  164  EELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARHIIVSAPTAKE  223

Query  700  LMNELEEYNPCHERVASKQKWEKDQLNY  783
            L+ ++EEY P HERVASK  WE +QL Y
Sbjct  224  LVKKMEEYFPRHERVASKLSWEIEQLGY  251



>ref|XP_010935881.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Elaeis guineensis]
Length=218

 Score =   363 bits (933),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            + + QSKFKRICVFCGSS GKK SY++AA+ELG+ELVSRNIDLVYGGGS+GLMGLVSQAV
Sbjct  5    QEVTQSKFKRICVFCGSSQGKKRSYQDAAVELGQELVSRNIDLVYGGGSVGLMGLVSQAV  64

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEE
Sbjct  65   HDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEE  124

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VSAP AKEL+
Sbjct  125  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPGARHIIVSAPTAKELV  184

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHERVASK  WE + L Y
Sbjct  185  KKLEEYFPCHERVASKLNWEMEHLGY  210



>gb|KHG02823.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
-like protein [Gossypium arboreum]
Length=218

 Score =   363 bits (933),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QSKFKRICVFCGSSPGKKNSY+EAAI+LG+ELVSRNIDLVYGGGSIGLMGL+SQAV++
Sbjct  7    MKQSKFKRICVFCGSSPGKKNSYREAAIDLGRELVSRNIDLVYGGGSIGLMGLISQAVFD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAV+DMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPREITGETVGEVKAVSDMHQRKAEMARQSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I +SAP A++L+  
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIILSAPTAQDLVKY  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HERVA K  WE +QL Y
Sbjct  187  MEEYEPQHERVAPKLNWEIEQLGY  210



>ref|XP_002276279.2| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Vitis vinifera]
 emb|CBI32740.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   363 bits (933),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QSKFKRICVFCGSS GKK SY++AAI+LGKELVSRNIDLVYGGGSIGLMGLVSQAV+N
Sbjct  7    VEQSKFKRICVFCGSSQGKKTSYQDAAIQLGKELVSRNIDLVYGGGSIGLMGLVSQAVHN  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TG TVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGVTVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR I VSAP A+EL+ +
Sbjct  127  EVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPTAEELVKK  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P H+ VASK  WE +QL+Y
Sbjct  187  LEEYVPSHQGVASKLSWEMEQLDY  210



>ref|XP_004291703.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Fragaria vesca subsp. vesca]
Length=216

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            + QS+FKRICVFCGSSPGKK+SY++AAIELG+ELVS++IDLVYGGGSIGLMGL+SQAVY+
Sbjct  5    MMQSRFKRICVFCGSSPGKKSSYQDAAIELGQELVSKDIDLVYGGGSIGLMGLISQAVYD  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMH RKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  65   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHSRKAEMAKHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYN LL+FID AVEEGFISP+AR I VSAP AKEL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNFLLSFIDTAVEEGFISPDARHIIVSAPTAKELVKK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HERVASK  WE++QL Y
Sbjct  185  MEEYVPRHERVASKLSWEREQLGY  208



>ref|XP_010509365.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Camelina sativa]
 ref|XP_010516980.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Camelina sativa]
Length=215

 Score =   363 bits (931),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
              LEEY PCHE VA+K  WE +++ Y
Sbjct  186  KMLEEYAPCHESVATKLCWEMERIGY  211



>ref|XP_011094655.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Sesamum indicum]
Length=218

 Score =   362 bits (930),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSS GKK SY+EAAIELGK LVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  7    VKASKFKRICVFCGSSQGKKTSYQEAAIELGKVLVSRNIDLVYGGGSIGLMGLVSQAVHD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I VSAP AKEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKK  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P HERVA K  WE +QL Y
Sbjct  187  LEEYVPRHERVAPKLSWEMEQLGY  210



>ref|XP_002323469.2| hypothetical protein POPTR_0016s09180g [Populus trichocarpa]
 gb|EEF05230.2| hypothetical protein POPTR_0016s09180g [Populus trichocarpa]
Length=224

 Score =   363 bits (931),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 190/210 (90%), Gaps = 4/210 (2%)
 Frame = +1

Query  160  EKEALQQ----SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            E   LQQ    SKFKRICVFCGSS GKK SY+ AAI+LG ELVSRNIDLVYGGGSIGLMG
Sbjct  5    ETTTLQQQSMSSKFKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMG  64

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            LVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG
Sbjct  65   LVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  124

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P+AR I VSAP
Sbjct  125  YGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARNIIVSAP  184

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQL  777
             AKEL+ +LEEY PCHERVASK  WE +QL
Sbjct  185  TAKELVKKLEEYVPCHERVASKLSWEIEQL  214



>ref|XP_011040899.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Populus euphratica]
Length=216

 Score =   362 bits (929),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPGKK+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGL+SQAV++
Sbjct  5    MKHSKFKRICVFCGSSPGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVFD  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  65   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P+AR I VSAP  +EL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HE VASK  WE +Q +Y
Sbjct  185  MEEYFPRHEIVASKVSWESEQFDY  208



>ref|XP_010505298.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Camelina sativa]
Length=215

 Score =   362 bits (929),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETIQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
              LEEY PCHE VA+K  WE +++ Y
Sbjct  186  KMLEEYAPCHESVATKLCWEMERIGY  211



>ref|XP_007132270.1| hypothetical protein PHAVU_011G080600g [Phaseolus vulgaris]
 gb|ESW04264.1| hypothetical protein PHAVU_011G080600g [Phaseolus vulgaris]
Length=232

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  154  GKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLV  333
            G+  E  Q+S+FKRICVFCGSSPG K+SY++AAIEL KELVSRNIDLVYGGGSIGLMGLV
Sbjct  15   GEGTEMKQESRFKRICVFCGSSPGNKSSYQDAAIELAKELVSRNIDLVYGGGSIGLMGLV  74

Query  334  SQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYG  513
            SQAVY+GGRHV+GVIPKTL+PREITGETVGEV AVADMHQRKAEMA+HSDAFIALPGGYG
Sbjct  75   SQAVYDGGRHVIGVIPKTLMPREITGETVGEVMAVADMHQRKAEMARHSDAFIALPGGYG  134

Query  514  TLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNA  693
            TLEE+LEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VS+P++
Sbjct  135  TLEEVLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSSPSS  194

Query  694  KELMNELEEYNPCHERVASKQKWEKDQLNY  783
            KEL+ ++EEY P HERVASK  WE +Q+ Y
Sbjct  195  KELVKKMEEYFPQHERVASKLSWETEQIEY  224



>ref|XP_009407199.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Musa acuminata subsp. malaccensis]
Length=217

 Score =   362 bits (929),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            K+  + SKF RICVFCGSS GKK SY++AAIELGKELVSRNIDLVYGGGS+GLMGLVSQA
Sbjct  4    KQEAKASKFTRICVFCGSSQGKKRSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVSQA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHV GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLE
Sbjct  64   VHDGGRHVTGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SPNAR I +SAP AKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPNARHIILSAPTAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQLNY  783
            M +LEEY P HERVASK  WE +QL Y
Sbjct  184  MKKLEEYFPRHERVASKLNWETEQLGY  210



>ref|XP_002314282.2| hypothetical protein POPTR_0009s01600g [Populus trichocarpa]
 gb|EEE88237.2| hypothetical protein POPTR_0009s01600g [Populus trichocarpa]
Length=216

 Score =   362 bits (928),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QS+FKRICVFCGSSPGKK+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGL+SQAV++
Sbjct  5    MKQSRFKRICVFCGSSPGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVFD  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  65   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P+AR I VSAP  +EL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HE VASK  WE +QL Y
Sbjct  185  MEEYFPRHEIVASKLSWEIEQLGY  208



>ref|XP_004145748.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Cucumis sativus]
 ref|XP_008463955.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Cucumis melo]
 gb|KGN46845.1| hypothetical protein Csa_6G141420 [Cucumis sativus]
Length=218

 Score =   361 bits (927),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  187  FKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHV  366
            FKRICVFCGSSPGKK SYK+AAIELGKELVSR+IDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  12   FKRICVFCGSSPGKKTSYKDAAIELGKELVSRDIDLVYGGGSVGLMGLVSQAVHNGGRHV  71

Query  367  LGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  546
            +GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELLEVI W
Sbjct  72   VGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVITW  131

Query  547  AQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYN  726
            AQLGIHDKPVGLLNV+GYYNSLL+FID+AVEEGFISP+AR I VSAPNAKEL+ ++EEY 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDQAVEEGFISPSARHIIVSAPNAKELVKKMEEYV  191

Query  727  PCHERVASKQKWEKDQLNY  783
            P HERVASK  WE +QL Y
Sbjct  192  PRHERVASKHSWEIEQLGY  210



>gb|ACU19348.1| unknown [Glycine max]
Length=233

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            QQS+FKRICVFCGSSPG K+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY G
Sbjct  23   QQSRFKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYEG  82

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEV AVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE
Sbjct  83   GRHVIGVIPKTLMPREITGETVGEVMAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  142

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL FI KAVEEGFISP AR I VSAP+ KEL+ ++
Sbjct  143  VITWAQLGIHDKPVGLLNVDGYYNSLLCFIGKAVEEGFISPKARHIIVSAPSTKELVKKM  202

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HERVA K  WE +Q++Y
Sbjct  203  EEYFPQHERVAFKLSWETEQIDY  225



>ref|XP_006294984.1| hypothetical protein CARUB_v10024052mg [Capsella rubella]
 gb|EOA27882.1| hypothetical protein CARUB_v10024052mg [Capsella rubella]
Length=213

 Score =   361 bits (926),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    EPKFKRICVFCGSSAGNKTSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFISP AR I VSAP+AKEL+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKELVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P HE+VASK+ WE +Q+
Sbjct  184  EYVPRHEKVASKKSWEMEQI  203



>ref|XP_003543475.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Glycine max]
 gb|KHN21508.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=209

 Score =   360 bits (925),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  160  EKEA-LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            EKE  ++QSKFKRICVFCGSSPG K SYK+AAIELG+ELVSRNIDLVYGGGSIGLMGL+S
Sbjct  2    EKETEMKQSKFKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLIS  61

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVY GGRHV GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAK SDAFIALPGGYGT
Sbjct  62   QAVYEGGRHVTGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKRSDAFIALPGGYGT  121

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYN+ L+FIDKAVEEGFISP AR I VSAP  K
Sbjct  122  LEELLEVITWAQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPK  181

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLN  780
            EL+ E+EEY P HERV SK  WE +QL+
Sbjct  182  ELVKEMEEYFPQHERVVSKLSWESEQLH  209



>ref|XP_010557341.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Tarenaya hassleriana]
Length=213

 Score =   361 bits (926),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            +++KFKRICVFCGSSPGKK SY++AA+ELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NG
Sbjct  3    REAKFKRICVFCGSSPGKKTSYRDAAVELGTELVSRNIDLVYGGGSIGLMGLISQAVFNG  62

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEVKAVADMH+RKAEMAKHSDAFIALPGGYGTLEELLE
Sbjct  63   GRHVIGVIPKTLMPREITGETVGEVKAVADMHERKAEMAKHSDAFIALPGGYGTLEELLE  122

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR I VSAPNAK+L+ ++
Sbjct  123  VITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPNAKDLVKKM  182

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HE VASK  WE +Q+ +
Sbjct  183  EEYVPRHEGVASKLSWEMEQIGF  205



>ref|NP_565668.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Arabidopsis thaliana]
 sp|Q8RUN2.1|LOG1_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1; AltName: Full=Protein LONELY GUY 1 [Arabidopsis 
thaliana]
 gb|AAM15149.1| expressed protein [Arabidopsis thaliana]
 gb|AAM15229.1| expressed protein [Arabidopsis thaliana]
 gb|AAM64338.1| unknown [Arabidopsis thaliana]
 gb|AEC08102.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Arabidopsis thaliana]
Length=213

 Score =   361 bits (926),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +SKFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    ESKFKRICVFCGSSAGNKVSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFISP AR I VSAP+AKEL+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKELVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            +Y P HE+VASK+ WE +Q+
Sbjct  184  DYVPRHEKVASKKSWEMEQI  203



>ref|XP_011044403.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Populus euphratica]
Length=216

 Score =   361 bits (926),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QS+FKRICVFCGSSPGKK+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGL+SQAV++
Sbjct  5    MKQSRFKRICVFCGSSPGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVFD  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAF+ALPGGYGTLEELL
Sbjct  65   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFMALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P+AR I VSAP  +EL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HE VASK  WE +QL Y
Sbjct  185  MEEYFPRHEIVASKLSWEIEQLGY  208



>ref|NP_001241195.1| uncharacterized protein LOC100787375 [Glycine max]
 gb|ACU18655.1| unknown [Glycine max]
Length=219

 Score =   360 bits (925),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +  ++ SKFKRICVFCGSSPGKK++Y++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQA
Sbjct  4    RSEMRHSKFKRICVFCGSSPGKKSTYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE
Sbjct  64   VHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQ  774
            + +LE+Y PCHE VASK  W+ +Q
Sbjct  184  VKKLEDYVPCHEGVASKLSWQIEQ  207



>ref|XP_006293523.1| hypothetical protein CARUB_v10024039mg [Capsella rubella]
 gb|EOA26421.1| hypothetical protein CARUB_v10024039mg [Capsella rubella]
Length=215

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFIS  AR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISTTAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHE VA+K  WE +++ Y
Sbjct  186  KKLEEYAPCHESVATKLCWEMERIGY  211



>ref|NP_001244911.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG6 
[Solanum lycopersicum]
 dbj|BAM09001.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase-like 
[Solanum lycopersicum]
Length=220

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  12   SKFKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  71

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMAKHSDAFIALPGGYGTLEELLEVI
Sbjct  72   HVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  131

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I VSAP++KEL+ +LEE
Sbjct  132  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPSSKELVKKLEE  191

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y P HE VASK  WE +QL Y
Sbjct  192  YVPSHEGVASKLNWETEQLGY  212



>ref|XP_006339070.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Solanum tuberosum]
Length=220

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  9    VKGSKFKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHD  68

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVA MHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  69   GGRHVIGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMARHSDAFIALPGGYGTLEELL  128

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I +SAP+ KEL+ +
Sbjct  129  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIISAPSPKELVKK  188

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY PCHE VASK  WE +QL Y
Sbjct  189  LEEYVPCHEGVASKLIWETEQLGY  212



>ref|XP_003554380.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Glycine max]
Length=219

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +  ++ SKFKRICVFCGSSPGKK+SY++AAI+LG ELVSRNIDLVYGGGSIGLMGLVSQA
Sbjct  4    RSEIRHSKFKRICVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE
Sbjct  64   VHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQ  774
            + +LE+Y PCHE VASK  W+ +Q
Sbjct  184  VKKLEDYVPCHEGVASKLSWQIEQ  207



>ref|XP_010253716.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X1 [Nelumbo nucifera]
Length=218

 Score =   360 bits (924),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            +Q SKFKRICVFCGSS GKK+SY++AAIELG+ELVSRNIDLVYGGGS+GLMGLVSQAVYN
Sbjct  7    MQLSKFKRICVFCGSSNGKKSSYQDAAIELGRELVSRNIDLVYGGGSVGLMGLVSQAVYN  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREI GETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPREICGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+F+DKAVEEGFISP+AR I VSAP AKEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFVDKAVEEGFISPSARHIIVSAPTAKELVKK  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P HE+VAS+  WE +QL Y
Sbjct  187  LEEYFPRHEKVASQLSWEMEQLGY  210



>ref|XP_008807508.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Phoenix dactylifera]
Length=218

 Score =   360 bits (924),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++SKFKRICVFCGSS GKK SY++AA+ELGKELVSRNIDLVYGGGS+GLMGLVSQAV++G
Sbjct  8    RRSKFKRICVFCGSSQGKKRSYQDAAVELGKELVSRNIDLVYGGGSVGLMGLVSQAVHDG  67

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAF+ALPGGYGTLEELLE
Sbjct  68   GRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFMALPGGYGTLEELLE  127

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I VSAP AKEL+ +L
Sbjct  128  VITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKL  187

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HE VASK  WE ++L Y
Sbjct  188  EEYFPRHEGVASKLNWEMERLGY  210



>gb|KEH39342.1| lysine decarboxylase family protein [Medicago truncatula]
Length=209

 Score =   360 bits (923),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPG K SYK+AAIELGKELVSRNIDLVYGGGSIGLMGL+SQAVY+
Sbjct  7    MKVSKFKRICVFCGSSPGNKTSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVYD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEM+++SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMSRNSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNS LTFIDKAVEEGFISP AR I VSAP  KEL+  
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSFLTFIDKAVEEGFISPTARHIIVSAPTPKELVKN  186

Query  712  LEEYNPCHERVASKQKWEKDQLN  780
            +EEY P HERVASK  WE +QL+
Sbjct  187  MEEYFPQHERVASKLSWENEQLD  209



>ref|NP_190913.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG4 
[Arabidopsis thaliana]
 sp|Q9LFH3.1|LOG4_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4; AltName: Full=Protein LONELY GUY 4 [Arabidopsis 
thaliana]
 emb|CAB67652.1| putative protein [Arabidopsis thaliana]
 gb|AEE79088.1| molybdenum cofactor binding protein [Arabidopsis thaliana]
Length=215

 Score =   360 bits (923),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELV RNIDLVYGGGSIGLM
Sbjct  1    MEV--NNETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFIS NARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISTNARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHE VA+K  WE ++++Y
Sbjct  179  PTAKELVKKLEEYSPCHESVATKLCWEIERIDY  211



>ref|XP_002880937.1| hypothetical protein ARALYDRAFT_481677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57196.1| hypothetical protein ARALYDRAFT_481677 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   359 bits (922),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K+SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    EPKFKRICVFCGSSAGNKSSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFISP AR I VSAP+AKEL+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIVVSAPSAKELVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            +Y P HE+VASK+ WE +Q+
Sbjct  184  DYVPRHEKVASKKSWEMEQI  203



>gb|KHN02336.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
Length=267

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +  ++ SKFKRICVFCGSSPGKK+SY++AAI+LG ELVSRNIDLVYGGGSIGLMGLVSQA
Sbjct  4    RSEIRHSKFKRICVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE
Sbjct  64   VHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQ  774
            + +LE+Y PCHE VASK  W+ +Q
Sbjct  184  VKKLEDYVPCHEGVASKLSWQIEQ  207



>ref|NP_001240198.1| uncharacterized protein LOC100791145 [Glycine max]
 gb|ACU18068.1| unknown [Glycine max]
 gb|KHN39072.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
 gb|KHN48287.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
Length=219

 Score =   359 bits (922),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKR+CVFCGSSPGKK SY++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  7    IRVSKFKRVCVFCGSSPGKKRSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP +KEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKK  186

Query  712  LEEYNPCHERVASKQKWE-KDQLNY  783
            LE+Y PCHE VASK  W+ + QL Y
Sbjct  187  LEDYVPCHESVASKLSWQIEQQLTY  211



>gb|AAK32797.1|AF361629_1 T3B23.2/T3B23.2 [Arabidopsis thaliana]
 gb|AAL87406.1| T3B23.2/T3B23.2 [Arabidopsis thaliana]
Length=213

 Score =   359 bits (921),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +SKFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    ESKFKRICVFCGSSAGNKVSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH+KPVGLLNVEGYYNSLL+FIDKAVEEGFISP AR I VSAP+AKEL+ +LE
Sbjct  124  ITWAQLGIHNKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKELVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            +Y P HE+VASK+ WE +Q+
Sbjct  184  DYVPRHEKVASKKSWEMEQI  203



>gb|EYU34458.1| hypothetical protein MIMGU_mgv1a013457mg [Erythranthe guttata]
Length=220

 Score =   359 bits (922),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E    SKFKRICVFCGSS GKK SY++AAIELGK LVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  7    EGKASSKFKRICVFCGSSHGKKTSYQDAAIELGKVLVSRNIDLVYGGGSIGLMGLVSQAV  66

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+P+E+TG+TVGEVKAVA MHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  67   HDGGRHVMGVIPKTLMPQELTGQTVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEE  126

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+ YYNSLL+FIDKAVEEGFISPNAR I VSAP AKEL+
Sbjct  127  LLEVITWAQLGIHDKPVGLLNVDDYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELV  186

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY P HERVASK  WE +QL+Y
Sbjct  187  KKLEEYTPRHERVASKLSWETEQLDY  212



>ref|XP_007144351.1| hypothetical protein PHAVU_007G148800g [Phaseolus vulgaris]
 gb|ESW16345.1| hypothetical protein PHAVU_007G148800g [Phaseolus vulgaris]
Length=219

 Score =   359 bits (922),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKR+CVFCGSSPGKK SY++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  7    IRVSKFKRVCVFCGSSPGKKRSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP +KEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKK  186

Query  712  LEEYNPCHERVASKQKWE-KDQLNY  783
            LE+Y PCHE VASK  W+ + QL Y
Sbjct  187  LEDYVPCHESVASKLSWQMEQQLTY  211



>ref|XP_007150188.1| hypothetical protein PHAVU_005G134000g [Phaseolus vulgaris]
 gb|ESW22182.1| hypothetical protein PHAVU_005G134000g [Phaseolus vulgaris]
Length=209

 Score =   359 bits (921),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  160  EKEA-LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            EKE  ++QSKFKRICVFCGSSPG K +YK+AAIELG+ELVSRNIDLVYGGGSIGLMGL+S
Sbjct  2    EKETEMKQSKFKRICVFCGSSPGNKTTYKDAAIELGRELVSRNIDLVYGGGSIGLMGLIS  61

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVY GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAK SDAFIALPGGYGT
Sbjct  62   QAVYEGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKRSDAFIALPGGYGT  121

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYN+ L+FIDKAVEEGFISP AR I VSAP  K
Sbjct  122  LEELLEVITWAQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPK  181

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLN  780
            EL+ E+EEY P HERV SK  WE ++L+
Sbjct  182  ELVKEMEEYFPQHERVVSKVSWESEKLH  209



>ref|XP_009139409.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like isoform X1 [Brassica rapa]
Length=215

 Score =   359 bits (921),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    + +Q+SKF RICVFCGSS GKK SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--NNDTMQKSKFGRICVFCGSSQGKKGSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            G+VSQ V++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GIVSQVVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYY+SLL+FIDKAVEEGFISPNARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYSSLLSFIDKAVEEGFISPNARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHE VASK  WE +++ Y
Sbjct  179  PTAKELVKKLEEYSPCHESVASKLCWEIERIGY  211



>emb|CDY30875.1| BnaC04g27300D [Brassica napus]
Length=215

 Score =   359 bits (921),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    + +Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV--NNDTMQKSKFERICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            G+VSQ V++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GIVSQVVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYY+SLL+FIDKAVEEGFISP ARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYSSLLSFIDKAVEEGFISPTARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHE VASK  WE +++ Y
Sbjct  179  PTAKELVKKLEEYSPCHESVASKLCWEIERIGY  211



>ref|XP_006384915.1| hypothetical protein POPTR_0004s22210g [Populus trichocarpa]
 gb|ERP62712.1| hypothetical protein POPTR_0004s22210g [Populus trichocarpa]
Length=216

 Score =   359 bits (921),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPGKK+SYK+AAIELGKELVS NIDLVYGGGSIGLMGL+SQAV++
Sbjct  5    MKHSKFKRICVFCGSSPGKKSSYKDAAIELGKELVSSNIDLVYGGGSIGLMGLISQAVFD  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  65   GGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P+AR I VSAP  +EL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            +EEY P HE VASK  WE +QL Y
Sbjct  185  MEEYFPRHEIVASKVSWEIEQLGY  208



>ref|XP_006592704.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Glycine max]
 gb|KHN11222.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=209

 Score =   358 bits (920),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  160  EKEA-LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            EKE  ++QSKFKRICVFCGSSPG K SYK+AAIELG+ELVSRNIDLVYGGGSIGLMGL+S
Sbjct  2    EKETEMKQSKFKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLIS  61

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVY GGRHV GVIPKTL+PRE+TGETVGEVKAVA+MHQRKAEMAK SDAFIALPGGYGT
Sbjct  62   QAVYEGGRHVTGVIPKTLMPRELTGETVGEVKAVANMHQRKAEMAKRSDAFIALPGGYGT  121

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYN+ L+FIDKAVEEGFISP AR I VSAP  K
Sbjct  122  LEELLEVITWAQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPK  181

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLN  780
            EL+ E+EEY P HERV SK  WE +QL+
Sbjct  182  ELVKEMEEYFPQHERVVSKLSWESEQLH  209



>ref|XP_009116037.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like [Brassica rapa]
Length=216

 Score =   358 bits (920),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 194/213 (91%), Gaps = 1/213 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV   K  +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSI LM
Sbjct  1    MEV-NTKTIIQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIVLM  59

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            G VSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  60   GFVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  119

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+ARQI +SA
Sbjct  120  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIISA  179

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY+PCHE VASK  WE +++ Y
Sbjct  180  PTAKELVKKLEEYSPCHESVASKLCWEIERIGY  212



>ref|XP_010264655.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like isoform X1 [Nelumbo nucifera]
Length=217

 Score =   358 bits (920),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QSKFKRICVFCGSS GKK+SY++AAIELGKELVSRNIDLVYGGGS+GLMGLVSQAVYN
Sbjct  7    MKQSKFKRICVFCGSSHGKKSSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVSQAVYN  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+P EI GETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPPEICGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGF+SP+AR I VSAP AKEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIVSAPTAKELVKK  186

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P HE+VAS+  WE +QL Y
Sbjct  187  LEEYFPRHEKVASQLSWEMEQLGY  210



>ref|XP_002519528.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF42942.1| carboxy-lyase, putative [Ricinus communis]
Length=220

 Score =   358 bits (920),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E  Q SKFKRICVFCGSS GKK+SY++AAIEL KELVS+ IDLVYGGGSIGLMGLVSQAV
Sbjct  7    EIRQASKFKRICVFCGSSQGKKSSYQDAAIELAKELVSKKIDLVYGGGSIGLMGLVSQAV  66

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+PRE+TG+TVGE+KAVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  67   HDGGRHVIGVIPKTLMPRELTGQTVGELKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  126

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI P+AR I  SAP AKEL+
Sbjct  127  LLEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIDPSARNIIASAPTAKELV  186

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHE VA K  WE DQL+Y
Sbjct  187  MKLEEYVPCHEGVAPKLSWEIDQLDY  212



>gb|KFK36610.1| hypothetical protein AALP_AA4G145900 [Arabis alpina]
Length=215

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKFKRICVFCGSS GKK+SY++AAI+LG ELVS++IDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFKRICVFCGSSQGKKSSYQDAAIDLGNELVSKSIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFIS NAR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISTNAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHE VA+K  WE +++ Y
Sbjct  186  KKLEEYAPCHEMVATKLCWEMERIGY  211



>ref|XP_003590484.1| hypothetical protein MTR_1g064260 [Medicago truncatula]
 gb|AES60735.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
Length=219

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKR+CVFCGSSPGKK+SY++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  7    IRVSKFKRVCVFCGSSPGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP +KEL+ +
Sbjct  127  EVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKK  186

Query  712  LEEYNPCHERVASKQKWEKDQ  774
            LE+Y PCHE VASK  W+ +Q
Sbjct  187  LEDYVPCHEGVASKLSWQMEQ  207



>ref|XP_004487095.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Cicer arietinum]
Length=209

 Score =   357 bits (917),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPG K SYK+AAIELG+ELVSRNIDLVYGGGSIGLMGL+SQAV+N
Sbjct  7    MKLSKFKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVHN  66

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMA++SDAFIALPGGYGTLEELL
Sbjct  67   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELL  126

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNS L+FIDKAVEEGFISP AR I VSAP  K+L+  
Sbjct  127  EVITWAQLGIHDKPVGLLNVDGYYNSFLSFIDKAVEEGFISPTARHIIVSAPTPKDLVKN  186

Query  712  LEEYNPCHERVASKQKWEKDQLN  780
            +EEY P HERVASK  WE +QL+
Sbjct  187  MEEYFPQHERVASKLSWESEQLD  209



>ref|XP_002529933.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF32441.1| carboxy-lyase, putative [Ricinus communis]
Length=218

 Score =   358 bits (918),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 190/213 (89%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV KE   ++ SKFKRICVFCGSSPGKK SYK+AAIELGKELV+RNIDLVYGGGSIGLM
Sbjct  1    MEVEKE---MRVSKFKRICVFCGSSPGKKTSYKDAAIELGKELVARNIDLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GL+SQAVY GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPG
Sbjct  58   GLISQAVYEGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYN+LL+FIDKAVEEGFI+P AR I VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNTLLSFIDKAVEEGFINPTARHIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P  KEL+ ++EEY P HE VA K  WE +QL Y
Sbjct  178  PTPKELVKKMEEYFPRHEIVAPKLNWENEQLGY  210



>ref|XP_007162751.1| hypothetical protein PHAVU_001G177400g [Phaseolus vulgaris]
 gb|ESW34745.1| hypothetical protein PHAVU_001G177400g [Phaseolus vulgaris]
Length=219

 Score =   358 bits (918),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKF RICVFCGSSPGKK+SY++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  10   SKFNRICVFCGSSPGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  69

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI
Sbjct  70   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  129

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL+ +LE+
Sbjct  130  TWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLED  189

Query  721  YNPCHERVASKQKWEKDQ  774
            Y PCHE VASK  W+ +Q
Sbjct  190  YVPCHEGVASKLSWQIEQ  207



>ref|XP_004497512.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cicer arietinum]
Length=220

 Score =   357 bits (917),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            SKFKR+CVFCGSSPGKK+SY++AAI+LG ELVSRNIDLVYGGGSIGLMGLVSQAV++GGR
Sbjct  11   SKFKRVCVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGR  70

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI
Sbjct  71   HVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  130

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP +KEL+ +LE+
Sbjct  131  TWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKKLED  190

Query  721  YNPCHERVASKQKWEKDQ  774
            Y PCHE VASK  W+ +Q
Sbjct  191  YVPCHEGVASKLSWQMEQ  208



>ref|XP_009141638.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Brassica rapa]
Length=210

 Score =   357 bits (916),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKFKRICVFCGSS GKK+SY++AA++LG ELVSR IDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFKRICVFCGSSQGKKSSYQDAAVDLGNELVSRKIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VS P AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSEPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQ  774
             +LEEY PCHE VASK  WE ++
Sbjct  186  KKLEEYAPCHESVASKLCWEMER  208



>ref|XP_010414556.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X2 [Camelina sativa]
 ref|XP_010470105.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X2 [Camelina sativa]
Length=213

 Score =   357 bits (916),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    EPKFKRICVFCGSSAGNKASYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FID AVEEGFISP AR I VSAP+AKEL+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDTAVEEGFISPTARHIIVSAPSAKELVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            +Y P HE+VASK+ WE +Q+
Sbjct  184  DYVPRHEKVASKKSWEMEQI  203



>ref|XP_010920460.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Elaeis guineensis]
Length=218

 Score =   357 bits (917),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME  KE   + QSKFKRICVFCGSS GKK SY++AAIELGKELVSRNIDLVYGGGS+GLM
Sbjct  1    MERDKE---MNQSKFKRICVFCGSSQGKKRSYQDAAIELGKELVSRNIDLVYGGGSVGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVY+GGRHV+GVIPKTL+P EITGETVGEVKAVADMHQRKAEMA+ SDAFIALPG
Sbjct  58   GLVSQAVYDGGRHVIGVIPKTLMPPEITGETVGEVKAVADMHQRKAEMARQSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI P+AR I VSA
Sbjct  118  GYGTLEELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIKPSARHIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY P HERVA K  WE +QL +
Sbjct  178  PTAKELVKKLEEYFPRHERVAPKPNWEMEQLGH  210



>ref|XP_011013920.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X2 [Populus euphratica]
Length=224

 Score =   357 bits (917),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 189/212 (89%), Gaps = 4/212 (2%)
 Frame = +1

Query  160  EKEALQQ----SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            E   LQQ    SKFKRICVFCGSS GKK SY+ AAI+LG ELVSRNIDLVYGGGSIGLMG
Sbjct  5    ETTTLQQQSMSSKFKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMG  64

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            L+SQAV++GGRHV+GVIPKTL+  E+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG
Sbjct  65   LISQAVHDGGRHVIGVIPKTLMRPELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  124

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR I VSAP
Sbjct  125  YGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARNIIVSAP  184

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
             AKEL+ +LEEY PCHERVASK  WE +QL +
Sbjct  185  TAKELVKKLEEYVPCHERVASKLSWEIEQLGH  216



>gb|KEH17130.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
 gb|AES81854.2| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
Length=220

 Score =   357 bits (917),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPGKK +Y++AA+ LG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  8    IKLSKFKRICVFCGSSPGKKTTYQDAAMNLGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  67

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  68   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  127

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL+ +
Sbjct  128  EVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKK  187

Query  712  LEEYNPCHERVASKQKWEKDQ  774
            LEEY PCHE VASK  W+ +Q
Sbjct  188  LEEYVPCHEGVASKLSWQMEQ  208



>ref|XP_010510645.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Camelina sativa]
Length=213

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    EPKFKRICVFCGSSAGNKASYKDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FID AVEEGFISP AR I VSAP+AKEL+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDTAVEEGFISPTARHIIVSAPSAKELVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            +Y P HE+VASK+ WE +Q+
Sbjct  184  DYVPRHEKVASKKSWEMEQI  203



>gb|KFK27249.1| hypothetical protein AALP_AA8G357400 [Arabis alpina]
Length=213

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  184  KFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRH  363
            KFKRICVFCGSS G K SY++AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAVYNGGRH
Sbjct  6    KFKRICVFCGSSAGNKTSYRDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVYNGGRH  65

Query  364  VLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIA  543
            V+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI 
Sbjct  66   VIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIT  125

Query  544  WAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEY  723
            WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI P AR I VSAP+AKEL+ +LEEY
Sbjct  126  WAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIIPTARHIIVSAPSAKELVKKLEEY  185

Query  724  NPCHERVASKQKWEKDQL  777
             P HE+VASK+ WE +Q+
Sbjct  186  VPRHEKVASKKSWEMEQI  203



>ref|XP_009103669.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Brassica rapa]
Length=247

 Score =   358 bits (919),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            K+KE   + KFKRICVFCGSS G K SY++AAIELG ELVS+NIDLVYGGGSIGLMGL+S
Sbjct  31   KDKEMEVEPKFKRICVFCGSSAGNKTSYRDAAIELGAELVSKNIDLVYGGGSIGLMGLIS  90

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVYNGGRHV+GVIPKTL+P+EITGETVGEVKAVADMH+RKAEMAKHSDAFIALPGGYGT
Sbjct  91   QAVYNGGRHVIGVIPKTLMPKEITGETVGEVKAVADMHERKAEMAKHSDAFIALPGGYGT  150

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFI+P AR I VSAP+AK
Sbjct  151  LEELLEVITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFITPTARHIIVSAPSAK  210

Query  697  ELMNELEEYNPCHERVASKQKWEKDQL  777
            +L+ +LEEY P HE+VASK+ WE +Q+
Sbjct  211  DLVKKLEEYVPRHEKVASKKSWEMEQI  237



>ref|XP_006292903.1| hypothetical protein CARUB_v10019168mg [Capsella rubella]
 gb|EOA25801.1| hypothetical protein CARUB_v10019168mg [Capsella rubella]
Length=215

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELV RNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARKIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AK+L+ +LEEY+PCHE VA+K  WE +++ Y
Sbjct  179  PTAKDLVKKLEEYSPCHESVATKLCWEIERIGY  211



>ref|XP_010906515.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X3 [Elaeis guineensis]
Length=218

 Score =   357 bits (915),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++SKFKRICVFCGSS GKK SY++AA+ELGKELVS NIDLVYGGGS+GLMGLVSQAV++G
Sbjct  8    RRSKFKRICVFCGSSQGKKRSYQDAAVELGKELVSGNIDLVYGGGSVGLMGLVSQAVHDG  67

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELLE
Sbjct  68   GRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLE  127

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+PNAR I VSAP AKEL+ +L
Sbjct  128  VITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPNARHIIVSAPTAKELVKKL  187

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HERVASK  WE ++L Y
Sbjct  188  EEYFPRHERVASKLNWEMERLGY  210



>ref|XP_003625636.1| hypothetical protein MTR_7g101290 [Medicago truncatula]
 gb|ABD32794.1| Conserved hypothetical protein 730 [Medicago truncatula]
Length=260

 Score =   358 bits (919),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKFKRICVFCGSSPGKK +Y++AA+ LG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  8    IKLSKFKRICVFCGSSPGKKTTYQDAAMNLGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  67

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  68   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  127

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL+ +
Sbjct  128  EVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKK  187

Query  712  LEEYNPCHERVASKQKWEKDQ  774
            LEEY PCHE VASK  W+ +Q
Sbjct  188  LEEYVPCHEGVASKLSWQMEQ  208



>ref|XP_006409853.1| hypothetical protein EUTSA_v10017171mg [Eutrema salsugineum]
 gb|ESQ51306.1| hypothetical protein EUTSA_v10017171mg [Eutrema salsugineum]
Length=241

 Score =   357 bits (917),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  184  KFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRH  363
            KFKRICVFCGSS G K SY++AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAVYNGGRH
Sbjct  34   KFKRICVFCGSSAGNKTSYRDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVYNGGRH  93

Query  364  VLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIA  543
            V+GVIPKTL+P+EITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI 
Sbjct  94   VIGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIT  153

Query  544  WAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEY  723
            WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFISP AR I VSAP+AK+L+ +LEEY
Sbjct  154  WAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKDLVKKLEEY  213

Query  724  NPCHERVASKQKWEKDQL  777
             P HE+VASK+ WE +Q+
Sbjct  214  VPRHEKVASKKSWEMEQI  231



>ref|XP_002877920.1| hypothetical protein ARALYDRAFT_348439 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54179.1| hypothetical protein ARALYDRAFT_348439 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   356 bits (914),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELV RNIDLVYGGGSIGLMGLVSQAV
Sbjct  7    ETMQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAV  66

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+PRE+TGETVGEV+AVA MHQRKAEMA+HSDAFIALPGGYGTLEE
Sbjct  67   HDGGRHVIGVIPKTLMPRELTGETVGEVRAVAGMHQRKAEMARHSDAFIALPGGYGTLEE  126

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFIS NARQI +SAP AKEL+
Sbjct  127  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISTNARQIIISAPTAKELV  186

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY+PCHE VA+K  WE +++ Y
Sbjct  187  KKLEEYSPCHESVATKLCWEIERIGY  212



>emb|CDX77168.1| BnaC04g39630D [Brassica napus]
Length=213

 Score =   356 bits (913),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SY++AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAVYNGG
Sbjct  4    EPKFKRICVFCGSSAGNKTSYRDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVYNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+P+EITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FID AVEEGFISP AR I VSAP+AK+L+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDNAVEEGFISPTARHIIVSAPSAKDLVMKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P HE+VASK+ WE +Q+
Sbjct  184  EYVPRHEKVASKKSWEMEQI  203



>ref|XP_009140853.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Brassica rapa]
 emb|CDY30498.1| BnaA04g16350D [Brassica napus]
Length=213

 Score =   356 bits (913),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SY++AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAVYNGG
Sbjct  4    EPKFKRICVFCGSSAGNKTSYRDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVYNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+P+EITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FID AVEEGFISP AR I VSAP+AK+L+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDNAVEEGFISPTARHIIVSAPSAKDLVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P HE+VASK+ WE +Q+
Sbjct  184  EYVPRHEKVASKKSWEIEQI  203



>gb|KHN09504.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
Length=219

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +  ++ SKFKRICVFCGSSPGKK++Y++AAIELG ELVSRNIDLVYGGGSIGLMGLVSQ 
Sbjct  4    RSEMRHSKFKRICVFCGSSPGKKSTYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQD  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GG HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE
Sbjct  64   VHDGGHHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQ  774
            + +LE+Y PCHE VASK  W+ +Q
Sbjct  184  VKKLEDYVPCHEGVASKLSWQIEQ  207



>ref|XP_010031982.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Eucalyptus grandis]
 gb|KCW51376.1| hypothetical protein EUGRSUZ_J00920 [Eucalyptus grandis]
Length=216

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 1/208 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            EKE  +QSKFKRICVFCGSS GKK+SY +AA+ELG+ELVSRNIDLVYGGGSIGLMGLVS+
Sbjct  2    EKET-KQSKFKRICVFCGSSQGKKSSYTDAALELGRELVSRNIDLVYGGGSIGLMGLVSR  60

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
            AVYNGGRHV+GVIPKTL+PRE+TGETVGEVK VA+MHQRKAEMA+HSDAFIALPGGYGTL
Sbjct  61   AVYNGGRHVIGVIPKTLMPRELTGETVGEVKPVANMHQRKAEMARHSDAFIALPGGYGTL  120

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P+AR I VS+P+AK+
Sbjct  121  EELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSSPSAKD  180

Query  700  LMNELEEYNPCHERVASKQKWEKDQLNY  783
            L+ ++EEY P HERVASK  WE +QL +
Sbjct  181  LVKKMEEYFPRHERVASKLNWETEQLGH  208



>ref|XP_003606367.1| hypothetical protein MTR_4g058740 [Medicago truncatula]
 gb|AES88564.1| lysine decarboxylase family protein [Medicago truncatula]
Length=209

 Score =   355 bits (912),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  187  FKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHV  366
            FKRICVFCGSSPG K+SYK+AAIELG ELVSRNIDLVYGGGSIGLMGLVSQAV +GGRHV
Sbjct  12   FKRICVFCGSSPGNKSSYKDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVSDGGRHV  71

Query  367  LGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  546
            +GVIP+TL+PREITGETVGEVKAVA MHQRKAEMAKHSDAFIALPGGYGTLEELLEVI W
Sbjct  72   IGVIPRTLMPREITGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  547  AQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYN  726
            AQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR I VSAP+ KEL+ ++EEY+
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSAPSTKELVKKMEEYS  191

Query  727  PCHERVASKQKWEKDQLN  780
            P HERVASKQ WE  +L+
Sbjct  192  PQHERVASKQSWETGKLD  209



>emb|CDX91344.1| BnaC04g08060D [Brassica napus]
Length=199

 Score =   355 bits (911),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            +Q S+FKRICVFCGSS GKK+SY++AA+ELG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  1    MQMSRFKRICVFCGSSQGKKSSYQDAAVELGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+G+IPKTL+P+E+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  61   GGRHVIGIIPKTLMPKELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+ +
Sbjct  121  EVITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKK  180

Query  712  LEEYNPCHERVASKQKWE  765
            LEEY PCHE VASK  WE
Sbjct  181  LEEYAPCHESVASKLCWE  198



>ref|XP_004493974.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Cicer arietinum]
Length=220

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++  KFKRICVFCGSS GKK+SY++AAI+LG ELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  8    IRHPKFKRICVFCGSSQGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHD  67

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  68   GGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  127

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGL+NV+GY+NSLL+FIDKAVEEGFISPNAR I VSAP AKEL+ +
Sbjct  128  EVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKK  187

Query  712  LEEYNPCHERVASKQKWEKDQ  774
            LEEY PCHE VASK  W+ +Q
Sbjct  188  LEEYVPCHEGVASKLSWQMEQ  208



>emb|CDX79722.1| BnaC03g20580D [Brassica napus]
Length=206

 Score =   355 bits (911),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKFKRICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFKRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWE  765
             +LEEY PC E V SK  WE
Sbjct  186  KKLEEYAPCRESVTSKLCWE  205



>emb|CDX71364.1| BnaC04g15990D [Brassica napus]
Length=213

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFK+ICVFCGSS G K SY++AAIELG ELVS+NIDLVYGGGSIGLMGL+SQAVYNGG
Sbjct  4    EPKFKKICVFCGSSAGNKTSYRDAAIELGAELVSKNIDLVYGGGSIGLMGLISQAVYNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+P+EITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFI+P AR I VSAP+AK+L+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFITPTARHIIVSAPSAKDLVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P HE+VASK+ WE +Q+
Sbjct  184  EYVPRHEKVASKKSWEMEQI  203



>ref|XP_011077347.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Sesamum indicum]
Length=219

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +1

Query  160  EKEA-LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            EKE+ ++ SKFKRICVFCGSS GKK+SY+EAA++LG  LVSRNIDLVYGGGSIGLMGLVS
Sbjct  2    EKESEVKASKFKRICVFCGSSQGKKSSYQEAAVQLGNVLVSRNIDLVYGGGSIGLMGLVS  61

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT
Sbjct  62   QAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  121

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNAR I VSAP A 
Sbjct  122  LEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAT  181

Query  697  ELMNELEEYNPCHERVASKQKWEKDQ  774
            EL+ +LEEY P HERVA K  WE +Q
Sbjct  182  ELVKKLEEYVPRHERVAPKLSWEMEQ  207



>emb|CDY04551.1| BnaA07g13770D [Brassica napus]
Length=213

 Score =   355 bits (910),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SY++AAIELG ELVS+NIDLVYGGGSIGLMGL+SQAVYNGG
Sbjct  4    EPKFKRICVFCGSSAGNKTSYRDAAIELGAELVSKNIDLVYGGGSIGLMGLISQAVYNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+P+EITGETVGEVKAVADMH+RKAEMAKHSDAFIALPGGYGTLEELLEV
Sbjct  64   RHVIGVIPKTLMPKEITGETVGEVKAVADMHERKAEMAKHSDAFIALPGGYGTLEELLEV  123

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAVEEGFI+P AR I VSAP+AK+L+ +LE
Sbjct  124  ITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFITPTARHIIVSAPSAKDLVKKLE  183

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P HE+VASK+ WE +Q+
Sbjct  184  EYVPRHEKVASKKSWEMEQI  203



>ref|XP_010043764.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Eucalyptus grandis]
 gb|KCW85757.1| hypothetical protein EUGRSUZ_B02514 [Eucalyptus grandis]
Length=215

 Score =   354 bits (909),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E  Q SKFK ICVFCGSS GKK+SYK+AAIELGKELVSRNIDLVYGGGSIGLMGLVSQ V
Sbjct  2    ETKQSSKFKSICVFCGSSQGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQVV  61

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            YNGGRHV+GVIPKTL+P EITGETVGEVKAVADMH+RKAEMA+ SDAFIALPGGYGTLEE
Sbjct  62   YNGGRHVIGVIPKTLMPPEITGETVGEVKAVADMHERKAEMARRSDAFIALPGGYGTLEE  121

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVG+LNV+GYYN LL FIDKAVEEGFI PNAR I V+APNAK+L+
Sbjct  122  LLEVITWAQLGIHDKPVGMLNVDGYYNPLLQFIDKAVEEGFIRPNARHIIVTAPNAKDLI  181

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
              +EEY P HERVA K  WE +QL Y
Sbjct  182  KRMEEYYPRHERVAPKLSWEMEQLTY  207



>ref|XP_010515835.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4 [Camelina sativa]
Length=215

 Score =   354 bits (909),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS GKK+SY++AA++LG ELV RNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETIQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+P+E+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPKELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFISP ARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AK+L+ +LEEY+PCHE VA+K  WE +++ Y
Sbjct  179  PTAKDLVKKLEEYSPCHEIVATKLCWEIERIGY  211



>ref|XP_009133130.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 ref|XP_009133131.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 ref|XP_009133132.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 ref|XP_009133133.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 emb|CDY46763.1| BnaA03g17070D [Brassica napus]
Length=206

 Score =   353 bits (907),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E +Q+SKFKRICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ETMQKSKFKRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+GVIPKTL+P+E+TGETVGEV+AV  MHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGVIPKTLMPKELTGETVGEVRAVTGMHQRKAEMAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAPNAKEL+
Sbjct  126  LLEVITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPNAKELV  185

Query  706  NELEEYNPCHERVASKQKWE  765
             +LEEY PCHE V SK  WE
Sbjct  186  KKLEEYAPCHESVTSKLCWE  205



>ref|XP_010426993.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like isoform X2 [Camelina sativa]
Length=215

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS G ++SY++AA++LG ELV RNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETMQKSKFGRICVFCGSSQGNRSSYQDAAVDLGNELVLRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFISP ARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AK+L+ +LEEY+PCHE VA+K  WE +++ Y
Sbjct  179  PTAKDLVKKLEEYSPCHEIVATKLCWEIERIGY  211



>emb|CDP06745.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++SKF RICVFCGSS GKK SY++AAIELG+ELVSRNIDLVYGGGSIGLMGLVSQAV+NG
Sbjct  8    KESKFGRICVFCGSSQGKKTSYQDAAIELGRELVSRNIDLVYGGGSIGLMGLVSQAVHNG  67

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHVLGVIPKTL+PRE+TGE VGEVKAVADMHQRKAEMA++SDAFIALPGGYGTLEELLE
Sbjct  68   GRHVLGVIPKTLMPRELTGEPVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLE  127

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR I VSAP A+EL+ +L
Sbjct  128  VITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPTAQELVKKL  187

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HE VASK  WE +QL Y
Sbjct  188  EEYVPRHEGVASKLSWEMEQLGY  210



>gb|AFK40158.1| unknown [Lotus japonicus]
Length=222

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME     E    SKFKR+CVFCGSSPGKK SY++AAIELG ELVSR+IDLVYGGGSIGLM
Sbjct  1    METTHSSEMRVVSKFKRVCVFCGSSPGKKRSYQDAAIELGNELVSRSIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  61   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGL++V+GY+NSLL+FIDKAVEEGFISPNAR I VSA
Sbjct  121  GYGTLEELLEVITWAQLGIHDKPVGLVDVDGYFNSLLSFIDKAVEEGFISPNARDIIVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQ  774
            P AKEL+ +LE+Y PCHE  A K  W+ +Q
Sbjct  181  PTAKELVKKLEDYVPCHEGDALKLSWQMEQ  210



>ref|XP_006846812.1| hypothetical protein AMTR_s00148p00076970 [Amborella trichopoda]
 gb|ERN08393.1| hypothetical protein AMTR_s00148p00076970 [Amborella trichopoda]
Length=218

 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 189/213 (89%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME  KE   ++QSKFKRICVFCGSS GKK+SY+ AA+ELG ELVS NIDLVYGGGS+GLM
Sbjct  1    MERDKE---MKQSKFKRICVFCGSSQGKKSSYQAAAVELGNELVSMNIDLVYGGGSVGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV+ GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPG
Sbjct  58   GLVSQAVHEGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI+P AR I VSA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPAARHIIVSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY P HE VASK  WE +QL Y
Sbjct  178  PTAKELVKKLEEYFPRHEGVASKLSWEMEQLGY  210



>ref|XP_004976245.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6-like [Setaria italica]
Length=255

 Score =   353 bits (907),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +1

Query  169  ALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY  348
            ++  S+F+RICVFCGSS GKK SY++AA+ELG+ELVSRNIDLVYGGGS+GLMGLVS+AVY
Sbjct  26   SMATSRFRRICVFCGSSQGKKKSYQDAAVELGEELVSRNIDLVYGGGSVGLMGLVSRAVY  85

Query  349  NGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEEL  528
            NGGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEEL
Sbjct  86   NGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEEL  145

Query  529  LEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMN  708
            LEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP AR I V AP  KEL++
Sbjct  146  LEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPTARHIIVLAPTPKELLD  205

Query  709  ELEEYNPCHERVASKQKWEKDQLNY  783
            +LEEY+P HE+V  K KWE +QL+Y
Sbjct  206  KLEEYSPRHEKVVPKMKWEVEQLSY  230



>ref|XP_010504107.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like [Camelina sativa]
Length=215

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    + +Q+SKF RICVFCGSS G ++SY++AA++LG ELV RNIDLVYGGGSIGLM
Sbjct  1    MEV--NTKTMQKSKFGRICVFCGSSQGNRSSYQDAAVDLGNELVLRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFISP ARQI +SA
Sbjct  119  GYGTLEELLEVITWAQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARQIIISA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AK+L+ +LEEY+PCHE VA+K  WE +++ Y
Sbjct  179  PTAKDLVKKLEEYSPCHEIVATKLCWEIERIGY  211



>ref|NP_001053328.1| Os04g0518800 [Oryza sativa Japonica Group]
 sp|Q0JBP5.1|LOGL6_ORYSJ RecName: Full=Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6; AltName: Full=Protein LONELY GUY-like 
6 [Oryza sativa Japonica Group]
 dbj|BAF15242.1| Os04g0518800 [Oryza sativa Japonica Group]
Length=250

 Score =   353 bits (906),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            E  AL QS+F+RICVFCGSS GKK SY++AA+ELGKELV+RNIDLVYGGGS+GLMGLVSQ
Sbjct  18   EAMALLQSRFRRICVFCGSSQGKKKSYQDAAVELGKELVARNIDLVYGGGSVGLMGLVSQ  77

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
            AVYNGGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTL
Sbjct  78   AVYNGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTL  137

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP+AR I V AP  KE
Sbjct  138  EELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPSARHIIVLAPTPKE  197

Query  700  LMNELEEYNPCHERVASKQKWEKDQLNY  783
            L+ +LE Y+P H++V  K +WE ++++Y
Sbjct  198  LLEKLEAYSPRHDKVVPKMQWEMEKMSY  225



>ref|XP_004304438.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Fragaria vesca subsp. vesca]
Length=219

 Score =   352 bits (902),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++ SKF+RICVFCGSS GKK SY++AA ELGKELVSRNIDLVYGGGSIGLMGLVSQAV++
Sbjct  8    MKLSKFRRICVFCGSSQGKKTSYQDAATELGKELVSRNIDLVYGGGSIGLMGLVSQAVHD  67

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+PRE+TG T GEVKAVA MHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  68   GGRHVIGVIPKTLMPRELTGVTPGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELL  127

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVIAWAQLGIHDKPVGLLNV+GYYNSLL+FID AVEEGFISP+AR I +SAP A EL+ +
Sbjct  128  EVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDSAVEEGFISPDARHIIISAPTAMELVKK  187

Query  712  LEEYNPCHERVASKQKWEKDQL  777
            LE+Y PCHERVASK  WE  QL
Sbjct  188  LEDYVPCHERVASKSNWEMAQL  209



>emb|CAE05626.1| OSJNBb0061C13.8 [Oryza sativa Japonica Group]
 gb|EEE61351.1| hypothetical protein OsJ_15484 [Oryza sativa Japonica Group]
Length=231

 Score =   352 bits (903),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +1

Query  169  ALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY  348
            AL QS+F+RICVFCGSS GKK SY++AA+ELGKELV+RNIDLVYGGGS+GLMGLVSQAVY
Sbjct  2    ALLQSRFRRICVFCGSSQGKKKSYQDAAVELGKELVARNIDLVYGGGSVGLMGLVSQAVY  61

Query  349  NGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEEL  528
            NGGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEEL
Sbjct  62   NGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEEL  121

Query  529  LEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMN  708
            LEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP+AR I V AP  KEL+ 
Sbjct  122  LEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPSARHIIVLAPTPKELLE  181

Query  709  ELEEYNPCHERVASKQKWEKDQLNY  783
            +LE Y+P H++V  K +WE ++++Y
Sbjct  182  KLEAYSPRHDKVVPKMQWEMEKMSY  206



>ref|XP_008791568.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Phoenix dactylifera]
Length=218

 Score =   351 bits (901),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            +EKE + QSKFKRICVFCGSS GKK SY++AAIELGKELVSRNIDLVYGGGS+GLMGLVS
Sbjct  3    REKE-MNQSKFKRICVFCGSSQGKKRSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVS  61

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVY+GGRHV+GVIPKTL+P EITGETVGEVK VADMHQRKAEMA+ SDAFIALPGGYGT
Sbjct  62   QAVYDGGRHVIGVIPKTLMPPEITGETVGEVKPVADMHQRKAEMARQSDAFIALPGGYGT  121

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFI P+AR I VSAP AK
Sbjct  122  LEELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIMPSARHIIVSAPTAK  181

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLNY  783
            EL+ +LE Y P HERVA K  WE + L +
Sbjct  182  ELVKKLEVYFPRHERVAPKPNWEMEHLGH  210



>ref|XP_009143522.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Brassica rapa]
Length=206

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  EK  +Q S+FKRICVFCGSS GKK+SY++AA+ELG ELVSR I+LVYGGGSIG+M
Sbjct  1    MEITAEK--MQISRFKRICVFCGSSQGKKSSYQDAAVELGNELVSRKIELVYGGGSIGVM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPG  118

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFIS  AR+I VSA
Sbjct  119  GYGTLEELLEVITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISTTAREIIVSA  178

Query  685  PNAKELMNELEEYNPCHERVASKQKWE  765
            P AKEL+ +LEEY PCHE VASK  WE
Sbjct  179  PTAKELVKKLEEYAPCHESVASKLCWE  205



>ref|XP_007016778.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
 gb|EOY34397.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
Length=250

 Score =   352 bits (903),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 194/243 (80%), Gaps = 31/243 (13%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV  + E ++QSKFK ICVFCGSSPGKK+SY+EA IELG+ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEVEMDME-MKQSKFKSICVFCGSSPGKKSSYREATIELGRELVSRNIDLVYGGGSIGLM  59

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP-  501
            GL+SQAV++GGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALP 
Sbjct  60   GLISQAVFDGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPG  119

Query  502  -----------------------------GGYGTLEELLEVIAWAQLGIHDKPVGLLNVE  594
                                         GGYGTLEELLEVI WAQLGIHDKPVGLLNV+
Sbjct  120  WYKTPKVLLFINLSMGTLRLGAFSWTTSVGGYGTLEELLEVITWAQLGIHDKPVGLLNVD  179

Query  595  GYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQ  774
            GYYNSLL+FIDKAVEEGFI PNAR I VSAP AKEL+ ++EEY P HERVASK  WE +Q
Sbjct  180  GYYNSLLSFIDKAVEEGFICPNARHIIVSAPTAKELVKKMEEYEPQHERVASKLSWEMEQ  239

Query  775  LNY  783
            L Y
Sbjct  240  LGY  242



>ref|NP_001189696.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Arabidopsis thaliana]
 gb|AEC09368.1| protein LONELY GUY 3 [Arabidopsis thaliana]
Length=239

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 193/230 (84%), Gaps = 24/230 (10%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E++Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ESMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP--------  501
            ++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALP        
Sbjct  66   HDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPEENNLVKL  125

Query  502  ----------------GGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKA  633
                             GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKA
Sbjct  126  KNMLSWSSCSVKATLKSGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKA  185

Query  634  VEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            VEEGFISP AR+I VSAP AKEL+ +LEEY PCHERVA+K  WE +++ Y
Sbjct  186  VEEGFISPTAREIIVSAPTAKELVKKLEEYAPCHERVATKLCWEMERIGY  235



>ref|XP_002446792.1| hypothetical protein SORBIDRAFT_06g022780 [Sorghum bicolor]
 gb|EES11120.1| hypothetical protein SORBIDRAFT_06g022780 [Sorghum bicolor]
Length=259

 Score =   351 bits (901),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  184  KFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRH  363
            +F+RICVFCGSS GKK +Y++AA+ELG+ELVSRNIDLVYGGGS+GLMGLVS+AVYNGGRH
Sbjct  34   RFRRICVFCGSSQGKKKTYQDAAVELGQELVSRNIDLVYGGGSVGLMGLVSRAVYNGGRH  93

Query  364  VLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIA  543
            V+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELLEVIA
Sbjct  94   VIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIA  153

Query  544  WAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEY  723
            WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP AR I V AP  KEL+++LEEY
Sbjct  154  WAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPTARHIIVLAPTPKELLDKLEEY  213

Query  724  NPCHERVASKQKWEKDQLNY  783
            +P HE+V  K KWE +QL+Y
Sbjct  214  SPQHEKVVPKTKWEMEQLSY  233



>dbj|BAG70979.1| putative lysine decarboxylase [Musa balbisiana]
Length=218

 Score =   349 bits (896),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            +QSKF+RICVFCGSS GKK SY++AA+ELGKELVSR+IDLVYGGGS+GLMGLVSQAV++G
Sbjct  8    RQSKFRRICVFCGSSQGKKRSYQDAAVELGKELVSRSIDLVYGGGSVGLMGLVSQAVHDG  67

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIP+ L+P EI+GETVGEVKAVADMHQRKAEMA++SDAFIALPGGYGTLEELLE
Sbjct  68   GRHVIGVIPRILMPPEISGETVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLE  127

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNVEGYYNSLL+FID+AVEEGFISP+AR I VSAP  KEL+  L
Sbjct  128  VITWAQLGIHDKPVGLLNVEGYYNSLLSFIDQAVEEGFISPSARHIVVSAPTVKELVKML  187

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HERVASK  WE +QL Y
Sbjct  188  EEYFPRHERVASKLNWEMEQLGY  210



>sp|B9F166.1|LOGL2_ORYSJ RecName: Full=Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2; AltName: Full=Protein LONELY GUY-like 
2 [Oryza sativa Japonica Group]
 gb|EEE57408.1| hypothetical protein OsJ_07599 [Oryza sativa Japonica Group]
Length=244

 Score =   350 bits (898),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  148  EVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            E   E   + QS+F+R+CVFCGSS GKK  Y++AAIELGKELV+RNIDLVYGGGS+GLMG
Sbjct  7    ETTAEVAMVVQSRFRRVCVFCGSSHGKKKIYQDAAIELGKELVARNIDLVYGGGSVGLMG  66

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            LVSQAV+NGGRHV+GVIPKTL+PREI+GETVGEVKAV+DMHQRKAEMA+ SDAFIALPGG
Sbjct  67   LVSQAVHNGGRHVIGVIPKTLMPREISGETVGEVKAVSDMHQRKAEMARQSDAFIALPGG  126

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVIAWAQLGIHDKPVGLLNV+GYYN LL+FIDKAVEEGFI P+AR I V AP
Sbjct  127  YGTLEELLEVIAWAQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIRPSARHIIVLAP  186

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
              KEL+ +LEEY+P HE+V SK KWE +Q++Y
Sbjct  187  TPKELIEKLEEYSPQHEKVVSKMKWEMEQMSY  218



>ref|XP_009631261.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana tomentosiformis]
Length=221

 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +1

Query  196  ICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHVLGV  375
            ICVFCGSSPGKKN YKEAAIELG+ELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHVLGV
Sbjct  17   ICVFCGSSPGKKNIYKEAAIELGRELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHVLGV  76

Query  376  IPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWAQL  555
            IP+TL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWA L
Sbjct  77   IPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWAYL  136

Query  556  GIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCH  735
            GIHDKPVGLLNV+GYY+SLLTFIDKAVEE FI PNA QIFVSAPNA EL+N+LE Y P  
Sbjct  137  GIHDKPVGLLNVDGYYDSLLTFIDKAVEEEFICPNAPQIFVSAPNATELLNKLEGYFPSQ  196

Query  736  ERVASKQKWEKDQLN  780
            E V S+  WE ++L+
Sbjct  197  EIVTSRLNWENEELD  211



>ref|XP_004953163.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2-like [Setaria italica]
Length=243

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F+RICVFCGSS GKK SY++AAIELGKELV+RNIDLVYGGGS+GLMGLVSQAVYNGGR
Sbjct  17   SRFRRICVFCGSSHGKKKSYQDAAIELGKELVARNIDLVYGGGSVGLMGLVSQAVYNGGR  76

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PREI+GETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELLEVI
Sbjct  77   HVIGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVI  136

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
            AWAQLGIHDKPVGLLNV+GYYN LL+FIDKAVEEGFI P AR I V AP  KEL+ +LEE
Sbjct  137  AWAQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIKPTARSIIVLAPTPKELIQKLEE  196

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y+P HE +  K KWE +Q++Y
Sbjct  197  YSPQHEEIIPKMKWEMEQVDY  217



>ref|XP_006653604.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6-like [Oryza brachyantha]
Length=252

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            E  AL  S+F+RICVFCGSS GKK SY++AA+ELGKELV+RNIDLVYGGGS+GLMGLVSQ
Sbjct  20   EGMALLPSRFRRICVFCGSSQGKKKSYQDAAVELGKELVARNIDLVYGGGSVGLMGLVSQ  79

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
            AVYNGGRHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTL
Sbjct  80   AVYNGGRHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTL  139

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVIAWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP+AR I V AP  KE
Sbjct  140  EELLEVIAWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPSARHIIVLAPTPKE  199

Query  700  LMNELEEYNPCHERVASKQKWEKDQLNY  783
            L+ +LE Y+P H+ V  K +WE ++L+Y
Sbjct  200  LVEKLEAYSPRHDEVVPKMQWEMEKLSY  227



>ref|XP_006410901.1| hypothetical protein EUTSA_v10017236mg [Eutrema salsugineum]
 gb|ESQ52354.1| hypothetical protein EUTSA_v10017236mg [Eutrema salsugineum]
Length=210

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 192/211 (91%), Gaps = 3/211 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+ K +  +Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEI-KAETMMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  59

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPG
Sbjct  60   GLVSQAVHDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPG  119

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFIS  AR+I VSA
Sbjct  120  GYGTLEELLEVITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISTTARKIIVSA  179

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQL  777
            P AKEL+ +LEEY PCHE V  K  WE +++
Sbjct  180  PTAKELVKKLEEYAPCHESV--KLCWEMERI  208



>gb|EAY86771.1| hypothetical protein OsI_08151 [Oryza sativa Indica Group]
Length=289

 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  148  EVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            E   E   + QS+F+R+CVFCGSS GKK  Y++AAIELGKELV+RNIDLVYGGGS+GLMG
Sbjct  7    ETTAEVAMVVQSRFRRVCVFCGSSHGKKKIYQDAAIELGKELVARNIDLVYGGGSVGLMG  66

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            LVSQAV+NGGRHV+GVIPKTL+PREI+GETVGEVKAV+DMHQRKAEMA+ SDAFIALPGG
Sbjct  67   LVSQAVHNGGRHVIGVIPKTLMPREISGETVGEVKAVSDMHQRKAEMARQSDAFIALPGG  126

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVIAWAQLGIHDKPVGLLNV+GYYN LL+FIDKAVEEGFI P+AR I V AP
Sbjct  127  YGTLEELLEVIAWAQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIRPSARHIIVLAP  186

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
              KEL+ +LEEY+P HE+V SK KWE +Q++Y
Sbjct  187  TPKELIEKLEEYSPQHEKVVSKMKWEMEQMSY  218



>ref|XP_009392159.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Musa acuminata subsp. malaccensis]
Length=218

 Score =   348 bits (892),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++SKF+RICVFCGSS GKK SY++AA+ELGKELVSR+IDLVYGGGS+GLMGLVSQAV++G
Sbjct  8    RRSKFRRICVFCGSSQGKKRSYQDAAVELGKELVSRSIDLVYGGGSVGLMGLVSQAVHDG  67

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHV+GVIP+ L+P EI+GETVGEVKAVADMHQRKAEMA++SDAFIALPGGYGTLEELLE
Sbjct  68   GRHVIGVIPRILMPPEISGETVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLE  127

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIHDKPVGLLNVEGYYNSLL+FID+AVEEGFISP+AR I VSAP  KEL+  L
Sbjct  128  VITWAQLGIHDKPVGLLNVEGYYNSLLSFIDQAVEEGFISPSARHIVVSAPTVKELVKML  187

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P HERVASK  WE +QL Y
Sbjct  188  EEYFPRHERVASKLNWEMEQLGY  210



>ref|XP_006647546.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2-like [Oryza brachyantha]
Length=244

 Score =   348 bits (893),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  148  EVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            E   E   + Q +F+RICVFCGSS GKK SY++AA++LGKELV+RNIDLVYGGGS GLMG
Sbjct  7    ETAAEVAVVVQLRFRRICVFCGSSHGKKKSYQDAAVDLGKELVTRNIDLVYGGGSAGLMG  66

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            LVSQAV++GGRHV+GVIPKTL+PREI+GETVGEVKAVADMHQRKAEMA+ SDAFIALPGG
Sbjct  67   LVSQAVHSGGRHVIGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARQSDAFIALPGG  126

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVIAWAQLGIHDKPVGLLNV+GYYN LL+FIDKAVEEGFI P+AR I V AP
Sbjct  127  YGTLEELLEVIAWAQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIRPSARHIIVLAP  186

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
              KEL+ +LEEY+P HE+V SK KWE +QL+Y
Sbjct  187  TPKELIEKLEEYSPQHEKVVSKMKWEMEQLSY  218



>ref|XP_009775949.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Nicotiana sylvestris]
Length=221

 Score =   347 bits (890),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  196  ICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHVLGV  375
            ICVFCGSSPGKKN YKEAA+ELG+ELVSRNIDLVYGGGSIGLMGLVS AVYNGGRHVLGV
Sbjct  17   ICVFCGSSPGKKNIYKEAAVELGRELVSRNIDLVYGGGSIGLMGLVSHAVYNGGRHVLGV  76

Query  376  IPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWAQL  555
            IPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWA L
Sbjct  77   IPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWAYL  136

Query  556  GIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCH  735
            GIHDKPVGLLNV+GYY+SLL FI+KAVEE FI PNA QIFVSAPNA EL+N+LE Y P  
Sbjct  137  GIHDKPVGLLNVDGYYDSLLKFIEKAVEEEFICPNAPQIFVSAPNATELLNKLEGYFPSQ  196

Query  736  ERVASKQKWEKDQLNY  783
            E V SK KWE ++L+Y
Sbjct  197  EIVTSKLKWENEELDY  212



>emb|CDX78180.1| BnaA09g33750D [Brassica napus]
Length=241

 Score =   347 bits (890),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 195/238 (82%), Gaps = 26/238 (11%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV   K  +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV-NTKTIIQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  59

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            G VSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  60   GFVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  119

Query  505  -------------------------GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNS  609
                                     GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNS
Sbjct  120  GKKHWVKHVVLVRLKLYNVKAILLCGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNS  179

Query  610  LLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            LL+FIDKAVEEGFISP+ARQI +SAP AKEL+ +LEEY+PCHE VASK  WE +++ Y
Sbjct  180  LLSFIDKAVEEGFISPSARQIIISAPTAKELVKKLEEYSPCHESVASKLCWEIERIGY  237



>emb|CDP07095.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   347 bits (889),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 192/229 (84%), Gaps = 16/229 (7%)
 Frame = +1

Query  145  MEVGKEKEA-----LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGG  309
            MEVGKE E       +QSKF +ICVFCGSS GKK SYK+AA ELGKELVSRNI LVYGGG
Sbjct  1    MEVGKETEVEKMKERKQSKFNKICVFCGSSSGKKTSYKDAATELGKELVSRNIGLVYGGG  60

Query  310  SIGLMGLVSQAVYNGGRHVLG-----------VIPKTLLPREITGETVGEVKAVADMHQR  456
            SIGLMGLV+QAVYNGG HVLG           VIP+TL+ REITGETVGEVKAVA+MHQR
Sbjct  61   SIGLMGLVAQAVYNGGCHVLGQRFPSPFFFPQVIPRTLMLREITGETVGEVKAVANMHQR  120

Query  457  KAEMAKHSDAFIALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAV  636
            KAEMA+HSDAFIALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYN LL+F+DKAV
Sbjct  121  KAEMARHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNCLLSFVDKAV  180

Query  637  EEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            EEGF+SPNAR I VSAP A+ELMN+LE+Y P HE VASK  W+ +QL+Y
Sbjct  181  EEGFVSPNARHIIVSAPTARELMNKLEDYFPHHEMVASKLNWDIEQLSY  229



>ref|XP_008669155.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6 [Zea mays]
Length=249

 Score =   347 bits (890),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F+RICVFCGSS G+K SY++AA+ELG+ELVSRNIDLVYGGGS+GLMGLVS+AVYNGGR
Sbjct  21   SRFRRICVFCGSSQGRKKSYQDAAVELGEELVSRNIDLVYGGGSVGLMGLVSRAVYNGGR  80

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELLEVI
Sbjct  81   HVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVI  140

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
            AWAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEE FISP AR I V AP   EL+++LEE
Sbjct  141  AWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPTARHIIVLAPTPNELLDKLEE  200

Query  721  YNPCHERVASKQKWEKDQLN  780
            Y+P HE V  K KWE +QL+
Sbjct  201  YSPRHEEVVPKTKWETEQLS  220



>ref|XP_010426991.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like isoform X1 [Camelina sativa]
 ref|XP_010426992.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like isoform X1 [Camelina sativa]
Length=225

 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 193/223 (87%), Gaps = 12/223 (5%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV    E +Q+SKF RICVFCGSS G ++SY++AA++LG ELV RNIDLVYGGGSIGLM
Sbjct  1    MEV--NTETMQKSKFGRICVFCGSSQGNRSSYQDAAVDLGNELVLRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP-  501
            GLVSQAV++GGRHV+GVIPKTL+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALP 
Sbjct  59   GLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPD  118

Query  502  ---------GGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFIS  654
                     GGYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAVEEGFIS
Sbjct  119  KSLKQFQKKGGYGTLEELLEVITWAQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFIS  178

Query  655  PNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P ARQI +SAP AK+L+ +LEEY+PCHE VA+K  WE +++ Y
Sbjct  179  PTARQIIISAPTAKDLVKKLEEYSPCHEIVATKLCWEIERIGY  221



>ref|XP_011013919.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Populus euphratica]
Length=246

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 189/234 (81%), Gaps = 26/234 (11%)
 Frame = +1

Query  160  EKEALQQ----SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            E   LQQ    SKFKRICVFCGSS GKK SY+ AAI+LG ELVSRNIDLVYGGGSIGLMG
Sbjct  5    ETTTLQQQSMSSKFKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMG  64

Query  328  LVSQAVYNGGRHVLGVIPKTLLPRE----------------------ITGETVGEVKAVA  441
            L+SQAV++GGRHV+GVIPKTL+  E                      +TGETVGEVKAVA
Sbjct  65   LISQAVHDGGRHVIGVIPKTLMRPEASVSQGFCSSDEYIIALSTVCLLTGETVGEVKAVA  124

Query  442  DMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTF  621
            DMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+F
Sbjct  125  DMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSF  184

Query  622  IDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            IDKAVEEGFISP+AR I VSAP AKEL+ +LEEY PCHERVASK  WE +QL +
Sbjct  185  IDKAVEEGFISPSARNIIVSAPTAKELVKKLEEYVPCHERVASKLSWEIEQLGH  238



>ref|XP_010262960.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 isoform X1 [Nelumbo nucifera]
Length=214

 Score =   343 bits (881),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSSPGKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    RSRFKRICVFCGSSPGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGETVGEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGFISP AR I VSAP AK+L+ ELE
Sbjct  125  ITWAQLGIHQKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARCIIVSAPTAKQLVRELE  184

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            EY P ++ + SK  WE ++L+Y
Sbjct  185  EYVPHYDEITSKLVWEVERLSY  206



>ref|XP_003575405.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2 [Brachypodium distachyon]
Length=242

 Score =   344 bits (883),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            K  E +  S+F+RICVFCGSS GKK SY++AAIELGKELVSR IDLVYGGGS+GLMGLVS
Sbjct  8    KAPEVVVPSRFRRICVFCGSSHGKKKSYQDAAIELGKELVSRKIDLVYGGGSVGLMGLVS  67

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVYNGGRHV+GVIPKTL+PREI+GETVGEVKAVADMHQRKAEMA+ SDAFIALPGGYGT
Sbjct  68   QAVYNGGRHVIGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGT  127

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVIAWAQLGIH+KPVGLLNV+GYYN LL FI+KAVEEGFI P A+ I V AP  K
Sbjct  128  LEELLEVIAWAQLGIHNKPVGLLNVDGYYNPLLAFIEKAVEEGFIKPTAQHIIVLAPTPK  187

Query  697  ELMNELEEYNPCHERVASKQKWEKDQLNY  783
            EL+ +LEEY+P HE+V  + KWE +QL+Y
Sbjct  188  ELIEKLEEYSPRHEKVVPQMKWEMEQLSY  216



>emb|CDX74979.1| BnaA05g07250D [Brassica napus]
Length=229

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 190/230 (83%), Gaps = 25/230 (11%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME+  EK  +Q S+FKRICVFCGSS GKK+SY++AA+ELG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEITAEK--MQISRFKRICVFCGSSQGKKSSYQDAAVELGNELVSRNIDLVYGGGSIGLM  58

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+G+IPKTL+PRE+TGETVGEV+AVADMHQRKAEMAKHSDAFIALPG
Sbjct  59   GLVSQAVHDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPG  118

Query  505  -----------------------GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLL  615
                                   GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYNSLL
Sbjct  119  RSKEFGKNMISWSSCSVKATAKSGYGTLEELLEVITWAQLGIHEKPVGLLNVDGYYNSLL  178

Query  616  TFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWE  765
            +FIDKAVEEGFIS  AR+I VSAP AKEL+ +LEEY PCHE VASK  WE
Sbjct  179  SFIDKAVEEGFISTTAREIIVSAPTAKELVKKLEEYAPCHESVASKLCWE  228



>ref|NP_001244912.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG8 
[Solanum lycopersicum]
 dbj|BAM09003.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase-like 
[Solanum lycopersicum]
Length=191

 Score =   340 bits (872),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            +++SKFKRICVFCGSS GKK+ YKEAAIELG+E+VSR IDLVYGGGSIGLMGLVSQ V+N
Sbjct  5    IKESKFKRICVFCGSSAGKKSIYKEAAIELGREIVSRKIDLVYGGGSIGLMGLVSQEVHN  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHVLGVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL
Sbjct  65   GGRHVLGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVIAWA LGIHDKPVGLLNV+GYYNSLLTFIDKAVEEGFI PNA QIFVSAPNAKEL+N+
Sbjct  125  EVIAWAYLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFICPNAPQIFVSAPNAKELLNK  184

Query  712  LEEY  723
            LE Y
Sbjct  185  LEGY  188



>gb|KDP36940.1| hypothetical protein JCGZ_08231 [Jatropha curcas]
Length=222

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME  +++    +S+F R+CVFCGSSPGK  SY+ AAI+LG +LV RNIDLVYGGGSIGLM
Sbjct  1    MENQQQQPPSVKSRFSRVCVFCGSSPGKNPSYQLAAIQLGHQLVERNIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVY+GGRHVLGVIPKTL+PREITGE VGEV+AV+DMHQRKAEMA+ +DAFIALPG
Sbjct  61   GLVSQAVYDGGRHVLGVIPKTLMPREITGEPVGEVRAVSDMHQRKAEMARQADAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P+AR I VSA
Sbjct  121  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIIVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQ  774
            P A+ELM++LEEY P H  VASK  WE +Q
Sbjct  181  PTAQELMSKLEEYEPRHSGVASKLTWEMEQ  210



>ref|XP_002452481.1| hypothetical protein SORBIDRAFT_04g026590 [Sorghum bicolor]
 gb|EES05457.1| hypothetical protein SORBIDRAFT_04g026590 [Sorghum bicolor]
Length=244

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 188/218 (86%), Gaps = 5/218 (2%)
 Frame = +1

Query  145  MEVGKEKEALQQ-----SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGG  309
            ME+  ++EA +      S+F+RICVFCGSS GKK SY++AAIELG ELV+RNIDLVYGGG
Sbjct  1    MEIKVDEEAAEAVAPLPSRFRRICVFCGSSHGKKRSYQDAAIELGNELVARNIDLVYGGG  60

Query  310  SIGLMGLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAF  489
            S+GLMG VSQAVYNGGRHV+GVIPKTL+PREI+GETVGEVKAVADMHQRKAEMA+ SDAF
Sbjct  61   SVGLMGSVSQAVYNGGRHVIGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARQSDAF  120

Query  490  IALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQ  669
            IALPGGYGTLEELLE IAWAQLGIHDKPVGLLNV+GYY+ LL+FIDKAVEEGFI P AR 
Sbjct  121  IALPGGYGTLEELLEAIAWAQLGIHDKPVGLLNVDGYYDPLLSFIDKAVEEGFIKPTARN  180

Query  670  IFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            I + AP  KEL+ +LEEY+P HE +  K KWE +Q++Y
Sbjct  181  IIILAPTPKELIKKLEEYSPQHEEIVPKMKWEVEQVSY  218



>ref|XP_004982851.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10-like isoform X2 [Setaria italica]
Length=206

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +1

Query  169  ALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY  348
             ++QS+FKRICVFCGSS GKK SY +AAIELG ELV+R++DLVYGGGSIGLMGLVSQAVY
Sbjct  2    TMRQSRFKRICVFCGSSQGKKRSYHDAAIELGNELVARSVDLVYGGGSIGLMGLVSQAVY  61

Query  349  NGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEEL  528
            +GGRHV+GVIPKTL+  EI+GETVGEV+ VADMHQRKAEMA+ SDAFIALPGGYGTLEEL
Sbjct  62   DGGRHVIGVIPKTLMTPEISGETVGEVRPVADMHQRKAEMARQSDAFIALPGGYGTLEEL  121

Query  529  LEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMN  708
            LEVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+P+AR+I V AP A+ELM+
Sbjct  122  LEVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMD  181

Query  709  ELEEYNPCHERVASKQKWEKDQLNY  783
            +LEEY P H+RVAS   WE   L Y
Sbjct  182  KLEEYVPYHDRVASTLNWEMGHLGY  206



>ref|XP_002873247.1| carboxy-lyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49506.1| carboxy-lyase [Arabidopsis lyrata subsp. lyrata]
Length=217

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAAI+LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEVKAVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+L+Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRLSY  207



>ref|XP_006288643.1| hypothetical protein CARUB_v10001948mg [Capsella rubella]
 ref|XP_010423360.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Camelina sativa]
 ref|XP_010452555.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Camelina sativa]
 ref|XP_010491186.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Camelina sativa]
 gb|EOA21541.1| hypothetical protein CARUB_v10001948mg [Capsella rubella]
 gb|KFK25030.1| hypothetical protein AALP_AA8G057900 [Arabis alpina]
Length=215

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAAI+LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEVKAVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+L+Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRLSY  207



>ref|XP_010470104.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X1 [Camelina sativa]
Length=246

 Score =   340 bits (872),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 185/233 (79%), Gaps = 33/233 (14%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    EPKFKRICVFCGSSAGNKASYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP------------  501
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP            
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGWFLFVFILSTF  123

Query  502  ---------------------GGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLT  618
                                 GGYGTLEELLEVI WAQLGIHDKPVGLLNVEGYYNSLL+
Sbjct  124  FSFIKILISKKWELTNVGNFVGGYGTLEELLEVITWAQLGIHDKPVGLLNVEGYYNSLLS  183

Query  619  FIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQL  777
            FID AVEEGFISP AR I VSAP+AKEL+ +LE+Y P HE+VASK+ WE +Q+
Sbjct  184  FIDTAVEEGFISPTARHIIVSAPSAKELVKKLEDYVPRHEKVASKKSWEMEQI  236



>ref|XP_010414555.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X1 [Camelina sativa]
Length=246

 Score =   340 bits (871),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 185/233 (79%), Gaps = 33/233 (14%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            + KFKRICVFCGSS G K SYK+AAIELG ELVSRNIDLVYGGGSIGLMGL+SQAV+NGG
Sbjct  4    EPKFKRICVFCGSSAGNKASYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGG  63

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP------------  501
            RHV+GVIPKTL+PREITGETVGEVKAVADMHQRKAEMAKHSDAFIALP            
Sbjct  64   RHVIGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGWFLFVFILSTF  123

Query  502  ---------------------GGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLT  618
                                 GGYGTLEELLEVI WAQLGIHDKPVGLLNVEGYYNSLL+
Sbjct  124  FSFLKILISKKWELTNVGNYVGGYGTLEELLEVITWAQLGIHDKPVGLLNVEGYYNSLLS  183

Query  619  FIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQL  777
            FID AVEEGFISP AR I VSAP+AKEL+ +LE+Y P HE+VASK+ WE +Q+
Sbjct  184  FIDTAVEEGFISPTARHIIVSAPSAKELVKKLEDYVPRHEKVASKKSWEMEQI  236



>ref|NP_001148891.1| carboxy-lyase [Zea mays]
 gb|ACG33313.1| carboxy-lyase [Zea mays]
 tpg|DAA49607.1| TPA: carboxy-lyase [Zea mays]
Length=208

 Score =   338 bits (867),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 183/207 (88%), Gaps = 2/207 (1%)
 Frame = +1

Query  169  ALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY  348
             ++QS+FKRICVFCGSS GKK SY +AA+ELG +LV+R+IDLVYGGGSIGLMGLVSQAVY
Sbjct  2    TMKQSRFKRICVFCGSSQGKKASYHDAAVELGNQLVARSIDLVYGGGSIGLMGLVSQAVY  61

Query  349  NGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEEL  528
             GGRHV+GVIPKTL+  EI+GETVGEV+AVADMHQRKAEMA+ SDAF+ALPGGYGTLEEL
Sbjct  62   GGGRHVIGVIPKTLMTPEISGETVGEVRAVADMHQRKAEMARQSDAFVALPGGYGTLEEL  121

Query  529  LEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMN  708
            LEVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+P+AR+I V AP A+ELM+
Sbjct  122  LEVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMD  181

Query  709  ELEEYNPCHERVASKQKWEK--DQLNY  783
            +LEEY P H+RVAS   WE   D L Y
Sbjct  182  KLEEYEPYHDRVASTLNWETTMDHLAY  208



>ref|XP_003581433.2| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Brachypodium distachyon]
Length=253

 Score =   340 bits (871),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F+RICVFCGSS GKK SY++AA+ELG+ELV+RNIDLVYGGGS+GLMGLVSQAVY+GGR
Sbjct  26   SRFRRICVFCGSSKGKKTSYQDAAVELGQELVARNIDLVYGGGSVGLMGLVSQAVYSGGR  85

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PREITGETVGEVK V DMHQRKAEMA+ SDAFIALPGGYGTLEELLEVI
Sbjct  86   HVIGVIPKTLMPREITGETVGEVKEVGDMHQRKAEMARQSDAFIALPGGYGTLEELLEVI  145

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYN+LL+FIDKAVEEGFI P AR I V AP  KEL+N+LEE
Sbjct  146  TWAQLGIHDKPVGLLNVDGYYNALLSFIDKAVEEGFIKPTARHIIVLAPTPKELLNKLEE  205

Query  721  YNPCHERVASKQKWEKD  771
            Y+P HE V  K KWE +
Sbjct  206  YSPRHEEVVPKMKWETE  222



>ref|XP_007027931.1| Lysine decarboxylase family protein, putative [Theobroma cacao]
 gb|EOY08433.1| Lysine decarboxylase family protein, putative [Theobroma cacao]
Length=215

 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PREITGETVGEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPREITGETVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGFISP AR+I VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            +Y P ++ V SK  W E D+L+Y
Sbjct  185  DYEPEYDEVTSKLVWDEVDRLSY  207



>ref|XP_006399100.1| hypothetical protein EUTSA_v10014650mg [Eutrema salsugineum]
 gb|ESQ40553.1| hypothetical protein EUTSA_v10014650mg [Eutrema salsugineum]
Length=215

 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAAI+LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEV+AVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVRAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+L+Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRLSY  207



>ref|XP_002467072.1| hypothetical protein SORBIDRAFT_01g019170 [Sorghum bicolor]
 gb|EER94070.1| hypothetical protein SORBIDRAFT_01g019170 [Sorghum bicolor]
Length=207

 Score =   337 bits (865),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +1

Query  169  ALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY  348
             ++QS+FKRICVFCGSS GKK SY +AAIELG ELV+R++DLVYGGGSIGLMGLVSQAVY
Sbjct  2    TMRQSRFKRICVFCGSSQGKKRSYHDAAIELGNELVARSVDLVYGGGSIGLMGLVSQAVY  61

Query  349  NGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEEL  528
            +GGRHV+GVIPKTL+  EI+GETVGEV+ VADMHQRKAEMA+ SDAFIALPGGYGTLEEL
Sbjct  62   DGGRHVIGVIPKTLMTPEISGETVGEVRPVADMHQRKAEMARQSDAFIALPGGYGTLEEL  121

Query  529  LEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMN  708
            LEVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+P+AR+I V AP A+ELM+
Sbjct  122  LEVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMD  181

Query  709  ELEEYNPCHERVASKQKWEK-DQLNY  783
            +LEEY P H+RVAS   WE   QL Y
Sbjct  182  KLEEYEPYHDRVASTLNWEMGHQLGY  207



>ref|NP_196248.3| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Arabidopsis thaliana]
 sp|Q8GW29.2|LOG7_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7; AltName: Full=Protein LONELY GUY 7 [Arabidopsis 
thaliana]
 dbj|BAB08952.1| lysine decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED91000.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Arabidopsis thaliana]
Length=217

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAAI+LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEVKAVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+++Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRISY  207



>ref|XP_009125642.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Brassica rapa]
 emb|CDY04985.1| BnaAnng01670D [Brassica napus]
Length=215

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F RICVFCGSS GKK SY+EAAIELG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFNRICVFCGSSSGKKPSYQEAAIELGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEVKAVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+L+Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRLSY  207



>ref|XP_006661863.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10-like [Oryza brachyantha]
Length=204

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++Q++FKRICVFCGSS GKK SY +AAIELG ELV+R+IDLVYGGGSIGLMGLVSQAV++
Sbjct  1    MRQTRFKRICVFCGSSQGKKRSYHDAAIELGNELVARSIDLVYGGGSIGLMGLVSQAVFD  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+  EI+GETVGEV+AVADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  61   GGRHVIGVIPKTLMTPEISGETVGEVRAVADMHQRKAEMARQSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+ +AR+I V AP A+ELM +
Sbjct  121  EVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINTSARRIIVMAPTAEELMEK  180

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P H+RVASK  WE   L Y
Sbjct  181  LEEYVPYHDRVASKLNWEIGHLGY  204



>ref|NP_001064868.1| Os10g0479500 [Oryza sativa Japonica Group]
 sp|Q7XDB8.1|LOGLA_ORYSJ RecName: Full=Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10; AltName: Full=Protein LONELY GUY-like 
10 [Oryza sativa Japonica Group]
 gb|AAG13575.1|AC037425_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54293.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26782.1| Os10g0479500 [Oryza sativa Japonica Group]
 dbj|BAG98533.1| unnamed protein product [Oryza sativa Japonica Group]
Length=204

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QS+FKRICVFCGSS GKK SY +AAIELG ELV+R+IDLVYGGGSIGLMGLVSQAV++
Sbjct  1    MRQSRFKRICVFCGSSQGKKRSYHDAAIELGNELVARSIDLVYGGGSIGLMGLVSQAVFD  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+  EI+GETVGEV+ VADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  61   GGRHVIGVIPKTLMTPEISGETVGEVRPVADMHQRKAEMARQSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+ +AR+I V AP A+ELM++
Sbjct  121  EVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINTSARRIIVMAPTAEELMDK  180

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P H+RVASK  WE   L Y
Sbjct  181  LEEYVPYHDRVASKLNWEMGHLGY  204



>ref|NP_001169307.1| hypothetical protein [Zea mays]
 gb|ACN33350.1| unknown [Zea mays]
 gb|AFW68572.1| hypothetical protein ZEAMMB73_363889 [Zea mays]
Length=207

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  169  ALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVY  348
             ++QS+FKRICVFCGSS GKK SY +AAIELG ELV+R++DLVYGGGSIGLMGLVSQAVY
Sbjct  2    TMRQSRFKRICVFCGSSQGKKRSYHDAAIELGNELVARSVDLVYGGGSIGLMGLVSQAVY  61

Query  349  NGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEEL  528
            +GGRHV+GVIPKTL+  EI+GETVGEV+AVADMHQRKAEMA+ SDAFIALPGGYGTLEEL
Sbjct  62   DGGRHVIGVIPKTLMTPEISGETVGEVRAVADMHQRKAEMARQSDAFIALPGGYGTLEEL  121

Query  529  LEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMN  708
            LEVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+P+AR+I V AP A+ELM+
Sbjct  122  LEVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMD  181

Query  709  ELEEYNPCHERVASKQKWEKDQLN  780
            +LEEY P H+ VAS   WE   L 
Sbjct  182  KLEEYEPYHDMVASTLNWEMGNLQ  205



>ref|XP_010246703.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 isoform X1 [Nelumbo nucifera]
Length=215

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++S+F+RICVFCGSS GKK  Y+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++G
Sbjct  5    RKSRFRRICVFCGSSSGKKARYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDG  64

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHVLGVIP+TL+PREITGETVGEV+AV+DMHQRKAEM++ +DAFIALPGGYGTLEELLE
Sbjct  65   GRHVLGVIPRTLMPREITGETVGEVRAVSDMHQRKAEMSRQADAFIALPGGYGTLEELLE  124

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGFISP+AR+I +SAP AK+L+ EL
Sbjct  125  VITWAQLGIHKKPVGLLNVDGYYNSLLSFIDKAVDEGFISPSARRIIISAPTAKQLVREL  184

Query  715  EEYNPCHERVASKQKWEKDQLNY  783
            EEY P ++ + SK  WE ++L+Y
Sbjct  185  EEYVPEYDEITSKLVWEVERLSY  207



>ref|XP_006342033.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Solanum tuberosum]
Length=225

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            +A + S+FKRICVFCGSSPGKK SY+ AAI+LG +LV RNIDLVYGGGS+GLMGLVSQ+V
Sbjct  10   QATKTSRFKRICVFCGSSPGKKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQSV  69

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            +NGGRHVLGVIPKTL+PREITGE+VGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEE
Sbjct  70   FNGGRHVLGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEE  129

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P+AR I +SAP A+ELM
Sbjct  130  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAPTAQELM  189

Query  706  NELEEYNPCHERVASKQKWEKDQ  774
            ++LE+Y P H  VA K  WE +Q
Sbjct  190  SKLEDYVPKHNGVAPKLSWEMEQ  212



>ref|XP_004143250.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis sativus]
 ref|XP_004170659.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis sativus]
 ref|XP_008449247.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Cucumis melo]
Length=211

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 193/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV  E   ++QSKF+RICVFCGSS G+K+SY++AAI+LG ELVSRNI+LVYGGGSIGLM
Sbjct  1    MEVENE---MRQSKFRRICVFCGSSQGRKSSYQDAAIDLGNELVSRNINLVYGGGSIGLM  57

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV+ GG HV+GVIPKTL+PRE+TGETVGEVKAVADMHQRKAEMAKHSDAFIALPG
Sbjct  58   GLVSQAVHGGGGHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  117

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP+AR+I +SA
Sbjct  118  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSAREIILSA  177

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKELM +LEEY PCHER A K  WE +QL Y
Sbjct  178  PTAKELMMKLEEYAPCHERAALKLNWEIEQLGY  210



>emb|CDY14086.1| BnaC02g02030D [Brassica napus]
Length=215

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GK+ SY+EAAIELG ELV R IDLVYGGGS+GLMGLVS AV++GG
Sbjct  5    KSRFKRICVFCGSSSGKRPSYQEAAIELGNELVERRIDLVYGGGSVGLMGLVSHAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEVKAVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+L+Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRLSY  207



>dbj|BAK52670.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Petunia 
x hybrida]
Length=224

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            +  + S+FKRICVFCGSSPGKK SY+ AAI+LG +LV RNIDLVYGGGS+GLMGLVSQAV
Sbjct  9    QPTKPSRFKRICVFCGSSPGKKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQAV  68

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            +NGGRHVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEE
Sbjct  69   FNGGRHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEE  128

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P+AR I VSAP A ELM
Sbjct  129  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIVSAPTAHELM  188

Query  706  NELEEYNPCHERVASKQKWEKDQ  774
            ++LE+Y P H  VA K  WE +Q
Sbjct  189  SKLEDYVPKHNGVAPKLSWEMEQ  211



>ref|XP_010906513.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Elaeis guineensis]
Length=254

 Score =   338 bits (866),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 188/239 (79%), Gaps = 36/239 (15%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELV--------------------------  276
            ++SKFKRICVFCGSS GKK SY++AA+ELGKELV                          
Sbjct  8    RRSKFKRICVFCGSSQGKKRSYQDAAVELGKELVRSRITFSEPETGKITVDNGVHPWPSS  67

Query  277  ----------SRNIDLVYGGGSIGLMGLVSQAVYNGGRHVLGVIPKTLLPREITGETVGE  426
                      S NIDLVYGGGS+GLMGLVSQAV++GGRHV+GVIPKTL+PREITGETVGE
Sbjct  68   LAFLVLNRPVSGNIDLVYGGGSVGLMGLVSQAVHDGGRHVIGVIPKTLMPREITGETVGE  127

Query  427  VKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYN  606
            VKAVADMHQRKAEMA+ SDAFIALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYN
Sbjct  128  VKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYN  187

Query  607  SLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            SLL+FIDKAVEEGFI+PNAR I VSAP AKEL+ +LEEY P HERVASK  WE ++L Y
Sbjct  188  SLLSFIDKAVEEGFINPNARHIIVSAPTAKELVKKLEEYFPRHERVASKLNWEMERLGY  246



>ref|XP_011074666.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Sesamum indicum]
Length=223

 Score =   337 bits (863),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME   ++ + + S+FKRICVFCGSSPGK  SY+ AAI+LGK+LV RNIDLVYGGGSIGLM
Sbjct  1    MENSPQQPSTKASRFKRICVFCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVYNGGRHVLGVIP+TL+PREITGE VGEV+AV+ MHQRKAEMA+ +DAFIALPG
Sbjct  61   GLVSQAVYNGGRHVLGVIPRTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P+AR I VSA
Sbjct  121  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIIVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQ  774
              A ELM++LEEY P H  VA K  WE +Q
Sbjct  181  QTAHELMSKLEEYVPEHNGVAPKLSWEMEQ  210



>ref|XP_004238344.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Solanum lycopersicum]
Length=225

 Score =   336 bits (862),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            +  + S+FKRICVFCGSSPGKK SY+ AAI+LG +LV RNIDLVYGGGS+GLMGLVSQ+V
Sbjct  10   QTTKTSRFKRICVFCGSSPGKKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQSV  69

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            +NGGRHVLGVIPKTL+PREITGE+VGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEE
Sbjct  70   FNGGRHVLGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEE  129

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P+AR I +SAP A+ELM
Sbjct  130  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAPTAQELM  189

Query  706  NELEEYNPCHERVASKQKWEKDQ  774
            ++LE+Y P H  VA K  WE +Q
Sbjct  190  SKLEDYVPKHNGVAPKLSWEMEQ  212



>ref|XP_008785140.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Phoenix dactylifera]
Length=228

 Score =   336 bits (861),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F+R+CVFCGSSPG K SY+ AAI+LG ELV RNIDLVYGGGS+GLMGLVSQAVY+GGR
Sbjct  20   SRFRRVCVFCGSSPGNKPSYQLAAIQLGHELVERNIDLVYGGGSVGLMGLVSQAVYDGGR  79

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+H+DAFIALPGGYGTLEELLEVI
Sbjct  80   HVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARHADAFIALPGGYGTLEELLEVI  139

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P AR I +SA  A EL+ +LEE
Sbjct  140  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIISAQTAHELLYKLEE  199

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y P H+ VA K  WE +QL +
Sbjct  200  YMPMHDGVAPKLSWEMEQLGH  220



>ref|XP_011094223.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Sesamum indicum]
Length=216

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 186/204 (91%), Gaps = 1/204 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++S+FKRICVFCGSS GKK SY+EAA+ELG+ELV R IDLVYGGGS+GLMGLVSQAV++G
Sbjct  5    KKSRFKRICVFCGSSSGKKPSYQEAAVELGRELVERRIDLVYGGGSVGLMGLVSQAVHDG  64

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHVLGVIP+TL+PREITGET+GEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLE
Sbjct  65   GRHVLGVIPRTLMPREITGETIGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLE  124

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIH KPVGLLNVEGYYNSLL+F+DKAV+EGFISP AR+I VSAP AK+L+ EL
Sbjct  125  VITWAQLGIHRKPVGLLNVEGYYNSLLSFLDKAVDEGFISPTARRIIVSAPTAKQLVREL  184

Query  715  EEYNPCHERVASKQKWEK-DQLNY  783
            EE+ P ++ + SK  WE+ ++LNY
Sbjct  185  EEHIPEYDEITSKLIWEEVERLNY  208



>ref|XP_002275414.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Vitis vinifera]
 emb|CAN67407.1| hypothetical protein VITISV_025618 [Vitis vinifera]
 emb|CBI30371.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   335 bits (859),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    RSRFKRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PREITGETVGEV+AV+ MH+RKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPREITGETVGEVRAVSHMHERKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGF+SP AR+I VSAP AKEL+ ELE
Sbjct  125  ITWAQLGIHKKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPTARRIIVSAPTAKELVRELE  184

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P H+ V SK  WE+ ++
Sbjct  185  EYVPEHDEVTSKLIWEEVEI  204



>ref|XP_010104785.1| hypothetical protein L484_018839 [Morus notabilis]
 gb|EXC01926.1| hypothetical protein L484_018839 [Morus notabilis]
Length=217

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 185/208 (89%), Gaps = 2/208 (1%)
 Frame = +1

Query  166  EALQ-QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            E LQ +S+F+RICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQA
Sbjct  2    EDLQTKSRFQRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQA  61

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHVLGVIPKTL+PREITGETVGEV+ V+DMHQRKAEM + +DAFIALPGGYGTLE
Sbjct  62   VHDGGRHVLGVIPKTLMPREITGETVGEVRTVSDMHQRKAEMTRQADAFIALPGGYGTLE  121

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGFISP AR+I VSAP AK+L
Sbjct  122  ELLEVITWAQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQL  181

Query  703  MNELEEYNPCHERVASKQKWEK-DQLNY  783
            +  LEEY P ++ V SK  WE+ ++LNY
Sbjct  182  VRLLEEYVPEYDEVTSKLVWEEVERLNY  209



>ref|XP_010941274.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Elaeis guineensis]
Length=226

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F+R+CVFCGSSPG K SY+ AAI+LG ELV RNIDLVYGGGSIGLMGLVS AVYNGGR
Sbjct  18   SRFRRVCVFCGSSPGNKASYQLAAIQLGNELVERNIDLVYGGGSIGLMGLVSHAVYNGGR  77

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEVI
Sbjct  78   HVIGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVI  137

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P AR I +SA NA EL+++LEE
Sbjct  138  TWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARHIIISAQNAHELLSKLEE  197

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y P HE VA K  WE +QL +
Sbjct  198  YVPEHEGVAPKLSWEMEQLGH  218



>ref|XP_009122236.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Brassica rapa]
Length=215

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS G K SY+EAAI+LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGNKPSYQEAAIQLGNELVERKIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGET+GEVKAVADMHQRKAEMA+ ++AFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQANAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFIDKAV+EGFISP AR+I VSAPNAKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P  + + SK  W E D+L+Y
Sbjct  185  EYEPEFDEITSKLVWDEVDRLSY  207



>gb|KDP36133.1| hypothetical protein JCGZ_08777 [Jatropha curcas]
Length=215

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY++AA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKASYQDAAVELGKELVDRRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PREI G+TVGEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPREIIGQTVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL+FIDKAV+EGFISP AR+I VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGFYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK-DQLNY  783
            EY P ++ + SK  WE+ D+LNY
Sbjct  185  EYEPEYDELTSKLVWEEVDRLNY  207



>ref|XP_006481574.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Citrus sinensis]
Length=213

 Score =   334 bits (856),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK +Y+EAA+ELGKELV R +DLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKATYQEAAVELGKELVERKLDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL PREITG+ VGEVK V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLTPREITGDPVGEVKTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL+F+DKAV+EGFISP AR+I +SAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGFYNSLLSFVDKAVDEGFISPTARRIIISAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            EY P H+ V SK  WE D+LNY
Sbjct  185  EYVPEHDEVTSKLVWE-DRLNY  205



>ref|XP_003574067.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Brachypodium distachyon]
Length=208

 Score =   333 bits (855),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QS+FKRICVFCGSS GKK SY +AAIELG ELV+R +DLVYGGGSIGLMG+VSQAVY+
Sbjct  1    MRQSRFKRICVFCGSSQGKKRSYHDAAIELGNELVARGVDLVYGGGSIGLMGMVSQAVYD  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+  EI+G+TVGEV+AVADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  61   GGRHVIGVIPKTLMTPEISGQTVGEVRAVADMHQRKAEMARQSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+ +AR+I V AP A+ELM +
Sbjct  121  EVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINTSARRIIVLAPTAEELMEK  180

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LEEY P H+RVASK  WE  ++ +
Sbjct  181  LEEYVPYHDRVASKLNWEIAEIGH  204



>ref|XP_006649247.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL3-like [Oryza brachyantha]
Length=211

 Score =   333 bits (855),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+FKR CVFCGSS G K +Y++AA++L KELV+R IDLVYGGGSIGLMGLVSQAVY+GGR
Sbjct  11   SRFKRTCVFCGSSQGNKTTYRDAAVDLAKELVARGIDLVYGGGSIGLMGLVSQAVYDGGR  70

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIPKTL+  EI GETVGEV+ V+DMHQRKAEMA+ SDAFIALPGGYGTLEELLEVI
Sbjct  71   HVIGVIPKTLMTPEIVGETVGEVRPVSDMHQRKAEMARQSDAFIALPGGYGTLEELLEVI  130

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIH KPVGLLNV+GYYNSLLTFID+AVEEGFISP+AR+I VSAP A+ELM++LEE
Sbjct  131  TWAQLGIHHKPVGLLNVDGYYNSLLTFIDQAVEEGFISPSARRIIVSAPTAQELMDKLEE  190

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y P H+RVAS   WE D L +
Sbjct  191  YVPYHDRVASGLNWEADHLGF  211



>ref|XP_009396585.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Musa acuminata subsp. malaccensis]
Length=237

 Score =   334 bits (857),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +1

Query  184  KFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRH  363
            +FKR+CVFCGSS GKK  Y+ AAI+LGKELV RNIDLVYGGGS+GLMGLVSQAV++GGRH
Sbjct  30   RFKRVCVFCGSSTGKKKGYQLAAIQLGKELVERNIDLVYGGGSVGLMGLVSQAVFDGGRH  89

Query  364  VLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIA  543
            VLG+IP+TL+P+EITGET+GEV+ VA MHQRKAEMA+ +DAF+ALPGGYGTLEELLEVI 
Sbjct  90   VLGIIPRTLMPKEITGETIGEVQPVAGMHQRKAEMARQADAFVALPGGYGTLEELLEVIT  149

Query  544  WAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEEY  723
            WAQLGIHDKPVGLLNVEGYYN+LL+FIDKAV+EGFISP+AR I +SA  A EL+++LEEY
Sbjct  150  WAQLGIHDKPVGLLNVEGYYNTLLSFIDKAVDEGFISPDARHIIISAQTAHELLSKLEEY  209

Query  724  NPCHERVASKQKWEKDQLNY  783
             P HERVASK +WE ++L +
Sbjct  210  EPRHERVASKLRWEMEKLGH  229



>pdb|2A33|A Chain A, X-Ray Structure Of A Lysine Decarboxylase-Like Protein 
From Arabidopsis Thaliana Gene At2g37210
 pdb|2A33|B Chain B, X-Ray Structure Of A Lysine Decarboxylase-Like Protein 
From Arabidopsis Thaliana Gene At2g37210
 pdb|2Q4O|A Chain A, Ensemble Refinement Of The Crystal Structure Of A Lysine 
Decarboxylase-Like Protein From Arabidopsis Thaliana Gene 
At2g37210
 pdb|2Q4O|B Chain B, Ensemble Refinement Of The Crystal Structure Of A Lysine 
Decarboxylase-Like Protein From Arabidopsis Thaliana Gene 
At2g37210
Length=215

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E+ Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGL GLVSQAV
Sbjct  6    ESXQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLXGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHV+G+IPKTL PRE+TGETVGEV+AVAD HQRKAE AKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRHVIGIIPKTLXPRELTGETVGEVRAVADXHQRKAEXAKHSDAFIALPGGYGTLEE  125

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+
Sbjct  126  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELV  185

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHERVA+K  WE +++ Y
Sbjct  186  KKLEEYAPCHERVATKLCWEXERIGY  211



>ref|XP_006430086.1| hypothetical protein CICLE_v10013759mg [Citrus clementina]
 gb|ESR43326.1| hypothetical protein CICLE_v10013759mg [Citrus clementina]
Length=213

 Score =   333 bits (854),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK +Y+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKPTYQEAAVELGKELVERKIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL PREITG+ VGEVK V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLTPREITGDPVGEVKTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL+F+DKAV+EGFISP AR+I +SAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGFYNSLLSFVDKAVDEGFISPTARRIIISAPTAKKLVRQLE  184

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            EY P H+ + SK  WE D+LNY
Sbjct  185  EYVPEHDEITSKLVWE-DRLNY  205



>gb|AAD18138.2| hypothetical protein [Arabidopsis thaliana]
Length=202

 Score =   333 bits (853),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 181/206 (88%), Gaps = 13/206 (6%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E++Q+SKF+RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLMGLVSQAV
Sbjct  6    ESMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAV  65

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRH             +TGETVGEV+AVADMHQRKAEMAKHSDAFIALPGGYGTLEE
Sbjct  66   HDGGRH-------------LTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  112

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+
Sbjct  113  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELV  172

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY PCHERVA+K  WE +++ Y
Sbjct  173  KKLEEYAPCHERVATKLCWEMERIGY  198



>gb|AHZ89694.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
protein [Dimocarpus longan]
Length=213

 Score =   333 bits (854),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 183/202 (91%), Gaps = 1/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+ KRICVFCGSS GKK SY+EAAIELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRSKRICVFCGSSSGKKASYQEAAIELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLG+IP+TL+PREITGETVGEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGIIPRTLMPREITGETVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+F+DKAV+EGFISP AR+I +SAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLSFVDKAVDEGFISPTARRIIISAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            EY P ++ + SK  WE +++NY
Sbjct  185  EYEPEYDEITSKLVWE-ERVNY  205



>ref|XP_006473638.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2-like [Citrus sinensis]
Length=225

 Score =   333 bits (855),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKR+CVFCGSSPGK  SY+ AAI+LGK+LV RNIDLVYGGGSIGLMGLVSQAVY+GG
Sbjct  15   KSRFKRVCVFCGSSPGKSPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGLVSQAVYDGG  74

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGETVGEVKAV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  75   RHVLGVIPKTLMPREITGETVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEV  134

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P AR I VSA  A ELM +LE
Sbjct  135  ITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARYIIVSAQTAHELMCKLE  194

Query  718  EYNPCHERVASKQKWEKDQ  774
            EY P H  VAS   WE +Q
Sbjct  195  EYVPKHSGVASNLSWEMEQ  213



>ref|XP_009610925.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana tomentosiformis]
Length=229

 Score =   333 bits (855),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  148  EVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            ++    +    S+FKRICVFCGSSPG K SY+ AAI+LG +LV RNIDLVYGGGS+GLMG
Sbjct  8    QINPSSQLTNPSRFKRICVFCGSSPGNKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMG  67

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            LVSQAV+NGGRHVLGVIPKTL+PREITGE+VGEV+AV+ MHQRKAEMA+ +DAFIALPGG
Sbjct  68   LVSQAVFNGGRHVLGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGG  127

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P+AR I +SAP
Sbjct  128  YGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAP  187

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQ  774
             A ELM++LE+Y P H  VA K  WE +Q
Sbjct  188  TAHELMSKLEDYVPEHNGVAPKLSWEMEQ  216



>ref|XP_010060231.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Eucalyptus grandis]
 gb|KCW66840.1| hypothetical protein EUGRSUZ_F00602 [Eucalyptus grandis]
Length=220

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            ++++  +S+F R+CVFCGSSPGK  SY+ AAI+LGK+LV R+IDLVYGGGSIGLMGLVSQ
Sbjct  4    QRQSPLKSRFSRVCVFCGSSPGKSPSYQLAAIQLGKQLVERDIDLVYGGGSIGLMGLVSQ  63

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
             VY+GGRHVLGVIPKTL+PREITGET+GEV+ V+ MHQRKAEMA+ +DAFIALPGGYGTL
Sbjct  64   VVYDGGRHVLGVIPKTLMPREITGETIGEVRPVSGMHQRKAEMARQADAFIALPGGYGTL  123

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P+AR I VSAP A E
Sbjct  124  EELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIVSAPTAHE  183

Query  700  LMNELEEYNPCHERVASKQKWEKDQ  774
            L+ +LEEY P H  VASK  WE +Q
Sbjct  184  LLTKLEEYEPKHSGVASKLTWEMEQ  208



>ref|XP_009372569.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Pyrus x bretschneideri]
Length=215

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F RICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFNRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PREITGETVGEV+ V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPREITGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGF+SP AR I VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPTARHIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK  768
            EY P H+ + SK  WE+
Sbjct  185  EYVPEHDEITSKLVWEE  201



>ref|XP_008391958.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Malus domestica]
Length=215

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 180/203 (89%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F RICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFNRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+P EITGETVGEV+ V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPXEITGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL FIDKAV+EGFISP AR I VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLCFIDKAVDEGFISPTARHIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK-DQLNY  783
            EY P H+ V SK  WE+ D+++Y
Sbjct  185  EYVPEHDEVTSKLVWEEVDRISY  207



>emb|CDX73553.1| BnaC08g24500D [Brassica napus]
Length=197

 Score =   331 bits (849),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            MEV   K  +Q+SKF RICVFCGSS GKK+SY++AA++LG ELVSRNIDLVYGGGSIGLM
Sbjct  1    MEV-NTKTIIQKSKFGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLM  59

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            G VSQAV++GGRHV+GVIPK L+PRE+TGETVGEV+AVADMHQRKAEMA+HSDAFIALPG
Sbjct  60   GFVSQAVHDGGRHVIGVIPKILMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPG  119

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAVEEGFISPNARQI +SA
Sbjct  120  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISA  179

Query  685  PNAKELMNELE  717
            P AKEL+ +LE
Sbjct  180  PTAKELVKKLE  190



>ref|XP_010242845.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG5-like [Nelumbo nucifera]
Length=220

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +E + +S+FKR+CVFCGSS GK++ Y++AA+ELG+ELVSR +DLVYGGGS+GLMGLVS+A
Sbjct  4    EEKVVKSRFKRVCVFCGSSTGKRDCYRDAALELGQELVSRRLDLVYGGGSVGLMGLVSEA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V+ GGRHVLG+IPKTL+ +EITGETVGEVK VADMH+RKAEMA+HSD FIALPGGYGTLE
Sbjct  64   VHRGGRHVLGIIPKTLMRKEITGETVGEVKPVADMHERKAEMARHSDCFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNAKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIMPSQRHIIVSAPNAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQLNY  783
            + +LEEY P H+ V +K +WE +Q+ +
Sbjct  184  VQKLEEYVPVHDEVIAKARWEVEQVEF  210



>ref|XP_007202920.1| hypothetical protein PRUPE_ppa016229mg [Prunus persica]
 gb|EMJ04119.1| hypothetical protein PRUPE_ppa016229mg [Prunus persica]
Length=216

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F RICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFNRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PRE+TGETVGEV+ V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPRELTGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL+FIDKAV+EGFIS  ARQI VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGFYNSLLSFIDKAVDEGFISTTARQIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK-DQLNY  783
            EY P  + + SK  WE+ D++NY
Sbjct  185  EYVPEQDEITSKLVWEEVDRINY  207



>ref|XP_010558001.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Tarenaya hassleriana]
Length=215

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS G K SY+EAA +LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGNKPSYQEAATQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGETVGEVKAVADMH+RKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPKTLMPREITGETVGEVKAVADMHRRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+FIDKAVEEGFISP AR+I VSAP AKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLSFIDKAVEEGFISPMARRIIVSAPTAKELVRKLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P ++ + SK  W E D+L+Y
Sbjct  185  EYEPEYDEITSKLVWDEVDRLSY  207



>ref|XP_009783018.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana sylvestris]
Length=229

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  148  EVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMG  327
            ++    +  + S+FKRICVFCGSSPG K SY+ AAI+L  +LV RNIDLVYGGGS+GLMG
Sbjct  8    QINPSSQLTKPSRFKRICVFCGSSPGNKPSYQLAAIQLANQLVERNIDLVYGGGSVGLMG  67

Query  328  LVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGG  507
            LVSQAV+NGGRHVLGVIPKTL+PREITGE+VGEV+AV+ MHQRKAEMA+ +DAFIALPGG
Sbjct  68   LVSQAVFNGGRHVLGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGG  127

Query  508  YGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAP  687
            YGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P+AR I +SAP
Sbjct  128  YGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAP  187

Query  688  NAKELMNELEEYNPCHERVASKQKWEKDQ  774
             A ELM++LE+Y P H  VA K  WE +Q
Sbjct  188  TAHELMSKLEDYVPKHNGVAPKLSWEMEQ  216



>ref|XP_002530151.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF32206.1| carboxy-lyase, putative [Ricinus communis]
Length=216

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSTGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGV+P+TL+PREI G+TVGEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVVPRTLMPREIIGQTVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL FIDKAV+EGFISP AR+I VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGFYNSLLCFIDKAVDEGFISPTARRIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK-DQLNY  783
            EY P ++ + SK  WE+ D LNY
Sbjct  185  EYVPEYDEITSKLVWEEVDILNY  207



>ref|XP_011028989.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Populus euphratica]
Length=224

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            ++++ L +S+F+R+CVFCGSSPGK  +Y+ AA++LGK+LV RNIDLVYGGGSIGLMGL+S
Sbjct  7    QQRQPLMKSRFRRVCVFCGSSPGKNPNYQHAAVQLGKQLVERNIDLVYGGGSIGLMGLIS  66

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVY+GGRHVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGT
Sbjct  67   QAVYDGGRHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGT  126

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P AR I VSA  A 
Sbjct  127  LEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAHTAH  186

Query  697  ELMNELEEYNPCHERVASKQKWEKDQ  774
            ELM +LE+Y   H  VASK  WE +Q
Sbjct  187  ELMCKLEDYEAEHSGVASKLSWEMEQ  212



>ref|XP_010104436.1| hypothetical protein L484_016035 [Morus notabilis]
 gb|EXC00969.1| hypothetical protein L484_016035 [Morus notabilis]
Length=226

 Score =   332 bits (850),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F+R+CVFCGSSPGK  SY+ AAI+LGKELV RNIDLVYGGGSIGLMGLVSQAVY GG
Sbjct  16   KSRFRRVCVFCGSSPGKSPSYQLAAIQLGKELVERNIDLVYGGGSIGLMGLVSQAVYEGG  75

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  76   RHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEV  135

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAV+EGFI+P AR I VSA  A+ELM +LE
Sbjct  136  ITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIVSAQTAQELMCKLE  195

Query  718  EYNPCHERVASKQKWEKDQ  774
            EY P H  VA K  WE +Q
Sbjct  196  EYVPKHSGVAPKLSWEMEQ  214



>ref|XP_002306920.1| hypothetical protein POPTR_0005s25880g [Populus trichocarpa]
 gb|EEE93916.1| hypothetical protein POPTR_0005s25880g [Populus trichocarpa]
Length=222

 Score =   332 bits (850),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 184/214 (86%), Gaps = 1/214 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME  ++++   +S+F+R+CVFCGSSPGK  +Y+ AAI+LGK+LV RNIDLVYGGGSIGLM
Sbjct  1    MENQQQRQPSMKSRFRRVCVFCGSSPGKNPNYQHAAIQLGKQLVERNIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAVY+GGRHVLGVIPKTL+PREITG+TVGEVKAV+ MHQRKAEMA+ +DAFIALPG
Sbjct  61   GLVSQAVYDGGRHVLGVIPKTLMPREITGDTVGEVKAVSGMHQRKAEMARQADAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P AR I VSA
Sbjct  121  GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEK-DQLNY  783
              A+ELM  LE+Y   H  VASK  WE   QL Y
Sbjct  181  NTAQELMCLLEDYEAEHSGVASKLSWEMGQQLGY  214



>ref|XP_010061042.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Eucalyptus grandis]
 gb|KCW67942.1| hypothetical protein EUGRSUZ_F01639 [Eucalyptus grandis]
Length=225

 Score =   332 bits (850),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+FKR+CVFCGSSPGK  SY+ AAI+LG +LV R IDLVYGGGSIGLMGLVSQ V++GGR
Sbjct  15   SRFKRVCVFCGSSPGKNPSYQLAAIQLGHQLVERCIDLVYGGGSIGLMGLVSQVVFDGGR  74

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HVLGVIP+TL+PREITGET+GEV+ V  MHQRKAEMA+H+DAFIALPGGYGTLEELLEVI
Sbjct  75   HVLGVIPRTLMPREITGETIGEVRPVCGMHQRKAEMARHADAFIALPGGYGTLEELLEVI  134

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNVEGYYNSLL+F+DKAV+EGF+SP+AR I VSAP   ELM++LEE
Sbjct  135  TWAQLGIHDKPVGLLNVEGYYNSLLSFLDKAVDEGFVSPSARHIIVSAPTPHELMSKLEE  194

Query  721  YNPCHERVASKQKWEKDQ  774
            Y P H  VASKQ WEK+Q
Sbjct  195  YVPEHSGVASKQCWEKEQ  212



>ref|XP_002276775.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Vitis vinifera]
 emb|CBI19842.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   331 bits (849),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E L  S+FKR+CVFCGSSPGK  SY+ AAI+L  +LV R IDLVYGGGSIGLMGLVSQAV
Sbjct  2    ETLLPSRFKRVCVFCGSSPGKNPSYQLAAIQLANQLVERKIDLVYGGGSIGLMGLVSQAV  61

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            Y+GGRHVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEE
Sbjct  62   YDGGRHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEE  121

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+  ARQI VSAP A+EL+
Sbjct  122  LLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITAAARQIIVSAPTAQELL  181

Query  706  NELEEYNPCHERVASKQKWEKDQ  774
             +LEEY P H  VA K  WE +Q
Sbjct  182  CKLEEYVPKHSGVAPKLSWEMEQ  204



>ref|NP_001048706.1| Os03g0109300 [Oryza sativa Japonica Group]
 sp|Q8H7U8.1|LOGL3_ORYSJ RecName: Full=Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL3; AltName: Full=Protein LONELY GUY-like 
3 [Oryza sativa Japonica Group]
 gb|AAN61486.1| Putative lysine decarboxylase-like protein [Oryza sativa Japonica 
Group]
 gb|ABF93572.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10620.1| Os03g0109300 [Oryza sativa Japonica Group]
 gb|EAZ25308.1| hypothetical protein OsJ_09119 [Oryza sativa Japonica Group]
Length=211

 Score =   330 bits (847),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKR CVFCGSS G K +Y++AA++L KELV+R IDLVYGGGSIGLMGLVSQAVY+GG
Sbjct  10   ESRFKRTCVFCGSSQGNKTTYRDAAVDLAKELVARGIDLVYGGGSIGLMGLVSQAVYDGG  69

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPKTL+  EI GETVGEV+ V+DMHQRKAEMA+ SDAFIALPGGYGTLEELLEV
Sbjct  70   RHVIGVIPKTLMTPEIIGETVGEVRPVSDMHQRKAEMARQSDAFIALPGGYGTLEELLEV  129

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLLTFID+AVEEGFISP+AR+I VSAP A+ELM++LE
Sbjct  130  ITWAQLGIHHKPVGLLNVDGYYNSLLTFIDQAVEEGFISPSARRIIVSAPTAQELMDKLE  189

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            EY P H+RVAS   WE   L +
Sbjct  190  EYVPYHDRVASGLNWETGHLGF  211



>emb|CDP10616.1| unnamed protein product [Coffea canephora]
Length=217

 Score =   331 bits (848),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  175  QQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNG  354
            ++S+FKRICV+CGS  GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++G
Sbjct  5    KRSRFKRICVYCGSCSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDG  64

Query  355  GRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLE  534
            GRHVLGVIP+TL+PREITGE +GEV+AV+DMHQRKAEM + +DAFIALPGGYGTLEELLE
Sbjct  65   GRHVLGVIPRTLMPREITGEKIGEVRAVSDMHQRKAEMVRQADAFIALPGGYGTLEELLE  124

Query  535  VIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNEL  714
            VI WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGFISP AR+I VSAP AKEL+ EL
Sbjct  125  VITWAQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARRIIVSAPAAKELVREL  184

Query  715  EEYNPCHERVASKQKWEK-DQLN  780
            EEY P ++ + SK  WE+ D+LN
Sbjct  185  EEYVPEYDEITSKLTWEEMDRLN  207



>ref|XP_004167905.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG5-like, partial [Cucumis sativus]
Length=218

 Score =   331 bits (848),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            L +SKFKR+CVFCGSS GK+N Y+EAA+EL +ELVSR +DLVYGGGSIGLMGLVS+ V+N
Sbjct  5    LMKSKFKRVCVFCGSSSGKRNCYREAAVELARELVSRRLDLVYGGGSIGLMGLVSREVHN  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GG HV+G+IPKTL+ +EITGETVGEV+ VADMHQRKAEMA+HSD FIALPGGYGTLEELL
Sbjct  65   GGGHVIGIIPKTLMRKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV GYYNSLL+FIDKAV++GFI P+ R I VSAPNAKEL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVHGYYNSLLSFIDKAVDDGFIMPSQRSIIVSAPNAKELVQK  184

Query  712  LEEYNPCHERVASKQKWEKDQL  777
            LEEY P H+ V +K KWE  Q+
Sbjct  185  LEEYVPVHDGVVAKAKWEAAQM  206



>ref|XP_010266115.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG5-like [Nelumbo nucifera]
Length=220

 Score =   331 bits (848),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +E   +S+FKR+CVFCGSS GK++ Y++AA+ELG+ELVSR +DLVYGGGSIGLMGLVSQA
Sbjct  4    EEKTVKSRFKRVCVFCGSSTGKRDCYRDAALELGQELVSRRLDLVYGGGSIGLMGLVSQA  63

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V+ GG HVLG+IPKTL+ +EITGETVGEVK VADMHQRKAEMA+HSD FIALPGGYGTLE
Sbjct  64   VHRGGGHVLGIIPKTLMCKEITGETVGEVKPVADMHQRKAEMARHSDCFIALPGGYGTLE  123

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNAKEL
Sbjct  124  ELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIMPSQRHIIVSAPNAKEL  183

Query  703  MNELEEYNPCHERVASKQKWEKDQLNY  783
            + +LEEY P H+ V +K +WE +Q+ +
Sbjct  184  VQKLEEYVPVHDGVIAKARWEVEQVEF  210



>ref|XP_010534395.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Tarenaya hassleriana]
Length=239

 Score =   332 bits (850),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAAI+LG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  6    KSRFKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  65

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGETVGEVKAVADMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  66   RHVLGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEV  125

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+ YY+SLL+FIDKAV+EGFISP AR+I VSAP AKEL+ +LE
Sbjct  126  ITWAQLGIHRKPVGLLNVDEYYDSLLSFIDKAVDEGFISPTARRIIVSAPTAKELVRKLE  185

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            +Y P ++ V SK  W E D++NY
Sbjct  186  KYEPEYDEVTSKLVWDEVDRINY  208



>ref|XP_011034907.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG5-like [Populus euphratica]
Length=221

 Score =   331 bits (848),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            K A++ SKFKR+CVFCGSS GK++ Y++AA+ELG+ELVSR++DLVYGGGS+GLMGLVSQ 
Sbjct  5    KVAVKSSKFKRVCVFCGSSTGKRDCYRDAALELGQELVSRSLDLVYGGGSVGLMGLVSQE  64

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V+ GG HV+GVIPKTL+ +E+TGETVGEV+ VADMHQRKAEMA+HSD FIALPGGYGTLE
Sbjct  65   VHRGGGHVIGVIPKTLMSKELTGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLE  124

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNAKEL
Sbjct  125  ELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIMPSQRSIIVSAPNAKEL  184

Query  703  MNELEEYNPCHERVASKQKWEKDQL  777
            + +LEEY P H+ V +K KWE +Q+
Sbjct  185  VQKLEEYVPVHDGVVAKAKWEAEQM  209



>ref|XP_006435156.1| hypothetical protein CICLE_v10002383mg [Citrus clementina]
 gb|ESR48396.1| hypothetical protein CICLE_v10002383mg [Citrus clementina]
Length=227

 Score =   331 bits (848),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKR+CVFCGSSPGK  SY+ AAI+LG +LV RNIDLVYGGGSIGLMGLVSQAVY+GG
Sbjct  17   KSRFKRVCVFCGSSPGKSPSYQLAAIQLGTQLVERNIDLVYGGGSIGLMGLVSQAVYDGG  76

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITG+TVGEVKAV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  77   RHVLGVIPKTLMPREITGDTVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEV  136

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P AR I VSA  A ELM +LE
Sbjct  137  ITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARYIIVSAQTAHELMCKLE  196

Query  718  EYNPCHERVASKQKWEKDQ  774
            EY P H  VAS   WE +Q
Sbjct  197  EYVPKHSGVASNLSWEMEQ  215



>ref|XP_006854693.1| hypothetical protein AMTR_s00030p00225360 [Amborella trichopoda]
 gb|ERN16160.1| hypothetical protein AMTR_s00030p00225360 [Amborella trichopoda]
Length=218

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E   +S+F+R+CVFCGSSPGKK+SY+EAA++LGKELV R+IDLVYGGGS+GLMGLVSQAV
Sbjct  4    EQKNKSRFRRVCVFCGSSPGKKSSYQEAAVQLGKELVERDIDLVYGGGSVGLMGLVSQAV  63

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHVLGVIPKTL+PREITG+ VGEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEE
Sbjct  64   HDGGRHVLGVIPKTLMPREITGKPVGEVRAVSDMHQRKAEMARRADAFIALPGGYGTLEE  123

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIH KPVGLLNV+GYYNSLL+F+D+AV+EGFISP+AR I VSAP A +L 
Sbjct  124  LLEVITWAQLGIHTKPVGLLNVDGYYNSLLSFVDQAVDEGFISPDARDIIVSAPTANDLF  183

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             +LEEY P  +  AS+  WE ++L Y
Sbjct  184  RKLEEYVPKRDDRASQLIWEIEELAY  209



>ref|XP_010664090.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG5-like [Vitis vinifera]
Length=219

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            EK  + +S+FKR+CVFCGSS GK+N Y++AAIEL +ELVSR +DLVYGGGS+GLMGLVSQ
Sbjct  2    EKTEMVRSRFKRVCVFCGSSTGKRNCYRDAAIELAQELVSRRLDLVYGGGSVGLMGLVSQ  61

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
             V+ GG HVLG+IPKTL+ +EITGETVGEV+ VADMHQRKAEMA+HSD FIALPGGYGTL
Sbjct  62   EVHRGGGHVLGIIPKTLMCKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTL  121

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVI WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNA+E
Sbjct  122  EELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIKPSQRHIIVSAPNARE  181

Query  700  LMNELEEYNPCHERVASKQKWEKDQL  777
            L+ +LEEY P H+ V +K +WE +QL
Sbjct  182  LVQKLEEYVPVHDGVVAKARWEAEQL  207



>gb|EEC67178.1| hypothetical protein OsI_34046 [Oryza sativa Indica Group]
 gb|EEE51147.1| hypothetical protein OsJ_31908 [Oryza sativa Japonica Group]
Length=345

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            ++QS+FKRICVFCGSS GKK SY +AAIELG ELV+R+IDLVYGGGSIGLMGLVSQAV++
Sbjct  1    MRQSRFKRICVFCGSSQGKKRSYHDAAIELGNELVARSIDLVYGGGSIGLMGLVSQAVFD  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GGRHV+GVIPKTL+  EI+GETVGEV+ VADMHQRKAEMA+ SDAFIALPGGYGTLEELL
Sbjct  61   GGRHVIGVIPKTLMTPEISGETVGEVRPVADMHQRKAEMARQSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIH KPVGLLNV+GYYNSLLTFIDKAVEEGFI+ +AR+I V AP A+ELM++
Sbjct  121  EVITWAQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINTSARRIIVMAPTAEELMDK  180

Query  712  LEEYNPCHERVASKQKWEKDQL  777
            LEEY P H+RVASK  WE   L
Sbjct  181  LEEYVPYHDRVASKLNWEMGHL  202



>ref|XP_010543825.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Tarenaya hassleriana]
Length=215

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKRICVFCGSS GKK SY+EAAIELG ELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFKRICVFCGSSSGKKPSYQEAAIELGNELVERRIDLVYGGGSVGLMGLVSQAVHHGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHV+GVIPK+L+PREITGETVGEVKAV DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVIGVIPKSLMPREITGETVGEVKAVDDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL+FIDKA++EGFIS  AR+I VSAP AKEL+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLSFIDKAMDEGFISAAARRIIVSAPTAKELVRQLE  184

Query  718  EYNPCHERVASKQKW-EKDQLNY  783
            EY P ++ + SK  W E D++NY
Sbjct  185  EYEPEYDEITSKLVWDEVDRINY  207



>ref|XP_008444787.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Cucumis melo]
Length=232

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            QSKF+RICVFCGSS GK  SY+ AAI+LG +LV RNIDLVYGGGSIGLMGLVSQAVY+GG
Sbjct  22   QSKFRRICVFCGSSSGKNPSYQIAAIQLGNQLVERNIDLVYGGGSIGLMGLVSQAVYDGG  81

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPK+L+P+EITGET+GEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  82   RHVLGVIPKSLMPKEITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEV  141

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH+KPVGLLNV+GYYNSLL+FIDKAV+EGF+SP AR I VSAP A  L+ +LE
Sbjct  142  ITWAQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPAARSIIVSAPTAHALITKLE  201

Query  718  EYNPCHERVASKQKWEKDQ  774
            EY P H  VASK  WE +Q
Sbjct  202  EYVPKHSSVASKLSWEMEQ  220



>ref|XP_008243464.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Prunus mume]
Length=218

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F RICVFCGSS GKK SY+EAA+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFNRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PRE+TGETVGEV+ V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPRELTGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL+FIDKAV+EGFIS  ARQI VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGFYNSLLSFIDKAVDEGFISTTARQIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK-DQLNY  783
            EY P  + + SK  WE+ D+++Y
Sbjct  185  EYVPEQDEITSKLVWEEVDRISY  207



>ref|XP_009349185.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Pyrus x bretschneideri]
Length=215

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 180/203 (89%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F RICVFCGSS GKK SY+E+A+ELGKELV R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSRFNRICVFCGSSSGKKASYQESAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIP+TL+PREITGETVGEV+ V+DMHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  65   RHVLGVIPRTLMPREITGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEV  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+GYYNSLL FIDKAV+EGFISP AR I VSAP AK+L+ +LE
Sbjct  125  ITWAQLGIHRKPVGLLNVDGYYNSLLCFIDKAVDEGFISPTARHIIVSAPTAKQLVRQLE  184

Query  718  EYNPCHERVASKQKWEK-DQLNY  783
            EY P  + V SK  WE+ D+++Y
Sbjct  185  EYVPELDEVTSKLVWEEMDRISY  207



>gb|AFW58873.1| hypothetical protein ZEAMMB73_274984 [Zea mays]
Length=253

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 181/207 (87%), Gaps = 7/207 (3%)
 Frame = +1

Query  145  MEVGKEKEALQ-------QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYG  303
            +E  KE+EA Q        S+F RICVFCGSS GKK SY++AA+ELG+ELVSRNIDLVYG
Sbjct  8    VEETKEEEAAQVMETTTAHSRFGRICVFCGSSQGKKKSYQDAAVELGEELVSRNIDLVYG  67

Query  304  GGSIGLMGLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSD  483
            GGS+GLMGLVS+AVYNGGRHV+GVIPKTL+PREITGETVGEVKAVA MHQRKAEMA+ SD
Sbjct  68   GGSVGLMGLVSRAVYNGGRHVMGVIPKTLMPREITGETVGEVKAVAGMHQRKAEMARQSD  127

Query  484  AFIALPGGYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNA  663
            AFIALPGGYGTLEELLEVI WAQLGIHDKPVGLLNV GYYNSLL+FIDKAVEE FISP A
Sbjct  128  AFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVNGYYNSLLSFIDKAVEEEFISPTA  187

Query  664  RQIFVSAPNAKELMNELEEYNPCHERV  744
            R I V AP  KEL+++LEEY+P HE++
Sbjct  188  RHIVVLAPTPKELLDKLEEYSPRHEKL  214



>ref|XP_004303504.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Fragaria vesca subsp. vesca]
Length=215

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F RICVFCGSS GKK SY+EAA+ELGKELV R I+LVYGGGS+GLMGLVSQAV++GGR
Sbjct  6    SRFNRICVFCGSSSGKKASYQEAAVELGKELVERRINLVYGGGSVGLMGLVSQAVHDGGR  65

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HV+GVIP+TL+PREITGETVGEV+ V++MHQRKAEMA+ +DAFIALPGGYGTLEELLEVI
Sbjct  66   HVIGVIPRTLMPREITGETVGEVRTVSNMHQRKAEMARQADAFIALPGGYGTLEELLEVI  125

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIH KPVGLLNV+GYYNSLL+FID+AV+EGFISP ARQI VSAP AK+L+ +LEE
Sbjct  126  TWAQLGIHRKPVGLLNVDGYYNSLLSFIDQAVDEGFISPTARQIIVSAPTAKQLVRQLEE  185

Query  721  YNPCHERVASKQKWEK-DQLNY  783
            Y P ++ V S   WE+ D++NY
Sbjct  186  YVPEYDEVTSNLVWEEVDRINY  207



>ref|XP_007017774.1| Lysine decarboxylase family protein [Theobroma cacao]
 gb|EOY14999.1| Lysine decarboxylase family protein [Theobroma cacao]
Length=240

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F+R+CVFCGSSPGK  SY+ +AI+LG++LV RNIDLVYGGGSIGLMGLVSQAV++GG
Sbjct  30   KSRFRRVCVFCGSSPGKNPSYQLSAIQLGQQLVERNIDLVYGGGSIGLMGLVSQAVFDGG  89

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGE VGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  90   RHVLGVIPKTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEV  149

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGFI+P AR I VSA  A+ELM +LE
Sbjct  150  ITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARDIIVSAQTAQELMCKLE  209

Query  718  EYNPCHERVASKQKWEKDQ  774
            EY P H  VASK  WE +Q
Sbjct  210  EYEPKHSEVASKLSWEMEQ  228



>ref|XP_003519126.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Glycine max]
 gb|KHN02824.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Glycine soja]
Length=214

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +SKFKRICV+CGSS G K SY+EAA+ELGKE+V R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSKFKRICVYCGSSSGNKASYQEAAVELGKEMVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPK+L+PREITG+ +GEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLE+
Sbjct  65   RHVLGVIPKSLMPREITGDPIGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEI  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNVEG+YNSLL+FIDKAV+EGFISP AR+I VSAP AK+L+ ELE
Sbjct  125  ITWAQLGIHSKPVGLLNVEGFYNSLLSFIDKAVDEGFISPKARRIIVSAPTAKDLVRELE  184

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            E+ P  + V SK  WE D+LNY
Sbjct  185  EHVPERDEVVSKLVWE-DRLNY  205



>ref|XP_006828985.1| hypothetical protein AMTR_s00001p00241960 [Amborella trichopoda]
 gb|ERM96401.1| hypothetical protein AMTR_s00001p00241960 [Amborella trichopoda]
Length=214

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            + +S+FKR+CVFCGSS GK+N Y++AA+EL +ELVSR +DLVYGGGS+GLMGLVSQ VY 
Sbjct  1    MAKSRFKRVCVFCGSSTGKRNCYRDAAVELAEELVSRKMDLVYGGGSVGLMGLVSQTVYR  60

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GG HVLG+IPKTL+ +EITGE VGEV+AVADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  61   GGGHVLGIIPKTLMCKEITGEKVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELL  120

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNVEGYYNSLL+FIDKAV++GFI P  R IFVSAP+AKEL+ +
Sbjct  121  EVITWAQLGIHDKPVGLLNVEGYYNSLLSFIDKAVDDGFIKPCQRHIFVSAPSAKELVQK  180

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LE+Y P H  V  K +WE +++ Y
Sbjct  181  LEDYVPVHNGVVPKARWEVEEVEY  204



>ref|NP_001244910.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Solanum lycopersicum]
 dbj|BAM09002.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase-like 
[Solanum lycopersicum]
Length=217

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  166  EALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAV  345
            E ++ SKF RICVFCGSS GKK SY+EAAI+LGKELV R IDLVYGGGS+GLMGLVSQAV
Sbjct  2    EKVESSKFNRICVFCGSSSGKKTSYQEAAIDLGKELVERRIDLVYGGGSVGLMGLVSQAV  61

Query  346  YNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEE  525
            ++GGRHVLGVIPKTL+PRE+TGET+GE++AV+ MHQRKAEMA+ +DAFIALPGGYGTLEE
Sbjct  62   HDGGRHVLGVIPKTLMPRELTGETIGELRAVSGMHQRKAEMARQADAFIALPGGYGTLEE  121

Query  526  LLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELM  705
            LLEVI WAQLGIH KPVGLLNVEGYYNSLL+FIDKAV+EGFISP AR+I VSAP AKEL+
Sbjct  122  LLEVITWAQLGIHQKPVGLLNVEGYYNSLLSFIDKAVDEGFISPIARRIIVSAPTAKELI  181

Query  706  NELEEYNPCHERVASKQKWEKDQLNY  783
             ELEE+ P  + + SK  WE +   Y
Sbjct  182  RELEEHVPEKDEIISKLIWEDEIQRY  207



>ref|XP_007017980.1| Lysine decarboxylase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY15205.1| Lysine decarboxylase family protein, putative isoform 1 [Theobroma 
cacao]
Length=219

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+FKR+CVFCGSS GK+N Y+EAA+ELGKELVSR +DLVYGGGS+GLMGLVSQ V+ GG 
Sbjct  9    SRFKRVCVFCGSSTGKRNCYREAALELGKELVSRRLDLVYGGGSVGLMGLVSQEVHRGGG  68

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HVLG+IPKTL+ +EITGETVGEVK VADMHQRKAEMA+HSD FIALPGGYGTLEELLEVI
Sbjct  69   HVLGIIPKTLMRKEITGETVGEVKPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEVI  128

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGL+NV+GYYNSLLTF+DKAV++GFI P+ R I VSAP A+EL+ +LEE
Sbjct  129  TWAQLGIHDKPVGLINVDGYYNSLLTFLDKAVDDGFIRPSQRSIVVSAPTARELVQKLEE  188

Query  721  YNPCHERVASKQKWEKDQL  777
            Y P H+ V +K +WE +QL
Sbjct  189  YVPLHDGVVAKARWEAEQL  207



>gb|KDP36835.1| hypothetical protein JCGZ_08126 [Jatropha curcas]
Length=220

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            +EK  + +S+FKR+CVFCGSS GKK+ Y++AA+ELGKELVSR +DLVYGGGS GLMGLVS
Sbjct  2    EEKRGVVKSRFKRVCVFCGSSTGKKDCYRDAALELGKELVSRRLDLVYGGGSAGLMGLVS  61

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            Q V+ GG HVLG+IPKTL+ +EITGETVGEV+ VADMHQRKAEMA+HSD FIALPGGYGT
Sbjct  62   QEVHRGGGHVLGIIPKTLMRKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGT  121

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNAK
Sbjct  122  LEELLEVITWAQLGIHDKPVGLLNVDGYYNLLLTFIDKAVDDGFIMPSQRSIIVSAPNAK  181

Query  697  ELMNELEEYNPCHERVASKQKWEKDQL  777
            EL+ +LE+Y P H+ V +K KWE +Q+
Sbjct  182  ELVQKLEDYVPLHDGVVAKAKWEAEQV  208



>ref|XP_010935044.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Elaeis guineensis]
Length=226

 Score =   329 bits (844),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +1

Query  181  SKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGR  360
            S+F+R+CVFCGSSPGKK SY+ AAI+LG ELV RNIDLVYGGGS+GLMG VSQA +NGG 
Sbjct  18   SRFRRVCVFCGSSPGKKASYQLAAIQLGNELVERNIDLVYGGGSVGLMGFVSQAAHNGGC  77

Query  361  HVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVI  540
            HVLGVIP+TL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEVI
Sbjct  78   HVLGVIPRTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVI  137

Query  541  AWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELEE  720
             WAQLGIHDKPVGLLNV+GYYN+LL+FIDKAV+EGFI+P AR I +SA  A EL+++LEE
Sbjct  138  TWAQLGIHDKPVGLLNVDGYYNTLLSFIDKAVDEGFIAPAARHIIISAQTANELLSKLEE  197

Query  721  YNPCHERVASKQKWEKDQLNY  783
            Y P HE VA K KWE +QL +
Sbjct  198  YVPRHEGVAPKLKWEMEQLGH  218



>ref|XP_006386178.1| hypothetical protein POPTR_0002s02560g [Populus trichocarpa]
 gb|ERP63975.1| hypothetical protein POPTR_0002s02560g [Populus trichocarpa]
Length=224

 Score =   329 bits (843),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +1

Query  157  KEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVS  336
            ++++   +S+F+R+CVFCGSSPGK  +Y+ AA++LGK+LV RNIDLVYGGGSIGLMGL+S
Sbjct  7    QQRQPSMKSRFRRVCVFCGSSPGKNPNYQHAAVQLGKQLVERNIDLVYGGGSIGLMGLIS  66

Query  337  QAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGT  516
            QAVY+GGRHVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGT
Sbjct  67   QAVYDGGRHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGT  126

Query  517  LEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAK  696
            LEELLEVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P AR I VSA  A 
Sbjct  127  LEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAHTAH  186

Query  697  ELMNELEEYNPCHERVASKQKWEKDQ  774
            ELM +LE+Y   H  VASK  WE +Q
Sbjct  187  ELMCKLEDYEAEHSGVASKLSWEMEQ  212



>ref|XP_002510515.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF52702.1| carboxy-lyase, putative [Ricinus communis]
Length=224

 Score =   329 bits (843),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 182/211 (86%), Gaps = 1/211 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F R+CVFCGSSPGK  SY+ AAI+LG +LV +NIDLVYGGGSIGLMGLVSQAVY+GG
Sbjct  14   KSRFSRVCVFCGSSPGKNPSYQLAAIQLGHQLVEKNIDLVYGGGSIGLMGLVSQAVYDGG  73

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPKTL+PREITGETVGEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLEELLEV
Sbjct  74   RHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEV  133

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV+EGF++P AR I VSA  A ELM++LE
Sbjct  134  ITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAQTANELMSKLE  193

Query  718  EYNPCHERVASKQKWEKD-QLNY*LIINVIK  807
            EY P H  VA K  WE + QL Y L  ++ +
Sbjct  194  EYVPRHSGVAPKLSWEMEQQLGYTLKTDIAR  224



>ref|XP_006828986.1| hypothetical protein AMTR_s00001p00242250 [Amborella trichopoda]
 gb|ERM96402.1| hypothetical protein AMTR_s00001p00242250 [Amborella trichopoda]
Length=218

 Score =   329 bits (843),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  172  LQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYN  351
            + +S+FKR+CVFCGSS GK+N Y++AA+EL +ELVSR +DLVYGGGS+GLMGLVSQAV+ 
Sbjct  5    VAKSRFKRVCVFCGSSTGKRNCYRDAAVELAEELVSRKMDLVYGGGSVGLMGLVSQAVHR  64

Query  352  GGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELL  531
            GG HVLG+IPKTL+ +EITGETVG+V+ VADMHQRKAEMA+HSDAFIALPGGYGTLEELL
Sbjct  65   GGGHVLGIIPKTLMCKEITGETVGDVRVVADMHQRKAEMARHSDAFIALPGGYGTLEELL  124

Query  532  EVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNE  711
            EVI WAQLGIHDKPVGLLNV+GYYNSLL+FIDKAV++GFI P  R IFVSAP+AKEL+ +
Sbjct  125  EVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDDGFIKPCQRHIFVSAPSAKELVQK  184

Query  712  LEEYNPCHERVASKQKWEKDQLNY  783
            LE+Y P H  V  K +WE +Q+ Y
Sbjct  185  LEDYVPVHNGVVPKARWEVEQVEY  208



>gb|EYU36778.1| hypothetical protein MIMGU_mgv1a013395mg [Erythranthe guttata]
Length=221

 Score =   329 bits (843),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 179/208 (86%), Gaps = 3/208 (1%)
 Frame = +1

Query  151  VGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGL  330
            V K+ EA   S+FKRICVFCGSSPGK  SY+ AA++LG +LV RNIDLVYGGGSIGLMGL
Sbjct  5    VQKQTEA---SRFKRICVFCGSSPGKNPSYQLAAVQLGAQLVERNIDLVYGGGSIGLMGL  61

Query  331  VSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGY  510
            VSQAVYNGGRHVLGVIP TL+PREITGE VGEV+AV+ MHQRKAEM + +DAFIALPGGY
Sbjct  62   VSQAVYNGGRHVLGVIPTTLMPREITGEPVGEVRAVSGMHQRKAEMNRQADAFIALPGGY  121

Query  511  GTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPN  690
            GTLEELLEVI WAQLGIH KPVGLLNV+GYYNSLL+FIDKAV+EGFI+P+AR I +SAP 
Sbjct  122  GTLEELLEVITWAQLGIHHKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIILSAPT  181

Query  691  AKELMNELEEYNPCHERVASKQKWEKDQ  774
            A ELM++LE+Y P H  V SK  WE +Q
Sbjct  182  AHELMSKLEDYIPEHNEVTSKLSWEMEQ  209



>emb|CDP07311.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   328 bits (842),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  160  EKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQ  339
            E E   +S+F+ +CVFCGSS GK+N Y++AA+ELG+ELV+R +DLVYGGGS+GLMGLVSQ
Sbjct  2    EDEEAAKSRFRSVCVFCGSSSGKRNCYRDAALELGQELVARRLDLVYGGGSVGLMGLVSQ  61

Query  340  AVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTL  519
             V+ GGRHVLGVIPKTL+ +EITGETVGEV+ VA+MHQRKAEMA+ SD FIALPGGYGTL
Sbjct  62   EVHRGGRHVLGVIPKTLMCKEITGETVGEVRPVANMHQRKAEMARQSDCFIALPGGYGTL  121

Query  520  EELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKE  699
            EELLEVI WAQLGIHDKPVGLLNVEGYYN+LLTFIDKAVE+GFI P+ R I VSAPNAKE
Sbjct  122  EELLEVITWAQLGIHDKPVGLLNVEGYYNNLLTFIDKAVEDGFIKPSQRHIIVSAPNAKE  181

Query  700  LMNELEEYNPCHERVASKQKWEKDQL  777
            L+ +LEEY P H+ V +K +WE +Q+
Sbjct  182  LLQKLEEYVPVHDEVVAKARWEVEQV  207



>gb|KHN08726.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Glycine soja]
Length=214

 Score =   328 bits (841),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +SKFKRICV+CGSS G K SY+EAA+ELGKE+V R IDLVYGGGS+GLMGLVSQAV++GG
Sbjct  5    KSKFKRICVYCGSSSGNKASYQEAAVELGKEMVERRIDLVYGGGSVGLMGLVSQAVHDGG  64

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
            RHVLGVIPK+L+PREITG+ +GEV+AV+DMHQRKAEMA+ +DAFIALPGGYGTLEELLE+
Sbjct  65   RHVLGVIPKSLMPREITGDPIGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEI  124

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIH KPVGLLNV+G+YNSLL+FIDKAV+EGFISP AR+I VSAP AK+L+ ELE
Sbjct  125  ITWAQLGIHSKPVGLLNVDGFYNSLLSFIDKAVDEGFISPKARRIIVSAPTAKDLVRELE  184

Query  718  EYNPCHERVASKQKWEKDQLNY  783
            E+ P  + V SK  WE D+LNY
Sbjct  185  EHVPERDEVVSKLVWE-DRLNY  205



>ref|XP_009801432.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Nicotiana sylvestris]
Length=219

 Score =   328 bits (842),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 184/209 (88%), Gaps = 2/209 (1%)
 Frame = +1

Query  163  KEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQA  342
            +E  + SKFKRICVFCGSS GKK +Y+EAAIELGK+LV R IDLVYGGGS+GLMGLVSQA
Sbjct  2    EEERRSSKFKRICVFCGSSSGKKPTYQEAAIELGKQLVEREIDLVYGGGSVGLMGLVSQA  61

Query  343  VYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLE  522
            V++GGRHVLGVIP+TL+PREITGET+GEV+AV+ MHQRKAEMA+ +DAFIALPGGYGTLE
Sbjct  62   VHDGGRHVLGVIPRTLMPREITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLE  121

Query  523  ELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKEL  702
            ELLEVI WAQLGIH KPVGLLNVEGYYNSLL+F+DKAV+EGFISP AR+I VSAP A++L
Sbjct  122  ELLEVITWAQLGIHRKPVGLLNVEGYYNSLLSFLDKAVDEGFISPTARRIIVSAPTAQQL  181

Query  703  MNELEEYNPCHERVASKQKWEKD--QLNY  783
            + ELEE+ P  + + SK  WE++  + NY
Sbjct  182  VRELEEHVPETDEITSKLIWEEEVQRFNY  210



>ref|XP_010558160.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG6 isoform X2 [Tarenaya hassleriana]
Length=220

 Score =   328 bits (841),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = +1

Query  145  MEVGKEKEALQQSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLM  324
            ME  +E +  Q S+F+RICVFCGSS GKK SY++AAIELGKELV + IDLVYGGGSIGLM
Sbjct  1    MEEEREMKKRQSSRFRRICVFCGSSHGKKPSYQDAAIELGKELVLKKIDLVYGGGSIGLM  60

Query  325  GLVSQAVYNGGRHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPG  504
            GLVSQAV++GGRHV+GVIPK L+ RE+TGETVGEV+ VADMHQRKAEMAKHSDAFIALPG
Sbjct  61   GLVSQAVHDGGRHVIGVIPKILMLRELTGETVGEVRPVADMHQRKAEMAKHSDAFIALPG  120

Query  505  GYGTLEELLEVIAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSA  684
            GYGTLEELLEVI WAQLGIH+KPVGLLNV+GYYN+LL+FIDKAVEEGFI P+AR+I VSA
Sbjct  121  GYGTLEELLEVITWAQLGIHNKPVGLLNVDGYYNALLSFIDKAVEEGFIRPSAREIIVSA  180

Query  685  PNAKELMNELEEYNPCHERVASKQKWEKDQLNY  783
            P AKEL+ +LEEY P H + ASK   E ++L +
Sbjct  181  PAAKELVKKLEEYVPRHGKEASKFSCEIEELEH  213



>ref|XP_010103315.1| hypothetical protein L484_014355 [Morus notabilis]
 gb|EXB95382.1| hypothetical protein L484_014355 [Morus notabilis]
Length=229

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+F R+CVFCGSS GK+N Y++AAIEL +ELVSR +DLVYGGGSIGLMGLVSQAV+ GG
Sbjct  7    KSRFNRVCVFCGSSTGKRNCYRDAAIELAQELVSRRLDLVYGGGSIGLMGLVSQAVHRGG  66

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
             +VLG+IP+TL+ +EITGETVGEV+AVADMHQRKAEMA+HSD FIALPGGYGTLEELLEV
Sbjct  67   GNVLGIIPRTLMCKEITGETVGEVRAVADMHQRKAEMARHSDCFIALPGGYGTLEELLEV  126

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYNSLLTFIDKAV++GFI P+ R I VSAPNAKEL+ +LE
Sbjct  127  ITWAQLGIHDKPVGLLNVDGYYNSLLTFIDKAVDDGFIKPSQRHIIVSAPNAKELVQKLE  186

Query  718  EYNPCHERVASKQKWEKDQ  774
            EY P H+ V +K +W KD 
Sbjct  187  EYVPVHDGVIAKARWGKDH  205



>emb|CBI18877.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKR+CVFCGSS GK+N Y++AAIEL +ELVSR +DLVYGGGS+GLMGLVSQ V+ GG
Sbjct  3    RSRFKRVCVFCGSSTGKRNCYRDAAIELAQELVSRRLDLVYGGGSVGLMGLVSQEVHRGG  62

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
             HVLG+IPKTL+ +EITGETVGEV+ VADMHQRKAEMA+HSD FIALPGGYGTLEELLEV
Sbjct  63   GHVLGIIPKTLMCKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEV  122

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNA+EL+ +LE
Sbjct  123  ITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIKPSQRHIIVSAPNARELVQKLE  182

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P H+ V +K +WE +QL
Sbjct  183  EYVPVHDGVVAKARWEAEQL  202



>emb|CAN74076.1| hypothetical protein VITISV_000977 [Vitis vinifera]
Length=214

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +1

Query  178  QSKFKRICVFCGSSPGKKNSYKEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGG  357
            +S+FKR+CVFCGSS GK+N Y++AAIEL +ELVSR +DLVYGGGS+GLMGLVSQ V+ GG
Sbjct  3    KSRFKRVCVFCGSSTGKRNCYRDAAIELAQELVSRRLDLVYGGGSVGLMGLVSQEVHRGG  62

Query  358  RHVLGVIPKTLLPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEV  537
             HVLG+IPKTL+ +EITGETVGEV+ VADMHQRKAEMA+HSD FIALPGGYGTLEELLEV
Sbjct  63   GHVLGIIPKTLMCKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEV  122

Query  538  IAWAQLGIHDKPVGLLNVEGYYNSLLTFIDKAVEEGFISPNARQIFVSAPNAKELMNELE  717
            I WAQLGIHDKPVGLLNV+GYYN LLTFIDKAV++GFI P+ R I VSAPNA+EL+ +LE
Sbjct  123  ITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIKPSQRHIIVSAPNARELVQKLE  182

Query  718  EYNPCHERVASKQKWEKDQL  777
            EY P H+ V +K +WE +QL
Sbjct  183  EYVPVHDGVVAKARWEAEQL  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2270289937569