BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8547_g2_i1 len=326 path=[2071:0-325]

Length=326
                                                                      Score     E

ref|XP_006343755.1|  PREDICTED: WAT1-related protein At2g39510-like   85.5    1e-17   
ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like   85.5    2e-17   
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...  83.6    9e-17   
ref|XP_011072598.1|  PREDICTED: WAT1-related protein At2g39510-li...  84.0    1e-16   
ref|XP_009601955.1|  PREDICTED: WAT1-related protein At2g39510-li...  81.6    3e-16   
ref|XP_009601954.1|  PREDICTED: WAT1-related protein At2g39510-li...  82.0    4e-16   
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like   82.0    5e-16   
ref|XP_009798285.1|  PREDICTED: WAT1-related protein At2g39510-like   81.6    5e-16   
ref|XP_004240770.1|  PREDICTED: WAT1-related protein At2g39510        81.3    6e-16   
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like   81.3    8e-16   
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like   81.3    8e-16   
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like   81.3    1e-15   
ref|NP_001057111.2|  Os06g0210000                                     75.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABK25095.1|  unknown                                               80.1    2e-15   Picea sitchensis
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like   80.1    3e-15   
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525           79.7    3e-15   
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg           79.7    3e-15   
emb|CDX99012.1|  BnaC09g48230D                                        78.2    3e-15   
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...  79.7    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050        79.7    3e-15   
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like   79.7    4e-15   
emb|CDX70003.1|  BnaA10g23520D                                        79.0    6e-15   
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                  79.0    6e-15   
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050        79.0    6e-15   
gb|KDP40571.1|  hypothetical protein JCGZ_24570                       78.6    9e-15   
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg           78.6    1e-14   
ref|XP_007133645.1|  hypothetical protein PHAVU_011G1969000g          74.3    1e-14   
ref|XP_007010783.1|  Nodulin MtN21 /EamA-like transporter family ...  77.8    1e-14   
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg           77.8    1e-14   
ref|XP_004236759.1|  PREDICTED: WAT1-related protein At2g39510        77.8    1e-14   
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like   77.8    2e-14   
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like       77.8    2e-14   
ref|XP_010939364.1|  PREDICTED: WAT1-related protein At2g37450 is...  76.3    2e-14   
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050        77.4    2e-14   
ref|XP_002303952.2|  hypothetical protein POPTR_0003s19170g           77.4    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007010782.1|  Nodulin MtN21 /EamA-like transporter family ...  77.4    3e-14   
ref|XP_002299181.1|  hypothetical protein POPTR_0001s06980g           77.0    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like   76.6    3e-14   
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg              76.3    3e-14   
ref|XP_011034692.1|  PREDICTED: WAT1-related protein At5g07050-like   76.6    4e-14   
ref|NP_001141126.1|  uncharacterized protein LOC100273211             76.6    4e-14   Zea mays [maize]
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510        76.3    4e-14   
dbj|BAB92246.1|  putative nodulin MtN21                               76.6    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148990.1|  nodulin protein                                  76.3    5e-14   Zea mays [maize]
gb|EEC71658.1|  hypothetical protein OsI_04113                        76.6    5e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like   76.3    5e-14   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like   76.3    6e-14   
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...  75.9    6e-14   
dbj|BAD35697.1|  putative MtN21                                       75.9    7e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ36228.1|  hypothetical protein OsJ_20548                        75.9    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436678.1|  hypothetical protein SORBIDRAFT_10g006950        75.9    7e-14   Sorghum bicolor [broomcorn]
gb|ABR16695.1|  unknown                                               76.3    8e-14   Picea sitchensis
gb|EAZ00107.1|  hypothetical protein OsI_22111                        75.9    8e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like   75.9    8e-14   
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg           75.9    8e-14   
gb|KHG09563.1|  Auxin-induced 5NG4                                    75.9    8e-14   
ref|XP_006365719.1|  PREDICTED: WAT1-related protein At2g39510-like   75.5    9e-14   
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050        75.5    1e-13   
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like   75.1    1e-13   
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like   75.5    1e-13   
ref|XP_010096006.1|  Auxin-induced protein 5NG4                       75.1    1e-13   
gb|ABR18253.1|  unknown                                               75.5    2e-13   Picea sitchensis
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like   74.7    2e-13   
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                   75.1    2e-13   
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like   74.7    2e-13   
ref|NP_001239827.1|  uncharacterized protein LOC100804390             74.7    2e-13   
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like   74.7    2e-13   
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g           74.3    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg           74.3    3e-13   
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like   73.9    3e-13   
gb|EEC74071.1|  hypothetical protein OsI_09081                        74.3    3e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001048238.1|  Os02g0768300                                     73.9    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like   73.9    3e-13   
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g           73.9    3e-13   
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050        74.3    3e-13   
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like   73.9    4e-13   
ref|XP_004141853.1|  PREDICTED: auxin-induced protein 5NG4-like       73.9    4e-13   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like   73.6    4e-13   
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like   73.6    4e-13   
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like   73.9    4e-13   
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510        73.6    4e-13   Vitis vinifera
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like       73.6    5e-13   
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like   73.6    5e-13   
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like   73.6    5e-13   
ref|XP_004173847.1|  PREDICTED: auxin-induced protein 5NG4-like       71.6    5e-13   
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                   73.9    5e-13   
gb|EMS46950.1|  Auxin-induced protein 5NG4                            72.8    6e-13   
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like   73.6    6e-13   
tpg|DAA57219.1|  TPA: hypothetical protein ZEAMMB73_947627            69.7    6e-13   
ref|XP_002525547.1|  Auxin-induced protein 5NG4, putative             73.6    6e-13   Ricinus communis
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like       72.8    6e-13   
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050        73.6    7e-13   Vitis vinifera
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg              73.2    8e-13   
emb|CDM84603.1|  unnamed protein product                              73.2    8e-13   
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330        72.8    8e-13   Sorghum bicolor [broomcorn]
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050        72.8    1e-12   
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like   73.9    1e-12   
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...  72.8    1e-12   
gb|KGN51609.1|  hypothetical protein Csa_5G584380                     72.0    1e-12   
emb|CDY04680.1|  BnaC05g17180D                                        72.8    1e-12   
gb|EMS46274.1|  Auxin-induced protein 5NG4                            72.8    1e-12   
emb|CAA75575.1|  MtN21                                                72.8    1e-12   Medicago truncatula
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like   72.8    1e-12   
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like   72.4    1e-12   
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg           72.4    1e-12   
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like   72.8    1e-12   
gb|EEC79453.1|  hypothetical protein OsI_20446                        72.4    1e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001055921.1|  Os05g0493800                                     72.4    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like   72.0    1e-12   
dbj|BAK02715.1|  predicted protein                                    72.4    1e-12   
ref|XP_004147717.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...  72.0    1e-12   
ref|XP_004167778.1|  PREDICTED: auxin-induced protein 5NG4-like       72.0    1e-12   
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510        72.0    2e-12   
emb|CDP05672.1|  unnamed protein product                              72.0    2e-12   
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890        72.0    2e-12   
ref|XP_004166081.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...  72.0    2e-12   
emb|CDP06236.1|  unnamed protein product                              72.0    2e-12   
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like       72.0    2e-12   
emb|CDY00403.1|  BnaC07g14230D                                        72.0    2e-12   
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like   72.0    2e-12   
ref|XP_008461651.1|  PREDICTED: WAT1-related protein At2g39510-li...  71.6    2e-12   
ref|XP_004144320.1|  PREDICTED: auxin-induced protein 5NG4-like       72.0    2e-12   
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like   71.6    2e-12   
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg           72.0    2e-12   
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like   71.6    2e-12   
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like   71.6    2e-12   
gb|ACJ84240.1|  unknown                                               70.1    2e-12   Medicago truncatula
ref|XP_003590514.1|  Auxin-induced protein 5NG4                       70.1    2e-12   
ref|XP_008461650.1|  PREDICTED: WAT1-related protein At2g39510-li...  71.6    2e-12   
gb|KCW65508.1|  hypothetical protein EUGRSUZ_G02912                   71.6    2e-12   
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                   72.0    3e-12   
gb|KHG29332.1|  Auxin-induced 5NG4                                    71.6    3e-12   
ref|XP_008461649.1|  PREDICTED: WAT1-related protein At2g39510-li...  71.6    3e-12   
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like   71.6    3e-12   
ref|XP_010067380.1|  PREDICTED: WAT1-related protein At2g39510-like   71.6    3e-12   
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like   71.6    3e-12   
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like   71.6    3e-12   
gb|EMT18779.1|  Auxin-induced protein 5NG4                            71.2    3e-12   
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like   71.2    3e-12   
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g           71.2    3e-12   
gb|EMT31802.1|  Auxin-induced protein 5NG4                            71.2    3e-12   
gb|KDP35589.1|  hypothetical protein JCGZ_09027                       71.2    4e-12   
gb|EMT33815.1|  Auxin-induced protein 5NG4                            71.2    4e-12   
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g           71.2    4e-12   
ref|XP_008461645.1|  PREDICTED: WAT1-related protein At2g39510-like   70.9    4e-12   
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like   70.9    4e-12   
ref|XP_004498423.1|  PREDICTED: WAT1-related protein At4g08290-like   70.9    5e-12   
tpg|DAA57218.1|  TPA: hypothetical protein ZEAMMB73_947627            69.7    5e-12   
gb|EMS45468.1|  Auxin-induced protein 5NG4                            70.9    5e-12   
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050        71.2    5e-12   
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like   70.9    5e-12   
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g           70.9    5e-12   Populus trichocarpa [western balsam poplar]
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                  70.9    5e-12   
ref|XP_003548654.1|  PREDICTED: uncharacterized protein LOC100792261  71.2    6e-12   
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like   70.9    6e-12   
emb|CDY01310.1|  BnaA07g10830D                                        70.5    6e-12   
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050        70.5    6e-12   
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like   70.5    6e-12   
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like   70.5    6e-12   
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like   70.5    6e-12   
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like   70.5    6e-12   
gb|EYU28757.1|  hypothetical protein MIMGU_mgv1a023410mg              69.3    7e-12   
ref|XP_010097389.1|  Auxin-induced protein 5NG4                       70.1    7e-12   
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050        70.5    7e-12   
gb|EMS55812.1|  Auxin-induced protein 5NG4                            70.1    7e-12   
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg              70.1    8e-12   
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like   70.1    8e-12   
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like       70.1    9e-12   
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like   70.1    9e-12   
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like   70.1    9e-12   
gb|EMT14666.1|  Auxin-induced protein 5NG4                            70.1    9e-12   
gb|EMS60726.1|  Auxin-induced protein 5NG4                            69.3    9e-12   
ref|XP_003590513.1|  Auxin-induced protein 5NG4                       69.7    9e-12   
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like   70.1    9e-12   
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...  70.1    9e-12   
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050        70.1    1e-11   
ref|XP_010498646.1|  PREDICTED: WAT1-related protein At1g21890-like   70.1    1e-11   
ref|XP_009778858.1|  PREDICTED: WAT1-related protein At2g37460-li...  69.7    1e-11   
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890        70.1    1e-11   
gb|EMT04611.1|  Auxin-induced protein 5NG4                            70.1    1e-11   
gb|EPS57420.1|  hypothetical protein M569_17398                       68.2    1e-11   
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like   70.1    1e-11   
ref|NP_001150619.1|  nodulin-like protein                             70.1    1e-11   Zea mays [maize]
gb|ACL54205.1|  unknown                                               70.1    1e-11   Zea mays [maize]
ref|XP_002893187.1|  T26F17.11                                        69.7    1e-11   
dbj|BAJ98418.1|  predicted protein                                    69.7    1e-11   
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...  69.7    1e-11   
gb|KDO67717.1|  hypothetical protein CISIN_1g045242mg                 68.2    1e-11   
gb|EMT08224.1|  Auxin-induced protein 5NG4                            68.9    1e-11   
ref|XP_009614497.1|  PREDICTED: WAT1-related protein At2g37460-li...  69.3    1e-11   
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like   69.7    1e-11   
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like   69.7    1e-11   
gb|EEC66708.1|  hypothetical protein OsI_33031                        65.5    1e-11   Oryza sativa Indica Group [Indian rice]
gb|KHN09434.1|  Auxin-induced protein 5NG4                            69.3    1e-11   
ref|XP_002440000.1|  hypothetical protein SORBIDRAFT_09g024200        69.3    2e-11   Sorghum bicolor [broomcorn]
ref|NP_001055529.2|  Os05g0409500                                     69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like   69.3    2e-11   
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like   69.3    2e-11   
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg              69.3    2e-11   
dbj|BAJ92223.1|  predicted protein                                    69.3    2e-11   
gb|EAY98030.1|  hypothetical protein OsI_19945                        69.3    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like   69.3    2e-11   
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g           69.3    2e-11   
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like   68.9    2e-11   
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like   69.3    2e-11   
ref|XP_002302243.2|  nodulin MtN21 family protein                     68.9    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...  68.9    2e-11   
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                   68.9    2e-11   
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like   68.9    2e-11   
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like   68.9    2e-11   
emb|CAH58631.1|  nodulin-like protein                                 68.9    2e-11   Plantago major [cart-track plant]
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like   68.9    2e-11   
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g           69.3    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like   68.9    2e-11   
ref|NP_001170095.1|  hypothetical protein                             69.3    2e-11   Zea mays [maize]
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative             68.9    2e-11   Ricinus communis
gb|KHG29659.1|  Auxin-induced 5NG4                                    68.9    3e-11   
ref|XP_009141949.1|  PREDICTED: WAT1-related protein At2g40900-like   68.9    3e-11   
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg           68.9    3e-11   
ref|XP_004493899.1|  PREDICTED: WAT1-related protein At2g37460-li...  68.6    3e-11   
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like   68.6    3e-11   
gb|KHG26265.1|  Auxin-induced 5NG4                                    68.6    3e-11   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...  68.6    3e-11   
emb|CDY06954.1|  BnaA04g23610D                                        68.6    3e-11   
ref|XP_006836228.1|  hypothetical protein AMTR_s00101p00110290        65.9    3e-11   
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like   68.6    3e-11   
ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg           68.6    3e-11   
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative             68.6    3e-11   Ricinus communis
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...  68.9    3e-11   
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like   68.9    3e-11   
gb|AFK45347.1|  unknown                                               65.1    3e-11   
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like   68.6    3e-11   
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like   68.6    3e-11   
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050        68.6    3e-11   
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like   68.6    3e-11   
gb|EMS48876.1|  Auxin-induced protein 5NG4                            68.6    3e-11   
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050        68.6    3e-11   Vitis vinifera
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein               68.6    3e-11   
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...  68.2    4e-11   
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like   68.6    4e-11   
gb|KHN12126.1|  Auxin-induced protein 5NG4                            66.6    4e-11   
ref|XP_003566095.1|  PREDICTED: WAT1-related protein At5g07050-like   68.2    4e-11   
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like   68.6    4e-11   
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050        68.6    4e-11   
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like   68.6    4e-11   
gb|ACR34989.1|  unknown                                               68.2    4e-11   Zea mays [maize]
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200        68.2    4e-11   Sorghum bicolor [broomcorn]
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like   68.2    4e-11   
gb|ACU23200.1|  unknown                                               68.2    4e-11   Glycine max [soybeans]
ref|XP_008455745.1|  PREDICTED: WAT1-related protein At5g07050-like   68.6    5e-11   
ref|NP_173607.1|  WAT1-related protein                                68.2    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516269.1|  PREDICTED: WAT1-related protein At3g56620-like   68.2    5e-11   
gb|EYU18591.1|  hypothetical protein MIMGU_mgv1a007543mg              68.2    5e-11   
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g           68.2    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like   68.2    5e-11   
ref|XP_010427496.1|  PREDICTED: WAT1-related protein At3g56620 is...  67.8    5e-11   
gb|AAF16542.1|AC013482_16  T26F17.11                                  68.2    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42327.1|  hypothetical protein AALP_AA2G241800                  67.8    5e-11   
emb|CDY22493.1|  BnaC03g23030D                                        65.9    5e-11   
gb|AAL38712.1|  putative nodulin protein                              67.8    5e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK04850.1|  predicted protein                                    67.8    6e-11   
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like   67.8    6e-11   Vitis vinifera
ref|XP_010906432.1|  PREDICTED: WAT1-related protein At5g07050-like   67.8    6e-11   
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like   67.8    6e-11   
ref|XP_002881508.1|  predicted protein                                67.4    6e-11   
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like   67.8    6e-11   
ref|XP_003544679.1|  PREDICTED: WAT1-related protein At4g08290-like   67.8    6e-11   
gb|ACU17314.1|  unknown                                               66.2    6e-11   Glycine max [soybeans]
gb|KHN33864.1|  Auxin-induced protein 5NG4                            67.8    7e-11   
gb|KGN54575.1|  hypothetical protein Csa_4G365050                     67.8    7e-11   
ref|XP_003601055.1|  Auxin-induced protein 5NG4                       65.9    7e-11   
ref|XP_010427495.1|  PREDICTED: WAT1-related protein At3g56620 is...  67.8    7e-11   
emb|CBI32681.3|  unnamed protein product                              67.4    7e-11   
emb|CDY35431.1|  BnaA03g19290D                                        67.8    7e-11   
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050        67.4    7e-11   
gb|KEH40540.1|  auxin-induced 5NG4-like protein                       67.4    7e-11   
ref|XP_009133465.1|  PREDICTED: WAT1-related protein At2g40900-like   67.4    8e-11   
ref|NP_001137108.1|  hypothetical protein                             67.4    8e-11   Zea mays [maize]
ref|XP_010554740.1|  PREDICTED: WAT1-related protein At2g40900-like   67.4    8e-11   
ref|XP_010108640.1|  Auxin-induced protein 5NG4                       67.4    8e-11   
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like   67.4    8e-11   
ref|NP_001151393.1|  nodulin-like protein                             67.4    8e-11   
gb|AFW78503.1|  nodulin-like protein                                  67.4    9e-11   
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like       67.4    9e-11   
ref|XP_009610630.1|  PREDICTED: WAT1-related protein At5g07050-li...  67.0    9e-11   
ref|XP_009790910.1|  PREDICTED: WAT1-related protein At5g07050-li...  67.0    9e-11   
ref|XP_009621490.1|  PREDICTED: WAT1-related protein At5g07050-li...  67.0    9e-11   
emb|CDX72122.1|  BnaC08g27520D                                        67.0    9e-11   
ref|XP_010534681.1|  PREDICTED: WAT1-related protein At1g21890 is...  67.0    9e-11   
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like   67.0    1e-10   
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg              67.0    1e-10   
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like   67.4    1e-10   
emb|CDY68060.1|  BnaCnng57410D                                        67.4    1e-10   
ref|XP_003601054.1|  Auxin-induced protein 5NG4                       65.9    1e-10   
gb|KGN51272.1|  hypothetical protein Csa_5G505820                     67.0    1e-10   
emb|CDY14752.1|  BnaC04g47490D                                        67.0    1e-10   
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg           67.0    1e-10   
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...  67.0    1e-10   
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like       67.0    1e-10   
ref|XP_011019905.1|  PREDICTED: WAT1-related protein At2g37460-li...  66.2    1e-10   
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...  67.4    1e-10   
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like   67.0    1e-10   
ref|XP_010505847.1|  PREDICTED: WAT1-related protein At2g40900-like   67.0    1e-10   
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg           67.0    1e-10   
ref|XP_008237581.1|  PREDICTED: WAT1-related protein At1g43650        66.6    1e-10   
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like   67.0    1e-10   
emb|CDX93378.1|  BnaC04g45180D                                        67.0    1e-10   
ref|XP_010517531.1|  PREDICTED: WAT1-related protein At2g40900        67.0    1e-10   
ref|XP_003619060.1|  Auxin-induced protein 5NG4                       66.6    1e-10   
ref|XP_010530196.1|  PREDICTED: WAT1-related protein At4g08300-like   66.6    1e-10   
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390        67.0    1e-10   
ref|XP_006599493.1|  PREDICTED: WAT1-related protein At1g43650-like   65.1    1e-10   
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg           66.6    1e-10   
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...  66.6    1e-10   
gb|AFK34273.1|  unknown                                               66.6    1e-10   
ref|XP_008463491.1|  PREDICTED: WAT1-related protein At2g39510-li...  66.2    1e-10   
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like   66.6    1e-10   
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...  66.6    1e-10   
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...  66.2    1e-10   
ref|XP_002881745.1|  nodulin MtN21 family protein                     66.6    1e-10   
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...  66.6    1e-10   
ref|XP_006574803.1|  PREDICTED: WAT1-related protein At1g43650 is...  66.2    1e-10   
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...  66.2    1e-10   
ref|XP_006349970.1|  PREDICTED: WAT1-related protein At2g37460-like   67.0    1e-10   
gb|KHG24903.1|  Auxin-induced 5NG4                                    66.6    2e-10   
ref|XP_007019492.1|  Nodulin MtN21 /EamA-like transporter family ...  66.2    2e-10   
gb|ABG65998.1|  nodulin MtN21 family protein, putative, expressed     65.9    2e-10   
ref|XP_011070209.1|  PREDICTED: WAT1-related protein At5g07050-like   65.1    2e-10   
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed     65.9    2e-10   
gb|EMS60728.1|  Auxin-induced protein 5NG4                            66.6    2e-10   
emb|CDX76001.1|  BnaA04g02650D                                        66.2    2e-10   
ref|XP_009139089.1|  PREDICTED: WAT1-related protein At3g56620-like   66.2    2e-10   
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like   66.2    2e-10   
gb|ADN33888.1|  nodulin-like protein                                  66.2    2e-10   
ref|NP_181282.1|  nodulin MtN21-like transporter family protein       66.2    2e-10   
ref|XP_006411357.1|  hypothetical protein EUTSA_v10016763mg           66.2    2e-10   
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like   66.2    2e-10   
ref|XP_010508790.1|  PREDICTED: WAT1-related protein At2g40900-like   66.2    2e-10   
ref|XP_010525433.1|  PREDICTED: WAT1-related protein At2g40900        66.2    2e-10   
ref|XP_007152023.1|  hypothetical protein PHAVU_004G095100g           65.9    2e-10   
gb|KGN59421.1|  hypothetical protein Csa_3G819780                     65.1    2e-10   
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                  66.2    2e-10   
ref|XP_003518600.1|  PREDICTED: WAT1-related protein At1g43650 is...  66.2    2e-10   
emb|CDX79964.1|  BnaA05g01920D                                        66.2    2e-10   
ref|XP_006294359.1|  hypothetical protein CARUB_v10023376mg           66.2    2e-10   
ref|XP_009142715.1|  PREDICTED: WAT1-related protein At2g40900-like   66.2    2e-10   
emb|CDY53669.1|  BnaC04g52190D                                        66.2    2e-10   
ref|XP_002878097.1|  hypothetical protein ARALYDRAFT_486104           66.2    2e-10   
ref|XP_008463490.1|  PREDICTED: WAT1-related protein At2g39510-li...  66.2    2e-10   
ref|XP_007152024.1|  hypothetical protein PHAVU_004G095100g           65.9    2e-10   
ref|XP_008233583.1|  PREDICTED: WAT1-related protein At2g37460-li...  65.1    2e-10   
ref|XP_006287944.1|  hypothetical protein CARUB_v10001177mg           66.2    2e-10   
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like   65.9    3e-10   
gb|KFK34904.1|  hypothetical protein AALP_AA5G208800                  65.9    3e-10   
ref|NP_191221.1|  nodulin MtN21-like transporter family protein       65.9    3e-10   
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g           65.9    3e-10   
gb|KHN41271.1|  Auxin-induced protein 5NG4                            65.5    3e-10   
ref|XP_002513792.1|  Auxin-induced protein 5NG4, putative             65.9    3e-10   
ref|XP_004494996.1|  PREDICTED: WAT1-related protein At2g37460-li...  64.7    3e-10   
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1          65.5    3e-10   
gb|EEC66707.1|  hypothetical protein OsI_33030                        65.5    3e-10   
ref|XP_002893995.1|  nodulin MtN21 family protein                     65.5    3e-10   
ref|NP_001064323.1|  Os10g0210500                                     65.5    3e-10   
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like   65.9    3e-10   
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like   65.5    3e-10   
gb|ACU19645.1|  unknown                                               65.5    4e-10   
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460        65.5    4e-10   
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like   65.1    4e-10   
gb|AFW81938.1|  hypothetical protein ZEAMMB73_476289                  65.9    4e-10   
ref|XP_004964911.1|  PREDICTED: WAT1-related protein At1g44800-like   65.5    4e-10   
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like       65.5    4e-10   
emb|CDY07016.1|  BnaA04g22990D                                        65.5    4e-10   
gb|AFK37263.1|  unknown                                               65.5    4e-10   
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510        65.5    4e-10   
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like   65.1    4e-10   
ref|XP_004164556.1|  PREDICTED: auxin-induced protein 5NG4-like       64.7    5e-10   
ref|XP_007141062.1|  hypothetical protein PHAVU_008G164100g           65.5    5e-10   
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg           65.1    5e-10   
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                  65.1    5e-10   
gb|ACU17518.1|  unknown                                               63.2    5e-10   
gb|KHN03657.1|  Putative UDP-rhamnose:rhamnosyltransferase 1          65.1    5e-10   
ref|XP_008233582.1|  PREDICTED: WAT1-related protein At2g39510-li...  64.7    5e-10   
gb|EMT13376.1|  Auxin-induced protein 5NG4                            65.5    5e-10   
gb|KDP42991.1|  hypothetical protein JCGZ_25177                       65.1    5e-10   
ref|XP_010665126.1|  PREDICTED: WAT1-related protein At1g43650 is...  64.3    5e-10   
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510        65.1    5e-10   
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800        65.1    5e-10   
ref|XP_007137395.1|  hypothetical protein PHAVU_009G1236001g          62.4    6e-10   
gb|AAM62626.1|  nodulin protein, putative                             65.1    6e-10   
ref|XP_003628011.1|  Auxin-induced protein 5NG4                       65.1    6e-10   
ref|XP_002881660.1|  nodulin MtN21 family protein                     65.1    6e-10   
gb|ABS52574.1|  nodulin family protein                                65.1    6e-10   
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like   65.1    6e-10   
emb|CDX93255.1|  BnaC04g46410D                                        64.7    6e-10   
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like   64.7    6e-10   
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg           64.7    6e-10   
ref|XP_003566093.1|  PREDICTED: uncharacterized protein LOC100824174  65.9    6e-10   
emb|CDY20446.1|  BnaC04g05980D                                        64.7    7e-10   
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290        64.7    7e-10   
ref|NP_192570.2|  nodulin MtN21 /EamA-like transporter family pro...  64.7    7e-10   
emb|CDY53594.1|  BnaA05g34670D                                        64.7    7e-10   
ref|XP_004494995.1|  PREDICTED: WAT1-related protein At2g37460-li...  64.3    7e-10   
emb|CDP04273.1|  unnamed protein product                              64.7    7e-10   
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like       64.7    7e-10   
ref|XP_002872390.1|  nodulin MtN21 family protein                     64.7    7e-10   
ref|XP_010504569.1|  PREDICTED: WAT1-related protein At3g56620-like   64.7    7e-10   
ref|NP_001242267.1|  uncharacterized protein LOC100811617             64.7    7e-10   
ref|XP_007200352.1|  hypothetical protein PRUPE_ppa008158mg           64.3    7e-10   
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like   64.7    7e-10   
ref|NP_181622.2|  nodulin MtN21-like transporter family protein       64.7    7e-10   
gb|KHN00763.1|  Auxin-induced protein 5NG4                            64.7    7e-10   
ref|NP_181483.1|  nodulin MtN21-like transporter family protein       64.7    7e-10   
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g           65.1    7e-10   
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg           64.7    7e-10   
gb|AAM64766.1|  nodulin-like protein                                  64.7    8e-10   
gb|KGN61714.1|  hypothetical protein Csa_2G231960                     64.7    8e-10   
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like       64.7    8e-10   
emb|CDY56779.1|  BnaAnng14440D                                        64.7    8e-10   
dbj|BAK04730.1|  predicted protein                                    64.3    8e-10   
gb|AAB86450.1|  putative integral membrane protein nodulin            64.7    8e-10   
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890        64.7    8e-10   
emb|CDX94896.1|  BnaC05g07750D                                        64.3    8e-10   
gb|KGN59418.1|  hypothetical protein Csa_3G818270                     64.7    8e-10   
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like       64.7    8e-10   
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg           64.3    8e-10   
gb|KHN12183.1|  Auxin-induced protein 5NG4                            64.3    8e-10   
emb|CDX79735.1|  BnaC03g20710D                                        63.5    9e-10   
ref|XP_007019493.1|  Nodulin MtN21 /EamA-like transporter family ...  64.3    9e-10   
ref|XP_006305116.1|  hypothetical protein CARUB_v10009485mg           64.3    9e-10   
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like   64.3    9e-10   
ref|XP_003601053.1|  Auxin-induced protein 5NG4                       64.3    9e-10   
ref|XP_007019490.1|  Nodulin MtN21 /EamA-like transporter family ...  64.3    9e-10   
ref|XP_004493329.1|  PREDICTED: WAT1-related protein At5g07050-li...  63.9    1e-09   
emb|CDY12554.1|  BnaC06g00800D                                        64.3    1e-09   
ref|XP_002266148.1|  PREDICTED: WAT1-related protein At1g43650 is...  64.3    1e-09   
ref|XP_006578975.1|  PREDICTED: WAT1-related protein At1g21890-like   60.8    1e-09   
ref|XP_002302179.1|  hypothetical protein POPTR_0002s06890g           64.3    1e-09   
ref|XP_009123503.1|  PREDICTED: WAT1-related protein At1g44800-like   64.3    1e-09   
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like   64.3    1e-09   
ref|XP_004494994.1|  PREDICTED: WAT1-related protein At2g37460-li...  63.9    1e-09   
emb|CDY14996.1|  BnaA10g08600D                                        64.3    1e-09   
ref|NP_565861.1|  nodulin MtN21 /EamA-like transporter family pro...  63.5    1e-09   
ref|XP_007019491.1|  Nodulin MtN21 /EamA-like transporter family ...  63.9    1e-09   
gb|KHN05928.1|  Auxin-induced protein 5NG4                            64.3    1e-09   
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...  64.3    1e-09   
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like   64.3    1e-09   
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...  64.3    1e-09   
emb|CDY18444.1|  BnaA04g21430D                                        64.3    1e-09   
ref|XP_006402969.1|  hypothetical protein EUTSA_v10006038mg           63.9    1e-09   
ref|XP_011042852.1|  PREDICTED: WAT1-related protein At1g43650-like   63.9    1e-09   
emb|CDY63536.1|  BnaCnng42250D                                        63.5    1e-09   
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like   63.9    1e-09   
ref|XP_004253170.1|  PREDICTED: WAT1-related protein At2g37460-like   64.3    1e-09   
ref|XP_010111209.1|  Auxin-induced protein 5NG4                       64.3    1e-09   
gb|KFK36195.1|  hypothetical protein AALP_AA4G090300                  63.9    1e-09   
ref|XP_002312071.1|  nodulin MtN21 family protein                     63.9    1e-09   
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like   63.9    1e-09   
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like   63.9    1e-09   
gb|KGN54680.1|  hypothetical protein Csa_4G420210                     63.9    1e-09   
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like   63.9    1e-09   
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like   63.9    1e-09   
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...  63.9    1e-09   
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460        63.9    1e-09   
ref|XP_009604082.1|  PREDICTED: WAT1-related protein At1g43650        63.5    1e-09   
ref|XP_004136770.1|  PREDICTED: auxin-induced protein 5NG4-like       63.5    1e-09   
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...  63.9    2e-09   
emb|CBI18201.3|  unnamed protein product                              63.5    2e-09   
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                  63.5    2e-09   
gb|KGN59420.1|  hypothetical protein Csa_3G819280                     63.5    2e-09   
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510        63.5    2e-09   
ref|XP_009793606.1|  PREDICTED: WAT1-related protein At1g43650-like   63.5    2e-09   
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300        63.5    2e-09   
ref|XP_010436420.1|  PREDICTED: WAT1-related protein At4g08300-like   63.5    2e-09   
gb|KHG16518.1|  Auxin-induced 5NG4                                    63.5    2e-09   
gb|AFK37217.1|  unknown                                               63.5    2e-09   
gb|ACU18786.1|  unknown                                               61.6    2e-09   
gb|KDO67719.1|  hypothetical protein CISIN_1g042257mg                 63.5    2e-09   
gb|KDP32785.1|  hypothetical protein JCGZ_12077                       63.5    2e-09   
ref|XP_006436052.1|  hypothetical protein CICLE_v10031808mg           63.5    2e-09   
ref|XP_003625520.1|  Auxin-induced protein 5NG4                       63.5    2e-09   
gb|KHG23400.1|  Auxin-induced 5NG4                                    63.5    2e-09   
ref|XP_006434457.1|  hypothetical protein CICLE_v10001572mg           63.5    2e-09   
gb|KHG10291.1|  Auxin-induced 5NG4                                    63.5    2e-09   
emb|CAB45800.1|  nodulin-like protein                                 63.5    2e-09   
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like   63.2    2e-09   
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...  63.5    2e-09   
ref|XP_006851384.1|  hypothetical protein AMTR_s00040p00026230        63.5    2e-09   
ref|XP_006359837.1|  PREDICTED: WAT1-related protein At1g43650-like   63.2    2e-09   
ref|XP_006473056.1|  PREDICTED: WAT1-related protein At1g43650-like   63.5    2e-09   
emb|CDY07788.1|  BnaA03g17230D                                        63.2    2e-09   
gb|KHN48995.1|  Auxin-induced protein 5NG4                            63.5    2e-09   
ref|XP_002489200.1|  hypothetical protein SORBIDRAFT_0012s002110      63.2    2e-09   
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like   63.5    2e-09   
emb|CDX79734.1|  BnaC03g20700D                                        63.2    2e-09   
ref|XP_007137398.1|  hypothetical protein PHAVU_009G123700g           63.2    2e-09   
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like   63.5    2e-09   
gb|KDO83730.1|  hypothetical protein CISIN_1g017672mg                 63.2    2e-09   
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like   63.5    2e-09   
ref|XP_006429015.1|  hypothetical protein CICLE_v10012001mg           63.2    2e-09   
gb|ACD56621.1|  putative nodulin-like protein                         63.2    2e-09   



>ref|XP_006343755.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=276

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            Q KPY AV  LQFGYAG A+IAK+ALN+GM+H+TFAVYRN+ AT++FAPFA  F
Sbjct  40   QGKPYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALLF  93



>ref|XP_006343754.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=366

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K + + KPY AV  LQFGYAG A+IAK+ALN+GM+H+TFAVYRN+ AT++FAPFA  F
Sbjct  6    KFVKEGKPYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALLF  63



>ref|XP_011072605.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Sesamum 
indicum]
Length=379

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K L ++KPY AVI LQFG  G A+IAK+ALN+GM+HYTF+VYRN+ ATV+ APFA   
Sbjct  4    KFLRKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVL  61



>ref|XP_011072598.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Sesamum 
indicum]
Length=386

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K L ++KPY AVI LQFG  G A+IAK+ALN+GM+HYTF+VYRN+ ATV+ APFA   
Sbjct  4    KFLRKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVL  61



>ref|XP_009601955.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K + +++PY AVI LQFGYAG A+IAK+ALN+GM+H+TFAVYRN  AT++FAPFA   
Sbjct  9    KFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVFAPFAIVL  66



>ref|XP_009601954.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Nicotiana 
tomentosiformis]
Length=372

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K + +++PY AVI LQFGYAG A+IAK+ALN+GM+H+TFAVYRN  AT++FAPFA   
Sbjct  9    KFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVFAPFAIVL  66



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  128  QLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFA  307
            Q+   S  ++ +++KP+ AVIFLQ G AGMA+IAK AL+ G+NHYTF VYRN  AT + +
Sbjct  4    QMPIQSPSRLFSKAKPFLAVIFLQLGLAGMAIIAKLALDEGLNHYTFVVYRNFIATCVIS  63

Query  308  PFAF  319
            PFA 
Sbjct  64   PFAI  67



>ref|XP_009798285.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana sylvestris]
Length=372

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K + +++PY AVI LQFGYAG A+IAK+ALN+GM+H+TFAVYRN+ AT +FAPFA   
Sbjct  9    KFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATFVFAPFAMVL  66



>ref|XP_004240770.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=364

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K + + K Y AV  LQFGYAG A+IAK+ALN+GM+H+TFAVYRN+ AT++FAPFA  F
Sbjct  6    KFVKEGKAYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALVF  63



>ref|XP_009361913.1| PREDICTED: WAT1-related protein At5g07050-like [Pyrus x bretschneideri]
Length=396

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT I APFAFFF
Sbjct  8    GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPFAFFF  66



>ref|XP_008375333.1| PREDICTED: WAT1-related protein At5g07050-like [Malus domestica]
Length=392

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT I APFAFFF
Sbjct  7    GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPFAFFF  65



>ref|XP_008346651.1| PREDICTED: WAT1-related protein At5g07050-like [Malus domestica]
Length=395

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT I APFAFFF
Sbjct  8    GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPFAFFF  66



>ref|NP_001057111.2| Os06g0210000 [Oryza sativa Japonica Group]
 dbj|BAF19025.2| Os06g0210000 [Oryza sativa Japonica Group]
Length=64

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+ L+ +KPY A++ LQ G+AGM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGRALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFAL  60

Query  320  FF  325
              
Sbjct  61   LL  62



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K++ +SKPY A+I LQFGYAGM +I K +LN GMNH+   VYR+  ATV+ APFAFF 
Sbjct  3    KLIERSKPYVAMISLQFGYAGMNIITKVSLNRGMNHFVLVVYRHAAATVVLAPFAFFI  60



>ref|XP_009370627.1| PREDICTED: WAT1-related protein At5g07050-like [Pyrus x bretschneideri]
Length=395

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT I APFAFFF
Sbjct  8    GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAIIAPFAFFF  66



>ref|XP_002873292.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49551.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF
Sbjct  8    SCESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  323  F  325
            F
Sbjct  68   F  68



>ref|XP_006289728.1| hypothetical protein CARUB_v10003296mg [Capsella rubella]
 gb|EOA22626.1| hypothetical protein CARUB_v10003296mg [Capsella rubella]
Length=391

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF
Sbjct  8    SCESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  323  F  325
            F
Sbjct  68   F  68



>emb|CDX99012.1| BnaC09g48230D [Brassica napus]
Length=224

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  13   LKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFF  68



>ref|NP_196322.3| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9FL41.1|WTR38_ARATH RecName: Full=WAT1-related protein At5g07050 [Arabidopsis thaliana]
 dbj|BAB11163.1| MtN21 nodulin protein-like [Arabidopsis thaliana]
 gb|AED91102.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=402

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF
Sbjct  8    SCESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  323  F  325
            F
Sbjct  68   F  68



>ref|XP_010423261.1| PREDICTED: WAT1-related protein At5g07050 [Camelina sativa]
Length=399

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF
Sbjct  8    SCESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  323  F  325
            F
Sbjct  68   F  68



>ref|XP_010495095.1| PREDICTED: WAT1-related protein At5g07050-like [Camelina sativa]
Length=396

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF
Sbjct  8    SCESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  323  F  325
            F
Sbjct  68   F  68



>emb|CDX70003.1| BnaA10g23520D [Brassica napus]
Length=399

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  13   LKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFF  68



>gb|KFK25097.1| hypothetical protein AALP_AA8G066000 [Arabis alpina]
Length=406

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  13   LKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFF  68



>ref|XP_009122385.1| PREDICTED: WAT1-related protein At5g07050 [Brassica rapa]
Length=399

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  13   LKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFF  68



>gb|KDP40571.1| hypothetical protein JCGZ_24570 [Jatropha curcas]
Length=407

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S  K L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAF 
Sbjct  7    SCLKFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVIAPFAFI  66

Query  323  F  325
            F
Sbjct  67   F  67



>ref|XP_006399183.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
 gb|ESQ40636.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
Length=406

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA++ LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  13   LKSSKPYFAMVSLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFF  68



>ref|XP_007133645.1| hypothetical protein PHAVU_011G1969000g, partial [Phaseolus vulgaris]
 gb|ESW05639.1| hypothetical protein PHAVU_011G1969000g, partial [Phaseolus vulgaris]
Length=91

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + K  A SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAF F
Sbjct  9    SAKFFASSKPYLAMISLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATAVIAPFAFIF  68



>ref|XP_007010783.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY19593.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=364

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +  +  G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + AP
Sbjct  1    MEKLRCGSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAP  60

Query  311  FAFFF  325
            FA  F
Sbjct  61   FALIF  65



>ref|XP_007218075.1| hypothetical protein PRUPE_ppa006848mg [Prunus persica]
 gb|EMJ19274.1| hypothetical protein PRUPE_ppa006848mg [Prunus persica]
Length=393

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  11   LESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAFFF  66



>ref|XP_004236759.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=376

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNL  286
            K+L +SKPY AVIFLQFG+ G A+IAK ALNNGM+HYTF+VYRNL
Sbjct  11   KLLKRSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNL  55



>ref|XP_010456426.1| PREDICTED: WAT1-related protein At5g07050-like [Camelina sativa]
Length=399

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF
Sbjct  8    SCESFLTTSKPYLAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  323  F  325
            F
Sbjct  68   F  68



>ref|XP_004307206.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  11   LENSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAFFF  66



>ref|XP_010939364.1| PREDICTED: WAT1-related protein At2g37450 isoform X2 [Elaeis 
guineensis]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M+ G++++++KPY A++FLQ GYAGM VI+ A+L  GMNHY   VYRN  A    APFA 
Sbjct  1    MAFGEVVSKAKPYLAMVFLQVGYAGMYVISVASLKRGMNHYVLVVYRNAVAVAAIAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_011020462.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=406

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
               K L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA F
Sbjct  6    CCSKFLESSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALF  65

Query  323  F  325
            F
Sbjct  66   F  66



>ref|XP_002303952.2| hypothetical protein POPTR_0003s19170g [Populus trichocarpa]
 gb|EEE78931.2| hypothetical protein POPTR_0003s19170g [Populus trichocarpa]
Length=406

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
               K L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA F
Sbjct  6    CCSKFLESSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALF  65

Query  323  F  325
            F
Sbjct  66   F  66



>ref|XP_007010782.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY19592.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=437

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +  +  G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + AP
Sbjct  1    MEKLRCGSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAP  60

Query  311  FAFFF  325
            FA  F
Sbjct  61   FALIF  65



>ref|XP_002299181.1| hypothetical protein POPTR_0001s06980g [Populus trichocarpa]
 gb|EEE83986.1| hypothetical protein POPTR_0001s06980g [Populus trichocarpa]
Length=407

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
               K L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA  
Sbjct  6    CCSKFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVIAPFALI  65

Query  323  F  325
            F
Sbjct  66   F  66



>ref|XP_006655900.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=379

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+ L+ +KPY A++ LQ G+AGM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGRALSDAKPYAAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFAL  60

Query  320  FF  325
             F
Sbjct  61   LF  62



>gb|EYU38348.1| hypothetical protein MIMGU_mgv1a009263mg [Erythranthe guttata]
Length=348

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K++ + KPY A++F+QFGYAG A+IAK AL+ GM++YT ++YRN  AT++ APFA   
Sbjct  4    KLVKKVKPYLAIVFMQFGYAGFAIIAKTALDQGMSNYTLSIYRNAIATLVVAPFALLL  61



>ref|XP_011034692.1| PREDICTED: WAT1-related protein At5g07050-like [Populus euphratica]
Length=408

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
               K L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA  
Sbjct  6    CCSKFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVIAPFALI  65

Query  323  F  325
            F
Sbjct  66   F  66



>ref|NP_001141126.1| uncharacterized protein LOC100273211 [Zea mays]
 gb|ACF85451.1| unknown [Zea mays]
 gb|AFW85362.1| hypothetical protein ZEAMMB73_886591 [Zea mays]
Length=390

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  GK++   KPY A++ LQ G++GM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGKLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVLAPFAL  60

Query  320  FF  325
             F
Sbjct  61   LF  62



>ref|XP_009798400.1| PREDICTED: WAT1-related protein At2g39510 [Nicotiana sylvestris]
Length=373

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRN  283
            K L ++KPY AVIFLQFGYAG A+IAK+ALN+GM+HYTFAVYRN
Sbjct  11   KFLKEAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYTFAVYRN  54



>dbj|BAB92246.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 gb|EAZ13862.1| hypothetical protein OsJ_03785 [Oryza sativa Japonica Group]
Length=398

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +AS   G  L ++KPYFA+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  AP
Sbjct  1    MASSPCGGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAP  60

Query  311  FAFFF  325
            FA   
Sbjct  61   FALLL  65



>ref|NP_001148990.1| nodulin protein [Zea mays]
 gb|ACG33741.1| nodulin protein [Zea mays]
 gb|AFW76688.1| nodulin protein [Zea mays]
Length=383

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  GK++   KPY A++ LQ G++GM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGKLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVMAPFAL  60

Query  320  FF  325
             F
Sbjct  61   LF  62



>gb|EEC71658.1| hypothetical protein OsI_04113 [Oryza sativa Indica Group]
Length=398

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +AS   G  L ++KPYFA+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  AP
Sbjct  1    MASSPCGGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAP  60

Query  311  FAFFF  325
            FA   
Sbjct  61   FALLL  65



>ref|XP_008646318.1| PREDICTED: WAT1-related protein At1g44800-like [Zea mays]
 gb|AFW73640.1| hypothetical protein ZEAMMB73_930197 [Zea mays]
Length=394

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  GK+L   KPY A++ LQ G+AGM ++A A+L  GM+H+   VYRNL AT + APFA 
Sbjct  1    MGVGKVLNDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLCATAVMAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  128  QLASMST-GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIF  304
            Q++S S   ++  ++KP+ AVIFLQ G AGMA+IAK AL+ G++HYTF VYRN  AT + 
Sbjct  4    QVSSQSLFCRLFNKAKPFLAVIFLQLGLAGMAIIAKIALDQGLSHYTFVVYRNAVATCVI  63

Query  305  APFAF  319
            APFA 
Sbjct  64   APFAI  68



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M+ G++++++KPY A++FLQ GYAGM VI+ A+L  GMNHY   VYRN  A    APFA 
Sbjct  1    MAFGEVVSKAKPYLAMVFLQVGYAGMYVISVASLKRGMNHYVLVVYRNAVAVAAIAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>dbj|BAD35697.1| putative MtN21 [Oryza sativa Japonica Group]
Length=389

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+ L+ +KPY A++ LQ G+AGM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGRALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFAL  60

Query  320  FF  325
              
Sbjct  61   LL  62



>gb|EAZ36228.1| hypothetical protein OsJ_20548 [Oryza sativa Japonica Group]
Length=393

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+ L+ +KPY A++ LQ G+AGM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGRALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFAL  60

Query  320  FF  325
              
Sbjct  61   LL  62



>ref|XP_002436678.1| hypothetical protein SORBIDRAFT_10g006950 [Sorghum bicolor]
 gb|EER88045.1| hypothetical protein SORBIDRAFT_10g006950 [Sorghum bicolor]
Length=395

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  GK++   KPY A++ LQ G++GM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGKLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVMAPFAL  60

Query  320  FF  325
             F
Sbjct  61   IF  62



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            SKPY A+I LQFGYAGM ++ K +LN GMNHY   VYR+  AT+  APFAFFF
Sbjct  16   SKPYIAMISLQFGYAGMNIMTKVSLNRGMNHYVLVVYRHAIATIAMAPFAFFF  68



>gb|EAZ00107.1| hypothetical protein OsI_22111 [Oryza sativa Indica Group]
Length=389

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+ L+ +KPY A++ LQ G+AGM +++ A+L  GMNH+   VYRNL ATV+ APFA 
Sbjct  1    MGVGRALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFAL  60

Query  320  FF  325
              
Sbjct  61   LL  62



>ref|XP_006471332.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
 gb|KDO44353.1| hypothetical protein CISIN_1g015299mg [Citrus sinensis]
Length=409

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF 
Sbjct  11   LETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAFFL  66



>ref|XP_006432378.1| hypothetical protein CICLE_v10001335mg [Citrus clementina]
 gb|ESR45618.1| hypothetical protein CICLE_v10001335mg [Citrus clementina]
Length=409

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFF 
Sbjct  11   LETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAFFL  66



>gb|KHG09563.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=419

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
              G  L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA  
Sbjct  6    CCGNFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALI  65

Query  323  F  325
            F
Sbjct  66   F  66



>ref|XP_006365719.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=377

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNL  286
            K L +SKPY AVIFLQFG+ G A+IAK ALNNGM+HYTF+VYRNL
Sbjct  11   KNLKRSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNL  55



>ref|XP_010067678.1| PREDICTED: WAT1-related protein At5g07050 [Eucalyptus grandis]
 gb|KCW65859.1| hypothetical protein EUGRSUZ_G03200 [Eucalyptus grandis]
Length=403

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K L  SKPYFA+I LQFGYAGM +I K +LN+GM+HY   VYR+  AT + APFA  F
Sbjct  9    KFLETSKPYFAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATAVIAPFALIF  66



>ref|XP_010926422.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=374

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            MS G + ++ KPY A++FLQFG+AGM VI+ A L  GM+HY   VYRN  AT + APFA 
Sbjct  1    MSFGGVWSRVKPYLAMVFLQFGFAGMYVISVATLKQGMSHYVLVVYRNAIATAVVAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_003570554.1| PREDICTED: WAT1-related protein At1g44800-like [Brachypodium 
distachyon]
Length=398

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G++L   KPY A++ LQ G+AGM V+A A+L  GM+H+   VYRNL AT + APFA 
Sbjct  1    MGVGRVLNDVKPYLAMVLLQVGFAGMYVVAVASLKGGMSHFVLVVYRNLVATAVMAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   YF  62



>ref|XP_010096006.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB62699.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=406

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA FF
Sbjct  8    LEVSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIFF  63



>gb|ABR18253.1| unknown [Picea sitchensis]
Length=429

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            +SKPY A+I LQFGYAGM +I K +L NGM+HY   VYR+  AT + APFAFF
Sbjct  18   RSKPYIAMISLQFGYAGMNIITKVSLTNGMSHYVLVVYRHAVATAVIAPFAFF  70



>ref|XP_010684183.1| PREDICTED: WAT1-related protein At2g37460-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S+ ++  QSKP+ AVIFLQ G AGM +++K ALN+GM++Y   VYR+  AT++  PFA F
Sbjct  3    SSRRLYNQSKPFLAVIFLQVGLAGMDILSKVALNHGMSNYVLVVYRHAVATIVITPFALF  62

Query  323  F  325
            F
Sbjct  63   F  63



>gb|KCW49647.1| hypothetical protein EUGRSUZ_K03165 [Eucalyptus grandis]
Length=472

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  119  DYYQLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATV  298
            D  +  +M   ++  + KP+ AV+FLQFG AGM ++ KAALN GM++Y   VYRN  AT+
Sbjct  80   DKIESKAMDAKRLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATI  139

Query  299  IFAPFAFFF  325
            + APFA   
Sbjct  140  VIAPFAVIM  148



>ref|XP_003526345.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN26401.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=396

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S    L  SKPYFA+I +QFGYAGM +I K +LN GM+HY   VYR+  AT + APFAF 
Sbjct  8    SCANFLENSKPYFAMIAIQFGYAGMNIITKISLNRGMSHYVLVVYRHAFATAVVAPFAFI  67

Query  323  F  325
            F
Sbjct  68   F  68



>ref|NP_001239827.1| uncharacterized protein LOC100804390 [Glycine max]
 gb|ACU18044.1| unknown [Glycine max]
 gb|KHN37729.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=409

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K  A SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAF F
Sbjct  11   KFFASSKPYLAMISLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATAVIAPFAFIF  68



>ref|XP_006644860.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=394

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S G  L ++KPYFA+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA  
Sbjct  3    SHGGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALL  62

Query  323  F  325
             
Sbjct  63   L  63



>ref|XP_002315243.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
 gb|EEF01414.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
Length=381

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +A+ S+     ++KP+ AV+ +QFGYAGM++I+K ALN GM+ +   VYR+  AT++ AP
Sbjct  1    MATESSDSPYDKAKPFLAVVLMQFGYAGMSIISKHALNEGMSQHVLVVYRHAVATIVIAP  60

Query  311  FAFFF  325
            FAF F
Sbjct  61   FAFIF  65



>ref|XP_006416254.1| hypothetical protein EUTSA_v10007890mg [Eutrema salsugineum]
 gb|ESQ34607.1| hypothetical protein EUTSA_v10007890mg [Eutrema salsugineum]
Length=387

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +LN+GMNHY  AVYR+  ATV+ APFA F
Sbjct  3    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLNHGMNHYILAVYRHAIATVVIAPFALF  60



>ref|XP_009625314.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana tomentosiformis]
Length=375

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRN  283
            K L ++KPY AVIFLQFGYAG A+IAK+ALN+GM+HY FAVYRN
Sbjct  11   KFLKEAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYAFAVYRN  54



>gb|EEC74071.1| hypothetical protein OsI_09081 [Oryza sativa Indica Group]
Length=384

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+++  +KPY A+I LQ G+AGM V+A A+L  GM+H+   VYRNL AT + APFA 
Sbjct  1    MGVGRVMNDAKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNLFATAVMAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|NP_001048238.1| Os02g0768300 [Oryza sativa Japonica Group]
 dbj|BAD16930.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 dbj|BAF10152.1| Os02g0768300 [Oryza sativa Japonica Group]
 dbj|BAG93404.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57869.1| hypothetical protein OsJ_08519 [Oryza sativa Japonica Group]
Length=384

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G+++  +KPY A+I LQ G+AGM V+A A+L  GM+H+   VYRNL AT + APFA 
Sbjct  1    MGVGRVMNDAKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNLFATAVMAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            MS  + +  +KP+FAV+FLQFG AGM +++KAALN GM++Y   VYR++ AT + APFA 
Sbjct  1    MSIVETMKAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAV  60

Query  320  FF  325
              
Sbjct  61   IL  62



>ref|XP_007133643.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
 gb|ESW05637.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
Length=391

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +A     K    SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT+  AP
Sbjct  1    MAMEGCSKFFRSSKPYLAMISLQFGYAGMTIITKISLNQGMSHYVLVVYRHAFATIAIAP  60

Query  311  FAFFF  325
            FAF F
Sbjct  61   FAFIF  65



>ref|XP_011085946.1| PREDICTED: WAT1-related protein At5g07050 [Sesamum indicum]
Length=397

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L   KPY  +I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAFFF
Sbjct  14   LKNCKPYMGMISLQFGYAGMNIITKISLNGGMSHYVLVVYRHAIATAVIAPFAFFF  69



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            MS  + +  +KP+FAV+FLQFG AGM +++KAALN GM++Y   VYR++ AT + APFA 
Sbjct  1    MSIVETMKAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAV  60

Query  320  FF  325
              
Sbjct  61   IL  62



>ref|XP_004141853.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50537.1| hypothetical protein Csa_5G181440 [Cucumis sativus]
Length=377

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + L  +KPYF VIF+QFGYAGMA++ K+AL+ GM+ + F  YR + AT++ APFA  F
Sbjct  6    RFLRSAKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVFVAYRQVAATLVIAPFAIIF  63



>ref|XP_008447554.1| PREDICTED: WAT1-related protein At2g37460-like [Cucumis melo]
Length=373

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +KP+FAV+FLQFG AGM +++KAALN GM++Y   VYR+  AT++ APFA  F
Sbjct  12   AKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFALIF  64



>ref|XP_006339335.1| PREDICTED: WAT1-related protein At5g07050-like, partial [Solanum 
tuberosum]
Length=358

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKPY A+I LQFGYAGM +I K +LN GM+HY   VYRN  AT++ APFA   
Sbjct  15   RSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATIVIAPFALIL  68



>ref|XP_003523924.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
Length=398

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAF  
Sbjct  13   LENSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVVAPFAFIL  68



>ref|XP_002284091.1| PREDICTED: WAT1-related protein At2g39510 [Vitis vinifera]
 emb|CBI31716.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 6/71 (8%)
 Frame = +2

Query  113  KEDYYQLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTA  292
            +EDY      S    + Q+ P  AV+ LQFGYAG+++IAK ALN GMNHYTF VYR++ A
Sbjct  3    EEDY------SLRVQIMQAMPILAVVLLQFGYAGLSIIAKYALNAGMNHYTFVVYRHVIA  56

Query  293  TVIFAPFAFFF  325
              + APFA   
Sbjct  57   AAVIAPFAIVL  67



>ref|XP_004142085.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN54225.1| hypothetical protein Csa_4G293840 [Cucumis sativus]
Length=375

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +KP+FAV+FLQFG AGM +++KAALN GM++Y   VYR+  AT++ APFA  F
Sbjct  12   AKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFALIF  64



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L + KPY A++ LQFGYAGM +I   +LN+GMNHY  AVYR++ AT++ APFAF  
Sbjct  11   LKKVKPYLAMVSLQFGYAGMYIITLVSLNHGMNHYVLAVYRHVVATLLIAPFAFVL  66



>ref|XP_011027136.1| PREDICTED: WAT1-related protein At2g39510-like [Populus euphratica]
Length=380

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +A+ S+     ++KP+ AV+ +QFGYAGM++I+K ALN GM+ +   VYR+  AT++ AP
Sbjct  1    MATESSDSPYDRAKPFLAVVLMQFGYAGMSLISKHALNEGMSQHVLVVYRHAVATIVIAP  60

Query  311  FAFFF  325
            FAF F
Sbjct  61   FAFIF  65



>ref|XP_004173847.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
Length=211

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I+K +L+ GM+HY   VYR++ AT   APF  FF
Sbjct  14   LENSKPYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHVFATASIAPFVLFF  69



>gb|KCW49650.1| hypothetical protein EUGRSUZ_K03168 [Eucalyptus grandis]
Length=446

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  119  DYYQLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATV  298
            D  +  +M    +  + KP+ AV+FLQFG AGM ++ KAALN GM++Y   VYRN  AT+
Sbjct  54   DKIESKAMDAKTLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATI  113

Query  299  IFAPFAFFF  325
            + APFA   
Sbjct  114  VIAPFAVIM  122



>gb|EMS46950.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=342

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G +  ++KPY A+I LQFGYAGM VI K +LN GM+HY   VYR+  ATV  APFA  F
Sbjct  5    GDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALIF  63



>ref|XP_004955229.1| PREDICTED: WAT1-related protein At1g21890-like [Setaria italica]
Length=395

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             GK+L   KPY A+I LQ G+AGM V+A A+L  GM+H+   VYRN+ AT + APFA +F
Sbjct  16   CGKVLNDVKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNVVATAVMAPFALWF  75



>tpg|DAA57219.1| TPA: hypothetical protein ZEAMMB73_947627, partial [Zea mays]
Length=86

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  ATV  APFA   
Sbjct  8    GDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALIL  66



>ref|XP_002525547.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF36806.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=415

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
               K L  SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT +  PFAF 
Sbjct  7    CCAKFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIFPFAFI  66

Query  323  F  325
            F
Sbjct  67   F  67



>ref|XP_004307548.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=350

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S  ++L Q+KP+ AVIFLQFG+AGM++I K ALN GM+ +   VYRN  A V  APFA  
Sbjct  5    SVSQMLTQAKPFVAVIFLQFGFAGMSIITKFALNQGMSQHVLVVYRNAVAFVFIAPFALV  64

Query  323  F  325
            F
Sbjct  65   F  65



>ref|XP_002267371.1| PREDICTED: WAT1-related protein At5g07050 [Vitis vinifera]
Length=403

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  L  SKPY A+I LQFGYAGM +I K +LN+GM+HY   VYR+  AT + APFA F 
Sbjct  8    GGFLHSSKPYLAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATAVIAPFAIFL  66



>gb|EYU26922.1| hypothetical protein MIMGU_mgv1a007458mg [Erythranthe guttata]
Length=406

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            + +  +  +    KPY  +I LQFGYAGM +I K +LN GM+HY   VYR+  AT + AP
Sbjct  5    IQTCCSSSLFKSCKPYIGMISLQFGYAGMNIITKISLNGGMSHYVLVVYRHAIATAVIAP  64

Query  311  FAFFF  325
            FAFFF
Sbjct  65   FAFFF  69



>emb|CDM84603.1| unnamed protein product [Triticum aestivum]
Length=387

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G +  ++KPY A+I LQFGYAGM VI K +LN GM+HY   VYR+  ATV  APFA  F
Sbjct  5    GDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALIF  63



>ref|XP_002454615.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
 gb|EES07591.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
Length=385

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  GK L   KPY A+I LQ G+AGM ++A A+L  GM+H+   VYRNL AT + APFA 
Sbjct  1    MGVGKALNDVKPYLAMILLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLFATAVMAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_004249326.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKPY A+I LQFGYAGM +I K +LN GM+HY   VYRN  AT++ APFA   
Sbjct  12   RSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYALVVYRNAFATLVIAPFALLL  65



>ref|XP_008785769.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=651

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M+ G+++++ KPY A++FLQFGYAGM VI+ A+L +GMNHY   VYRN  A  + APFA 
Sbjct  1    MAFGEVVSKVKPYLAMVFLQFGYAGMFVISVASLKHGMNHYVLVVYRNAVAVAVVAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  SMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFA  316
            SM+  ++ ++ KPY A++FLQFGYAGM VI+  +L   MNHY   VYRN  A    +PFA
Sbjct  275  SMAFSEVASKVKPYLAMVFLQFGYAGMFVISVESLKRRMNHYVLVVYRNAIAVAAVSPFA  334

Query  317  FFF  325
             +F
Sbjct  335  LWF  337



>ref|XP_004249327.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Solanum 
lycopersicum]
Length=393

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKPY A+I LQFGYAGM +I K +LN GM+HY   VYRN  AT++ APFA   
Sbjct  16   RSKPYIAMISLQFGYAGMNIITKVSLNKGMSHYVLVVYRNAFATLVIAPFALIL  69



>gb|KGN51609.1| hypothetical protein Csa_5G584380 [Cucumis sativus]
Length=332

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I+K +L+ GM+HY   VYR++ AT   APF  FF
Sbjct  14   LENSKPYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHVFATASIAPFVLFF  69



>emb|CDY04680.1| BnaC05g17180D [Brassica napus]
Length=396

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  ATV+ APFA F
Sbjct  8    GSLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPFALF  65



>gb|EMS46274.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+L+  KPY A++ LQ G+AGM ++A A+L  GM+H+   VYRNL AT + APFA +F
Sbjct  4    KVLSDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYF  61



>emb|CAA75575.1| MtN21 [Medicago truncatula]
 gb|KEH32985.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=394

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            SKPYFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT+  APFA  F
Sbjct  16   SKPYFAMILLQFGYAGMNIITKLSLNGGMSHYVLVVYRHAFATIAIAPFAIIF  68



>ref|XP_003545806.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN11194.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=409

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + A SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA  F
Sbjct  12   VFASSKPYLAMISLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATAVIAPFAIIF  68



>ref|XP_010039215.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M   ++  + KP+ AV+FLQFG AGM ++ KAALN GM++Y   VYRN  AT++ APFA 
Sbjct  1    MDAKRLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAV  60

Query  320  FF  325
              
Sbjct  61   IM  62



>ref|XP_007205382.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
 gb|EMJ06581.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
Length=372

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +KP+FAVIFLQFG AGM +++KAALN GM++Y   VYR++ AT + APFA   
Sbjct  15   AKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFALIL  67



>ref|XP_006654584.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=407

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +2

Query  131  LASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAP  310
            +AS  +G  + ++KPYFA+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  AP
Sbjct  1    MASCCSG-FMDRAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAP  59

Query  311  FAFFF  325
            FA   
Sbjct  60   FALIL  64



>gb|EEC79453.1| hypothetical protein OsI_20446 [Oryza sativa Indica Group]
Length=404

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
              G  + ++KPYFA+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA  
Sbjct  4    CCGGFMEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALI  63

Query  323  F  325
             
Sbjct  64   L  64



>ref|NP_001055921.1| Os05g0493800 [Oryza sativa Japonica Group]
 gb|AAT69654.1| putative nodulin MtN21 protein [Oryza sativa Japonica Group]
 dbj|BAF17835.1| Os05g0493800 [Oryza sativa Japonica Group]
 gb|EEE64206.1| hypothetical protein OsJ_19039 [Oryza sativa Japonica Group]
Length=404

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
              G  + ++KPYFA+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA  
Sbjct  4    CCGGFMEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALI  63

Query  323  F  325
             
Sbjct  64   L  64



>ref|XP_008241503.1| PREDICTED: WAT1-related protein At2g37460-like [Prunus mume]
Length=372

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +KP+FAVIFLQFG AGM +++KAALN GM++Y   VYR++ AT + APFA   
Sbjct  15   AKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFALIL  67



>dbj|BAK02715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G +  ++KPY A+I LQFGYAGM VI K +LN GM+HY   VYR++ ATV  APFA   
Sbjct  9    GDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHVFATVSIAPFALIL  67



>ref|XP_004147717.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=373

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + L  +KPYF V+F+Q G AGMA+IAK ALN GM+ Y F  YR + ATVI APFA  F
Sbjct  6    RFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAIIF  63



>ref|XP_004167778.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50536.1| hypothetical protein Csa_5G181430 [Cucumis sativus]
Length=374

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + L  +KPYF V+F+Q G AGMA+IAK ALN GM+ Y F  YR + ATVI APFA  F
Sbjct  6    RFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAIIF  63



>ref|XP_010669871.1| PREDICTED: WAT1-related protein At2g39510 [Beta vulgaris subsp. 
vulgaris]
Length=366

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KPY AVIF+QFG AG+A+IAK ALN GM+HY+F VYR   A ++ +PFA   
Sbjct  8    KPYLAVIFMQFGIAGLAIIAKFALNKGMSHYSFVVYRQAVAAIVISPFALVL  59



>emb|CDP05672.1| unnamed protein product [Coffea canephora]
Length=375

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNL  286
            Q+KPY AVIF+QFGYAG A+I+K+ALN GM+HY FA+YRNL
Sbjct  6    QAKPYLAVIFMQFGYAGSAIISKSALNKGMSHYAFAIYRNL  46



>ref|XP_009103277.1| PREDICTED: WAT1-related protein At1g21890 [Brassica rapa]
Length=389

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  ATV+ APFA F
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPFALF  65



>ref|XP_004166081.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=377

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + L  +KPYF VIF+QFGYAGMA++ K+AL+ GM+ +    YR + AT++ APFA  F
Sbjct  6    RFLRSAKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVLXAYRQVAATLVIAPFAIIF  63



>emb|CDP06236.1| unnamed protein product [Coffea canephora]
Length=406

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             +KPYFA+I LQFGYAGM VI K +LN GM+HY   VYR+  AT + APFA F 
Sbjct  13   SAKPYFAMICLQFGYAGMNVITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIFL  66



>ref|XP_004151540.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=391

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I+K +L+ GM+HY   VYR++ AT   APF  FF
Sbjct  14   LENSKPYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHVFATASIAPFVLFF  69



>emb|CDY00403.1| BnaC07g14230D [Brassica napus]
Length=379

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  ATV+ APFA F
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPFALF  65



>ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-like [Citrus sinensis]
 gb|KDO80699.1| hypothetical protein CISIN_1g016580mg [Citrus sinensis]
Length=387

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L++ KPY A+I LQFGYAGM +I   +L +GM+HY  AVYR++ AT++ APFAF  
Sbjct  14   LSKFKPYLAIISLQFGYAGMYIITMVSLKHGMSHYVLAVYRHVVATIVLAPFAFVL  69



>ref|XP_008461651.1| PREDICTED: WAT1-related protein At2g39510-like isoform X3 [Cucumis 
melo]
Length=357

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +  +KPYF VIF+QFGYAGM ++ K+AL+ GM+ + F  YR + AT++ APFA  F
Sbjct  6    RFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAIIF  63



>ref|XP_004144320.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004157980.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=441

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++PY A+I LQFGYAGM +I K ALN GM+HY    YR   AT++ APFAFFF
Sbjct  15   AQPYIAMISLQFGYAGMNIITKVALNRGMSHYVLVTYRQAFATIVLAPFAFFF  67



>ref|XP_010064999.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
Length=381

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            L ++KPY A++ LQFGYAGM +I   +LN+GMNHY  AVYR + AT++ APFAF
Sbjct  11   LKKAKPYLAMVSLQFGYAGMNIITLVSLNHGMNHYVLAVYRYVVATLLIAPFAF  64



>ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
 gb|ESR47405.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
Length=387

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L++ KPY A+I LQFGYAGM +I   +L +GM+HY  AVYR++ AT++ APFAF  
Sbjct  14   LSKFKPYLAIISLQFGYAGMYIITMVSLKHGMSHYVLAVYRHVVATIVLAPFAFVL  69



>ref|XP_006649078.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=357

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M   +++   KPY A+I LQ G+AGM V+A A+L  GM+H+   VYRNL AT + APFA 
Sbjct  1    MGVSRVMNDVKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNLFATAVMAPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_010906409.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=379

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L ++KPY A+I LQFGYAGM +I+K +LN+GM+HY   VYR+  AT+  APFA +F
Sbjct  8    LQRAKPYVAMISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFALYF  63



>gb|ACJ84240.1| unknown [Medicago truncatula]
Length=247

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            + T   + ++KP+ AV+FLQFGYA M V++KAALN GM++Y F VYR+  A ++  PFA 
Sbjct  5    LQTQNWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFAL  64

Query  320  FF  325
            +F
Sbjct  65   YF  66



>ref|XP_003590514.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=261

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            + T   + ++KP+ AV+FLQFGYA M V++KAALN GM++Y F VYR+  A ++  PFA 
Sbjct  5    LQTQNWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFAL  64

Query  320  FF  325
            +F
Sbjct  65   YF  66



>ref|XP_008461650.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=378

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +  +KPYF VIF+QFGYAGM ++ K+AL+ GM+ + F  YR + AT++ APFA  F
Sbjct  6    RFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAIIF  63



>gb|KCW65508.1| hypothetical protein EUGRSUZ_G02912 [Eucalyptus grandis]
Length=369

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++L++ KPY AV+ LQFG+AGMA++AK +LN GMN + F VYR+  A  + APFA  F
Sbjct  10   RVLSRLKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAVVAPFAILF  67



>gb|KCW49646.1| hypothetical protein EUGRSUZ_K03164 [Eucalyptus grandis]
Length=446

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  119  DYYQLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATV  298
            D  +  +M   ++  + KP+ AV+FLQFG+AGM ++ KAALN GM++Y   VYR+  AT+
Sbjct  54   DKIESRAMDAKRLFHKLKPFLAVVFLQFGFAGMDILCKAALNKGMSNYVLVVYRHAVATI  113

Query  299  IFAPFAFFF  325
            +  PFA   
Sbjct  114  VIVPFAVIM  122



>gb|KHG29332.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L ++KPY ++I LQFG+AGM VI   +L +GMNHY  AVYR+L AT++ APFA   
Sbjct  7    LNKAKPYLSMISLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVL  62



>ref|XP_008461649.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=388

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +  +KPYF VIF+QFGYAGM ++ K+AL+ GM+ + F  YR + AT++ APFA  F
Sbjct  6    RFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAIIF  63



>ref|XP_010529854.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=383

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G+ + +++P+ AV+FLQ G AGM +++KA LN GM++Y   VYR+  AT I APFAF+F
Sbjct  9    GECMERARPFMAVVFLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATFIIAPFAFYF  67



>ref|XP_010067380.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=382

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++L++ KPY AV+ LQFG+AGMA++AK +LN GMN + F VYR+  A  + APFA  F
Sbjct  10   RVLSRLKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAVVAPFAILF  67



>ref|XP_010938846.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=407

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
              GK   +SKPY A+I LQFGYAGM +I K +LN+GM+HY   VYR+  AT+  APFA  
Sbjct  6    CCGKFFQRSKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSIAPFALI  65

Query  323  F  325
             
Sbjct  66   L  66



>ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
Length=405

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
              G  L + KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA  
Sbjct  6    CCGNFLQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALL  65

Query  323  F  325
             
Sbjct  66   L  66



>gb|EMT18779.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=393

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+L   KPY  +I LQ GYAGM +++ A+L  GM+HY    YRNL AT++  PFA FF
Sbjct  6    KVLNDVKPYMMMILLQIGYAGMYIVSVASLKRGMSHYVLVTYRNLVATLVMLPFALFF  63



>ref|XP_010039216.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KP+ AV+FLQFG AGM ++ KAALN GM++Y   VYRN  AT++ APFA   
Sbjct  11   KPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIM  62



>ref|XP_007162672.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
 gb|ESW34666.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
Length=382

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+  + KP+  V+FLQFGYAGM V++KAALN GM++Y F VYR++ A V+ APFA F 
Sbjct  7    KLFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVMAPFAVFL  64



>gb|EMT31802.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=387

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G +  ++KPY A+I LQFGYAGM VI K +LN GM+HY   VYR+  ATV  APFA   
Sbjct  5    GDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALIL  63



>gb|KDP35589.1| hypothetical protein JCGZ_09027 [Jatropha curcas]
Length=375

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KP+ AVIF+Q G AGM V++KAALN GM++Y   VYR+  AT++ APFAFF 
Sbjct  13   KPFIAVIFMQIGLAGMDVMSKAALNGGMSNYVLVVYRHAVATIVIAPFAFFL  64



>gb|EMT33815.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+++  KPY A++ LQ G+AGM ++A A+L  GM+H+   VYRNL AT + APFA +F
Sbjct  4    KVVSDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYF  61



>ref|XP_007148806.1| hypothetical protein PHAVU_005G015900g [Phaseolus vulgaris]
 gb|ESW20800.1| hypothetical protein PHAVU_005G015900g [Phaseolus vulgaris]
Length=382

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SK YFA+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFAF F
Sbjct  13   LENSKHYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAFIF  68



>ref|XP_008461645.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=374

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + L  +KPYF V+F+Q G AGMA+IAK ALN GM+ Y F  YR + AT+I APFA  F
Sbjct  6    RFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATLIMAPFAIIF  63



>ref|XP_009390894.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M  G++    +PY A++FLQFGYAGM V++  +L  GM+HY   VYRN  A  +  PFA 
Sbjct  1    MGVGEVWRSVRPYLAMVFLQFGYAGMYVVSVVSLKQGMSHYVLVVYRNAIAAAVIGPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_004498423.1| PREDICTED: WAT1-related protein At4g08290-like [Cicer arietinum]
Length=375

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SK Y  +I LQFG AGM V+   ALN GM+HY F VYRN+ ATV  APFAFF 
Sbjct  14   LCNSKSYLLIISLQFGSAGMYVLTMDALNKGMSHYIFVVYRNVIATVALAPFAFFL  69



>tpg|DAA57218.1| TPA: hypothetical protein ZEAMMB73_947627 [Zea mays]
Length=283

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  ATV  APFA   
Sbjct  8    GDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALIL  66



>gb|EMS45468.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=407

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+L   KPY  +I LQ GYAGM +++ A+L  GM+HY    YRNL AT++  PFA FF
Sbjct  6    KVLNDVKPYMMMILLQIGYAGMYIVSVASLKRGMSHYVLVTYRNLAATLVMLPFALFF  63



>ref|XP_010673090.1| PREDICTED: WAT1-related protein At5g07050 [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L +SKPY A+I LQFGYAGM ++ K +LN GM+HY   VYR+  AT + APFA   
Sbjct  13   LEKSKPYIAMICLQFGYAGMNIVTKVSLNGGMSHYVLVVYRHAFATAVIAPFALVL  68



>ref|XP_008788560.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=400

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L ++KPY A+I LQFGYAGM +I K +LNNGM+HY   VYR+  AT+  APFA   
Sbjct  8    LQRAKPYIAMISLQFGYAGMNIITKVSLNNGMSHYVLVVYRHAFATLSIAPFALIL  63



>ref|XP_002323220.2| hypothetical protein POPTR_0016s03120g [Populus trichocarpa]
 gb|EEF04981.2| hypothetical protein POPTR_0016s03120g [Populus trichocarpa]
Length=402

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +G    +SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  7    SGSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIIL  66



>gb|KFK44291.1| hypothetical protein AALP_AA1G239100 [Arabis alpina]
Length=391

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  AT++ APFA ++
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATLVIAPFALYY  66



>ref|XP_003548654.1| PREDICTED: uncharacterized protein LOC100792261 [Glycine max]
Length=471

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            I+ +++PY A++F+QF YAGMA+++KAA++ GM+ Y F VYR   A+V  +PFAFF
Sbjct  11   IVEKNRPYVAMLFIQFVYAGMALLSKAAISKGMSPYVFVVYRQALASVALSPFAFF  66



>ref|XP_009800321.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=399

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KPY A+I LQFGYAGM +I K +LN GM+HY   VYRN  AT + APFA   
Sbjct  12   RAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATAVIAPFALIL  65



>emb|CDY01310.1| BnaA07g10830D [Brassica napus]
Length=388

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  ATV+  PFA F
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIVPFALF  65



>ref|XP_008445949.1| PREDICTED: WAT1-related protein At5g07050 [Cucumis melo]
Length=388

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L  SKPYFA+I LQFGYAGM +I+K +L+ GM+HY   VYR+  AT   APF  FF
Sbjct  15   LENSKPYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHAFATASIAPFVLFF  70



>ref|XP_006341065.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=375

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KP+ AVIFLQFG AGM ++ K ALN GM++Y F VYR+  AT++ APFA   
Sbjct  10   RAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAIIL  63



>ref|XP_010916579.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=376

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M+ G + ++ KPY A++FLQFGYAGM +I+ A L  GM+HY   VYRN  A  +  PFA 
Sbjct  1    MALGGVWSRVKPYLAMVFLQFGYAGMYLISVATLKQGMSHYVLVVYRNAIAAAVIFPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>ref|XP_004246473.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=375

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KP+ AVIFLQFG AGM ++ K ALN GM++Y F VYR+  AT++ APFA   
Sbjct  10   RAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAIIL  63



>ref|XP_008802062.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=373

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            M+ G +  ++KPY A++FLQFG++GM VI+ A L  GM+HY   VYRN  A  +  PFA 
Sbjct  1    MALGGVWTRAKPYMAMVFLQFGFSGMYVISVATLKRGMSHYVLVVYRNAIAAAVILPFAL  60

Query  320  FF  325
            +F
Sbjct  61   WF  62



>gb|EYU28757.1| hypothetical protein MIMGU_mgv1a023410mg, partial [Erythranthe 
guttata]
Length=302

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KP+ AV+FLQ   AGM +IAKAALN GM++Y F VYR+  AT++ APFAF  
Sbjct  4    KAKPFLAVVFLQAALAGMDIIAKAALNQGMSNYVFIVYRHAVATIVIAPFAFLL  57



>ref|XP_010097389.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB67895.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=357

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFA  316
            ++  +SKP+  V+FLQFG+AGM V++KAALN+GM++Y   VYR+  AT + APFA
Sbjct  8    RLFERSKPFLGVVFLQFGFAGMDVLSKAALNHGMSNYVLVVYRHAVATAVIAPFA  62



>ref|XP_003564421.1| PREDICTED: WAT1-related protein At5g07050 [Brachypodium distachyon]
Length=392

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  ATV  APFA   
Sbjct  5    GDFFEKAKPYIAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALLL  63



>gb|EMS55812.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=367

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++ + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA F 
Sbjct  13   LMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALFL  69



>gb|EYU28266.1| hypothetical protein MIMGU_mgv1a008729mg [Erythranthe guttata]
Length=364

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KP+ AVIFLQ G AG+ +I KAALN GM+ Y F VYR++ ATV  APFA   
Sbjct  17   KAKPFLAVIFLQLGVAGLDIICKAALNEGMSSYVFVVYRHVIATVFIAPFALVL  70



>ref|XP_011094815.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
 ref|XP_011094816.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  128  QLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFA  307
            +++  S   +  +SKP+  V+FLQ G AGM +I+KAALN GM++Y F VYR+  AT++ A
Sbjct  2    KMSRESMHDLFHKSKPFLGVVFLQAGLAGMDIISKAALNEGMSNYVFVVYRHAVATLVIA  61

Query  308  PFAF  319
            PFA 
Sbjct  62   PFAI  65



>ref|XP_004161682.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=368

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            S+ +FAV+FLQFG AGM +++KAALN GM++Y   VYR+  AT++ APFA  F
Sbjct  5    SQAFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFALIF  57



>ref|XP_011027560.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=391

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L + KPY A++ LQFGYAGM +I   +L +GM+HY  AVYR++ AT++ APFAF  
Sbjct  14   LKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATIVIAPFAFVL  69



>ref|XP_008795134.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=390

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             GK   + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA   
Sbjct  7    CGKFFQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALIL  66



>gb|EMT14666.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=406

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++ + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA F 
Sbjct  15   LMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALFL  71



>gb|EMS60726.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=308

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K +  +KPY A++ LQ G+AGM ++A A+L  GM H+   VYRN+ ATV+ APFA +F
Sbjct  6    KAVNDAKPYLAMVLLQVGFAGMYIVAVASLKRGMCHFVLVVYRNIVATVVMAPFALYF  63



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            + T   + ++KP+ AV+FLQFGYA M V++KAALN GM++Y F VYR+  A ++  PFA 
Sbjct  5    LQTQNWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFAL  64

Query  320  FF  325
            +F
Sbjct  65   YF  66



>ref|XP_010477438.1| PREDICTED: WAT1-related protein At1g21890-like [Camelina sativa]
Length=393

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  AT + APFA F
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPFALF  65



>ref|XP_009778852.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKP+ AVIFLQFG AGM ++ K ALN GM++Y F VYR+  AT+  APFA   
Sbjct  10   RSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAIIL  63



>ref|XP_011041376.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=402

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    +SKPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    GSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIIL  66



>ref|XP_010498646.1| PREDICTED: WAT1-related protein At1g21890-like [Camelina sativa]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  AT + APFA F
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPFALF  65



>ref|XP_009778858.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKP+ AVIFLQFG AGM ++ K ALN GM++Y F VYR+  AT+  APFA   
Sbjct  10   RSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAIIL  63



>ref|XP_010459911.1| PREDICTED: WAT1-related protein At1g21890 [Camelina sativa]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++ + KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  AT + APFA F
Sbjct  8    GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPFALF  65



>gb|EMT04611.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K +  +KPY A++ LQ G+AGM +IA A+L  GM+H+   VYRNL AT + APFA +F
Sbjct  6    KAVNDAKPYLAMVLLQVGFAGMYIIAVASLKRGMSHFVLVVYRNLVATAVMAPFALYF  63



>gb|EPS57420.1| hypothetical protein M569_17398, partial [Genlisea aurea]
Length=252

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + KP+FAV FLQ G AGM +I KAALN GM++Y F VYR++ AT + APFA  F
Sbjct  1    RGKPFFAVFFLQAGLAGMDIITKAALNYGMSNYVFVVYRHVVATAVVAPFALIF  54



>ref|XP_003568462.2| PREDICTED: WAT1-related protein At5g07050-like [Brachypodium 
distachyon]
Length=406

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA F 
Sbjct  13   MQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALFL  68



>ref|NP_001150619.1| nodulin-like protein [Zea mays]
 gb|ACG39776.1| nodulin-like protein [Zea mays]
Length=413

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  ATV  APFA   
Sbjct  8    GDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALIL  66



>gb|ACL54205.1| unknown [Zea mays]
 tpg|DAA57217.1| TPA: nodulin-like protein [Zea mays]
Length=413

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  ATV  APFA   
Sbjct  8    GDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALIL  66



>ref|XP_002893187.1| T26F17.11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69446.1| T26F17.11 [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            G ++   KPY A+I +QFGYAGM +I   +L +GMNHY  AVYR+  AT + APFA F
Sbjct  3    GGLMNSVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATAVIAPFALF  60



>dbj|BAJ98418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+L   KPY A++ LQ G+AGM +IA A+L  GM+H+   VYRNL AT +  PFA +F
Sbjct  6    KVLDDVKPYLAMVLLQVGFAGMYIIAVASLKAGMSHFVLVVYRNLVATAVMTPFAIYF  63



>ref|XP_009614496.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKP+ AVIFLQFG AGM ++ K ALN GM++Y F VYR+  AT+  APFA   
Sbjct  10   RSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAMIL  63



>gb|KDO67717.1| hypothetical protein CISIN_1g045242mg, partial [Citrus sinensis]
Length=243

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KP+ AVI LQFGYAGM++ +K ALN GM+ + FAVYR+  AT++ APFA   
Sbjct  10   RAKPFLAVILLQFGYAGMSIFSKFALNKGMSPHVFAVYRHAVATIVVAPFALIL  63



>gb|EMT08224.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=322

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             G  + ++KPY A+I LQFGYAGM V+ K +LN GM+HY   VYR+  AT+  APFA F 
Sbjct  4    CGGFMDKAKPYIAMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALFI  63



>ref|XP_009614497.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +SKP+ AVIFLQFG AGM ++ K ALN GM++Y F VYR+  AT+  APFA   
Sbjct  10   RSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAMIL  63



>ref|XP_003521346.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=377

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+  + KP+  V+FLQFGYAGM +++KAALN GM++Y F VYR++ A V+ APFA   
Sbjct  7    KLFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALIL  64



>ref|XP_011079091.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=382

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    GSFFEKAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALVL  66



>gb|EEC66708.1| hypothetical protein OsI_33031 [Oryza sativa Indica Group]
 gb|EEE50727.1| hypothetical protein OsJ_31033 [Oryza sativa Japonica Group]
Length=65

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++ PY A++FLQFG+AG+ +I+ A+L  GM+HY   VYRN  A V+ APFA +F
Sbjct  9    KAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWF  62



>gb|KHN09434.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+  + KP+  V+FLQFGYAGM +++KAALN GM++Y F VYR++ A V+ APFA   
Sbjct  7    KLFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALIL  64



>ref|XP_002440000.1| hypothetical protein SORBIDRAFT_09g024200 [Sorghum bicolor]
 gb|EES18430.1| hypothetical protein SORBIDRAFT_09g024200 [Sorghum bicolor]
Length=379

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  + ++KPY A+I LQFGYAGM V+ K +LNNGM+HY   VYR+  AT+  APFA   
Sbjct  6    GGFVEKAKPYIAMISLQFGYAGMNVLTKVSLNNGMSHYVLVVYRHAFATLSIAPFALVL  64



>ref|NP_001055529.2| Os05g0409500 [Oryza sativa Japonica Group]
 gb|AAT58856.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE63706.1| hypothetical protein OsJ_18524 [Oryza sativa Japonica Group]
 dbj|BAF17443.2| Os05g0409500 [Oryza sativa Japonica Group]
Length=420

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  143  STGKILAQ-SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            +TG+ L Q  KPY A++ LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA 
Sbjct  14   ATGESLMQKCKPYVAMVSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFAL  73

Query  320  FF  325
              
Sbjct  74   VL  75



>ref|XP_010037869.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  140  MSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFA  316
            M   ++  + KP+ AV+FLQFG+AGM ++ KAALN GM++Y   VYR+  AT++  PFA
Sbjct  1    MDAKRLFHKLKPFLAVVFLQFGFAGMDILCKAALNKGMSNYVLVVYRHAVATIVIVPFA  59



>ref|XP_008810183.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=407

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            S GK   + KPY A+I LQFGYAGM +I K +LN+GM+HY   VYR+  A +  APFA  
Sbjct  6    SCGKFFQRCKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFAALSIAPFALI  65

Query  323  F  325
             
Sbjct  66   L  66



>gb|EYU20823.1| hypothetical protein MIMGU_mgv1a008005mg [Erythranthe guttata]
Length=388

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  + ++KPY A+I LQFGYAGM +I K +LN+GM+HY   VYR+  AT   APFA   
Sbjct  6    GNFMEKAKPYIAMICLQFGYAGMNIITKVSLNSGMSHYVLVVYRHAFATAAIAPFALLL  64



>dbj|BAJ92223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+L   KPY  +I LQ GYAGM +++ A+L  GM+HY    YRNL AT++  PFA  F
Sbjct  6    KVLNDVKPYMMMILLQIGYAGMYIVSVASLKRGMSHYVLVTYRNLVATLVMLPFALVF  63



>gb|EAY98030.1| hypothetical protein OsI_19945 [Oryza sativa Indica Group]
Length=419

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  143  STGKILAQ-SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            +TG+ L Q  KPY A++ LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA 
Sbjct  13   ATGESLMQKCKPYVAMVSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFAL  72

Query  320  FF  325
              
Sbjct  73   VL  74



>ref|XP_010534481.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=375

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L   KP+  VIFLQFG AGM++IAK ALN GM+ +  A YR++ AT+I APFAFF 
Sbjct  9    LKTWKPFLTVIFLQFGNAGMSIIAKFALNKGMSPHVLAAYRHVVATLIIAPFAFFL  64



>ref|XP_007141061.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
 gb|ESW13055.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
Length=385

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  ASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPF  313
            AS   GK   ++KPY A++ LQFGY+GM +I   +  +GM+H+  +VYR++ AT+I APF
Sbjct  6    ASSGFGKGFNKAKPYLAMVSLQFGYSGMYIITMVSFKHGMSHWVLSVYRHIVATLIMAPF  65

Query  314  AFFF  325
            AFF 
Sbjct  66   AFFL  69



>ref|XP_008444144.1| PREDICTED: WAT1-related protein At1g44800-like [Cucumis melo]
Length=374

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            I+ + KPY A++ LQFGYAGM +I    L  GMNHY  AVYR++ AT++  PFA   
Sbjct  13   IIQKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATIVIVPFAIVL  69



>ref|XP_009419851.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
              KPY A+I LQFGYAGM +I+K +LN+GM+HY   VYR+  AT+  APFA  F
Sbjct  10   SCKPYLAMISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFALIF  63



>ref|XP_002302243.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE81516.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=383

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L + KPY A++ LQFGYAGM +I   +L +GM+HY  AVYR++ AT++ APFA   
Sbjct  14   LKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATIVIAPFALVL  69



>ref|XP_007019030.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY16255.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=383

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +2

Query  119  DYYQLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATV  298
            D  Q  +   G  L ++K Y A+IFLQFG+AGM VI   +L  GMNHY  AVYR+L AT+
Sbjct  3    DKMQSGTFPVG--LTRAKSYSAMIFLQFGFAGMYVITMFSLQQGMNHYILAVYRHLVATI  60

Query  299  IFAPFAFFF  325
            + APFA   
Sbjct  61   VIAPFALVL  69



>gb|KCW65509.1| hypothetical protein EUGRSUZ_G02914 [Eucalyptus grandis]
Length=373

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KPY AV+ LQFG+AGMA+I K +LN GMN + F VYR+  AT + APFA  F
Sbjct  7    KPYLAVVLLQFGFAGMAIITKFSLNRGMNQHVFVVYRHAFATAVVAPFAILF  58



>ref|XP_003553527.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=383

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+  + KP+  V+FLQFGYAGM V++KAALN GM++Y F VYR++ A V+ APFA   
Sbjct  7    KLFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVTAPFALIL  64



>ref|XP_008219662.1| PREDICTED: WAT1-related protein At1g21890-like [Prunus mume]
Length=381

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  128  QLASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFA  307
            Q+A       L + KPY A+I LQFGYAGM +I+   L  GMNH+  AVYR+L A V+ A
Sbjct  4    QIAKGKLALFLYKIKPYLAMISLQFGYAGMYIISMVGLKRGMNHFVLAVYRHLIAVVVIA  63

Query  308  PFAFFF  325
            PFA   
Sbjct  64   PFALVL  69



>emb|CAH58631.1| nodulin-like protein [Plantago major]
Length=364

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    ++KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    GNFFERAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIIL  66



>ref|XP_010055600.1| PREDICTED: WAT1-related protein At5g07050-like [Eucalyptus grandis]
 gb|KCW89996.1| hypothetical protein EUGRSUZ_A02192 [Eucalyptus grandis]
Length=401

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +++PY A++ LQFGYAGM +I K +LN GM+HY   VYR+  ATV+ APFA   
Sbjct  17   MQRARPYIAMVSLQFGYAGMNIITKVSLNGGMSHYVLVVYRHAFATVVIAPFALIL  72



>ref|XP_002308146.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
 gb|EEE91669.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
Length=414

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFA  316
            ++KP+ AVIFLQ G+AGM +++KAALN GM++Y   VYR+  ATV+ APFA
Sbjct  72   RAKPFVAVIFLQVGFAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFA  122



>ref|XP_003560938.1| PREDICTED: WAT1-related protein At1g44800-like [Brachypodium 
distachyon]
Length=396

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +++   KPY  ++FLQFGYAGM +++ A++  GM+H+    YRNL AT++  PFA +F
Sbjct  7    RVVEDVKPYVMMVFLQFGYAGMYIVSVASMKRGMSHFVLVTYRNLVATILMTPFALYF  64



>ref|NP_001170095.1| hypothetical protein [Zea mays]
 gb|ACN35775.1| unknown [Zea mays]
Length=449

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
             +  ++ + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA  
Sbjct  7    DSESLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALV  66

Query  323  F  325
             
Sbjct  67   L  67



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  161  AQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             ++KP+ AVI LQFGYAG+++I+K ALN GM+ +   VYR+  AT++  PFA  F
Sbjct  11   GKAKPFLAVILLQFGYAGLSIISKFALNQGMSQHVLVVYRHAVATIVITPFAILF  65



>gb|KHG29659.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L ++KPY  +  LQFG+AGM VI   +L +GMNHY  AVYR+L AT++ APFA   
Sbjct  9    LNKAKPYLTMTSLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVL  64



>ref|XP_009141949.1| PREDICTED: WAT1-related protein At2g40900-like [Brassica rapa]
Length=387

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            +I   +KPYFA+I LQFGYAGM ++ K  L+ GM+HY    YRN  AT   APFAF 
Sbjct  4    RISESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFL  60



>ref|XP_006410933.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52386.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=380

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +++P+ +V+ LQ G AGM +++KA LN GM++Y   VYR+  ATV+ APFAF+F
Sbjct  10   MEKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYF  65



>ref|XP_004493899.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=361

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KP+ AV+FLQFGYAGM V++KAALN GM++Y   VYR+  A ++ APFA   
Sbjct  13   KPFIAVVFLQFGYAGMDVLSKAALNKGMSNYVLVVYRHAVAFIVIAPFALIL  64



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KPY A++FLQFG+AGM +I+ A+L  GM+HY   VYRN  A V+ APFA +F
Sbjct  11   KPYMAMVFLQFGFAGMFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWF  62



>gb|KHG26265.1| Auxin-induced 5NG4 [Gossypium arboreum]
 gb|KHG27688.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L + KPYFA IFLQ G AGM +++KAALN GM++Y   VYR+  AT++ APFA   
Sbjct  4    LGKFKPYFAAIFLQVGLAGMDILSKAALNQGMSNYVLVVYRHAIATLVMAPFAVIL  59



>ref|XP_004493898.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=382

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  170  KPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            KP+ AV+FLQFGYAGM V++KAALN GM++Y   VYR+  A ++ APFA   
Sbjct  13   KPFIAVVFLQFGYAGMDVLSKAALNKGMSNYVLVVYRHAVAFIVIAPFALIL  64



>emb|CDY06954.1| BnaA04g23610D [Brassica napus]
Length=387

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            +I   +KPYFA+I LQFGYAGM ++ K  L+ GM+HY    YRN  AT   APFAF 
Sbjct  4    RISESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFL  60



>ref|XP_006836228.1| hypothetical protein AMTR_s00101p00110290 [Amborella trichopoda]
 gb|ERM99081.1| hypothetical protein AMTR_s00101p00110290 [Amborella trichopoda]
Length=128

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFA  316
            +L +SKPY A++ LQFGYAGM +I K +LN GM+HY   VYR+  AT   APFA
Sbjct  10   VLNRSKPYIAMMSLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATGAIAPFA  63



>ref|XP_009143490.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
 emb|CDX91365.1| BnaC04g07850D [Brassica napus]
 emb|CDX74958.1| BnaA05g07040D [Brassica napus]
Length=380

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +++P+ +V+ LQ G AGM +++KA LN GM++Y   VYR+  ATV+ APFAF+F
Sbjct  10   MEKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYF  65



>ref|XP_006436050.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
 ref|XP_006486498.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49290.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
Length=375

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KP+ AVI LQFGYAGM++ +K ALN GM+ + FAVYR+  AT++ APFA   
Sbjct  10   RAKPFLAVILLQFGYAGMSIFSKFALNKGMSPHVFAVYRHAVATIVVAPFALIL  63



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G  + + KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT+  APFA   
Sbjct  8    GSFIQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATLAIAPFALVL  66



>ref|XP_008655310.1| PREDICTED: uncharacterized protein LOC100384013 isoform X1 [Zea 
mays]
 gb|AFW81937.1| hypothetical protein ZEAMMB73_476289 [Zea mays]
Length=409

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  STGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
             +  ++ + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA  
Sbjct  7    DSESLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALV  66

Query  323  F  325
             
Sbjct  67   L  67



>ref|XP_011015432.1| PREDICTED: WAT1-related protein At5g07050-like [Populus euphratica]
Length=405

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    + KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    GSFFERCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIIL  66



>gb|AFK45347.1| unknown [Lotus japonicus]
Length=90

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAF  319
            L + KPY A++ LQFGY+GM VI   +  +GM+H+  +VYR++ A +I APFAF
Sbjct  12   LHKVKPYLAIVSLQFGYSGMYVITMVSFKHGMSHWILSVYRHVVALIIIAPFAF  65



>ref|XP_009620098.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=371

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  12   RAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALIL  65



>ref|XP_003544681.1| PREDICTED: WAT1-related protein At1g44800-like [Glycine max]
Length=387

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  ASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPF  313
            +S   GK+  + KPY A++ LQFGY+GM +I   +  +GM+H+  +VYR++ AT+I APF
Sbjct  7    SSSGLGKVFRKVKPYLAMMSLQFGYSGMYIITMVSFKHGMSHWVLSVYRHVVATLIMAPF  66

Query  314  AFFF  325
            AF  
Sbjct  67   AFVL  70



>ref|XP_011040724.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=405

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    + KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    GSFFERCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIIL  66



>ref|XP_004499808.1| PREDICTED: WAT1-related protein At5g07050-like [Cicer arietinum]
Length=398

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            L +S PY A+I LQFGYAG+ +I K +LN GM+HY   VYR+  AT+  APFA  F
Sbjct  13   LDKSMPYIAMILLQFGYAGVNIITKLSLNGGMSHYVLVVYRHAFATIAIAPFAIIF  68



>gb|EMS48876.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             G  + ++KPY ++I LQFGYAGM V+ K +LN GM+HY   VYR+  AT+  APFA F 
Sbjct  4    CGGFMDKAKPYISMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALFL  63



>ref|XP_002283348.1| PREDICTED: WAT1-related protein At5g07050 [Vitis vinifera]
 emb|CBI32824.3| unnamed protein product [Vitis vinifera]
Length=396

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  GKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            G    + KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    GSFFQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALVL  66



>gb|KHN02414.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=383

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  152  KILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            K+  + KP+  V+FLQFGYAGM +++KAALN GM++Y F VYR++ A V+ APFA   
Sbjct  7    KLFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVTAPFALIL  64



>ref|XP_007009428.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY18238.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=376

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            I  Q+KP+ AVIFLQFGYAGM++IAK ALN GM+ + F +YR+  A ++ APFA   
Sbjct  4    IFNQAKPFLAVIFLQFGYAGMSIIAKFALNQGMSQHVFVMYRHAIAFLVIAPFAIVL  60



>ref|XP_009788498.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=389

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  14   RAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALIL  67



>gb|KHN12126.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=211

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFF  322
            I+ +++PY A++F+QF YAGMA+++KAA++ GM+ Y F VYR   A+V  +PFAFF
Sbjct  11   IVEKNRPYVAMLFIQFVYAGMALLSKAAISKGMSPYVFVVYRQALASVALSPFAFF  66



>ref|XP_003566095.1| PREDICTED: WAT1-related protein At5g07050-like [Brachypodium 
distachyon]
Length=388

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
             G  L ++KPY A+I LQFGYAGM V+ K +LN GM+HY   VYR+  ATV  AP A   
Sbjct  4    CGGFLEKAKPYIAMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATVAIAPLALIL  63



>ref|XP_010055591.1| PREDICTED: WAT1-related protein At5g07050-like [Eucalyptus grandis]
 gb|KCW89995.1| hypothetical protein EUGRSUZ_A02191 [Eucalyptus grandis]
Length=405

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + +++PY A++ LQFGYAGM +I K +LN GM+HY   VYR+  ATV+ APFA   
Sbjct  12   MQRARPYIAMMSLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATVVIAPFALIL  67



>ref|XP_010244423.1| PREDICTED: WAT1-related protein At5g07050 [Nelumbo nucifera]
Length=397

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  158  LAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            + + KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  8    IQRCKPYVAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALVL  63



>ref|XP_009620096.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=411

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  164  QSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++KPY A+I LQFGYAGM +I K +LN GM+HY   VYR+  AT + APFA   
Sbjct  14   RAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALIL  67



>gb|ACR34989.1| unknown [Zea mays]
Length=406

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  TGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            +  ++ + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA   
Sbjct  8    SESLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVL  67



>ref|XP_002441090.1| hypothetical protein SORBIDRAFT_09g020200 [Sorghum bicolor]
 gb|EES19520.1| hypothetical protein SORBIDRAFT_09g020200 [Sorghum bicolor]
Length=399

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++ + KPY A+I LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA   
Sbjct  13   LMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVL  69



>ref|XP_004962102.1| PREDICTED: WAT1-related protein At5g07050-like [Setaria italica]
Length=401

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  155  ILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++ + KPY A++ LQFGYAGM VI K +LN+GM+HY   VYR+  AT+  APFA   
Sbjct  11   LMQRCKPYMAMVSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVL  67



>gb|ACU23200.1| unknown [Glycine max]
Length=389

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  ASMSTGKILAQSKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPF  313
            +S   GK+  + KPY A++ LQFGY+GM +I   +  +GM+H+  +VYR++ AT+I APF
Sbjct  7    SSNGLGKVFHKVKPYLAMMSLQFGYSGMYIITMVSFKHGMSHWVLSVYRHIVATLIMAPF  66

Query  314  AFFF  325
            AF  
Sbjct  67   AFVL  70



>ref|XP_008455745.1| PREDICTED: WAT1-related protein At5g07050-like [Cucumis melo]
Length=444

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  SKPYFAVIFLQFGYAGMAVIAKAALNNGMNHYTFAVYRNLTATVIFAPFAFFF  325
            ++PY A+I LQFGYAGM ++ K ALN GM+HY    YR   AT+  APFAFF 
Sbjct  15   AQPYIAMISLQFGYAGMNIVTKVALNRGMSHYVLVTYRQAFATIALAPFAFFL  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522986485888