BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8547_g1_i1 len=1058 path=[1:0-1057]

Length=1058
                                                                      Score     E

emb|CDP05672.1|  unnamed protein product                                396   8e-133   
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510          388   1e-129   
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like     385   1e-128   
ref|XP_009601954.1|  PREDICTED: WAT1-related protein At2g39510-li...    384   3e-128   
ref|XP_004240770.1|  PREDICTED: WAT1-related protein At2g39510          380   9e-127   
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...    380   1e-126   
ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like     379   2e-126   
ref|XP_009798285.1|  PREDICTED: WAT1-related protein At2g39510-like     379   2e-126   
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg                376   2e-125   
ref|XP_011072598.1|  PREDICTED: WAT1-related protein At2g39510-li...    374   4e-124   
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative               372   2e-123   Ricinus communis
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             371   6e-123   Populus trichocarpa [western balsam poplar]
emb|CDP00045.1|  unnamed protein product                                371   6e-123   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like     368   1e-121   
ref|XP_002312071.1|  nodulin MtN21 family protein                       367   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like     365   2e-120   
ref|XP_011023754.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    363   2e-120   
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like         362   5e-120   
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like     362   1e-119   
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...    360   6e-119   
ref|XP_009601955.1|  PREDICTED: WAT1-related protein At2g39510-li...    358   8e-119   
ref|NP_181483.1|  nodulin MtN21-like transporter family protein         360   9e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like     360   1e-118   
gb|KDP29854.1|  hypothetical protein JCGZ_18429                         358   3e-118   
emb|CDY53594.1|  BnaA05g34670D                                          359   3e-118   
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg             358   4e-118   
ref|XP_011080962.1|  PREDICTED: WAT1-related protein At2g39510-like     358   5e-118   
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510          358   6e-118   
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...    358   7e-118   
ref|XP_002881660.1|  nodulin MtN21 family protein                       358   8e-118   
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like     358   9e-118   
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                    357   1e-117   
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like     357   1e-117   
emb|CDY20446.1|  BnaC04g05980D                                          357   2e-117   
ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg             357   2e-117   
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like     356   2e-117   
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like     356   3e-117   
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg             355   5e-117   
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg             354   8e-117   
gb|KHG11891.1|  Auxin-induced 5NG4                                      355   1e-116   
ref|XP_006365719.1|  PREDICTED: WAT1-related protein At2g39510-like     355   1e-116   
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like         354   2e-116   
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like     353   2e-116   
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like     352   4e-116   
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like     353   6e-116   
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like     352   6e-116   
emb|CBI32681.3|  unnamed protein product                                352   1e-115   
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like     351   1e-115   
ref|XP_004236759.1|  PREDICTED: WAT1-related protein At2g39510          352   2e-115   
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like     352   2e-115   
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510          350   6e-115   
emb|CDY07016.1|  BnaA04g22990D                                          350   7e-115   
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like     351   7e-115   Vitis vinifera
emb|CDX93255.1|  BnaC04g46410D                                          350   1e-114   
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...    349   2e-114   
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like         349   2e-114   
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          348   3e-114   Vitis vinifera
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like         348   4e-114   
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like     347   8e-114   
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...    348   8e-114   
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg             347   1e-113   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like     347   1e-113   
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like     346   1e-113   
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like     346   3e-113   
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510          345   5e-113   
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...    345   1e-112   
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510          343   2e-112   
emb|CDP06652.1|  unnamed protein product                                341   1e-111   
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like     339   2e-110   
ref|XP_007009429.1|  Nodulin MtN21 /EamA-like transporter family ...    341   2e-110   
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like     338   3e-110   
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                     337   6e-110   
ref|XP_010067380.1|  PREDICTED: WAT1-related protein At2g39510-like     337   2e-109   
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                     338   2e-109   
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like     335   4e-109   
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like     335   4e-109   
gb|KGN51272.1|  hypothetical protein Csa_5G505820                       335   9e-109   
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like         335   1e-108   
ref|XP_008461645.1|  PREDICTED: WAT1-related protein At2g39510-like     328   2e-106   
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like     328   3e-106   
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890          328   5e-106   
ref|XP_010553301.1|  PREDICTED: WAT1-related protein At2g37460-like     328   7e-106   
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...    326   1e-105   
ref|XP_010096638.1|  Auxin-induced protein 5NG4                         326   1e-105   
ref|XP_010067382.1|  PREDICTED: WAT1-related protein At2g39510-like     323   2e-105   
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein                 326   3e-105   
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g             326   3e-105   
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like     326   3e-105   
gb|KHG26265.1|  Auxin-induced 5NG4                                      326   3e-105   
ref|XP_008461650.1|  PREDICTED: WAT1-related protein At2g39510-li...    325   4e-105   
gb|KHN09434.1|  Auxin-induced protein 5NG4                              325   5e-105   
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like     325   5e-105   
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like     325   6e-105   
ref|XP_008461649.1|  PREDICTED: WAT1-related protein At2g39510-li...    325   6e-105   
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...    325   7e-105   
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like     324   2e-104   
emb|CDX79734.1|  BnaC03g20700D                                          323   2e-104   
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg                323   2e-104   
ref|XP_004141853.1|  PREDICTED: auxin-induced protein 5NG4-like         323   2e-104   
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                     326   2e-104   
ref|XP_008463490.1|  PREDICTED: WAT1-related protein At2g39510-li...    323   2e-104   
ref|XP_004166081.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    323   3e-104   
emb|CDY07788.1|  BnaA03g17230D                                          322   5e-104   
ref|XP_008233582.1|  PREDICTED: WAT1-related protein At2g39510-li...    320   5e-104   
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like     323   5e-104   
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like     322   6e-104   
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          322   1e-103   
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like     322   1e-103   
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg             322   1e-103   
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                    321   2e-103   
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                     324   3e-103   
gb|AAM62850.1|  nodulin-like protein                                    320   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181282.1|  nodulin MtN21-like transporter family protein         320   5e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37217.1|  unknown                                                 320   5e-103   
ref|XP_009778858.1|  PREDICTED: WAT1-related protein At2g37460-li...    319   6e-103   
ref|XP_003625520.1|  Auxin-induced protein 5NG4                         320   6e-103   
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g             321   8e-103   Populus trichocarpa [western balsam poplar]
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg             319   1e-102   
emb|CDY18444.1|  BnaA04g21430D                                          318   2e-102   
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460          318   2e-102   
ref|XP_009614497.1|  PREDICTED: WAT1-related protein At2g37460-li...    318   2e-102   
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like     318   4e-102   
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like     318   4e-102   
ref|XP_010534299.1|  PREDICTED: WAT1-related protein At2g39510-like     318   4e-102   
ref|XP_003590513.1|  Auxin-induced protein 5NG4                         317   5e-102   
gb|EYU41683.1|  hypothetical protein MIMGU_mgv1a009185mg                316   6e-102   
gb|KHG24903.1|  Auxin-induced 5NG4                                      317   7e-102   
ref|XP_004147717.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    317   7e-102   
emb|CDX93378.1|  BnaC04g45180D                                          317   9e-102   
gb|KHG03072.1|  Auxin-induced 5NG4                                      317   9e-102   
ref|XP_004167778.1|  PREDICTED: auxin-induced protein 5NG4-like         317   1e-101   
gb|KDP35589.1|  hypothetical protein JCGZ_09027                         316   1e-101   
gb|KHG29314.1|  Auxin-induced 5NG4                                      313   2e-101   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...    316   2e-101   
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like     315   4e-101   
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like     315   5e-101   
gb|KDO67718.1|  hypothetical protein CISIN_1g043160mg                   313   6e-101   
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...    314   1e-100   
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g             313   2e-100   
gb|AFK37263.1|  unknown                                                 314   2e-100   
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like     313   3e-100   
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460          313   3e-100   
ref|XP_004167845.1|  PREDICTED: auxin-induced protein 5NG4-like         310   1e-99    
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like     319   2e-99    
ref|XP_004142736.1|  PREDICTED: auxin-induced protein 5NG4-like         310   3e-99    
ref|XP_006294396.1|  hypothetical protein CARUB_v10023413mg             310   5e-99    
ref|XP_008463583.1|  PREDICTED: WAT1-related protein At2g39510-like     311   7e-99    
ref|XP_007009431.1|  Nodulin MtN21 /EamA-like transporter family ...    309   7e-99    
ref|XP_006410932.1|  hypothetical protein EUTSA_v10016799mg             307   7e-99    
ref|XP_007220060.1|  hypothetical protein PRUPE_ppa025780mg             309   1e-98    
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    307   3e-98    
ref|XP_010419331.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    307   4e-98    
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     306   6e-98    
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...    307   8e-98    
ref|XP_008233580.1|  PREDICTED: WAT1-related protein At2g39510-like     306   9e-98    
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like     306   1e-97    
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like     305   2e-97    
gb|KDO40045.1|  hypothetical protein CISIN_1g019311mg                   304   2e-97    
ref|XP_006436052.1|  hypothetical protein CICLE_v10031808mg             306   2e-97    
ref|NP_001064323.1|  Os10g0210500                                       305   2e-97    Oryza sativa Japonica Group [Japonica rice]
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         305   3e-97    
ref|XP_006429015.1|  hypothetical protein CICLE_v10012001mg             305   4e-97    
ref|XP_011019905.1|  PREDICTED: WAT1-related protein At2g37460-li...    302   5e-97    
gb|EEC66707.1|  hypothetical protein OsI_33030                          304   7e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_002302243.2|  nodulin MtN21 family protein                       304   8e-97    Populus trichocarpa [western balsam poplar]
gb|KDO67719.1|  hypothetical protein CISIN_1g042257mg                   304   9e-97    
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like     303   9e-97    
ref|XP_004290852.1|  PREDICTED: auxin-induced protein 5NG4-like         303   1e-96    
ref|XP_006289117.1|  hypothetical protein CARUB_v10002538mg             304   1e-96    
gb|KHN05928.1|  Auxin-induced protein 5NG4                              303   1e-96    
gb|AFK43964.1|  unknown                                                 300   3e-96    
emb|CDY29141.1|  BnaA09g53940D                                          303   3e-96    
ref|XP_010097389.1|  Auxin-induced protein 5NG4                         301   6e-96    
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290          302   8e-96    
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like     301   8e-96    
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740             301   1e-95    
emb|CDX75163.1|  BnaC09g25190D                                          301   1e-95    
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg             300   1e-95    
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g             300   4e-95    Populus trichocarpa [western balsam poplar]
emb|CDY18443.1|  BnaA04g21440D                                          300   5e-95    
ref|NP_192569.1|  nodulin MtN21 /EamA-like transporter family pro...    300   5e-95    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43205.1|  putative nodulin                                       300   6e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65570.1|  nodulin-like protein                                    299   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg             299   7e-95    
emb|CDX91104.1|  BnaC02g04930D                                          299   9e-95    
ref|XP_009141664.1|  PREDICTED: WAT1-related protein At2g37460-li...    298   9e-95    
gb|KGN54575.1|  hypothetical protein Csa_4G365050                       298   1e-94    
ref|XP_004494995.1|  PREDICTED: WAT1-related protein At2g37460-li...    296   1e-94    
ref|XP_009388785.1|  PREDICTED: WAT1-related protein At1g21890-like     298   1e-94    
emb|CDX93377.1|  BnaC04g45190D                                          298   1e-94    
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290          298   2e-94    
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like     297   2e-94    
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     297   6e-94    
gb|AGZ85011.1|  hypothetical protein 6                                  297   7e-94    
gb|KDO40046.1|  hypothetical protein CISIN_1g019311mg                   293   2e-93    
ref|XP_008461651.1|  PREDICTED: WAT1-related protein At2g39510-li...    295   2e-93    
gb|KCW65508.1|  hypothetical protein EUGRSUZ_G02912                     295   2e-93    
gb|EMS57240.1|  Auxin-induced protein 5NG4                              294   3e-93    
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg               294   5e-93    
ref|XP_006399861.1|  hypothetical protein EUTSA_v10013837mg             294   7e-93    
ref|NP_001137108.1|  hypothetical protein                               293   7e-93    Zea mays [maize]
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330          294   7e-93    Sorghum bicolor [broomcorn]
gb|EYU28757.1|  hypothetical protein MIMGU_mgv1a023410mg                291   1e-92    
ref|XP_011023643.1|  PREDICTED: WAT1-related protein At5g13670-like     293   1e-92    
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                    293   1e-92    
ref|XP_003601053.1|  Auxin-induced protein 5NG4                         294   1e-92    
gb|KDP22890.1|  hypothetical protein JCGZ_01964                         292   1e-92    
ref|XP_006486497.1|  PREDICTED: WAT1-related protein At2g39510-like     292   2e-92    
ref|XP_002312070.1|  hypothetical protein POPTR_0008s05130g             293   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like     293   2e-92    
ref|XP_006436051.1|  hypothetical protein CICLE_v10033577mg             291   2e-92    
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like     293   2e-92    
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg             293   2e-92    
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like     293   2e-92    
ref|XP_009141665.1|  PREDICTED: WAT1-related protein At2g37460-li...    290   3e-92    
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like     293   3e-92    
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     292   4e-92    
ref|XP_009398157.1|  PREDICTED: WAT1-related protein At1g21890-like     291   4e-92    
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         291   5e-92    
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300          291   5e-92    
gb|EMT04611.1|  Auxin-induced protein 5NG4                              292   6e-92    
gb|AFK47115.1|  unknown                                                 291   6e-92    
dbj|BAK04730.1|  predicted protein                                      291   7e-92    
dbj|BAJ98418.1|  predicted protein                                      291   9e-92    
emb|CDP15800.1|  unnamed protein product                                291   1e-91    
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like     290   1e-91    
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          291   1e-91    
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like     291   1e-91    
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...    290   2e-91    
gb|AFK35679.1|  unknown                                                 290   2e-91    
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like     290   2e-91    
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     290   3e-91    
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like     290   4e-91    
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g             290   4e-91    
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like     289   4e-91    
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               289   4e-91    Ricinus communis
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...    290   4e-91    
gb|EMS60728.1|  Auxin-induced protein 5NG4                              290   4e-91    
ref|NP_001242267.1|  uncharacterized protein LOC100811617               290   6e-91    
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     290   7e-91    
emb|CDY65991.1|  BnaA10g29860D                                          288   8e-91    
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     289   1e-90    
gb|EMT07558.1|  Auxin-induced protein 5NG4                              288   1e-90    
ref|XP_004290853.1|  PREDICTED: auxin-induced protein 5NG4-like         288   1e-90    
gb|ACJ84735.1|  unknown                                                 288   1e-90    Medicago truncatula
ref|XP_004494994.1|  PREDICTED: WAT1-related protein At2g37460-li...    286   1e-90    
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like     288   1e-90    
gb|KHN48995.1|  Auxin-induced protein 5NG4                              288   2e-90    
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like     288   2e-90    
gb|EMS60727.1|  Auxin-induced protein 5NG4                              287   2e-90    
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like     288   2e-90    
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     287   3e-90    
ref|XP_010492135.1|  PREDICTED: WAT1-related protein At5g13670 is...    287   3e-90    
ref|XP_010492134.1|  PREDICTED: WAT1-related protein At5g13670 is...    287   4e-90    
ref|XP_010910818.1|  PREDICTED: WAT1-related protein At4g08290-like     285   4e-90    
gb|ACD56621.1|  putative nodulin-like protein                           287   4e-90    Gossypioides kirkii
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g             286   5e-90    Populus trichocarpa [western balsam poplar]
gb|EMS45454.1|  Auxin-induced protein 5NG4                              286   5e-90    
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...    287   6e-90    
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like     286   6e-90    
ref|XP_010558786.1|  PREDICTED: WAT1-related protein At5g13670          286   7e-90    
ref|XP_004493899.1|  PREDICTED: WAT1-related protein At2g37460-li...    286   7e-90    
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     286   8e-90    
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed       284   8e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289509.1|  hypothetical protein CARUB_v10003044mg             286   9e-90    
ref|XP_010096633.1|  Auxin-induced protein 5NG4                         285   1e-89    
gb|AFK34273.1|  unknown                                                 286   1e-89    
ref|XP_009121742.1|  PREDICTED: WAT1-related protein At5g13670          286   1e-89    
gb|KHG16518.1|  Auxin-induced 5NG4                                      286   1e-89    
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         285   1e-89    
ref|XP_002284452.2|  PREDICTED: WAT1-related protein At4g08290          285   2e-89    Vitis vinifera
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg                285   2e-89    
ref|XP_004500562.1|  PREDICTED: WAT1-related protein At4g08300-li...    283   2e-89    
emb|CDY09817.1|  BnaC09g43440D                                          283   3e-89    
gb|EMS46274.1|  Auxin-induced protein 5NG4                              285   3e-89    
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...    285   3e-89    
gb|EEC74071.1|  hypothetical protein OsI_09081                          285   4e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like     285   4e-89    
ref|NP_001048238.1|  Os02g0768300                                       284   5e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002489200.1|  hypothetical protein SORBIDRAFT_0012s002110        283   5e-89    
gb|ABS52574.1|  nodulin family protein                                  284   7e-89    
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like     284   7e-89    
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     283   1e-88    
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300          284   1e-88    
gb|KHN09198.1|  Auxin-induced protein 5NG4                              284   1e-88    
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    283   1e-88    
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890          283   2e-88    
ref|XP_010453454.1|  PREDICTED: WAT1-related protein At5g13670-like     283   2e-88    
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         283   2e-88    
ref|XP_006349970.1|  PREDICTED: WAT1-related protein At2g37460-like     284   2e-88    
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like     283   3e-88    
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     282   3e-88    
gb|KHG29659.1|  Auxin-induced 5NG4                                      282   3e-88    
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like     281   4e-88    
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     282   4e-88    
ref|NP_001240202.1|  uncharacterized protein LOC100811114               282   4e-88    
ref|XP_010525695.1|  PREDICTED: WAT1-related protein At2g37460-like     282   4e-88    
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like     282   5e-88    
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     281   8e-88    
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    281   8e-88    
gb|EMT18534.1|  Auxin-induced protein 5NG4                              279   8e-88    
emb|CDP06236.1|  unnamed protein product                                281   9e-88    
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             280   9e-88    
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like     281   9e-88    
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein                 281   1e-87    
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     281   1e-87    
gb|EMT33815.1|  Auxin-induced protein 5NG4                              281   1e-87    
gb|KHG10291.1|  Auxin-induced 5NG4                                      280   1e-87    
emb|CDX85633.1|  BnaA02g01800D                                          280   1e-87    
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    281   2e-87    
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             282   2e-87    
gb|KHG18008.1|  Auxin-induced 5NG4                                      280   2e-87    
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     281   2e-87    
gb|AAO41946.1|  unknown protein                                         278   2e-87    
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     281   2e-87    
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800          280   2e-87    
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                280   2e-87    
ref|XP_009363179.1|  PREDICTED: WAT1-related protein At1g21890-like     280   2e-87    
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like     280   3e-87    
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300          280   3e-87    
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     280   3e-87    
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          280   3e-87    
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    280   3e-87    
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like     280   3e-87    
ref|NP_196871.1|  nodulin MtN21-like transporter UMAMIT 15              279   4e-87    
ref|XP_009125930.1|  PREDICTED: WAT1-related protein At5g13670-like     279   5e-87    
ref|XP_006339251.1|  PREDICTED: WAT1-related protein At5g07050-like     279   5e-87    
gb|ACU23200.1|  unknown                                                 279   8e-87    
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          279   1e-86    
gb|KHG29332.1|  Auxin-induced 5NG4                                      278   1e-86    
ref|XP_008466700.1|  PREDICTED: WAT1-related protein At4g08290          278   1e-86    
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          279   1e-86    
gb|ABR18253.1|  unknown                                                 280   1e-86    
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     278   2e-86    
emb|CAH58631.1|  nodulin-like protein                                   277   2e-86    
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g             278   2e-86    
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             278   2e-86    
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg             278   2e-86    
gb|ABR16695.1|  unknown                                                 278   2e-86    
ref|XP_004253170.1|  PREDICTED: WAT1-related protein At2g37460-like     278   2e-86    
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    278   2e-86    
gb|AAM62626.1|  nodulin protein, putative                               276   3e-86    
gb|KHG23400.1|  Auxin-induced 5NG4                                      277   3e-86    
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     278   3e-86    
ref|XP_008391904.1|  PREDICTED: WAT1-related protein At1g21890-like     277   4e-86    
ref|XP_008219762.1|  PREDICTED: WAT1-related protein At4g08290          277   4e-86    
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like         276   5e-86    
ref|XP_008782344.1|  PREDICTED: WAT1-related protein At1g21890-like     277   6e-86    
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     276   7e-86    
gb|KGN61714.1|  hypothetical protein Csa_2G231960                       276   8e-86    
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         275   9e-86    
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1            275   1e-85    
gb|ABK25095.1|  unknown                                                 276   1e-85    
ref|XP_002284458.1|  PREDICTED: WAT1-related protein At4g08290 is...    275   1e-85    
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like     275   2e-85    
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     275   3e-85    
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             275   4e-85    
gb|AFK39842.1|  unknown                                                 273   4e-85    
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...    274   4e-85    
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like     274   5e-85    
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     275   6e-85    
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          274   7e-85    
ref|XP_007223097.1|  hypothetical protein PRUPE_ppa007061mg             273   8e-85    
ref|XP_006305116.1|  hypothetical protein CARUB_v10009485mg             273   8e-85    
ref|XP_002893995.1|  nodulin MtN21 family protein                       273   1e-84    
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     272   1e-84    
ref|NP_001148990.1|  nodulin protein                                    273   2e-84    
gb|EMT13376.1|  Auxin-induced protein 5NG4                              277   2e-84    
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         273   2e-84    
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             273   2e-84    
ref|XP_010664225.1|  PREDICTED: WAT1-related protein At4g08290 is...    271   2e-84    
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like     273   2e-84    
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    273   3e-84    
emb|CDX70003.1|  BnaA10g23520D                                          272   4e-84    
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          272   4e-84    
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             272   4e-84    
emb|CBI19038.3|  unnamed protein product                                274   4e-84    
gb|AAM01041.1|AC091735_14  Putative nodulin-like protein                270   4e-84    
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     273   5e-84    
emb|CDY00403.1|  BnaC07g14230D                                          271   6e-84    
ref|XP_010999363.1|  PREDICTED: WAT1-related protein At4g08290 is...    269   6e-84    
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          271   8e-84    
ref|XP_009767374.1|  PREDICTED: WAT1-related protein At4g08300-like     271   9e-84    
gb|KHN33840.1|  Auxin-induced protein 5NG4                              269   2e-83    
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     270   2e-83    
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     270   2e-83    
ref|XP_003543089.1|  PREDICTED: WAT1-related protein At4g08290-li...    269   2e-83    
ref|NP_001183198.1|  uncharacterized protein LOC100501578               266   3e-83    
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     270   3e-83    
dbj|BAD35697.1|  putative MtN21                                         269   3e-83    
gb|KHN47037.1|  Auxin-induced protein 5NG4-like protein                 269   3e-83    
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         269   5e-83    
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     268   5e-83    
gb|EAZ00107.1|  hypothetical protein OsI_22111                          269   5e-83    
gb|EAZ36228.1|  hypothetical protein OsJ_20548                          269   5e-83    
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like     269   7e-83    
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             269   7e-83    
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         269   8e-83    
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...    268   1e-82    
ref|XP_004964911.1|  PREDICTED: WAT1-related protein At1g44800-like     268   1e-82    
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...    268   1e-82    
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890          268   1e-82    
ref|XP_004250321.2|  PREDICTED: WAT1-related protein At4g08300-like     268   1e-82    
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          268   2e-82    
gb|KHN09193.1|  Auxin-induced protein 5NG4                              268   2e-82    
ref|XP_007010782.1|  Nodulin MtN21 /EamA-like transporter family ...    269   2e-82    
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg             268   3e-82    
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         267   3e-82    
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       267   3e-82    
gb|EMS48876.1|  Auxin-induced protein 5NG4                              267   4e-82    
ref|XP_003527931.1|  PREDICTED: WAT1-related protein At4g08290-like     267   4e-82    
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          266   8e-82    
gb|KHG10292.1|  Auxin-induced 5NG4                                      266   8e-82    
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     266   9e-82    
gb|KFK36195.1|  hypothetical protein AALP_AA4G090300                    265   9e-82    
ref|XP_010419959.1|  PREDICTED: WAT1-related protein At5g13670-like     265   1e-81    
dbj|BAJ92223.1|  predicted protein                                      266   1e-81    
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like     265   1e-81    
ref|XP_007019026.1|  Nodulin MtN21 /EamA-like transporter family ...    264   1e-81    
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          265   1e-81    
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                    265   2e-81    
ref|XP_003601062.1|  Auxin-induced protein 5NG4                         265   2e-81    
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          265   3e-81    
ref|XP_003544696.1|  PREDICTED: WAT1-related protein At4g08290-like     263   3e-81    
ref|XP_007019025.1|  Nodulin MtN21 /EamA-like transporter family ...    264   3e-81    
ref|XP_009107474.1|  PREDICTED: WAT1-related protein At1g44800          264   3e-81    
emb|CDM84603.1|  unnamed protein product                                264   3e-81    
ref|XP_002513792.1|  Auxin-induced protein 5NG4, putative               263   4e-81    
emb|CDY04680.1|  BnaC05g17180D                                          264   4e-81    
ref|XP_007141063.1|  hypothetical protein PHAVU_008G164200g             263   8e-81    
ref|XP_010498646.1|  PREDICTED: WAT1-related protein At1g21890-like     263   8e-81    
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050          263   1e-80    
gb|KHG09563.1|  Auxin-induced 5NG4                                      264   1e-80    
ref|XP_004498329.1|  PREDICTED: WAT1-related protein At1g44800-li...    260   1e-80    
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    263   1e-80    
ref|XP_004493328.1|  PREDICTED: WAT1-related protein At5g07050-li...    260   1e-80    
emb|CDY49560.1|  BnaAnng10230D                                          262   1e-80    
ref|XP_002893187.1|  T26F17.11                                          263   1e-80    
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like     263   1e-80    
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg             263   1e-80    
ref|XP_009151420.1|  PREDICTED: WAT1-related protein At4g08300 is...    262   1e-80    
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    263   2e-80    
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like     263   2e-80    
ref|NP_001055529.2|  Os05g0409500                                       263   2e-80    
ref|NP_173607.1|  WAT1-related protein                                  262   2e-80    
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     263   2e-80    
emb|CDY01310.1|  BnaA07g10830D                                          262   2e-80    
gb|EAY98030.1|  hypothetical protein OsI_19945                          263   2e-80    
ref|XP_008233583.1|  PREDICTED: WAT1-related protein At2g37460-li...    258   2e-80    
emb|CBI35062.3|  unnamed protein product                                261   2e-80    
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like     262   3e-80    
ref|XP_002873622.1|  nodulin MtN21 family protein                       261   3e-80    
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like     262   3e-80    
gb|EMT18779.1|  Auxin-induced protein 5NG4                              262   3e-80    
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     262   3e-80    
ref|XP_004164556.1|  PREDICTED: auxin-induced protein 5NG4-like         259   3e-80    
ref|XP_006393710.1|  hypothetical protein EUTSA_v10011570mg             261   3e-80    
ref|XP_004493329.1|  PREDICTED: WAT1-related protein At5g07050-li...    259   4e-80    
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890          261   4e-80    
ref|XP_004151019.1|  PREDICTED: auxin-induced protein 5NG4-like         260   4e-80    
dbj|BAK04850.1|  predicted protein                                      261   4e-80    
gb|AFK35983.1|  unknown                                                 261   4e-80    
ref|XP_008463487.1|  PREDICTED: WAT1-related protein At2g39510-like     260   5e-80    
emb|CDY14996.1|  BnaA10g08600D                                          261   5e-80    
emb|CDY63388.1|  BnaCnng41950D                                          260   6e-80    
emb|CAB45800.1|  nodulin-like protein                                   260   6e-80    
emb|CDY12554.1|  BnaC06g00800D                                          261   7e-80    
gb|KHN04117.1|  Auxin-induced protein 5NG4                              259   7e-80    
ref|XP_011091919.1|  PREDICTED: WAT1-related protein At5g07050-like     261   8e-80    
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like     261   8e-80    
ref|XP_006397314.1|  hypothetical protein EUTSA_v10028745mg             260   8e-80    
gb|ADN33888.1|  nodulin-like protein                                    260   9e-80    
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                261   1e-79    
gb|EMT31802.1|  Auxin-induced protein 5NG4                              260   1e-79    
ref|NP_192570.2|  nodulin MtN21 /EamA-like transporter family pro...    260   1e-79    
gb|ACR34989.1|  unknown                                                 261   1e-79    
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             260   1e-79    
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     260   1e-79    
gb|EEC79453.1|  hypothetical protein OsI_20446                          261   1e-79    
ref|NP_001055921.1|  Os05g0493800                                       261   1e-79    
ref|XP_006410931.1|  hypothetical protein EUTSA_v10017814mg             256   1e-79    
ref|XP_009123503.1|  PREDICTED: WAT1-related protein At1g44800-like     260   1e-79    
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     260   1e-79    
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             260   1e-79    
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          260   2e-79    
gb|AAL38712.1|  putative nodulin protein                                259   2e-79    
ref|XP_010063982.1|  PREDICTED: WAT1-related protein At4g08290-like     259   2e-79    
dbj|BAK02715.1|  predicted protein                                      259   3e-79    
ref|XP_002436678.1|  hypothetical protein SORBIDRAFT_10g006950          259   4e-79    
gb|EMT29950.1|  Auxin-induced protein 5NG4                              258   6e-79    
ref|NP_001239827.1|  uncharacterized protein LOC100804390               259   6e-79    
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    259   6e-79    
ref|NP_001141126.1|  uncharacterized protein LOC100273211               258   1e-78    
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     258   1e-78    
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         258   1e-78    
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    258   1e-78    
gb|EPS73987.1|  hypothetical protein M569_00767                         255   1e-78    
gb|AAF16542.1|AC013482_16  T26F17.11                                    257   2e-78    
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like     258   2e-78    
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     257   3e-78    



>emb|CDP05672.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   396 bits (1018),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 251/314 (80%), Gaps = 5/314 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RP+MT SV WKI+LLGLLEPVIDQNLYY  MKYTTATF  ++ N+LPA+TF+LAWIL
Sbjct  61   RKVRPRMTISVLWKIILLGLLEPVIDQNLYYAAMKYTTATFAVSMTNMLPALTFLLAWIL  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN R+LHSQ KI GT +T+GGAMIMTLVRG  I LPWT+  ++ QS +A N Q DP
Sbjct  121  RLEEVNTRRLHSQIKIAGTIITVGGAMIMTLVRGPAINLPWTRADANVQSPAAANPQ-DP  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI+AGC CWASF+ILQA+T+KSYPA LSLTS++C  GALQG+++TLV ERGN ++
Sbjct  180  IKGALMISAGCFCWASFHILQAMTVKSYPACLSLTSMICTAGALQGTIVTLVAERGNPSV  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+DT L++Y+YSGV+ SGV Y ISG++M+ KGPVFVTAF+PLSM+IVA M +FILAE
Sbjct  240  WSIHFDTILMSYVYSGVVTSGVGYCISGIIMRAKGPVFVTAFSPLSMVIVAFMSTFILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDA--PVDQQLP--VIRPATTHQE  888
            +L FG+V GA  IV GLYLVIWG  KD  S S   ++D   P+D+QLP   +   +++ E
Sbjct  300  RLTFGRVFGAISIVTGLYLVIWGKCKDQISPSKSTNVDETDPIDEQLPDKNLTTKSSNDE  359

Query  889  QHSATPIEVPGEES  930
            ++ AT  ++ G ++
Sbjct  360  KNDATKGDIAGGDN  373



>ref|XP_009798400.1| PREDICTED: WAT1-related protein At2g39510 [Nicotiana sylvestris]
Length=373

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 246/314 (78%), Gaps = 13/314 (4%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMTFS+FWKIMLLGLLEPVIDQNLYY GMK+TTATF TA+ NVLPAITF+LAWIL
Sbjct  70   RKIRPKMTFSIFWKIMLLGLLEPVIDQNLYYAGMKFTTATFATAMCNVLPAITFLLAWIL  129

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN+ K+HSQAKI+GT +T+GGAM+MTLV G  IGLPWTK +S   ++ A  ++ +P
Sbjct  130  RLENVNIWKIHSQAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSSTATTSVASPTELNP  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            VKGA  I  GC CWA FY LQ ITLK+YPAGLSLTSL+C  GALQG+ LTLVVERGN+A+
Sbjct  190  VKGALFILVGCFCWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLVVERGNSAV  249

Query  541  WAVHWDTT-LLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            W++ W ++ L+A +Y G++ SG+ YY+SG++M  KGPVFVTAFNPL+M+IVAI+GSFIL+
Sbjct  250  WSIQWGSSKLIASVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVAILGSFILS  309

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD--APVDQQLPVIRPATTHQEQ  891
            EQL+ G+V+GA VIV+GLYLVIWG++K+  S       +    VD++LP I+ +      
Sbjct  310  EQLNLGRVVGAAVIVIGLYLVIWGTTKEQKSSKILSTNEEVEQVDKELPEIKSSNQ----  365

Query  892  HSATPIEVPGEESV  933
                   V G+ESV
Sbjct  366  ------AVMGDESV  373



>ref|XP_009625314.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana tomentosiformis]
Length=375

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 243/316 (77%), Gaps = 15/316 (5%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+FWKIMLLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LAWIL
Sbjct  70   RKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  129

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN+ K+HSQAKI+GT +T+GGAM+MTLV G  IGLPWTK ++   S  A  ++ +P
Sbjct  130  RLENVNIWKIHSQAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSTTTTSV-ASPTELNP  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            VKGA  I  GC CWA FY LQ ITLK+YPAGLSLTSL+C  GALQG+ LTLVVERGN+A+
Sbjct  189  VKGALFILVGCFCWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLVVERGNSAV  248

Query  541  WAVHWDTT-LLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            W++ W ++ L AY+Y G++ SG+ YY+SG++M  KGPVFVTAFNPL+M+IVAI+GSFIL+
Sbjct  249  WSIQWGSSKLFAYVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVAILGSFILS  308

Query  718  EQLDFGKVLGACVIVVGLYLVIW----gsskddsskssgddLDAPVDQQLPVIRPATTHQ  885
            EQL+ G+V+GA VIV+GLYLVIW             ++ ++ +A VD++L  I+      
Sbjct  309  EQLNLGRVVGAAVIVIGLYLVIWGTTKEQKSSKILSTTTEEEEAAVDKELAEIK------  362

Query  886  EQHSATPIEVPGEESV  933
               S+    + G+ESV
Sbjct  363  ---SSNQAVITGDESV  375



>ref|XP_009601954.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Nicotiana 
tomentosiformis]
Length=372

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 242/312 (78%), Gaps = 8/312 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP MT S+F KIMLLGLLEPVIDQNLYYTG++YTTATF TA+ NVLPA+TF+LAWIL
Sbjct  68   RKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFMLAWIL  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQ-D  357
            RLE+VNVR+L SQAKI+GT+VT GGAMIMTL+ G  IGLPWT+      +A++ +  +  
Sbjct  128  RLEKVNVRRLSSQAKIVGTTVTFGGAMIMTLIGGPTIGLPWTRHLLSTTTATSASLTELQ  187

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA  IAAGC CWA FY LQAITLK+YPA LSLT L+C  GA+QG+ LTLV ERGN +
Sbjct  188  PIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTALTLVAERGNTS  247

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IW++H DT LL+Y+YSG++ SGV YY+SG++MKDKGPVFVTAFNPL+M+IVAI+GSFIL+
Sbjct  248  IWSIHLDTKLLSYVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVIVAILGSFILS  307

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHS  897
            EQL+ G+VLG  +IV+GLYLVIWG SKD          D  V+   PV +  +T +  + 
Sbjct  308  EQLNLGRVLGGAIIVIGLYLVIWGKSKDQKLSKYSSTDDVEVE---PVGKETSTTKSLNQ  364

Query  898  ATPIEVPGEESV  933
                   G+E+V
Sbjct  365  TK----AGDEAV  372



>ref|XP_004240770.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=364

 Score =   380 bits (976),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/264 (69%), Positives = 222/264 (84%), Gaps = 5/264 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKM+ S+F KIMLLGL+EPVIDQNLYYTG++YTTAT   A+ N+LPA+TF+LAWIL
Sbjct  65   RKIRPKMSISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQD-  357
            RLE+VN+ +L SQAKI+GT+VT GGAMIMTLV G  IGLPWT+   HD      +S  D 
Sbjct  125  RLEKVNIMRLSSQAKIIGTTVTFGGAMIMTLVGGPTIGLPWTR---HDHINIIPSSTTDL  181

Query  358  -PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
             P+KGA  IAAGC CWA FY LQAITLK+YPA LSLT L+C  GALQG++LTLVVERGN 
Sbjct  182  QPIKGALFIAAGCICWACFYNLQAITLKTYPASLSLTCLICSAGALQGTLLTLVVERGNT  241

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            +IWA+ WDTT L+Y+YSG++ SGV YY+SG++MK+KGPVFVTAFNPL+M+IVAI+GSFIL
Sbjct  242  SIWAIQWDTTFLSYVYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFIL  301

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            +E+L+ G+VLG  +IV+GLYLVIW
Sbjct  302  SEELNLGRVLGGAIIVIGLYLVIW  325



>ref|XP_011072605.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Sesamum 
indicum]
Length=379

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 218/266 (82%), Gaps = 4/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MTFS+F+KI+LL LLEPVIDQNLYY GMKYTTATF +A+ NVLPAITF+LAW L
Sbjct  63   RKIRPRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWAL  122

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAG----NS  348
             LE+VN+++  SQAK+ GT VT+ GAMIMTLVRG +IGLPWT+ +  +   +A     NS
Sbjct  123  GLERVNIKRWSSQAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRHSHINSQLTAADADANS  182

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             Q+PV+GA MI AGC CW+ FYILQAITLKSYPAGLSLT+L+C  GALQG+ LTLV E+ 
Sbjct  183  HQNPVRGALMITAGCFCWSIFYILQAITLKSYPAGLSLTALICMGGALQGTALTLVAEKS  242

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N AIW +  DT LLAY+YSG++ SG+ YY++GVV K+KGPVF T+FNPLSM+ VA+M SF
Sbjct  243  NTAIWTIRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFVAVMSSF  302

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            ILAEQLD GKV GA VIVVGLYL IW
Sbjct  303  ILAEQLDVGKVSGAIVIVVGLYLFIW  328



>ref|XP_006343754.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=366

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 221/262 (84%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+F KIMLLGL+EPVIDQNLYYTG++YTTAT   A+ N+LPA+TF+LAWIL
Sbjct  65   RKIRPKMTISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+++L SQAKI+GT+VT GGAMIMTL+ G  IGLPWT+   H     +  +   P
Sbjct  125  RLERVNIKRLSSQAKIIGTTVTFGGAMIMTLIGGPTIGLPWTRH--HLNIIPSSPTDLQP  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA  IAAGC CWA FY LQAITLK+YPA LSLT L+C  GALQG++LTLVVERGN +I
Sbjct  183  IKGALFIAAGCICWACFYNLQAITLKTYPATLSLTCLICSAGALQGTLLTLVVERGNTSI  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT+ L+Y+YSG++ SGV YY+SG++MK+KGPVFVTAFNPL+M+IVAI+GSFIL+E
Sbjct  243  WAIQWDTSFLSYVYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFILSE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            +L+ G+VLG  +IV+GLYLVIW
Sbjct  303  ELNLGRVLGGAIIVIGLYLVIW  324



>ref|XP_009798285.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana sylvestris]
Length=372

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 222/263 (84%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP MT S+F KIMLLGLLEPVIDQNLYYTG++YTTATF TA+ NVLPA+TF+LAWIL
Sbjct  68   RKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFLLAWIL  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQ-D  357
            RLE+VN+R+L SQAKI+GT+VT GGAMIM L+ G  IGLPWT+      +A++ +  +  
Sbjct  128  RLEKVNIRRLSSQAKIVGTTVTFGGAMIMALIGGPTIGLPWTRHLLSTTTATSASLTELQ  187

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA  IAAGC CWA FY LQAITLK+YPA LSLT L+C  GA++G+ LTLV ERGN +
Sbjct  188  PIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVEGTALTLVAERGNTS  247

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IWA+H DT LL+Y+YSG++ SG+ YY+SG++MKDKGPVFVTAFNPL+M++VAI+GSFIL+
Sbjct  248  IWAIHLDTKLLSYVYSGMVTSGLGYYVSGLIMKDKGPVFVTAFNPLNMVLVAILGSFILS  307

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQL+ G+VLG  +IV+GLYLVIW
Sbjct  308  EQLNLGRVLGGAIIVIGLYLVIW  330



>gb|EYU38348.1| hypothetical protein MIMGU_mgv1a009263mg [Erythranthe guttata]
Length=348

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/263 (70%), Positives = 215/263 (82%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT SV WKI LL  LEPVIDQNLYY GMK+TTATF+TA+ N+LPAITF+LAW L
Sbjct  63   RKIRPKMTVSVLWKIALLAFLEPVIDQNLYYMGMKHTTATFSTAMCNILPAITFLLAWAL  122

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN-SQQD  357
            RLE+VNVR+ H  AKILGT  T+GGAMIMTLV+G +IGLPWTK   + +SA     + QD
Sbjct  123  RLEKVNVRRAHGYAKILGTFATLGGAMIMTLVQGSIIGLPWTKIEPNSESADGVVITTQD  182

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            PVKGA MI  GC C + FYILQAIT+KSY A LSLT L+C  G LQG VLTL VERGN +
Sbjct  183  PVKGALMITVGCFCCSIFYILQAITMKSYAAPLSLTCLICMAGMLQGIVLTLAVERGNFS  242

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IW++ WDT LLAY YSGVICSGV+YY+SG+VM +KGPVFVT+FNPL+M+IVA++ SFI A
Sbjct  243  IWSIGWDTKLLAYTYSGVICSGVSYYVSGIVMNEKGPVFVTSFNPLNMVIVAVLSSFIFA  302

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQL+ GKV+GA VIV GLYLVIW
Sbjct  303  EQLNIGKVIGATVIVFGLYLVIW  325



>ref|XP_011072598.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Sesamum 
indicum]
Length=386

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 182/273 (67%), Positives = 218/273 (80%), Gaps = 11/273 (4%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MTFS+F+KI+LL LLEPVIDQNLYY GMKYTTATF +A+ NVLPAITF+LAW L
Sbjct  63   RKIRPRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWAL  122

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAG----NS  348
             LE+VN+++  SQAK+ GT VT+ GAMIMTLVRG +IGLPWT+ +  +   +A     NS
Sbjct  123  GLERVNIKRWSSQAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRHSHINSQLTAADADANS  182

Query  349  QQDPVKGAAMIAAGCCCWASFYILQ-------AITLKSYPAGLSLTSLLCGMGALQGSVL  507
             Q+PV+GA MI AGC CW+ FYILQ       AITLKSYPAGLSLT+L+C  GALQG+ L
Sbjct  183  HQNPVRGALMITAGCFCWSIFYILQKKLTYLQAITLKSYPAGLSLTALICMGGALQGTAL  242

Query  508  TLVVERGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMII  687
            TLV E+ N AIW +  DT LLAY+YSG++ SG+ YY++GVV K+KGPVF T+FNPLSM+ 
Sbjct  243  TLVAEKSNTAIWTIRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVF  302

Query  688  VAIMGSFILAEQLDFGKVLGACVIVVGLYLVIW  786
            VA+M SFILAEQLD GKV GA VIVVGLYL IW
Sbjct  303  VAVMSSFILAEQLDVGKVSGAIVIVVGLYLFIW  335



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 219/262 (84%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F KI+++GLLEP IDQNLYYTGMKYTTATF   + N+LPA  FI+AWIL
Sbjct  67   RKVRPKMTISIFLKILMMGLLEPTIDQNLYYTGMKYTTATFAATMCNILPAFAFIMAWIL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN++++HSQAK+LGT VT+GGAMIMTLV+G  + LPWT+  +  Q +S+  + QD 
Sbjct  127  RLEKVNLKRVHSQAKLLGTIVTVGGAMIMTLVKGAKLNLPWTEGYNDIQGSSSAPTMQDT  186

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA++I  GC CW++F ILQAITLK+YPA LSLT+ +C MG ++G++  +++ERGN + 
Sbjct  187  IKGASLIGVGCICWSAFIILQAITLKTYPAELSLTAFICLMGTIEGTIFAVIMERGNPSA  246

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+DT LLA +YSGVICSGVAYY+ GV+MK KGPVFVTAFNPL MIIV I+GSF+L+E
Sbjct  247  WSIHFDTKLLACVYSGVICSGVAYYVQGVIMKSKGPVFVTAFNPLCMIIVTILGSFVLSE  306

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             + FG+VLGA VIV+GLYLV+W
Sbjct  307  IVYFGRVLGALVIVIGLYLVLW  328



>ref|XP_002315243.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
 gb|EEF01414.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
Length=381

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 216/263 (82%), Gaps = 3/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F+KIML+GLLEP IDQNLYYTGMKYTTATF +A+ N+LPA  F++AW L
Sbjct  67   RKVRPKMTLSIFFKIMLMGLLEPTIDQNLYYTGMKYTTATFASAMCNILPAFAFLMAWAL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN-SQQD  357
            RLE+VN+RK+HSQAKI+GT VT+GGAM+MTLV+G  + LPWTK   +DQ AS G  ++QD
Sbjct  127  RLEKVNIRKMHSQAKIIGTIVTVGGAMLMTLVKGTQLDLPWTK--GYDQHASTGGLTKQD  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA MI  GC CWASF ILQAITLKSYP  LSLT+ +C MG ++G+VL +V+ERGN +
Sbjct  185  PIKGALMITTGCACWASFIILQAITLKSYPVELSLTAWICFMGTIEGTVLAVVMERGNPS  244

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W++  D  LLA +YSGV CSG+AYY+ G++MK +GPVFVTAFNPLSM+IVAI+GSF L 
Sbjct  245  AWSIALDYKLLAAVYSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILGSFFLK  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V GA VIV GLYLV+W
Sbjct  305  EILYLGRVFGAVVIVTGLYLVLW  327



>emb|CDP00045.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   371 bits (952),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 250/313 (80%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RP+MTFSV WKI+LLGLLEPVIDQNLYY  MKYTTATFT A+ N++PA+TF+LAWIL
Sbjct  67   RKVRPRMTFSVLWKILLLGLLEPVIDQNLYYAAMKYTTATFTAAMTNMVPALTFLLAWIL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLEQVN+R++H   KI GT+VT+GGAMIMTLV+G  IGLPWTK  +   S++  N Q DP
Sbjct  127  RLEQVNLRRIHGLVKIAGTAVTVGGAMIMTLVKGPTIGLPWTKADTGVHSSTVANPQ-DP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA M+AAGC CWA+FY LQAITLKSYPAGLSLTS++C  GALQ  V+TLV ERGN++I
Sbjct  186  IKGALMLAAGCFCWANFYNLQAITLKSYPAGLSLTSMICMAGALQAIVVTLVAERGNSSI  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+DT LL Y+Y G+I SGV YY++G++++ KGPVFV AFNPLSM+IVAIM SFIL+E
Sbjct  246  WSIHFDTILLCYVYCGLINSGVTYYVTGLILRSKGPVFVAAFNPLSMVIVAIMSSFILSE  305

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD--APVDQQLPVIRPATTHQEQH  894
            +L+FG+V GA +I++GLYLVIWG SKD    S  +++D  AP+DQQLP      T+    
Sbjct  306  RLNFGRVFGAVIIMLGLYLVIWGKSKDKCLLSKSNNIDRIAPIDQQLP-----DTNLPTK  360

Query  895  SATPIEVPGEESV  933
            S+  I+   E ++
Sbjct  361  SSINIDEKSEANI  373



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score =   368 bits (944),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 217/262 (83%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT+SVF KI LLGLLEPVIDQNLYY GM YTTATFT A+ N+LPA+TF+LA++L
Sbjct  72   RKVRPKMTYSVFAKIALLGLLEPVIDQNLYYAGMSYTTATFTAAMCNILPALTFLLAFVL  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN++ + SQAK++GT VT+GGAM+MTL++G  + LPWTK   ++ S +    QQDP
Sbjct  132  RLEKVNIKNVRSQAKVVGTLVTVGGAMLMTLIKGPTMDLPWTKGTVNNTSQTGHPVQQDP  191

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MIA GC CW+ F ILQAITLK+YPAGLSLT+LLC MG ++G+ + L ++ GN + 
Sbjct  192  IKGALMIATGCFCWSCFIILQAITLKAYPAGLSLTALLCFMGTIEGAAVALAMQWGNTSS  251

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+HWD   LA +Y G++CSGVAYY+ GV+MK++GPVFVTAF+PL MIIVAI+GSFILAE
Sbjct  252  WAIHWDAKFLAAVYGGIMCSGVAYYVQGVIMKERGPVFVTAFSPLCMIIVAILGSFILAE  311

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G V+GA VIVVGLYLV+W
Sbjct  312  EMYLGSVIGATVIVVGLYLVVW  333



>ref|XP_002312071.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE89438.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=380

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 217/263 (83%), Gaps = 3/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F+KIMLLGLLEP IDQNLYYTGMKYTTATFT+A+ NVLPA  F++AW L
Sbjct  65   RKVRPKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWAL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN-SQQD  357
            R+EQVN+RK+HSQAKI GT VT+GGAM+MTLV+G  + LPWT+   +DQ AS    ++QD
Sbjct  125  RIEQVNIRKMHSQAKIFGTIVTVGGAMLMTLVKGTQLDLPWTR--GYDQQASTSALTKQD  182

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA MIA GC CWASF ILQ+ITLKSYP  LSLT+ +C MG ++GS++ +V+ERGN +
Sbjct  183  PIKGALMIATGCVCWASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPS  242

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W+V  +  LLA +YSGVICSG+ YY+ G++MK KGPVFVTAF+PLSM+IVAI+GSF L 
Sbjct  243  AWSVGLNYKLLAAVYSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVAILGSFFLK  302

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V+GA VIV GLYLV+W
Sbjct  303  EILCVGRVIGAVVIVTGLYLVLW  325



>ref|XP_011027136.1| PREDICTED: WAT1-related protein At2g39510-like [Populus euphratica]
Length=380

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 214/263 (81%), Gaps = 3/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F+KIML+GLLEP +DQNLYYTGMKYTTATF +A+ NVLPA  F++AW L
Sbjct  67   RKVRPKMTLSIFFKIMLMGLLEPTLDQNLYYTGMKYTTATFASAMCNVLPAFAFLMAWAL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNS-QQD  357
            RLE+VN+RK+HSQAKI+GT VT+GGAM+MTLV+G  + LPWTK   +DQ  S G   +QD
Sbjct  127  RLEKVNIRKMHSQAKIIGTIVTVGGAMLMTLVKGTQLDLPWTK--GYDQHPSTGGLIKQD  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA MI  GC CWASF ILQAITLK+YP  LSLT+ +C MG ++G+VL +V+ERGN +
Sbjct  185  PIKGALMITIGCVCWASFIILQAITLKTYPVELSLTAWICFMGTIEGTVLAVVMERGNPS  244

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W++  D  LLA +YSGV CSG+AYY+ G++MK +GPVFVTAFNPLSM+IVAI+GSF L 
Sbjct  245  AWSIALDYKLLAAVYSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILGSFFLK  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V GA VIV GLYLV+W
Sbjct  305  EILYLGRVFGAVVIVTGLYLVLW  327



>ref|XP_011023754.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g39510-like 
[Populus euphratica]
Length=351

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 216/263 (82%), Gaps = 3/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F+KIMLLGLLEP IDQNLYYTGMKYTTATFT+A+ NVLPA  F++AW+L
Sbjct  65   RKVRPKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWVL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN-SQQD  357
            R+EQVN+RK HSQAKI GT VT+GGAM+MTLV+G  + LPWT+   +DQ AS    ++QD
Sbjct  125  RIEQVNIRKKHSQAKIFGTIVTVGGAMLMTLVKGTQLDLPWTR--GYDQQASTSALTKQD  182

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA MIA GC CWASF ILQ+ITLKSYP  LSLT+ +C MG ++GS++ +V+ERGN +
Sbjct  183  PIKGALMIATGCVCWASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPS  242

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W+V  +  LLA +YSGVICSG+ YY+ G++MK KGPVFVTAF+PLSM+IV I+GSF L 
Sbjct  243  AWSVGLNYKLLAAVYSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVTILGSFFLK  302

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V+GA VIV GLYLV+W
Sbjct  303  EILYVGRVIGAVVIVTGLYLVLW  325



>ref|XP_004307548.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=350

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/262 (67%), Positives = 210/262 (80%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVF KI+LLGLLEPVID NL+YTGMK TTATFTTA+ NVLPA  FI+AWI 
Sbjct  67   RKLRPKMTLSVFVKILLLGLLEPVIDGNLFYTGMKLTTATFTTAMCNVLPAFAFIMAWIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN+RKLHSQAKILGT VT+GGAM+MTLV G ++ LPWT+  SH Q  +   + QDP
Sbjct  127  RLEMVNIRKLHSQAKILGTIVTVGGAMLMTLVNGPMLTLPWTRSTSHHQY-TGSTASQDP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC CWASF ILQA+TLK YPA LSLT+ +C MG L+G+V  + +E  N A 
Sbjct  186  IKGALMITAGCFCWASFMILQAVTLKVYPAELSLTAWICLMGTLEGTVAAVAIEWHNTAA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+H D  LL  +Y GVICSGVAYYI G+VMK++GPVFVTAFNPLSM+IVAI+ S  L+E
Sbjct  246  WAIHLDYKLLPAVYGGVICSGVAYYIQGIVMKERGPVFVTAFNPLSMVIVAILSSIALSE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             L  G+V+GA VI++GLY+V+W
Sbjct  306  ILYLGRVMGAMVIIIGLYMVLW  327



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 215/262 (82%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KIMLL LLEPV+DQNLY+ GMKYTTATF  A+ N+LPA+TF++AW+L
Sbjct  64   KKVRPKMTLSIFIKIMLLALLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAWVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN++ + SQ+K++GT  T+ GAMIMTLV+G ++ L WT+ ASH+Q  SA  S QD 
Sbjct  124  RLEKVNLKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTR-ASHEQHTSAATSLQDS  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC CWA F ILQAITLK+YPA LSL++ +C +G L+G+ + LV+ERGNAA+
Sbjct  183  IKGSLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAVALVMERGNAAV  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA  YSG+ CSG+AYYI GVVMK +GPVFVTAF+PLSM+IVA+M SFIL E
Sbjct  243  WSIKWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILRE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G++LGA VI+ GLYLV+W
Sbjct  303  QMFLGRLLGAVVIIAGLYLVVW  324



>ref|XP_008233581.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Prunus 
mume]
Length=347

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 211/262 (81%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSVF KI+LLGLLEPVIDQNL+YTGMK TTATFT+A+ NVLPA  FI+AWI 
Sbjct  67   RKVRPKMTFSVFTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE +N R L S AKILGT VT+GGAM+MTL+ G ++ LPWT+   H +S SA +  QDP
Sbjct  127  RLENINFRSLRSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSATD-HQDP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG  +I AGC CWA F  LQAITLKSYPA LSL + +C MG +QG+V+ L  E  N A 
Sbjct  186  IKGTLLIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWD+ LLA +YSG+ICSGV YY+ G+VMK++GPVFVTAF+PLSMIIVA+M SF+LAE
Sbjct  246  WSIHWDSKLLAAVYSGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  306  IMYLGRVIGAMVIVIGLYMVLW  327



>ref|XP_009601955.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score =   358 bits (920),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 174/257 (68%), Positives = 213/257 (83%), Gaps = 4/257 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP MT S+F KIMLLGLLEPVIDQNLYYTG++YTTATF TA+ NVLPA+TF+LAWIL
Sbjct  68   RKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFMLAWIL  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQ-D  357
            RLE+VNVR+L SQAKI+GT+VT GGAMIMTL+ G  IGLPWT+      +A++ +  +  
Sbjct  128  RLEKVNVRRLSSQAKIVGTTVTFGGAMIMTLIGGPTIGLPWTRHLLSTTTATSASLTELQ  187

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA  IAAGC CWA FY LQAITLK+YPA LSLT L+C  GA+QG+ LTLV ERGN +
Sbjct  188  PIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTALTLVAERGNTS  247

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IW++H DT LL+Y+YSG++ SGV YY+SG++MKDKGPVFVTAFNPL+M+IVAI+GSFIL+
Sbjct  248  IWSIHLDTKLLSYVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVIVAILGSFILS  307

Query  718  EQLDFGKVL---GACVI  759
            EQL+ G  +   G C+I
Sbjct  308  EQLNLGSNVACKGGCLI  324



>ref|NP_181483.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|O80638.1|WTR14_ARATH RecName: Full=WAT1-related protein At2g39510 [Arabidopsis thaliana]
 gb|AAC27842.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAP12854.1| At2g39510 [Arabidopsis thaliana]
 dbj|BAE99731.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09688.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   360 bits (924),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 178/290 (61%), Positives = 227/290 (78%), Gaps = 5/290 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  FI+AWI 
Sbjct  60   RKIRPKMTLSIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VNV+K+HSQAKILGT VT+GGAM+MT+V+G +I LPW       Q +S    +QD 
Sbjct  120  RLEKVNVKKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPHDIHQDSSNTGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA++IA GC CWA F  LQAITLKSYP  LSLT+ +C +G+++ +++ L +ERGN + 
Sbjct  180  TKGASLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFLGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+H D+ LLA +Y GVICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WAIHLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRP  870
             +  G++LGA VIV+GLY V+WG SKD+ S S      + +D++LP+  P
Sbjct  300  VMFLGRILGAIVIVLGLYSVLWGKSKDEPSSSF-----SDMDKELPLSTP  344



>ref|XP_009143306.1| PREDICTED: WAT1-related protein At2g39510-like [Brassica rapa]
Length=375

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 211/262 (81%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKILGT VT+GGAM+MT+V+G +I LPW   + + Q +S    +QD 
Sbjct  120  RLEKVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+L+C MG+++ +++ L +ERGN + 
Sbjct  180  TKGALLIATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y GVICSGV YY+ GV+MK +GPVFVTAFNPLSM+IVAIMGS IL+E
Sbjct  240  WAIQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSE  299

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  300  VMYLGRILGAIVIVLGLYSVLW  321



>gb|KDP29854.1| hypothetical protein JCGZ_18429 [Jatropha curcas]
Length=348

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 217/262 (83%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSVF KI+LLGLLEP IDQNLYYTGMKYTTATF +A+ N+LPA  F++AW L
Sbjct  39   RKVRPKMTFSVFVKILLLGLLEPTIDQNLYYTGMKYTTATFASAMCNILPAFAFLMAWAL  98

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V  +K+HS AK+LGT VT+GGAM+MTL++G ++ LPW+K    +Q+++A  +  D 
Sbjct  99   RLEEVKWKKVHSWAKVLGTIVTVGGAMLMTLIKGAILELPWSK-GYDNQASTAAVTPHDT  157

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC CW+ F ILQAITLK+YPA LSLT+L+C MG ++GS+  +++E+GN + 
Sbjct  158  IKGAFMIGIGCLCWSCFIILQAITLKTYPAELSLTALICFMGTIEGSIFAVIMEKGNPSA  217

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D+ LLA +YSGV+CSG+AYY+ GV+MK KGPVFVTAFNPLSM+IV I+GSF+L+E
Sbjct  218  WSIHFDSKLLAAVYSGVMCSGIAYYVQGVIMKAKGPVFVTAFNPLSMVIVTILGSFVLSE  277

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+++GA VIV GLYLV+W
Sbjct  278  IMYLGRIIGALVIVTGLYLVLW  299



>emb|CDY53594.1| BnaA05g34670D [Brassica napus]
Length=375

 Score =   359 bits (921),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 211/262 (81%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKILGT VT+GGAM+MT+V+G +I LPW   + + Q +S    +QD 
Sbjct  120  RLEKVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+L+C MG+++ +++ L +ERGN + 
Sbjct  180  TKGALLIATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ L+A +Y GVICSGV YY+ GV+MK +GPVFVTAFNPLSM+IVAIMGS IL+E
Sbjct  240  WAIQLDSKLVAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSE  299

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  300  VMYLGRILGAIVIVLGLYSVLW  321



>ref|XP_006296517.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
 gb|EOA29415.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
Length=375

 Score =   358 bits (920),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 224/299 (75%), Gaps = 18/299 (6%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  FI+AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS-HDQSASAGNSQQD  357
            RLE+VNV+K+HSQAKILGT VT+GGAM+MT+V+G +I LPW   +  H Q AS    +QD
Sbjct  120  RLEKVNVKKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPSDMHHQDASNPGVKQD  179

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
              KGA +IA GC CWA F  LQAITLKSYP  LS+T+ +C MG+L+ +++ L +ERGN +
Sbjct  180  LTKGALLIAIGCICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPS  239

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             WA+  D+ LLA +Y GVICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILA
Sbjct  240  AWAIQLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILA  299

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAP------VDQQLPVIRPAT  876
            E +  G++LGA VIV+GLY V+WG SK           D P      +D++LP+  P T
Sbjct  300  EVMYLGRILGAVVIVLGLYSVLWGKSK-----------DQPSSSFPDMDKELPLSTPQT  347



>ref|XP_011080962.1| PREDICTED: WAT1-related protein At2g39510-like [Sesamum indicum]
Length=379

 Score =   358 bits (920),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 230/304 (76%), Gaps = 7/304 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMTFSVF KIMLLGLL+PV  QN++Y+G+ YT+ATF +A+ N+LPAITF++AWIL
Sbjct  65   RKIRPKMTFSVFVKIMLLGLLDPVFGQNMFYSGLNYTSATFASAMCNLLPAITFVMAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+R++ S AKI+GT VT+GGAMIMTL+ G VI LPWT ++    S+S  N  ++P
Sbjct  125  RIEKVNLREVRSHAKIVGTMVTVGGAMIMTLLSGPVIPLPWTHKSHQSHSSSNSNDHENP  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            VKGA MI AGC  ++ FYILQA+TLK+YPAGLSLT+L+C  GAL+G+VLT +VERGN AI
Sbjct  185  VKGALMIGAGCFGYSLFYILQAVTLKTYPAGLSLTALICTFGALEGTVLTFIVERGNTAI  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ W+  LLAY+Y G++ SGV YY+SGV+MK KGPVF+TAFNP +M+IVAI+ SFI  E
Sbjct  245  WALGWNAKLLAYVYGGIVASGVTYYLSGVIMKHKGPVFLTAFNPCTMVIVAILSSFIFHE  304

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD-------APVDQQLPVIRPATT  879
            Q+  GKV GA VIV GLY VIWG SKD   +    +L        A   Q  P ++P  T
Sbjct  305  QMTVGKVTGALVIVTGLYFVIWGKSKDQKEEVKLTELPQHKPAAAAADHQDFPSLKPGKT  364

Query  880  HQEQ  891
               Q
Sbjct  365  EGSQ  368



>ref|XP_010517305.1| PREDICTED: WAT1-related protein At2g39510 [Camelina sativa]
Length=375

 Score =   358 bits (919),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 226/315 (72%), Gaps = 25/315 (8%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  FI+AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VNVRK+HSQAKILGT VT+GGAM+MT+V+G +I LPW       Q AS    +QD 
Sbjct  120  RLEKVNVRKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPNDIHQDASNPGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+ +C MG+L+ +++ L +ERGN + 
Sbjct  180  TKGALLIAVGCICWAGFINLQAITLKSYPVELSLTAYICFMGSLESTIVALYIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y G+ICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WAIQLDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAP------VDQQLPVIRP----  870
             +  G++LGA VIV+GLY V+WG SK           D P      +D +LP+  P    
Sbjct  300  VMFLGRILGAIVIVLGLYSVLWGKSK-----------DEPPSSFPDMDTELPLSTPQIVT  348

Query  871  ----ATTHQEQHSAT  903
                A T  + + AT
Sbjct  349  FSSKANTEMDTNDAT  363



>ref|XP_007009430.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18240.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=394

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 173/262 (66%), Positives = 213/262 (81%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFS+F +I+LLGLLEP IDQNLYYTG+KYTTAT  TAL NVLPA  F+LA   
Sbjct  65   RKVRPKMTFSIFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVLPAFVFLLALAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V++RKLH QAKILGT  T+GGAMIMTLV G ++ LPWTK  +  QS +   ++ DP
Sbjct  125  RLEKVDMRKLHCQAKILGTLGTVGGAMIMTLVNGPILPLPWTKVTNEHQS-TVSATKDDP  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC CWA F ILQAITLKSYPA LSLT+L+C MGA++G+++ LV+E GNAA 
Sbjct  184  LKGALMILAGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGNAAA  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWD+ L A +YSGVICSGVAYY+  +V++ KGPVF  AFNPL+M+IVAIM SFI +E
Sbjct  244  WSIHWDSKLFAAVYSGVICSGVAYYVGAMVIQAKGPVFYAAFNPLTMVIVAIMSSFIFSE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIVVGLYLV+W
Sbjct  304  IMYLGRVIGAIVIVVGLYLVLW  325



>ref|XP_002881660.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57919.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score =   358 bits (918),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 181/309 (59%), Positives = 228/309 (74%), Gaps = 13/309 (4%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  FI+AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VNV+K+HSQAKILGT VT+GGAM+MT+V+G +I LPW       Q  S    QQD 
Sbjct  120  RLEKVNVKKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWANPHDIHQDPSNTGVQQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA++IA GC CWA F  LQAITLKSYP  LSLT+ +C MG+++ +++ L +ERGN + 
Sbjct  180  TKGASLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFMGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y GVICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WAIQLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRP--------AT  876
             +  G++LGA VIV+GLY V+WG SKD+ S S      +  D++LP+  P        A 
Sbjct  300  VMFLGRILGAIVIVLGLYSVLWGKSKDEPSSSF-----SDTDKELPLSTPQIVTLPSKAN  354

Query  877  THQEQHSAT  903
               + H A+
Sbjct  355  AKMDTHDAS  363



>ref|XP_010509005.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   358 bits (918),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 228/320 (71%), Gaps = 18/320 (6%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  FI+AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VNVRK+HSQAKILGT VT+GGAM+MT+V+G +I LPW       Q AS    +QD 
Sbjct  120  RLEKVNVRKIHSQAKILGTIVTVGGAMLMTVVKGPMIPLPWANPNDIHQDASNPGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LS+T+ +C MG+L+ +++ L +ERGN + 
Sbjct  180  TKGALLIAVGCICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y G+ICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WAIQLDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAP------VDQQLPVIRPATTH  882
             +  G++LGA VIV+GLY V+WG SK           D P      +D++LP+  P    
Sbjct  300  VMFLGRILGAIVIVLGLYSVLWGKSK-----------DEPSSPFPDMDRELPLSSPQIVT  348

Query  883  QEQHSATPIEVPGEESV*FT  942
                +   I+     SV FT
Sbjct  349  FSSKANAEIDT-NHASVVFT  367



>gb|KFK36842.1| hypothetical protein AALP_AA4G179000 [Arabis alpina]
Length=368

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 208/262 (79%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  +F+KI+LLGLLEP IDQNLYY GMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  60   RKVRPKMTLPIFFKILLLGLLEPTIDQNLYYMGMKYTSATFTAAMTNVLPAFAFLMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+K+HSQAKILGT VT+GGAM+MTLV+G +I LPW     H Q +S    +QD 
Sbjct  120  RLENVNVKKIHSQAKILGTVVTVGGAMLMTLVKGPLIPLPWANPNDHHQDSSNTGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+ +C MG+++ +++ L +ERGN + 
Sbjct  180  TKGAMLIATGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++  D+ LLA +Y+GVICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WSIQLDSKLLAAVYAGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  300  VMYLGRILGAIVIVLGLYSVLW  321



>ref|XP_010505629.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 208/262 (79%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F+KI+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  FI+AWI 
Sbjct  60   RKIRPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VNVRK+HSQAKILGT VT+GGAM+MT+V+G +I LPW       Q AS    +QD 
Sbjct  120  RLEKVNVRKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPNDIHQDASNPGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+ +C MG+L+ +++ L +ERGN + 
Sbjct  180  TKGALLIAVGCICWAGFINLQAITLKSYPVELSLTACICFMGSLESTIVALYIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y G+ICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WAIQLDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  300  VMFLGRILGAIVIVLGLYSVLW  321



>emb|CDY20446.1| BnaC04g05980D [Brassica napus]
Length=375

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 211/262 (81%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F++I+LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  60   RKIRPKMTLPIFFEILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKILGT VT+GGAM+MT+V+G +I LPW   + + Q +S    +QD 
Sbjct  120  RLEKVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+L+C MG+++ +++ L +ERGN + 
Sbjct  180  TKGALLIATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y G+ICSGV YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS IL+E
Sbjct  240  WAIQLDSKLLAAVYGGIICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSE  299

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  300  VMYLGRILGAIVIVLGLYSVLW  321



>ref|XP_006436050.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
 ref|XP_006486498.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49290.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
Length=375

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/262 (67%), Positives = 216/262 (82%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F KI+LLGLLEP IDQNL+YTGMKYTTATFTTA+ NVLPA  F++AWI+
Sbjct  65   RKVRPKMTLSIFVKILLLGLLEPTIDQNLFYTGMKYTTATFTTAMANVLPAFAFLMAWII  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN RK HS AK+ GT VT+GGAM MTL++G V+ LPWT    H +S S  +S Q P
Sbjct  125  RLEKVNFRKFHSWAKVFGTIVTVGGAMFMTLIKGPVLDLPWTNHNYHQESTS-NSSVQSP  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC  WA F +LQAITLKSYP  LSLT+L+C MG ++G+++ L +ERGNAA+
Sbjct  184  IKGALMITIGCFSWAGFMVLQAITLKSYPTELSLTALICLMGTIEGTIVALFLERGNAAV  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H D+ LLA +YSGVICSG+ YY+SGVVMKD+GPVFVTAFNPL MIIVAIMGSF+L+E
Sbjct  244  WSIHLDSKLLAAVYSGVICSGIGYYVSGVVMKDRGPVFVTAFNPLCMIIVAIMGSFLLSE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA +IVVGLYLV+W
Sbjct  304  IMYLGRVVGAIIIVVGLYLVLW  325



>ref|XP_010554433.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=355

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 212/262 (81%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  + +KI+LLGLLEP IDQNLYYTGM  T+ATFT A+ NVLPA +F++AW+ 
Sbjct  48   RKVRPKMTLPILFKIVLLGLLEPTIDQNLYYTGMGCTSATFTAAMSNVLPAFSFLMAWLF  107

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VNVRK+ SQAKILGT VT+GGAM+MTLV+G ++ LPWT   S+ Q AS   ++QD 
Sbjct  108  RLEKVNVRKIPSQAKILGTIVTVGGAMLMTLVKGPLVPLPWTNNHSNSQGASNPETKQDL  167

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            VKGA +I  GC CWA F  LQAITLKSYPA LSLT+ +C  GA+ G+++ LV+ER N A 
Sbjct  168  VKGAILIGVGCICWAGFINLQAITLKSYPAELSLTAYMCLSGAIGGTIVALVIERANPAA  227

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D+ LLA +YSGVICSG++YYI G VMK +GPVFVTAFNPLSM+IVAI+GSF+LAE
Sbjct  228  WSIQFDSKLLAVVYSGVICSGISYYIQGAVMKTRGPVFVTAFNPLSMVIVAILGSFLLAE  287

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  288  VMFLGRILGAVVIVLGLYSVLW  309



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 212/262 (81%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KIMLLGLLEPV+DQNLY+ GMKYTTATF  A+ N+LPA+TF++AW+L
Sbjct  64   KKVRPKMTLSIFIKIMLLGLLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAWVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQ+K++GT  T+ GAMIMTLV+G ++ L WT+   H+Q  SA  S QD 
Sbjct  124  RLEKVKLKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTRPG-HEQHTSAATSLQDS  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC CWA F ILQAITLK+YPA LSL++ +C +G L+G+   LV+ERGNAA+
Sbjct  183  IKGSLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAAALVMERGNAAV  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA  YSG+ CSG+AYYI GVVMK +GPVFVTAF+PLSM+IVA+M SFIL E
Sbjct  243  WSIKWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILRE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G++LGA VI+ GLYLV+W
Sbjct  303  QMFLGRLLGAVVIIAGLYLVVW  324



>ref|XP_006411179.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
 gb|ESQ52632.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
Length=371

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 223/295 (76%), Gaps = 16/295 (5%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  +F+KI++LGLLEP +DQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  60   RKVRPKMTLPIFFKILVLGLLEPTLDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKI+GT VT+GGAM+MT+V+G +I LPWT    + Q +S    + D 
Sbjct  120  RLEKVNIRKIHSQAKIIGTIVTVGGAMLMTVVKGPLIPLPWTNPNENHQDSSNPGVKPDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA+F  LQAITLKSYP  LSLT+ +C MG+++ +++ L +ERGN A 
Sbjct  180  TKGALLIATGCICWAAFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPAA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA IY GVICSG+ YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS IL+E
Sbjct  240  WAIQLDSKLLAAIYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSE  299

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAP-----VDQQLPVIRP  870
             +  G++LGA VIV+GLY V+WG SK           D P     +D++LP+  P
Sbjct  300  VMYLGRILGAIVIVIGLYSVLWGKSK-----------DEPSNSFDLDKELPLSNP  343



>ref|XP_007218251.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
 gb|EMJ19450.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
Length=347

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 213/262 (81%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSV  KI+LLGLLEPVIDQNL+YTGMK TTATFT+A+ NVLPA  FI+AWI 
Sbjct  67   RKVRPKMTFSVLTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE +N R LHS AKILGT VT+GGAM+MTL+ G ++ LPWT+   H +S SA +  QDP
Sbjct  127  RLENINFRSLHSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSATD-HQDP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC CWA F  LQAITLKSYPA LSL + +C MG +QG+V+ L  E  N A 
Sbjct  186  IKGALMIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWD+ LLA +YSG+ICSGVAYY+ G+VMK++GPVFVTAF+PLSMIIVA+M SF+LAE
Sbjct  246  WSIHWDSKLLAAVYSGIICSGVAYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  306  IMYLGRVIGAMVIVIGLYMVLW  327



>gb|KHG11891.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=392

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 210/263 (80%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVF +I LLGLLEP IDQNLYYTG+KYTTAT  TAL NVLPA  F+LAW+ 
Sbjct  67   RKVRPKMTLSVFVQIALLGLLEPAIDQNLYYTGIKYTTATVATALSNVLPAFVFLLAWVC  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASA-GNSQQD  357
            RLE+V+VRK+  QAKILGT  T+ GAMIMT+V G ++ LPWTK  +H QS +    + +D
Sbjct  127  RLEKVDVRKVKCQAKILGTIGTVAGAMIMTIVYGPMLPLPWTKVNNHHQSTNTDAKNNED  186

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KGA MI  GC CWA F ILQAITLKSYPA LSLT+L+C MGA++G ++ LV+ERGNAA
Sbjct  187  ALKGAVMILVGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGGIVALVMERGNAA  246

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             WA+HWD+ L A +YSG+ICSGVAYYI  +V++ KGPVF  +FNPL+M+IVAIM SFI +
Sbjct  247  AWAIHWDSKLFAVVYSGIICSGVAYYIGAMVIQAKGPVFFASFNPLTMVIVAIMSSFIFS  306

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E +  G+V+GA VIVVGLY+V+W
Sbjct  307  EIMYLGRVIGAMVIVVGLYMVLW  329



>ref|XP_006365719.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=377

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/267 (69%), Positives = 220/267 (82%), Gaps = 7/267 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+FWKIMLLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LAWIL
Sbjct  70   RKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  129

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN----S  348
            RLE VNV K+ SQAKI+GT +T+GGA IMTLV G  IGLPWTK   H+   +  N    +
Sbjct  130  RLENVNVWKVGSQAKIIGTIITLGGATIMTLVGGPTIGLPWTKH--HNNVPTTTNVVSPN  187

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
            + +P+KGA  IAAGC CWA FY LQAITLK Y AG+SLTSL+C  GALQG+ LTL+V+RG
Sbjct  188  ELNPLKGAIFIAAGCFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQRG  247

Query  529  NAAIWAVHWDTTLL-AYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGS  705
            N  IW++HW ++L  A +Y G++ SG+ YY+SG++M +KGPVFVTAFNPL+M+IVAI+GS
Sbjct  248  NFGIWSIHWGSSLFYASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILGS  307

Query  706  FILAEQLDFGKVLGACVIVVGLYLVIW  786
            FIL+EQL+ G+V+GA VIVVGLYLVIW
Sbjct  308  FILSEQLNMGRVVGAAVIVVGLYLVIW  334



>ref|XP_004302750.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 212/262 (81%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT ++F KIM+LGLLEPV+DQNLYY GMKYTTATF  A+ N+LPA+TF++AWIL
Sbjct  67   KKVRPKMTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTFVMAWIL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  + SQ K+LGT+ T+ GAMIMTLV+G ++ L WT+  + +Q  + G      
Sbjct  127  RLEKVKLTCIRSQCKLLGTAATVAGAMIMTLVKGPLLKLFWTRATTSNQQQTNGVDIHSS  186

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC CWA F ILQ++TL++YPA LSL++ +C MG L+G+ + LV+ERGNAA+
Sbjct  187  IKGALMITAGCFCWACFMILQSMTLRTYPAELSLSAWICLMGTLEGTAVALVMERGNAAV  246

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+HWD  LLA +YSG+ CSG+AYYI GVVMK +GPVFVTAF+PLSM+IVA+M SFIL E
Sbjct  247  WAIHWDGKLLAAVYSGIFCSGLAYYIQGVVMKHRGPVFVTAFSPLSMVIVAVMSSFILRE  306

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            QL  G++LGA VI++GLYLV+W
Sbjct  307  QLFLGRLLGAFVIIIGLYLVVW  328



>ref|XP_008371417.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 208/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F KI+LLGLLEPVIDQNL+YTGMK TTATF +A+ NVLPA  FI+AWI 
Sbjct  67   RKVRPKMTLSIFIKIVLLGLLEPVIDQNLFYTGMKLTTATFASAMCNVLPAFAFIMAWIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N+R LHS AKILGT VT+GGAM+MTL+ G ++  PWT+   H +S +     QDP
Sbjct  127  RLEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQES-TVSTVHQDP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MIAAGC CWA F ILQAITL SYPA L+L + +C  G +QG+ + L  E  N  +
Sbjct  186  IKGAIMIAAGCFCWAGFMILQAITLNSYPAELTLATWICLAGTVQGTAVALAFEWNNPIV  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D  LLA +YSG+ICSG+AYYI GVVMK++GPVFVTAF+PLSMIIVAIM S ILAE
Sbjct  246  WSIHFDFKLLAAVYSGIICSGIAYYIQGVVMKERGPVFVTAFSPLSMIIVAIMSSLILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  306  IMYLGRVIGAMVIVIGLYMVLW  327



>ref|XP_009347454.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=345

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 209/262 (80%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT S+F KI+LLGLLEPVIDQNL+YTGMK TTATFT+A+ NVLPA  FI+AWI 
Sbjct  62   RNVRPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIF  121

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N+R LHS AKILGT VT+GGAM+MTL+ G ++  PWT+   H +S +     QDP
Sbjct  122  RLEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQES-TVSTVHQDP  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MIAAGC CW+ F ILQAITLKSYPA LSLT+ +C +G +QG+   L  E  N   
Sbjct  181  IKGAIMIAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIA  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D  LLA +YSG++CSG+AYYI G+VMK++GPVFVTAF+PL+MII A+M SFILAE
Sbjct  241  WSIHFDYKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  301  IMYLGRVIGAMVIVIGLYMVLW  322



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score =   353 bits (907),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 215/262 (82%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTF++F KI LLGLLEPVIDQNLYY+GM+ T+ATFTTA+ N+LPA+TF++A+I 
Sbjct  71   RKVRPKMTFTIFAKIALLGLLEPVIDQNLYYSGMRITSATFTTAMCNILPALTFLMAFIC  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++K+ SQAK++GT VT+GGAM+MTL++G VI LPWTK   ++         QDP
Sbjct  131  RLEKVKIKKVRSQAKVVGTLVTVGGAMLMTLIKGPVINLPWTKGRVNNHGNQTTPIHQDP  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MIAAGC CW+ F ILQAITL+ YPA L+LT+L+C MGA +G+V+ L ++ G ++I
Sbjct  191  IKGSLMIAAGCFCWSCFIILQAITLREYPAELTLTALICLMGAAEGAVVALALQWGKSSI  250

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWD   LA +Y G++CSGV+YYI  V++K +GPVFVTAF+PL MIIVAI+GSFILAE
Sbjct  251  WSIHWDAKFLAALYGGIVCSGVSYYIQAVIIKKRGPVFVTAFSPLCMIIVAILGSFILAE  310

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G V+GA VIVVGLYLV+W
Sbjct  311  QMFVGSVIGAIVIVVGLYLVVW  332



>ref|XP_009347451.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=350

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 208/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F KI+LLGLLEPV+DQNL+YTGMK TTATFT+A+ NVLP   FI+AWI 
Sbjct  67   RKVRPKMTLSIFTKIVLLGLLEPVLDQNLFYTGMKLTTATFTSAMCNVLPTFAFIMAWIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++N+R LHS AKILGT VT+GGAM+MTL+ G ++  PWT+   H +S +     QDP
Sbjct  127  RIEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPLLNFPWTRRNIHQES-TVSTVHQDP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MIAAGC CWA F ILQAITL SYPA LSL + +C  G +QG+ + L  E  N   
Sbjct  186  IKGAIMIAAGCFCWAGFMILQAITLNSYPAELSLATWICLAGTVQGTAVALAFEWNNPIA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D  LLA +YSG+ICSG+AYY+ GVVMK++GPVFVTAF+PLSMIIVA+M SFILAE
Sbjct  246  WSIHFDFKLLAAVYSGIICSGIAYYVQGVVMKERGPVFVTAFSPLSMIIVAVMSSFILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  306  IMYLGRVIGAMVIVIGLYMVLW  327



>emb|CBI32681.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFS+F K+MLL LLEPVIDQNLYY G+KYTTATF  A+ N+LPAITF++A I 
Sbjct  77   RKVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNILPAITFLMACIF  136

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V ++ +HSQAK++GT  T+ GAM+MTLV+G VI L WTK  ++      G +  D 
Sbjct  137  GLEKVTLKSIHSQAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNNQGVKGGGTNIHDS  196

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI AGC  WA F ILQAITLK+YPA LSLT+ +C +G  QG+++ LV+ERG  ++
Sbjct  197  IKGSLMITAGCFSWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVMERGKTSV  256

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWDT  LA +YSG++CSG+AYYI GVVMKD+GPVFVTAFNPLSMIIVA+M SFILAE
Sbjct  257  WSIHWDTKFLAALYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMSSFILAE  316

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+V+GA VIV GLY V+W
Sbjct  317  QMYLGRVIGAIVIVAGLYFVVW  338



>ref|XP_009357771.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=337

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 208/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT S+F KI+LLGLLEPVIDQNL+YTGMK TTATFT+A+ NVLPA  FI+AWI 
Sbjct  54   RNVRPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIF  113

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N+R LHS AKILGT VT+GGAM+MTL+ G ++  PWT+   H Q ++     QDP
Sbjct  114  RLEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIH-QESTVSTVHQDP  172

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MIAAGC CW+ F ILQAITLKSYPA LSLT+ +C +G +QG+   L  E  N   
Sbjct  173  IKGAIMIAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIA  232

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D  LLA  YSG++CSG+AYYI G+VMK++GPVFVTAF+PL+MII A+M SFILAE
Sbjct  233  WSIHFDYKLLAAFYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAE  292

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  293  IMYLGRVIGAMVIVIGLYMVLW  314



>ref|XP_004236759.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=376

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/267 (68%), Positives = 219/267 (82%), Gaps = 7/267 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+FWKIMLLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LAWIL
Sbjct  70   RKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  129

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN----S  348
            RLE VNV K+ SQAKI+GT +T+GGA IM+LV G +IGLPWTK   H    +  N    +
Sbjct  130  RLENVNVWKVSSQAKIIGTIITLGGATIMSLVGGPIIGLPWTKH--HSNVPTTKNVVSPN  187

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
            + +PVKGA  IAAGC CWA FY LQAITLK Y AG+SLTSL+C  GALQG+ LTL+V+RG
Sbjct  188  ELNPVKGAIFIAAGCFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQRG  247

Query  529  NAAIWAVHWDTTLL-AYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGS  705
            N  IW++ W ++L  A +Y G++ SG+ YY+SG++M +KGPVFVTAFNPL+M+IVAI+GS
Sbjct  248  NFGIWSIKWGSSLFYASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILGS  307

Query  706  FILAEQLDFGKVLGACVIVVGLYLVIW  786
            FIL+EQL+ G+V+GA VIVVGLYLVIW
Sbjct  308  FILSEQLNMGRVVGAAVIVVGLYLVIW  334



>ref|XP_010534481.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=375

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 237/316 (75%), Gaps = 11/316 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  + +KI+LLGLLEP IDQNLYYTGM+YT+ATFT A+ NVLPA  F++AW+ 
Sbjct  66   RKVRPKMTLPILFKILLLGLLEPTIDQNLYYTGMRYTSATFTAAMSNVLPAFAFLMAWLF  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNS-QQD  357
            RLE+VN++K+ SQAKILGT VT+GGAM+MTLV+G ++ LPWT   ++    S+  S +QD
Sbjct  126  RLEKVNIKKMPSQAKILGTIVTVGGAMLMTLVKGPLVPLPWTDNPNNAHQESSNPSIKQD  185

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            PVKGA +IA GC CWA F  LQAITLK+YP  LSLT+ +C MGA++G+V+ LV+ERGN +
Sbjct  186  PVKGALLIAVGCICWAGFINLQAITLKTYPVELSLTAYICLMGAIEGTVVALVIERGNPS  245

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W++  D+ LLA +YSGVICSG+AYY+ GVVMK +GPVFVTAFNPLSM+IVAI+GSF+LA
Sbjct  246  AWSIQLDSKLLAIVYSGVICSGIAYYVQGVVMKTRGPVFVTAFNPLSMVIVAILGSFVLA  305

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIR----PATTHQ  885
            E +  G +LGA VIV+GLY V+WG SKDD++        + +D +LP+       + + +
Sbjct  306  EVMFLGTILGAIVIVLGLYSVLWGKSKDDNASF------SDIDNELPLSHIHQVESVSSK  359

Query  886  EQHSATPIEVPGEESV  933
                  P   P  ESV
Sbjct  360  ANRGVEPQARPNNESV  375



>ref|XP_009141815.1| PREDICTED: WAT1-related protein At2g39510 [Brassica rapa]
Length=375

 Score =   350 bits (899),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 205/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  +F+KI LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  60   RKVRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKILGT VT+GGAM+MT+V+G ++ LPW       Q +S      D 
Sbjct  120  RLEKVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWANPNDSHQDSSNPGVTPDL  179

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+ +C MG+++ +++ L +ERGN + 
Sbjct  180  TKGALLIAIGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSA  239

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y GVICSGV YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  240  WAIQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  299

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  300  VMYLGRILGAIVIVLGLYSVLW  321



>emb|CDY07016.1| BnaA04g22990D [Brassica napus]
Length=376

 Score =   350 bits (899),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 205/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  +F+KI LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  61   RKVRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKILGT VT+GGAM+MT+V+G ++ LPW       Q +S      D 
Sbjct  121  RLEKVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWVNPNDSHQDSSNPGVTPDL  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAITLKSYP  LSLT+ +C MG+++ +++ L +ERGN + 
Sbjct  181  TKGALLIAIGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSA  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y GVICSGV YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  241  WAIQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  301  VMYLGRILGAIVIVLGLYSVLW  322



>ref|XP_002274909.2| PREDICTED: WAT1-related protein At2g37460-like [Vitis vinifera]
Length=396

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F K+MLL LLEPVIDQNLYY G+KYTTATF  A+ N+LPAITF++A I 
Sbjct  71   KKVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNILPAITFLMACIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V ++ +HSQAK++GT  T+ GAM+MTLV+G VI L WTK  ++      G +  D 
Sbjct  131  GLEKVTLKSIHSQAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNNQGVKGGGTNIHDS  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI AGC  WA F ILQAITLK+YPA LSLT+ +C +G  QG+++ LV+ERG  ++
Sbjct  191  IKGSLMITAGCFSWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVMERGKTSV  250

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWDT  LA +YSG++CSG+AYYI GVVMKD+GPVFVTAFNPLSMIIVA+M SFILAE
Sbjct  251  WSIHWDTKFLAALYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMSSFILAE  310

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+V+GA VIV GLY V+W
Sbjct  311  QMYLGRVIGAIVIVAGLYFVVW  332



>emb|CDX93255.1| BnaC04g46410D [Brassica napus]
Length=376

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 206/262 (79%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  +F+KI LLGLLEP IDQNLYYTGMKYT+ATFT A+ NVLPA  F++AWI 
Sbjct  61   RKVRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIF  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+RK+HSQAKILGT VT+GGAM+MT+V+G ++ LPW     + Q +S      D 
Sbjct  121  RLEKVNIRKVHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWANPNDNHQDSSNPGVTPDL  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
             KGA +IA GC CWA F  LQAIT+KSYP  LSLT+ +C MG+++ +++ L +ERGN + 
Sbjct  181  TKGALLIAIGCICWAGFVNLQAITIKSYPVELSLTAYICLMGSIESTIVALFIERGNPSA  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+  D+ LLA +Y GVICSGV YY+ GV+MK +GPVFVTAFNPLSM+IVAI+GS ILAE
Sbjct  241  WAIQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA VIV+GLY V+W
Sbjct  301  VMYLGRILGAIVIVLGLYSVLW  322



>ref|XP_009778852.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT S+F K++LL +LEPVIDQNLY  G+KYTTATF  A+ N+LPAITFI+AWI 
Sbjct  65   KKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  + SQAKI+GT  T+ GAMIMTLVRG VI L WTK  S  +S S G +    
Sbjct  125  RLERVKLTSIRSQAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  WA+F ILQAITL++YPA LSLT+ +C +G  +G+++ +V+ERG AA+
Sbjct  185  IKGSLMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT  LA +YSG+ CSG+AYYI GV+MKD+GPVFVTAFNPLSM+IVAI+ SFIL E
Sbjct  245  WAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILRE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q++ G+VLGA VIV+GLY+V+W
Sbjct  305  QMNLGRVLGAVVIVLGLYIVLW  326



>ref|XP_004161682.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=368

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 210/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  VF K+M+L LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWIL
Sbjct  59   KKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVMAWIL  118

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAKI+GT  T+GGAMIMTL++G ++ L W KE +++       S Q  
Sbjct  119  RLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEISLQHT  178

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  WA F ILQAITLK+YPA LSLT+ +C +G  +G+V+ LV+ERGN A+
Sbjct  179  IKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAV  238

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ W T LLA +YSG+ CSG+AYYI G+VMKDKGPVFVTAF+PLSM+IVAIM SFIL E
Sbjct  239  WSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGE  298

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            +L FG+VLGA VI+VGLYLV+W
Sbjct  299  RLYFGRVLGAVVIIVGLYLVVW  320



>ref|XP_002284091.1| PREDICTED: WAT1-related protein At2g39510 [Vitis vinifera]
 emb|CBI31716.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK  P+MT S+F KIML+GLLEPVIDQNLYY GMK TTATFTTA+ N++PA TF++A +L
Sbjct  69   RKRWPRMTVSIFAKIMLMGLLEPVIDQNLYYVGMKNTTATFTTAMSNIIPAFTFLVALVL  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+R+LHSQAK++GT VT+GGAM+MTLV+G    LPWTK   + QS+++   QQ P
Sbjct  129  RLEKVNLRRLHSQAKVVGTLVTVGGAMLMTLVKGPAPDLPWTKGRHYHQSSTS--QQQHP  186

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC CWA F  LQA T+KSYPA LSLT+L+C MGAL+G+++TL++E GNA+I
Sbjct  187  IKGALMITAGCVCWACFLNLQARTVKSYPAQLSLTTLICLMGALEGAMVTLIIEHGNASI  246

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W +    TL A +Y G++CS +AYYI GV+M +KGPVFV++FNPLSMIIVAI+ SFI AE
Sbjct  247  WVIPKGPTLCAVLYGGIVCSAIAYYIQGVIMGEKGPVFVSSFNPLSMIIVAILSSFIFAE  306

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHSA  900
             L  G VLGA VI++GLYL++WG SKD            P+DQQ+  +          S 
Sbjct  307  ALYLGMVLGAVVIIIGLYLILWGKSKDQPEGVRL----VPIDQQMARMNGNAETLNGDSV  362

Query  901  TPIEVPGEESV  933
            T + V  EE V
Sbjct  363  TKVTV--EECV  371



>ref|XP_004142085.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN54225.1| hypothetical protein Csa_4G293840 [Cucumis sativus]
Length=375

 Score =   348 bits (893),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 210/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  VF K+M+L LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWIL
Sbjct  66   KKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVMAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAKI+GT  T+GGAMIMTL++G ++ L W KE +++       S Q  
Sbjct  126  RLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEISLQHT  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  WA F ILQAITLK+YPA LSLT+ +C +G  +G+V+ LV+ERGN A+
Sbjct  186  IKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAV  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ W T LLA +YSG+ CSG+AYYI G+VMKDKGPVFVTAF+PLSM+IVAIM SFIL E
Sbjct  246  WSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            +L FG+VLGA VI+VGLYLV+W
Sbjct  306  RLYFGRVLGAVVIIVGLYLVVW  327



>ref|XP_008371332.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
 ref|XP_008348046.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=345

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT S+F KI+LLGLLEPVIDQNL+YTGMK TTATFT+A+ NVLPA  FI+AWI 
Sbjct  62   RNVRPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIF  121

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R E++N+R LHS A ILGT VT+GGAM+MTL+ G ++  PWT+   H +S +     QDP
Sbjct  122  RFEKINLRSLHSLAMILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQES-TVSTVHQDP  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG  M+AAGC CW+ F ILQAITLKSYPA LSLT+ +C +G +QG+   L  E  N   
Sbjct  181  IKGGIMLAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIA  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D  LLA +YSG++CSG+AYYI G+VMK++GPVFVTAF+PLSMII A+M SFILAE
Sbjct  241  WSIHFDYKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLSMIITAVMSSFILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  301  IMYLGRVIGAMVIVIGLYMVLW  322



>ref|XP_009614496.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score =   348 bits (892),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT S+F K++LL +LEPVIDQNLY  G+KYTTATF  A+ N+LPAITFI+AWI 
Sbjct  65   KKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  + SQAKI+GT  T+ GAMIMTLVRG VI L WTK  S  +S S G +    
Sbjct  125  RLERVKLTSIRSQAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ +I  GC  WA+F ILQAITL++YPA LSLT+ +C +G  +G+++ +V+ERG AA+
Sbjct  185  IKGSLLITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT  LA +YSG+ CSG+AYYI GV+MKD+GPVFVTAFNPLSM+IVAI+ SFIL E
Sbjct  245  WAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILRE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q++ G+VLGA VIV+GLY+V+W
Sbjct  305  QMNLGRVLGAVVIVLGLYIVLW  326



>ref|XP_007205382.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
 gb|EMJ06581.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
Length=372

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT  +F KIMLLGLLEPVIDQNLY+ GM+YTTATF  A+ N+LPA+TF +AWIL
Sbjct  69   KKIRPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPALTFAMAWIL  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+V ++ + SQ+K+ GT+ T+ GAMIMTLV+G ++ L WT+   SH+Q      S Q 
Sbjct  129  RLEKVKLKCIRSQSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAISLQS  188

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KGA MI  GC CWA F ILQ+ITLK+YPA LSL++ +C MG L+G+ L LV+ERGN+A
Sbjct  189  SIKGAVMITIGCFCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVMERGNSA  248

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +WA+ WD  LLA  YS V CSG+AYYI GVVMK +GPVFVTAF+PLSM+IVA+M SFIL 
Sbjct  249  VWAIKWDAKLLAACYSAVFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILR  308

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQL  G++LGA VIV GLY+V+W
Sbjct  309  EQLYLGRLLGAAVIVAGLYMVVW  331



>ref|XP_008447554.1| PREDICTED: WAT1-related protein At2g37460-like [Cucumis melo]
Length=373

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  VF K+M+L LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWIL
Sbjct  66   KKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFLGMKYTTATFAAAMCNILPAITFVMAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAKI+GT  T+GGAMIMTL++G ++ L W KE   +   S   S Q  
Sbjct  126  RLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPILELFWVKERGTNPQQSGEISLQHT  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  WA F ILQAITLK+YPA LSLT+ +C +G  +G+V+ LV+ERGN A+
Sbjct  186  IKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAV  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ W T LLA +YSG+ CSG+AYYI G+VMKDKGPVFVTAF+PLSM+IVAIM SFIL E
Sbjct  246  WSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            +L FG+VLGA VI+VGLYLV+W
Sbjct  306  RLYFGRVLGAVVIIVGLYLVVW  327



>ref|XP_008370940.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R++RPKMT S+F+KI+LLGLLEPV+DQNL YTGMK TTAT T+AL NVLPA  FI+AW+ 
Sbjct  67   RRVRPKMTLSIFFKIVLLGLLEPVMDQNLAYTGMKLTTATVTSALYNVLPAFAFIMAWVF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+R LHSQAKILGT V +GGAM+MTL+ G ++  PWT+   H +S +     QD 
Sbjct  127  RLEKVNLRSLHSQAKILGTIVMVGGAMLMTLINGPMLNFPWTRRNPHHES-TVSTDHQDH  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA M+AAGC CWA F  LQAITLKSYPA LSLT  +C  G +QG  + L  E  N   
Sbjct  186  IKGAIMVAAGCFCWAGFVTLQAITLKSYPAELSLTVWICLAGTVQGFAVALAFEWNNLTA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D+ LLA +Y G++CSG+A+YI G+VMK++GPVFVTAFNPLS+IIVA+M SFILAE
Sbjct  246  WSIHFDSKLLAVVYCGIMCSGIAFYIQGIVMKERGPVFVTAFNPLSLIIVAVMSSFILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VIV+GLY+V+W
Sbjct  306  IMYLGRVIGAIVIVIGLYMVLW  327



>ref|XP_008241503.1| PREDICTED: WAT1-related protein At2g37460-like [Prunus mume]
Length=372

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT  +F KIMLLGLLEPVIDQNLY+ GM+YTTATF  A+ N+LPA+TF +AWIL
Sbjct  69   KKIRPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPALTFAMAWIL  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+V ++ + SQ+K+ GT+ T+ GAMIMTLV+G ++ L WT+   SH+Q      S Q 
Sbjct  129  RLEKVKLKCIRSQSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAVSLQS  188

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KGA MI  GC CWA F ILQ+ITLK+YPA LSL++ +C MG L+G+ L LV+ERGN+A
Sbjct  189  SIKGAIMITIGCFCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVMERGNSA  248

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +WA+ WD  LLA  YS V CSG+AYYI G+VMK +GPVFVTAF+PLSM+IVA+M SFIL 
Sbjct  249  VWAIKWDAKLLAACYSAVFCSGLAYYIQGIVMKYRGPVFVTAFSPLSMVIVAVMSSFILR  308

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQL  G++LGA VI+ GLY+V+W
Sbjct  309  EQLYLGRLLGAAVIITGLYMVVW  331



>ref|XP_010669871.1| PREDICTED: WAT1-related protein At2g39510 [Beta vulgaris subsp. 
vulgaris]
Length=366

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 224/295 (76%), Gaps = 10/295 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RP M+ S+F KI LLGLLEPVIDQNLYY GM+YTTATF +AL N +PA+TFI+AWI 
Sbjct  61   RKVRPNMSVSIFIKIALLGLLEPVIDQNLYYAGMQYTTATFVSALSNTVPALTFIMAWIF  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+VN+R++ S AK+ GT VTIGGA IMTLV+G  + LPW K + +H  + S     QD
Sbjct  121  RLEKVNLREVRSLAKVGGTMVTIGGATIMTLVKGPGVKLPWIKRDYNHVTNTS---YHQD  177

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA MI +GC  WA+F ILQAITL+SYPA +SLT+L+C  GA++G ++ L++ER N +
Sbjct  178  PIKGAIMITSGCMGWAAFVILQAITLRSYPAEMSLTALMCFAGAVEGGIIALIMER-NTS  236

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IW++HWD  LLAYIYSGV+CS + +++ G +M++KGPVFVTAFNPLSM+IVAI+GSFILA
Sbjct  237  IWSLHWDPKLLAYIYSGVVCSAIGFFLQGKIMQEKGPVFVTAFNPLSMVIVAILGSFILA  296

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTH  882
            EQL  G++ GA VIV GLY+VIWG SKD    S         +Q LP+  P T  
Sbjct  297  EQLTLGRITGAVVIVSGLYIVIWGKSKDKDQTSHNT-----TEQILPIDSPKTNQ  346



>ref|XP_007009428.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY18238.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=376

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 234/316 (74%), Gaps = 6/316 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F K++LLGLLEP IDQNLY+TGMKYT+ATFT A+ NVLPA  F+LAWI 
Sbjct  62   RKVRPKMTLSIFVKLLLLGLLEPTIDQNLYFTGMKYTSATFTAAMCNVLPAFAFVLAWIF  121

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            +LE+V+++KLHSQAKILGT VT+GGAM+MTL+ G ++ LPW    +    +SA  ++QD 
Sbjct  122  KLEKVHIKKLHSQAKILGTMVTVGGAMLMTLINGPMLNLPWANPNNQHVFSSAA-AKQDH  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MIA GC CWA F ILQAITLKSYPA LSLT+L+C +G ++GS++ L  E GNAA 
Sbjct  181  IKGAVMIAVGCFCWAGFIILQAITLKSYPAELSLTALICLVGTIEGSIVALAREAGNAAA  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W+VH D   LA +Y GV+CSGV YY+  V+MK +GPVFVTAFNPL+M+IVAI+GSF+L+E
Sbjct  241  WSVHLDVKFLAAVYGGVVCSGVGYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSE  300

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQH--  894
             L  G+V+GA VIV+GLYLV+WG SKD  S +   D++   DQ++  +        Q   
Sbjct  301  VLYSGRVIGAIVIVIGLYLVLWGKSKDQPSSNLDVDVEPSSDQKMTAMDETKVGPNQDYV  360

Query  895  --SATPIEV-PGEESV  933
                T   V P +ESV
Sbjct  361  VLDVTSNRVNPSDESV  376



>ref|XP_009337582.1| PREDICTED: WAT1-related protein At2g39510 [Pyrus x bretschneideri]
Length=350

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 208/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R++RPKMT S+F KI+LLGLLEPV+DQNL YTGMK TTATFT+AL NVLPA  FI+AW+ 
Sbjct  67   RRVRPKMTLSIFCKIVLLGLLEPVLDQNLTYTGMKLTTATFTSALYNVLPAFAFIMAWVF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N+R LHSQAKILGT VT+GGAM++TL+ G ++  PWT+   H +S +     QD 
Sbjct  127  RLEKINLRSLHSQAKILGTLVTVGGAMLLTLINGPMLNFPWTRRNPHHES-TVSTDHQDH  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA M+AAGC CWA F  L AITLKSYPA LSLT+ +C +G +QGS + +  E  N   
Sbjct  186  IKGAIMVAAGCFCWAGFVNLLAITLKSYPAELSLTAWICLVGTVQGSAVAVAFEWNNPTS  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H+D+ LLA +YSG++CSG+AYYI G+VMK++GPVFVT+F+PL MIIVA+M SFILAE
Sbjct  246  WSIHFDSKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTSFSPLIMIIVAVMSSFILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+ +GA VIV+GLY+V+W
Sbjct  306  IMYLGRAIGAIVIVIGLYMVLW  327



>emb|CDP06652.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKM  S+F KI++L LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWI 
Sbjct  27   KKIRPKMRLSIFAKILVLSLLEPVIDQNLYFLGMKYTTATFAAAMSNILPAITFLMAWIF  86

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ ++SQAKI+GT  T+GGAM+MTL+RG VI LPWTK  +  +  S G + Q+ 
Sbjct  87   RLEKVKLKSINSQAKIVGTVATVGGAMLMTLLRGPVIKLPWTKGTTSPEHQSGGINLQNS  146

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA  I  G   W+ F +LQAITL++YPA LSLT+ +C +G  +G++L L++ERG AA+
Sbjct  147  IKGALFITIGYFGWSCFMVLQAITLRAYPAELSLTAWICLLGTAEGAILALIMERGKAAV  206

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W+++WDT  LA +YSGV CSG+AYYI GVVMK +GPVFVTAF+PL+M+IVA++ SFIL E
Sbjct  207  WSINWDTKFLAALYSGVFCSGLAYYIQGVVMKQRGPVFVTAFSPLNMVIVAVLSSFILHE  266

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +D G+VLGA  IVVGLYLV+W
Sbjct  267  LMDLGRVLGAITIVVGLYLVVW  288



>ref|XP_010554592.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=378

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 216/308 (70%), Gaps = 17/308 (6%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  V +KI++LGLLEP IDQNLYYTGM+YT+ATFT A+ NVLPA  F++AW+ 
Sbjct  66   RKVRPKMTLPVLFKILMLGLLEPTIDQNLYYTGMRYTSATFTAAMSNVLPAFAFLMAWLF  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPW-TKEASHDQSASAGNSQQD  357
            RLE VN+RK   QAKI GT VT+GGAM+MTLVRG ++ LPW T     D+ A     +  
Sbjct  126  RLENVNIRKTQGQAKIFGTIVTVGGAMLMTLVRGPLVPLPWNTNPDIIDREAPNPEIENQ  185

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            P+KGA +I  G  CWA F  LQAITLKSYP  LSLT+ +C MGA++G++   ++ERGN A
Sbjct  186  PLKGAILIVVGSICWAGFINLQAITLKSYPFELSLTAYICLMGAIEGTLAAFLIERGNPA  245

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W+V +D+ LLA +YSGVICSG+AYY+ G++MK +GPVFVTAF+PL M+IVAI+GSF+LA
Sbjct  246  AWSVQFDSKLLAAVYSGVICSGIAYYVQGLIMKTRGPVFVTAFSPLKMVIVAILGSFVLA  305

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAP-----VDQQLPVIRPATTH  882
            E    G VLGA VIV+GLY V+WG SK           D P     +D +LP+ R     
Sbjct  306  EVFFLGTVLGAIVIVLGLYSVLWGKSK-----------DEPAPFSDMDNELPLGRIQQVE  354

Query  883  QEQHSATP  906
                 A P
Sbjct  355  SVSSEARP  362



>ref|XP_007009429.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18239.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=436

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 212/262 (81%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSVF +I+LLGLLEP IDQNLYYTG+KYTTAT  TAL NVLPA  F+LAW  
Sbjct  65   RKVRPKMTFSVFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVLPAFVFLLAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V++RKLH QAKILGT  T+GGAMIMTLV G ++ LPWTK  +  QS +   ++ DP
Sbjct  125  RLEKVDMRKLHCQAKILGTLGTVGGAMIMTLVNGPILPLPWTKVKNEHQS-TVSATKDDP  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC CWA F ILQAITLKSYPA LSLT+L+C MGA++G+++ LV+E GNAA 
Sbjct  184  LKGALMILAGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGNAAA  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++HWD+ L A  YSGVICSGVAYY+  +V++ KGPVF  AFNPL+M+IVAIM SFI +E
Sbjct  244  WSIHWDSKLFAAAYSGVICSGVAYYVGAMVIQAKGPVFFAAFNPLTMVIVAIMSSFIFSE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+G  VIVVGLYLV+W
Sbjct  304  IMYLGRVIGVIVIVVGLYLVLW  325


 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  583  SGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIV  762
             GV+CSGVAYY+  V+MK +GPVFVTAFNPL+M+IVAI+GSF+L+E L  G+V+GA +IV
Sbjct  371  DGVVCSGVAYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSEVLYLGRVIGAILIV  430

Query  763  VGLYLV  780
             GLYLV
Sbjct  431  TGLYLV  436



>ref|XP_010037869.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 226/315 (72%), Gaps = 16/315 (5%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F ++M+L LLEPVIDQNLYY GMK TTATF  A+ N+LPAITF++AWI+
Sbjct  64   RKTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAITFVIAWIM  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS------HDQSASAG  342
            RLE+V ++ + SQAK+ GT  T+ GAMIMTL++G V+ L WT+          + SA+ G
Sbjct  124  RLEKVKLKSIRSQAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGG  183

Query  343  NSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE  522
             S Q+ +KG+ MI AGC  WA F ILQAITL++YPA LSLT+ +C +G ++G+ + L +E
Sbjct  184  ISLQNSIKGSLMITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFME  243

Query  523  RGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMG  702
            RGNA +W + WDT LLA +YSG++CSGVAYYI GVVMKD+GPVFVTAFNPLSM+IVAI+ 
Sbjct  244  RGNATVWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAILS  303

Query  703  SFILAEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQ--LPV--IRP  870
            +FI AEQL  G+++GA VIV GLYLV+WG  KD  S        AP D+   LP   + P
Sbjct  304  TFIFAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYKSS------PAPTDEHKALPTKFVDP  357

Query  871  ATTHQEQHSATPIEV  915
                +E +S   I +
Sbjct  358  GGNGKENYSQEMITI  372



>gb|KCW65509.1| hypothetical protein EUGRSUZ_G02914 [Eucalyptus grandis]
Length=373

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 206/262 (79%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF KI+LLGLLEPVIDQNLYYTGMKYTTA+FT A+ N+LPA  F++AW  
Sbjct  60   RKTRPKMTRSVFLKILLLGLLEPVIDQNLYYTGMKYTTASFTAAMSNMLPAFAFLMAWFF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++++R  HSQAKILGT VTIGGAMIMTL +G V+ LPWTK AS           Q P
Sbjct  120  RLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSAS--AHVDLDGVAQKP  177

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            ++GA MI AGC CWASF ILQAITLKSYPA L+LT+L+C  G  QG+V    +ER N+A 
Sbjct  178  IEGALMITAGCFCWASFIILQAITLKSYPAELTLTALICMTGTFQGAVFAFAMERSNSAA  237

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D  LLA +YSG+ICSGV YY+ GVVM+ KGPVF+TAFNPL M++VAI+GSFIL E
Sbjct  238  WSIQFDVRLLAIVYSGLICSGVGYYVQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHE  297

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             L  G+V+GA VIV+GLYLV+W
Sbjct  298  ILCLGRVIGALVIVLGLYLVLW  319



>ref|XP_010067380.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=382

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 205/262 (78%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF KI+LLGLLEPVIDQNL+YTGMKYTTA+FT A+ N+LPA TF++AW  
Sbjct  69   RKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPAFTFLMAWFF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++++R  HSQAKILGT VTIGGAMIMTL +G V+ LPWTK  S           Q P
Sbjct  129  RLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTSAH--VDLDGVAQKP  186

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            ++GA MI AGC CWASF ILQAITLKSYPA L+LT+L+C  G  QG+V    +ER N A 
Sbjct  187  IEGALMITAGCFCWASFIILQAITLKSYPAELTLTTLICMTGTFQGAVFAFAMERSNFAA  246

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D  LLA +YSG+ICSGV YYI GVVM+ KGPVF+TAFNPL M++VAI+GSFIL E
Sbjct  247  WSIQFDVRLLAVVYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHE  306

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             L  G+V+GA VIV+GLYLV+W
Sbjct  307  ILCLGRVIGALVIVLGLYLVLW  328



>gb|KCW49646.1| hypothetical protein EUGRSUZ_K03164 [Eucalyptus grandis]
Length=446

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 229/315 (73%), Gaps = 16/315 (5%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F ++M+L LLEPVIDQNLYY GMK TTATF  A+ N+LPAITF++AWI+
Sbjct  124  RKTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAITFVIAWIM  183

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK----EASHDQSASA--G  342
            RLE+V ++ + SQAK+ GT  T+ GAMIMTL++G V+ L WT+     A++ Q+ SA  G
Sbjct  184  RLEKVKLKSIRSQAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGG  243

Query  343  NSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE  522
             S Q+ +KG+ MI AGC  WA F ILQAITL++YPA LSLT+ +C +G ++G+ + L +E
Sbjct  244  ISLQNSIKGSLMITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFME  303

Query  523  RGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMG  702
            RGNA +W + WDT LLA +YSG++CSGVAYYI GVVMKD+GPVFVTAFNPLSM+IVAI+ 
Sbjct  304  RGNATVWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAILS  363

Query  703  SFILAEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQ--LPV--IRP  870
            +FI AEQL  G+++GA VIV GLYLV+WG  KD  S        AP D+   LP   + P
Sbjct  364  TFIFAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYKSS------PAPTDEHKALPTKFVDP  417

Query  871  ATTHQEQHSATPIEV  915
                +E +S   I +
Sbjct  418  GGNGKENYSQEMITI  432



>ref|XP_006341065.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=375

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 208/263 (79%), Gaps = 2/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++LL LLEPVIDQNLY  G+KYTTATF  A+ N+LPAITFI+AWI 
Sbjct  65   KKVRPKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+V +  + SQAK++GT  T+ GAMIMTLVRG ++ L WT   A HD S S G +   
Sbjct  125  RLEKVKLTSIRSQAKLVGTVATVAGAMIMTLVRGPIVELFWTAGNAGHD-SQSGGLNLSH  183

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KG+ MI  GC  WA+F ILQAITL++YPA LSLT+ +C +G  +G+++ +V+ERG  A
Sbjct  184  AIKGSIMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGKPA  243

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +WA++WD+  LA +YSG+ CSG+AYYI GV+MKD+GPVFVTAFNPLSM+IVAI+ + IL 
Sbjct  244  VWAINWDSKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSTIILR  303

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQL+ G+VLGA VIVVGLY+V+W
Sbjct  304  EQLNLGRVLGAVVIVVGLYIVLW  326



>ref|XP_004246473.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=375

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 206/262 (79%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++LL LLEPVIDQNLY  G+KYTTATF  A+ N+LPAITFI+AWI 
Sbjct  65   KKVRPKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  + SQAKI+GT  T+ GAMIMTLVRG ++ L WT   +   S S G +    
Sbjct  125  RLEKVKLTSIRSQAKIVGTVATVAGAMIMTLVRGPIVELFWTTGNAGHNSQSGGLNLSHA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  WA+F ILQAITL++YPA LSLT+ +C +G  +G+++ +V+ERG  A+
Sbjct  185  IKGSIMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGKPAV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA++WD+  LA +YSG+ CSG+AYYI GV+MKD+GPVFVTAFNPLSM+IVA++ + IL E
Sbjct  245  WAINWDSKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAVLSTIILRE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            QL+ G+VLGA VIVVGLY+V+W
Sbjct  305  QLNLGRVLGAVVIVVGLYIVLW  326



>gb|KGN51272.1| hypothetical protein Csa_5G505820 [Cucumis sativus]
Length=376

 Score =   335 bits (858),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 220/298 (74%), Gaps = 3/298 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT+S+F K++LLGLLEP +DQNLYYTGMKYTTATF +A+ N+ P + F++AW+ 
Sbjct  65   RKVRPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVA  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V+VR+L SQAKILGT V +GGAMIMT VRG ++ LPWT    HD S +A N QQD 
Sbjct  125  RLEKVDVRQLSSQAKILGTVVAVGGAMIMTAVRGPILNLPWTNHNLHDHSTTAAN-QQDL  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  W+ F +LQAIT+K YPA LSLT+ +C  GA+Q SV+   +E    A 
Sbjct  184  LKGSLMILIGCIFWSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPAA  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H D+TLLA +YSG++ SGV+Y I   VMK KGPVF + F+PLSM+IVAI+ SF L+E
Sbjct  244  WSLHLDSTLLAPLYSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALSE  303

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVI--RPATTHQE  888
             L FG+V+GA VI+ GLYLV+WG  KD +      +  AP DQ+L  I  +P T+ +E
Sbjct  304  ILYFGRVIGAAVIITGLYLVLWGKIKDQALYKLDSEKMAPSDQKLTAITEKPKTSDKE  361



>ref|XP_004149823.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
 ref|XP_004166635.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
Length=384

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 220/298 (74%), Gaps = 3/298 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT+S+F K++LLGLLEP +DQNLYYTGMKYTTATF +A+ N+ P + F++AW+ 
Sbjct  73   RKVRPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVA  132

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V+VR+L SQAKILGT V +GGAMIMT VRG ++ LPWT    HD S +A N QQD 
Sbjct  133  RLEKVDVRQLSSQAKILGTVVAVGGAMIMTAVRGPILNLPWTNHNLHDHSTTAAN-QQDL  191

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  W+ F +LQAIT+K YPA LSLT+ +C  GA+Q SV+   +E    A 
Sbjct  192  LKGSLMILIGCIFWSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPAA  251

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H D+TLLA +YSG++ SGV+Y I   VMK KGPVF + F+PLSM+IVAI+ SF L+E
Sbjct  252  WSLHLDSTLLAPLYSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALSE  311

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVI--RPATTHQE  888
             L FG+V+GA VI+ GLYLV+WG  KD +      +  AP DQ+L  I  +P T+ +E
Sbjct  312  ILYFGRVIGAAVIITGLYLVLWGKIKDQALYKLDSEKMAPSDQKLTAITEKPKTSDKE  369



>ref|XP_008461645.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=374

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+R KMT S+ +KI++LGLLEPVID NLY+TGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  65   RKVRTKMTISLVFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+VN+RK  SQAKI+GT VT+GGAMIMT +RG ++ LPWTK       S+S+  + QD
Sbjct  125  RLEKVNIRKRGSQAKIVGTIVTVGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSKNHQD  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KG+ MIA GC C ++F ILQAITLK YPA LSLT+L+C +  + G ++ LV+ERGN +
Sbjct  185  QIKGSLMIAIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPS  244

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             WA+H+D+ LL+ +Y+GVICSGV YYI G+VM+ KGPVFVTAFNPLSMI VAIM SFIL+
Sbjct  245  AWALHFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILS  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E +  G+++GA  I+ GLYLV+W
Sbjct  305  EIMLLGRIVGAVTIITGLYLVLW  327



>ref|XP_003521346.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=377

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 205/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F KIM+L LLEPVIDQNLY+ GMKYTTATF  ++ NVLPAITF++AWIL
Sbjct  66   KKVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAK++GT  T+ GAM+MTL++G ++ L  T  +S     + G + Q  
Sbjct  126  RLEKVKLKSIRSQAKVVGTLATVVGAMVMTLIKGPILDLFGTHASSTHNQQNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC   A F ILQAIT+++YPA LSLT+ +C +G ++G V+ LV+ER N + 
Sbjct  186  IKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI G VMKD+GPVFVT FNPL M+IVAIMGSF LAE
Sbjct  246  WSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VI++GLYLV+W
Sbjct  306  IMYLGRVVGAIVIILGLYLVVW  327



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score =   328 bits (840),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 205/262 (78%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT SVF KIM+LG LEPV+DQNLYY GM+YT+ATF++A+ NVLPAITFI+A I 
Sbjct  71   RKIRPKMTLSVFLKIMVLGFLEPVLDQNLYYVGMRYTSATFSSAMFNVLPAITFIMAIIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ LHSQAKI+GT VT+ GAM MTL +G ++ L  ++  SH + +S+ + Q   
Sbjct  131  RLEKVKIKNLHSQAKIIGTVVTLAGAMAMTLYKGPILNLGLSRGGSHHEDSSSSSGQHW-  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+   C  WASF+ILQ+ TLK YPA LSLTSL+C MG +QG+ + LV+ER N A 
Sbjct  190  VVGTLMLLGSCTGWASFFILQSFTLKQYPAELSLTSLICFMGTMQGAAVALVMER-NPAA  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WAV WD+ LLA +Y+GVICSGVAYY+ GVV+K++GPVFVTAFNPL MIIVA +GS IL E
Sbjct  249  WAVGWDSRLLAAVYTGVICSGVAYYVQGVVIKERGPVFVTAFNPLCMIIVAALGSLILGE  308

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            QL  G V+GA VIV+GLY V+W
Sbjct  309  QLHLGSVIGALVIVIGLYSVVW  330



>ref|XP_010553301.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=388

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 199/262 (76%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+R KMT  VF  +MLLGLLEPVIDQNLYY GMKYTTATF +A+ NVLPAITF+LA+I 
Sbjct  67   KKVRTKMTMRVFINVMLLGLLEPVIDQNLYYLGMKYTTATFASAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +R + S AKILGT+ T+ GAM+MTLV+G V+ L WTK AS +   +AG      
Sbjct  127  RLERVKLRCVRSAAKILGTAATVSGAMMMTLVKGPVLHLFWTKGASTNDGGTAGTDIHSA  186

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA +I  GC  +A F ILQAITLK+YPA LSLT+ +C MG ++G+ + LV+E+GN  +
Sbjct  187  IKGAVLITIGCFSYACFMILQAITLKTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGV  246

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WDT LL   YSG++CS +AYYI GVVMK +GPVFVTAFNPL M+IVA M S I AE
Sbjct  247  WVIGWDTKLLTATYSGIVCSALAYYIGGVVMKSRGPVFVTAFNPLCMVIVAFMSSVIFAE  306

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI VGLY V+W
Sbjct  307  QMYLGRVLGALVICVGLYFVLW  328



>ref|XP_011019904.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Populus 
euphratica]
Length=348

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 202/262 (77%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++ L LLEPVIDQNLY+ GMKYTTATF  A+ NVLPAITFI+AWI+
Sbjct  61   KKLRPKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIV  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  LHSQAK+ GT  T+ GAM+MTL++G +I     K  ++ ++ ++G      
Sbjct  121  RLEKVKIGSLHSQAKVAGTIATVAGAMLMTLMKGPLIEFFRIKGRAYHENGTSGIDLHSS  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC  WA F ILQAITLKSYP  LSLT+ +C +G ++G+V+ LV E+G  ++
Sbjct  181  IKGALMITVGCFSWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSV  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA++WD  LLA +YSGV CSG+AYYI G+VMKD+GPVFVTAF+PL M+IVA+M S I AE
Sbjct  241  WAINWDMKLLAAVYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIIWAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G++LGA +IV GLYLV+W
Sbjct  301  QMYLGRILGALIIVAGLYLVVW  322



>ref|XP_010096638.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65306.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=361

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 194/245 (79%), Gaps = 1/245 (0%)
 Frame = +1

Query  52   LGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKIL  231
            L L  PVIDQNL+YTGMK TTATF  A+ NVLPA  FI+AWI+RLE+VN+ ++HSQAKIL
Sbjct  63   LVLERPVIDQNLFYTGMKSTTATFAAAMSNVLPAFVFIMAWIVRLEKVNIGRIHSQAKIL  122

Query  232  GTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASF  411
            GT VT+GGAM MTL  G V+ LPW K+ +H  S + G   Q  +KGA MI AGC  W+SF
Sbjct  123  GTIVTVGGAMFMTLFNGPVLNLPWAKQDNHIDS-TKGAHNQVSIKGALMIGAGCVSWSSF  181

Query  412  YILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGV  591
             ILQAITLK+YPA LSLT+L+C MG +QGS + L +E GN A W++H+D+ LLA +YSGV
Sbjct  182  IILQAITLKAYPAELSLTALICLMGMVQGSAVALALEWGNPAAWSIHFDSKLLAALYSGV  241

Query  592  ICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGL  771
            ICSG+ YYI G+VM+DKGPVFVTAFNPL+M+IVAIM SFIL+E +  G+V+GA VIV GL
Sbjct  242  ICSGLTYYIQGIVMQDKGPVFVTAFNPLNMVIVAIMSSFILSETMYLGRVIGAAVIVAGL  301

Query  772  YLVIW  786
            Y+V+W
Sbjct  302  YMVLW  306



>ref|XP_010067382.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=308

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 201/256 (79%), Gaps = 2/256 (1%)
 Frame = +1

Query  19   MTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVN  198
            MT SVF KI+LLGLLEPVIDQNLYYTGMKYTTA+FT A+ N+LPA  F++AW  RLE+++
Sbjct  1    MTRSVFLKILLLGLLEPVIDQNLYYTGMKYTTASFTAAMSNMLPAFAFLMAWFFRLERLS  60

Query  199  VRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAM  378
            +R  HSQAKILGT VTIGGAMIMTL +G V+ LPWTK AS           Q P++GA M
Sbjct  61   IRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSASAH--VDLDGVAQKPIEGALM  118

Query  379  IAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWD  558
            I AGC CWASF ILQAITLKSYPA L+LT+L+C  G  QG+V    +ER N+A W++ +D
Sbjct  119  ITAGCFCWASFIILQAITLKSYPAELTLTALICMTGTFQGAVFAFAMERSNSAAWSIQFD  178

Query  559  TTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGK  738
              LLA +YSG+ICSGV YY+ GVVM+ KGPVF+TAFNPL M++VAI+GSFIL E L  G+
Sbjct  179  VRLLAIVYSGLICSGVGYYVQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHEILCLGR  238

Query  739  VLGACVIVVGLYLVIW  786
            V+GA VIV+GLYLV+W
Sbjct  239  VIGALVIVLGLYLVLW  254



>gb|KHN02414.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=383

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 203/262 (77%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F KIM+L LLEPVIDQNLY+ GMKYTTATF  ++ NVLPAITF++AWI 
Sbjct  66   KKVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIF  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAK++GT  T+ GAM+MTL++G V+ L  T  ++     + G + Q  
Sbjct  126  RLEKVKLKSIRSQAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSNTHNQQNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC   A F ILQAIT+++YPA LSLT+ +C +G ++G V+ LV+ER N + 
Sbjct  186  IKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI G VMKD+GPVFVT FNPL M+IVAIMGSF LAE
Sbjct  246  WSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+ +GA VI++GLYLV+W
Sbjct  306  IMYLGRAVGAIVIILGLYLVVW  327



>ref|XP_007162672.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
 gb|ESW34666.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
Length=382

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 206/262 (79%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F K+++L LLEPVIDQNLY+ GMKYTTATF  ++ NVLPAITF++AWIL
Sbjct  66   KKVRPKMTFSIFMKLVILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFLMAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++ ++ + SQAK++GT  T+ GAMIMTL++G ++ L  T   + +   + G + Q  
Sbjct  126  RLEKIKLKSIRSQAKVVGTLATVAGAMIMTLLKGPILDLFGTHGNNTNNLQNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC   A F ILQAIT+++YPA LSLT+ +C +G ++G ++ LV+ER N + 
Sbjct  186  IKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGIVALVMERNNFSA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI GVVMKD+GPVFVT FNPL M+IVAIMGSF LAE
Sbjct  246  WSLQWDTKLLAAVYSGIVCSGMAYYIQGVVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+ +GA VI++GLYLV+W
Sbjct  306  QMYLGRAVGAIVIILGLYLVVW  327



>ref|XP_003553527.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=383

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 203/262 (77%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F KIM+L LLEPVIDQNLY+ GMKYTTATF  ++ NVLPAITF++AWI 
Sbjct  66   KKVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIF  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAK++GT  T+ GAM+MTL++G V+ L  T  ++     + G + Q  
Sbjct  126  RLEKVKLKSIRSQAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSNTHNQQNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC   A F ILQAIT+++YPA LSLT+ +C +G ++G V+ LV+ER N + 
Sbjct  186  IKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI G VMKD+GPVFVT FNPL M+IVAIMGSF LAE
Sbjct  246  WSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+ +GA VI++GLYLV+W
Sbjct  306  IMYLGRAVGAIVIILGLYLVVW  327



>gb|KHG26265.1| Auxin-induced 5NG4 [Gossypium arboreum]
 gb|KHG27688.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 205/264 (78%), Gaps = 2/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KIMLL LLEPVIDQNLYY GMKYTTATF  A+ N+LPAITF++AWIL
Sbjct  61   KKVRPKMTISIFIKIMLLSLLEPVIDQNLYYVGMKYTTATFAAAMYNILPAITFLMAWIL  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQ--Q  354
            RLE+VN R + S AK+ GT  T+ GAM+MTL++G V+ L WT    ++  A+A N     
Sbjct  121  RLEKVNFRSIRSHAKVFGTLATVAGAMVMTLMKGPVLELFWTTGRINNHEAAAKNRTDFH  180

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D +KG  +IA GC  +A F ILQA+TLK+YPA LSLT  +C MG L+ +V  LV+E G A
Sbjct  181  DTIKGGLLIAVGCFSYACFVILQAVTLKTYPAELSLTVWICLMGTLEATVAALVMETGKA  240

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            +IWA+ WDT LL   YSG++CSG+AYYI GV+MKD+GPVFVTAF+PL M+IVAIM SFIL
Sbjct  241  SIWAIKWDTKLLTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMASFIL  300

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AEQ+  G+V+GA +I+VGLYLV+W
Sbjct  301  AEQMFLGRVIGAIIIIVGLYLVLW  324



>ref|XP_008461650.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=378

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 222/316 (70%), Gaps = 9/316 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK R KMTFS+ +KI+LLG LEPVIDQNL+YTGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  65   RKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLMAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAG-----N  345
            RLE+VN+ K  SQAKILGT VT+GGAMIMT ++G ++ LPW+K  +H  ++S+       
Sbjct  125  RLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSAAST  184

Query  346  SQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVER  525
              Q+ + G  M+  GC CWA+F  LQAITLK YPA LSLT+L+C +G + GS + LV+ER
Sbjct  185  DHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALVIER  244

Query  526  GNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGS  705
            GN + WA+H+D  LLA +YSGVICSGV YYI GVVM+ KGPVF +AFNPL+M++VAIM  
Sbjct  245  GNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAIMSF  304

Query  706  FILAEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD-APVDQQLPVIRPATTH  882
            FIL+E +  G+++G  +I+ GLY+V+WG ++D       +     P +QQ+   +  TT 
Sbjct  305  FILSEIMFLGRMIGVVIIICGLYMVLWGKTRDQPPVLKSECDKITPCEQQM---KTTTTV  361

Query  883  QEQHSATPIEVPGEES  930
            Q       ++V  EE 
Sbjct  362  QSSQDFLALDVAKEEK  377



>gb|KHN09434.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 204/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F KIM+L LLEPVIDQNLY+ GMKYTTATF  ++ NVLPAITF++AWIL
Sbjct  66   KKVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++ + SQAK++GT  T+ GAM+MTL++G ++ L  T  +S     + G + Q  
Sbjct  126  RLEKVKLKSIRSQAKVVGTLATVVGAMVMTLIKGPILDLFGTHASSTHNQQNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC   A F ILQAIT+++YPA LSLT+ +C +G ++G V+ LV+ER N + 
Sbjct  186  IKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI G VMKD+GPVFVT FNPL M+IVAIMGSF  AE
Sbjct  246  WSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFPAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA VI++GLYLV+W
Sbjct  306  IMYLGRVVGAIVIILGLYLVVW  327



>ref|XP_010039216.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 204/268 (76%), Gaps = 6/268 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F ++++L LLEPVIDQNLYY GMK TTATF  A+ N+LPAI  ++AWI+
Sbjct  64   RKTRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIM  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS------HDQSASAG  342
             LE V ++ + SQAK+ GT   + GAMIMTLV+G V+ L WT+          + SA+ G
Sbjct  124  GLETVKMKSIRSQAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGG  183

Query  343  NSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE  522
             S Q+ ++G+ MI AGC  WA F ILQAITL++YPA LSLT+ +C +G ++G+V+ L++E
Sbjct  184  ISLQNSIEGSLMITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIME  243

Query  523  RGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMG  702
            RGNA  W + WDT LLA +YSG++CSGVAYYI GVVMKD+GPVFV AFNPLSM+IVAI+ 
Sbjct  244  RGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILS  303

Query  703  SFILAEQLDFGKVLGACVIVVGLYLVIW  786
            +FILAEQL  G+++GA VIV GLYLV+W
Sbjct  304  TFILAEQLFLGRLVGAVVIVAGLYLVVW  331



>ref|XP_010529854.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=383

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 197/262 (75%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+R KMT  +F +I LLGLLEPVIDQNLYY GMKYTTATF  A+ NVLPAITF+LA+I 
Sbjct  69   KKVRTKMTMRIFIQITLLGLLEPVIDQNLYYLGMKYTTATFAAAMYNVLPAITFVLAYIF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN+R + S AKI+GT+ T+ GAM+MTLV+G V+ L WTK  S     + G      
Sbjct  129  RLERVNLRCIRSAAKIIGTAATVAGAMMMTLVKGPVLDLFWTKGPSPQHDGTEGTDIHSA  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA +I  GC  +A F +LQAITL++YPA LSLT+ +C MG ++G+ L LV+E+G+   
Sbjct  189  IKGAVLITIGCFSYACFMVLQAITLRTYPAELSLTAWICLMGTIEGTALALVMEKGHPGA  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CSG+AYYI GVVMKD+GPVFVTAFNPL M+IVA + S I AE
Sbjct  249  WAIGWDTKLLTATYSGIVCSGLAYYIGGVVMKDRGPVFVTAFNPLCMVIVAFISSIIFAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLY VIW
Sbjct  309  QMYLGRVLGAVVICAGLYFVIW  330



>ref|XP_008461649.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=388

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 222/316 (70%), Gaps = 9/316 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK R KMTFS+ +KI+LLG LEPVIDQNL+YTGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  75   RKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLMAWAC  134

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAG-----N  345
            RLE+VN+ K  SQAKILGT VT+GGAMIMT ++G ++ LPW+K  +H  ++S+       
Sbjct  135  RLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSAAST  194

Query  346  SQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVER  525
              Q+ + G  M+  GC CWA+F  LQAITLK YPA LSLT+L+C +G + GS + LV+ER
Sbjct  195  DHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALVIER  254

Query  526  GNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGS  705
            GN + WA+H+D  LLA +YSGVICSGV YYI GVVM+ KGPVF +AFNPL+M++VAIM  
Sbjct  255  GNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAIMSF  314

Query  706  FILAEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD-APVDQQLPVIRPATTH  882
            FIL+E +  G+++G  +I+ GLY+V+WG ++D       +     P +QQ+   +  TT 
Sbjct  315  FILSEIMFLGRMIGVVIIICGLYMVLWGKTRDQPPVLKSECDKITPCEQQM---KTTTTV  371

Query  883  QEQHSATPIEVPGEES  930
            Q       ++V  EE 
Sbjct  372  QSSQDFLALDVAKEEK  387



>ref|XP_007027104.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY07606.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=391

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RP+MT  +F KIM+LGLLEPVIDQNLYY GMKYTTATF +A+ N+LPAITF++AW+L
Sbjct  67   KKVRPRMTLPIFIKIMVLGLLEPVIDQNLYYVGMKYTTATFASAMYNILPAITFVMAWVL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+VN+R +    K++GT  T+ GAM+MTL++G V+ L WTK   +H  +A  G     
Sbjct  127  RLEKVNLRSIRGHGKVVGTLATVAGAMVMTLMKGPVLELFWTKGSTNHQAAAQNGTDIHH  186

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KG  MI  GC  +A F ILQA+TL++YPA LSLT  +C MG L+G++  L++ERGNAA
Sbjct  187  TIKGGLMITVGCFSYACFVILQAVTLETYPAELSLTVWICLMGTLEGTIAALIMERGNAA  246

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IWA+ WDT LL   YSG++CSG+AYYI GV+MKD+GPVFVTAF+PL M+IVAIM +FILA
Sbjct  247  IWAIKWDTKLLTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMSTFILA  306

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQ+  G+V+GA +I+VGLYLV+W
Sbjct  307  EQMYLGRVIGAIIIIVGLYLVLW  329



>ref|XP_011094815.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
 ref|XP_011094816.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 204/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT ++F KIMLL LLEPVIDQNLY+ GMKYTTATF  A+ NVLPAITF++A I 
Sbjct  69   KKIRPKMTTAIFAKIMLLSLLEPVIDQNLYFLGMKYTTATFAAAMANVLPAITFVMACIF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  + SQAKI+GT  T+ GAMIMTLVRG  + LPWTK  +      +  + Q  
Sbjct  129  RLEKVRLMSIRSQAKIIGTLATVAGAMIMTLVRGPNLDLPWTKVMTDPARQQSEVNLQHS  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC  WA F ILQA+TL++YPA LSLT+ +C +G  QG+ + LV+E+GN+A 
Sbjct  189  IKGALMITVGCFSWACFMILQAVTLRTYPAELSLTAWICLLGTAQGAAVALVMEKGNSAA  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT  LA  YSG+ CSG+AYY+ GV+MK++GPVFVTAF+PLSM+IVAIM SFILAE
Sbjct  249  WAIKWDTKFLAAAYSGIFCSGIAYYVQGVIMKERGPVFVTAFSPLSMVIVAIMSSFILAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+V+GA VIV+GLYLV+W
Sbjct  309  QMFLGRVVGAIVIVMGLYLVVW  330



>emb|CDX79734.1| BnaC03g20700D [Brassica napus]
Length=362

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 200/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTF +F++I LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITFILA+I 
Sbjct  67   KKVRPKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFILAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK AS   +A  G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGASAPNTA--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA TL++YPA LSLT+ +C MG ++G+V+ LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT L+   Y+G++CSG+ YY+ G+VMK KGPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLITATYTGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICAGLYLVIW  326



>gb|EYU28266.1| hypothetical protein MIMGU_mgv1a008729mg [Erythranthe guttata]
Length=364

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 205/265 (77%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT SVF KI+LL LLEP+IDQNLY+ GMKYTTATF  A+GNVLPAITFI+A + 
Sbjct  72   KKIRPKMTTSVFAKIVLLSLLEPIIDQNLYFLGMKYTTATFAAAMGNVLPAITFIMACLF  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKE--ASHDQSASAGN-SQ  351
            RLE+V     HS AK++GT  T+ GAMIMTLV+G  I LPW KE  ++++ S   G  S 
Sbjct  132  RLEKVKFTSKHSLAKMVGTLTTVTGAMIMTLVKGPHIHLPWNKEGLSNNNHSTQKGEISF  191

Query  352  QDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V GA MIA GC CWA F ILQ ITL++YPA LSLT+ +C +GA++G V+ L++E   
Sbjct  192  HHSVTGAIMIAIGCLCWACFMILQVITLRAYPAELSLTAWICVLGAVEGGVVALIMENDK  251

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             A W++ WD  LLA  YSG+ICSG+AYY+ GVV+K++GPVFVTAF+PLSM++VA++ SFI
Sbjct  252  LA-WSLKWDIKLLAVAYSGIICSGIAYYVQGVVLKERGPVFVTAFSPLSMVLVAVLSSFI  310

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L+EQ+  G+V+GA +I++GLYLVIW
Sbjct  311  LSEQMYLGRVIGAIIIIMGLYLVIW  335



>ref|XP_004141853.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50537.1| hypothetical protein Csa_5G181440 [Cucumis sativus]
Length=377

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 220/315 (70%), Gaps = 8/315 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK R KMTFS+ +KI+LLG LEPVIDQNLYYTGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  65   RKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLMAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASH----DQSASAGNS  348
            RLE+V + K  SQAKILGT VT+GGAMIMT +RG ++ LPWTK  +        ++A   
Sbjct  125  RLEKVKIMKRGSQAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSAASPD  184

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             Q+ + G  MI  GC CWA+F  LQAITLK YPA LSLT+L+C +G + G  + LV+ERG
Sbjct  185  HQNQIVGFLMITTGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALVIERG  244

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N + WA+H+D+ LLA +YSGVICSGV YYI GVVM+ KGPVF  +FNPL+MI+VAIM  F
Sbjct  245  NVSAWALHFDSQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAIMSFF  304

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD-APVDQQLPVIRPATTHQ  885
            IL+E +  G+++G  +I+ GLY+V+WG S+D+    + +  +  P +QQ+   +  TT Q
Sbjct  305  ILSEIMFLGRMIGVVIIICGLYMVLWGKSQDEPPVLNSECDNMTPCEQQM---KTTTTVQ  361

Query  886  EQHSATPIEVPGEES  930
                   + V  EE 
Sbjct  362  SSQDFLALNVAKEEK  376



>gb|KCW49650.1| hypothetical protein EUGRSUZ_K03168 [Eucalyptus grandis]
Length=446

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 207/268 (77%), Gaps = 6/268 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F ++++L LLEPVIDQNLYY GMK TTATF  A+ N+LPAI  ++AWI+
Sbjct  124  RKTRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIM  183

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK----EASHDQSASA--G  342
             LE V ++ + SQAK+ GT   + GAMIMTLV+G V+ L WT+     A++ Q+ SA  G
Sbjct  184  GLETVKMKSIRSQAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGG  243

Query  343  NSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE  522
             S Q+ ++G+ MI AGC  WA F ILQAITL++YPA LSLT+ +C +G ++G+V+ L++E
Sbjct  244  ISLQNSIEGSLMITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIME  303

Query  523  RGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMG  702
            RGNA  W + WDT LLA +YSG++CSGVAYYI GVVMKD+GPVFV AFNPLSM+IVAI+ 
Sbjct  304  RGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILS  363

Query  703  SFILAEQLDFGKVLGACVIVVGLYLVIW  786
            +FILAEQL  G+++GA VIV GLYLV+W
Sbjct  364  TFILAEQLFLGRLVGAVVIVAGLYLVVW  391



>ref|XP_008463490.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=376

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 215/298 (72%), Gaps = 3/298 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RP+MT+S+F K++LLGLLEP +DQNLYYTGMKYTTATF +A+ N+ P + F++AW +
Sbjct  65   RKVRPRMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMTPGLVFLMAWAV  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE V+VR+L SQAKILGT V +GGAMIMT VRG ++ LPWT    HD S +A N QQD 
Sbjct  125  RLEIVDVRQLSSQAKILGTVVAVGGAMIMTTVRGPILNLPWTNHNIHDHSTTAVN-QQDL  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC  W+ F +LQAIT+K YPA LSLT+L+C  GA+Q SV+   +E    A 
Sbjct  184  LKGSLMILVGCILWSVFNVLQAITIKVYPAQLSLTTLICFTGAVQASVIAFAMEGHKPAA  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++H D+TLLA +YSG++ SGV+Y I   VMK KGPVF + F PLS++IVAI+ SF L+E
Sbjct  244  WSLHLDSTLLAPLYSGIMSSGVSYTIQSAVMKTKGPVFSSTFGPLSLVIVAIISSFALSE  303

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVI--RPATTHQE  888
             L  G+V+GA VI+ GLYLV+WG  K  +      +   P DQ+L  I  +  T+ +E
Sbjct  304  ILYIGRVIGAAVIITGLYLVLWGKIKGQALYKLDSEKMTPSDQKLTAITDKSKTSDKE  361



>ref|XP_004166081.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=377

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 220/315 (70%), Gaps = 8/315 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK R KMTFS+ +KI+LLG LEPVIDQNLYYTGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  65   RKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLMAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASH----DQSASAGNS  348
            RLE+V + K  SQAKILGT VT+GGAMIMT +RG ++ LPWTK  +        ++A   
Sbjct  125  RLEKVKIMKRGSQAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSAASPD  184

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             Q+ + G  MI  GC CWA+F  LQAITLK YPA LSLT+L+C +G + G  + LV+ERG
Sbjct  185  HQNQIVGFLMITTGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALVIERG  244

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N + WA+H+D+ LLA +YSGVICSGV YYI GVVM+ KGPVF  +FNPL+MI+VAIM  F
Sbjct  245  NVSAWALHFDSQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAIMSFF  304

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLD-APVDQQLPVIRPATTHQ  885
            IL+E +  G+++G  +I+ GLY+V+WG S+D+    + +  +  P +QQ+   +  TT Q
Sbjct  305  ILSEIMFLGRMIGVVIIICGLYMVLWGKSQDEPPVLNSECDNMTPCEQQM---KTTTTVQ  361

Query  886  EQHSATPIEVPGEES  930
                   + V  EE 
Sbjct  362  SSQDFLALNVAKEEK  376



>emb|CDY07788.1| BnaA03g17230D [Brassica napus]
Length=362

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTF +F++I LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK AS   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGASAPNTV--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA TL++YPA LSLT+ +C MG ++G+V+ LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT L+   YSG++CSG+ YY+ G+VMK KGPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLITATYSGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICAGLYLVIW  326



>ref|XP_008233582.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Prunus 
mume]
Length=321

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 190/241 (79%), Gaps = 1/241 (0%)
 Frame = +1

Query  64   EPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGTSV  243
             PVIDQNL+YTGMK TTATFT+A+ NVLPA  FI+AWI RLE +N R L S AKILGT V
Sbjct  62   RPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLENINFRSLRSLAKILGTIV  121

Query  244  TIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYILQ  423
            T+GGAM+MTL+ G ++ LPWT+   H +S SA +  QDP+KG  +I AGC CWA F  LQ
Sbjct  122  TVGGAMLMTLINGPMLNLPWTRRNIHQESTSATD-HQDPIKGTLLIGAGCFCWAGFVNLQ  180

Query  424  AITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVICSG  603
            AITLKSYPA LSL + +C MG +QG+V+ L  E  N A W++HWD+ LLA +YSG+ICSG
Sbjct  181  AITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWSIHWDSKLLAAVYSGIICSG  240

Query  604  VAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYLVI  783
            V YY+ G+VMK++GPVFVTAF+PLSMIIVA+M SF+LAE +  G+V+GA VIV+GLY+V+
Sbjct  241  VVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIMYLGRVIGAMVIVIGLYMVL  300

Query  784  W  786
            W
Sbjct  301  W  301



>ref|XP_010039215.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 203/268 (76%), Gaps = 6/268 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F ++++L LLEPVIDQNLYY GMK TTATF  A+ N+LPAI  ++AWI+
Sbjct  64   RKKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIM  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS------HDQSASAG  342
             LE V ++ + SQAK+ GT   + GAMIMTL++G V+ L WT+          + SA+ G
Sbjct  124  GLETVKMKSIRSQAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGG  183

Query  343  NSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE  522
             S Q+ ++G+ MI AGC  WA F ILQAITL++YPA LSLT  +C +G ++G+V+ L++E
Sbjct  184  ISLQNSIEGSLMITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIME  243

Query  523  RGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMG  702
            RGNA  W + WDT LLA +YSG++CSGVAYYI GVVMKD+GPVFV AFNPLSM+IVAI+ 
Sbjct  244  RGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILS  303

Query  703  SFILAEQLDFGKVLGACVIVVGLYLVIW  786
            +FILAEQL  G+++GA VIV GLYLV+W
Sbjct  304  TFILAEQLFLGRLVGAVVIVAGLYLVVW  331



>ref|XP_009133180.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
Length=362

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTF +F++I LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK AS   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGASAPNTV--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA TL++YPA LSLT+ +C MG ++G+V+ LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT L+   YSG++CSG+ YY+ G+VMK KGPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLITATYSGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICAGLYLVIW  326



>ref|XP_010664224.1| PREDICTED: WAT1-related protein At1g21890 [Vitis vinifera]
 emb|CBI19037.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 221/306 (72%), Gaps = 14/306 (5%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S F KIM+LG LEPV+DQNLYY GMKYT+ATF +A  NVLPAITFILA I 
Sbjct  71   RKVRPKMTLSTFLKIMVLGFLEPVLDQNLYYVGMKYTSATFASATVNVLPAITFILAIIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N++K+ SQAK++GT +T+ GAM+MTL +G +I    T+  SH +S+S  ++ Q+ 
Sbjct  131  RLEKINIKKIPSQAKVIGTLITVTGAMVMTLYKGPIIDFIHTRGISHHESSSDPSAGQNW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
              G  M+   C  W+ F+ILQ+ TLK YPA LSLT+L+C MG +QG+ + LV+ER  AA 
Sbjct  191  ATGTLMLLGSCFGWSGFFILQSFTLKQYPAELSLTALICFMGTVQGAAVALVMERDKAA-  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WAV +D+ +LA  YSGV+CSG+AYY+  +V+K++GPVFVTAF+PL MII A +GSFILAE
Sbjct  250  WAVGFDSRILAAAYSGVVCSGIAYYVQSLVIKERGPVFVTAFSPLCMIITAALGSFILAE  309

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQ------QLPV---IRPA  873
            +L  G +LGA VIVVGLY V+WG SK+  S +S     AP D+      +LPV    +P+
Sbjct  310  KLHLGSILGAAVIVVGLYSVVWGKSKEARSSAS----QAPTDEKAGGSHELPVASSTKPS  365

Query  874  TTHQEQ  891
              H   
Sbjct  366  IVHNNN  371



>ref|XP_011077436.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 202/262 (77%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRP+M FS+FWKI+LL LLEP+IDQN Y+ GMK+TTATFT A+ NVLPAITF++A   
Sbjct  71   KKIRPRMNFSIFWKILLLSLLEPIIDQNFYFLGMKHTTATFTAAMANVLPAITFLMACFF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++  HSQAKI+GT  T+ GAMIMTLVRG  I LPWTKE S   +       Q  
Sbjct  131  RLEKVKLKSTHSQAKIVGTLATVAGAMIMTLVRGPDIPLPWTKEGSKHGNHQGEIDLQHS  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC  WA F ILQ ITL++YPA LSLT+ +C MG ++G+++ L++E+GNA  
Sbjct  191  IKGAVMIIIGCFSWACFMILQVITLQTYPAELSLTAWICLMGTVEGAIVALIMEKGNATA  250

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WD    A  YSG+ CSG+AYY+ GVVMK++GPVFVTAF+PLSMI+VAI+ SFILAE
Sbjct  251  WSLKWDIRFFAAAYSGIFCSGIAYYVQGVVMKERGPVFVTAFSPLSMILVAILSSFILAE  310

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            +L  G+V+GA VI+VGLY V+W
Sbjct  311  KLYLGRVIGAMVIIVGLYFVVW  332



>ref|XP_006294412.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
 gb|EOA27310.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
Length=380

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 200/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +A  G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGISSKNTA--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG L+G+V+ LV+E+GN + 
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTLEGTVVALVMEKGNPSA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICGGLYLVIW  326



>gb|KFK36632.1| hypothetical protein AALP_AA4G149800 [Arabis alpina]
Length=370

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  58   KKVRPKMTMMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  117

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+VN+R + S  KI+GT  T+GGAMIMTLV+G V+ L WTK  S   +A  G      
Sbjct  118  GLERVNLRCIRSAGKIIGTLATVGGAMIMTLVKGPVLELFWTKGVSAPNTA--GTDIHSA  175

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+ + LV+E+GN   
Sbjct  176  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGA  235

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  236  WAIGWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAE  295

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  296  QMYLGRVLGAGVICAGLYLVIW  317



>gb|KCW49647.1| hypothetical protein EUGRSUZ_K03165 [Eucalyptus grandis]
Length=472

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 206/268 (77%), Gaps = 6/268 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F ++++L LLEPVIDQNLYY GMK TTATF  A+ N+LPAI  ++AWI+
Sbjct  150  RKKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIM  209

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK----EASHDQSASA--G  342
             LE V ++ + SQAK+ GT   + GAMIMTL++G V+ L WT+     A++ Q+ SA  G
Sbjct  210  GLETVKMKSIRSQAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGG  269

Query  343  NSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE  522
             S Q+ ++G+ MI AGC  WA F ILQAITL++YPA LSLT  +C +G ++G+V+ L++E
Sbjct  270  ISLQNSIEGSLMITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIME  329

Query  523  RGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMG  702
            RGNA  W + WDT LLA +YSG++CSGVAYYI GVVMKD+GPVFV AFNPLSM+IVAI+ 
Sbjct  330  RGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILS  389

Query  703  SFILAEQLDFGKVLGACVIVVGLYLVIW  786
            +FILAEQL  G+++GA VIV GLYLV+W
Sbjct  390  TFILAEQLFLGRLVGAVVIVAGLYLVVW  417



>gb|AAM62850.1| nodulin-like protein [Arabidopsis thaliana]
Length=362

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  49   KKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  108

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +A  G      
Sbjct  109  GLERVKLRCIRSTGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGVSAHNTA--GTDIHSA  166

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQAITL++YPA LSLT+ +C MG ++G+ + LV+E+GN + 
Sbjct  167  IKGAVLVTIGCFSYACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSA  226

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  227  WAIGWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAE  286

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  287  QMYLGRVLGAVVICAGLYLVIW  308



>ref|NP_181282.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q9ZUS1.1|WTR13_ARATH RecName: Full=WAT1-related protein At2g37460 [Arabidopsis thaliana]
 gb|AAC98072.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAK59607.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAK73261.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL34209.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AEC09403.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=380

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +A  G      
Sbjct  127  GLERVKLRCIRSTGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGVSAHNTA--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQAITL++YPA LSLT+ +C MG ++G+ + LV+E+GN + 
Sbjct  185  IKGAVLVTIGCFSYACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICAGLYLVIW  326



>gb|AFK37217.1| unknown [Medicago truncatula]
Length=379

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 205/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++ L +LEPVIDQNLY+ GMKYTTATF  A+ NVLPAITF++AWIL
Sbjct  66   KKVRPKMTLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVVAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            ++E++ +R +HSQAKI+GT  T+ GAM+MTL++G ++ L    E+S     + G + Q  
Sbjct  126  KMEKIKMRSVHSQAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            VKG+ MI  GC   A F ILQA+TL++YPA LSLT+ +C +G ++G ++ L++ERG  ++
Sbjct  186  VKGSIMITIGCFSCACFTILQAVTLEAYPAELSLTAWICLLGTVEGGIVALIMERGEPSV  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI GVVM+ +GPVFVT FNPL M+IVAIM  FILAE
Sbjct  246  WSLSWDTKLLAAVYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPFILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+V+GA VI++GLYLV+W
Sbjct  306  KIYLGRVIGAVVIILGLYLVVW  327



>ref|XP_009778858.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   319 bits (818),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = +1

Query  58   LLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGT  237
            L +PVIDQNLY  G+KYTTATF  A+ N+LPAITFI+AWI RLE+V +  + SQAKI+GT
Sbjct  63   LDKPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIFRLERVKLTSIRSQAKIIGT  122

Query  238  SVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYI  417
              T+ GAMIMTLVRG VI L WTK  S  +S S G +    +KG+ MI  GC  WA+F I
Sbjct  123  VATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHAIKGSLMITIGCFSWAAFMI  182

Query  418  LQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVIC  597
            LQAITL++YPA LSLT+ +C +G  +G+++ +V+ERG AA+WA+ WDT  LA +YSG+ C
Sbjct  183  LQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIKWDTKFLAAVYSGIFC  242

Query  598  SGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYL  777
            SG+AYYI GV+MKD+GPVFVTAFNPLSM+IVAI+ SFIL EQ++ G+VLGA VIV+GLY+
Sbjct  243  SGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNLGRVLGAVVIVLGLYI  302

Query  778  VIW  786
            V+W
Sbjct  303  VLW  305



>ref|XP_003625520.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES81738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=379

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 205/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++ L +LEPVIDQNLY+ GMKYTTATF  A+ NVLPAITF++AWIL
Sbjct  66   KKVRPKMTLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVVAWIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            ++E++ +R +HSQAKI+GT  T+ GAM+MTL++G ++ L    E+S     + G + Q  
Sbjct  126  KMEKIKMRSVHSQAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVNLQHA  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            VKG+ MI  GC   A F ILQA+TL++YPA LSLT+ +C +G ++G ++ L++ERG  ++
Sbjct  186  VKGSIMITIGCFSCACFTILQAVTLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSV  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WDT LLA +YSG++CSG+AYYI GVVM+ +GPVFVT FNPL M+IVAIM  FILAE
Sbjct  246  WSLSWDTKLLAAVYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPFILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+V+GA VI++GLYLV+W
Sbjct  306  KIYLGRVIGAVVIILGLYLVVW  327



>ref|XP_002308146.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
 gb|EEE91669.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
Length=414

 Score =   321 bits (822),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 200/262 (76%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++ L LLEPVIDQNLY+ GMKYTTATF  A+ NVLPAITFI+AWI+
Sbjct  127  KKLRPKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIV  186

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  LHSQAK+ GT  T+ GAM+MTL++G +I     K  ++ ++ + G      
Sbjct  187  RLEKVKIGSLHSQAKLAGTIATVAGAMLMTLMKGPLIEFFRIKGNAYHENGTGGIDLHSS  246

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC  WA F ILQAITLKSYPA LSLT+ +C +G ++G+V+ LV E G  ++
Sbjct  247  IKGALMITVGCFSWACFMILQAITLKSYPAELSLTAWICLLGTIEGAVVALVAENGKPSV  306

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA++WD  LLA +YSG+ CSG+AYYI G+VMKD+GPVFVTAF+PL M+IVA+M   I AE
Sbjct  307  WAINWDMKLLAAVYSGIFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSCIIWAE  366

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G++LGA +IV GLYLV+W
Sbjct  367  QMYLGRILGAIIIVAGLYLVVW  388



>ref|XP_006410933.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52386.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=380

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 216/309 (70%), Gaps = 3/309 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK +S   +   G      
Sbjct  127  GLERVKLRCIRSAGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGSSAQNTN--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+ + LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYYI GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTATYSGIVCSALAYYIGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHSA  900
            Q+  G+VLGA VI  GLYLVIWG  KD    S+    D     +L +IR    + + H  
Sbjct  305  QMYLGRVLGAVVICAGLYLVIWGKGKDYEYPSTLQTDDVLTQPKLELIRNGKDNVD-HEV  363

Query  901  TPIEVPGEE  927
              +   GE+
Sbjct  364  INVIKQGEQ  372



>emb|CDY18444.1| BnaA04g21430D [Brassica napus]
Length=373

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 198/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  63   KKVRPKMTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  122

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK AS   +   G      
Sbjct  123  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKVASAQNTD--GTDIHSA  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+ + LV+E+GN   
Sbjct  181  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGA  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ G+VMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  241  WAIGWDTKLLTSTYSGIVCSAIAYYVGGLVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  301  QMYLGRVLGAAVICAGLYLVIW  322



>ref|XP_010517017.1| PREDICTED: WAT1-related protein At2g37460 [Camelina sativa]
Length=380

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLVIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGISSKNTD--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+V+ LV+E+GN + 
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICGGLYLVIW  326



>ref|XP_009614497.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/278 (57%), Positives = 205/278 (74%), Gaps = 9/278 (3%)
 Frame = +1

Query  58   LLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGT  237
            L +PVIDQNLY  G+KYTTATF  A+ N+LPAITFI+AWI RLE+V +  + SQAKI+GT
Sbjct  63   LDKPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIFRLERVKLTSIRSQAKIIGT  122

Query  238  SVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYI  417
              T+ GAMIMTLVRG VI L WTK  S  +S S G +    +KG+ +I  GC  WA+F I
Sbjct  123  IATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHAIKGSLLITIGCFSWAAFMI  182

Query  418  LQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVIC  597
            LQAITL++YPA LSLT+ +C +G  +G+++ +V+ERG AA+WA+ WDT  LA +YSG+ C
Sbjct  183  LQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIKWDTKFLAAVYSGIFC  242

Query  598  SGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYL  777
            SG+AYYI GV+MKD+GPVFVTAFNPLSM+IVAI+ SFIL EQ++ G+VLGA VIV+GLY+
Sbjct  243  SGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNLGRVLGAVVIVLGLYI  302

Query  778  VIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQ  891
            V+WG SKD           +P   +  +    TTH+ +
Sbjct  303  VLWGKSKDQ---------KSPSTDEQAIPTQETTHENK  331



>ref|XP_010505334.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 198/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGISSKNTD--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+V+ LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPRA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICGGLYLVIW  326



>ref|XP_010509331.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGISSKNTD--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+V+ LV+E+GN + 
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ GVVMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAVVICGGLYLVIW  326



>ref|XP_010534299.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=386

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 198/273 (73%), Gaps = 11/273 (4%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT+ +F KI+ LGLLEP I QNL+YTGMKYT+ TFT+A+ NVLPA  F++AWI 
Sbjct  59   RKVRPKMTWPIFIKIVFLGLLEPTIGQNLFYTGMKYTSPTFTSAMSNVLPAFAFLMAWIF  118

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS--HD---------Q  327
            RLE+V++R++HSQA I+GT VT+GGAM M LV+G  + +PW       HD          
Sbjct  119  RLEKVDIRRVHSQAMIMGTIVTVGGAMAMALVKGPSMDIPWVHNHHKIHDMYLNLLQQQS  178

Query  328  SASAGNSQQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVL  507
              +   +  DP KGA  +A+GC CWA+F  LQA+TLK+YPA LSL + +C +GA +GS+ 
Sbjct  179  HQTKSTTSHDPTKGALFVASGCLCWAAFTTLQALTLKAYPAVLSLAAWICFIGATEGSIA  238

Query  508  TLVVERGNAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMII  687
             LV+ER N + W++H D  L A +YSGVICSGV YY+ G++M+ KGPVFVTAFNPLSM+I
Sbjct  239  ALVMERHNISAWSLHIDIKLFAAVYSGVICSGVGYYVQGMIMRKKGPVFVTAFNPLSMVI  298

Query  688  VAIMGSFILAEQLDFGKVLGACVIVVGLYLVIW  786
            V I+ S +  E +  G+V G+ +IVVGLYLV+W
Sbjct  299  VTIISSLVFHEGIHLGRVTGSILIVVGLYLVLW  331



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 200/263 (76%), Gaps = 4/263 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+F KI+LL LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITFILA I+
Sbjct  68   RKIRPKMTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIV  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQS-ASAGNSQQD  357
            RLE++ ++ + SQAK+LGT  T+ GAM+MTL++G ++   +     H QS  S+G S   
Sbjct  128  RLEKIKIKSMRSQAKVLGTIATVSGAMVMTLMKGPIL---FETFGDHSQSYHSSGTSAHH  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             + G+ +I  GC  WA F ILQAITL++YPA LSL+S +C  GA++G+ L LV+ER N +
Sbjct  185  TILGSVLITIGCFSWACFVILQAITLETYPAALSLSSWICLFGAIEGAALALVMERNNPS  244

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W++ WD  LL+ IY+G+ CSG+ YY+ GVVMK +GPVFVT FNP  M+IVAIMG F+LA
Sbjct  245  VWSIKWDMRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPFCMVIVAIMGYFLLA  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQ+  G+V+GA +I +GLYLV+W
Sbjct  305  EQMFLGRVIGAFIICLGLYLVVW  327



>gb|EYU41683.1| hypothetical protein MIMGU_mgv1a009185mg [Erythranthe guttata]
Length=350

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 198/261 (76%), Gaps = 0/261 (0%)
 Frame = +1

Query  4    KIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILR  183
            KIRPKMT S+F KIML+ LLEPVIDQNLY+ GMKYTTATF  A+ N+LPA+TF++A   R
Sbjct  28   KIRPKMTTSIFVKIMLMSLLEPVIDQNLYFLGMKYTTATFAAAMANILPALTFVIACFFR  87

Query  184  LEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPV  363
            LE+V V  + SQAKI+GT  T+ GAMIMTLV+G  I LPWT+            S    +
Sbjct  88   LEKVKVMSIRSQAKIIGTLATVAGAMIMTLVQGPHINLPWTRSGIDHAHHHGEVSLHHTI  147

Query  364  KGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIW  543
            KGA MI  GC  WA F ILQAITLK+YPA LSLT+ +C +G  +G+ L LV+E+GN++ W
Sbjct  148  KGAIMITIGCLAWACFMILQAITLKTYPAELSLTAWICLLGTAEGAALALVMEKGNSSAW  207

Query  544  AVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQ  723
            A+ WDT  LA  YSG+ CSG+AYY+ GVVMK++GPVFVTAF+PLSM++VAIM SFILAEQ
Sbjct  208  AIKWDTKFLAAAYSGIFCSGIAYYVQGVVMKERGPVFVTAFSPLSMVMVAIMSSFILAEQ  267

Query  724  LDFGKVLGACVIVVGLYLVIW  786
            +  G+++GA VIV+GLY V+W
Sbjct  268  MFLGRIVGAIVIVLGLYFVVW  288



>gb|KHG24903.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=373

 Score =   317 bits (812),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F +IM+LGLLEPVIDQNLY+ GMKYTTATF TA+ N+LPAITF++AWI 
Sbjct  67   KKVRPKMTMRIFIQIMVLGLLEPVIDQNLYFLGMKYTTATFATAMYNILPAITFVMAWIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+V +R + S  KI+GT  T+ GAM+MTL++G V+ L WTK   +H+ ++  G    D
Sbjct  127  RLEKVKLRSIRSHGKIIGTLATVAGAMVMTLMKGPVLELFWTKGRNNHEAASKNGTDLHD  186

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KG  +I  GC  +A F ILQAITL++YPA LSLT  +C +G L+G++  L++E+GNAA
Sbjct  187  CIKGGVLITIGCFSYACFVILQAITLETYPADLSLTVWICLLGTLEGTIAALIMEKGNAA  246

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            IWA+ WDT LL   Y+G++CSG+AYYI G++M+ +GPVFVTAF+PL M+IVAIM SFILA
Sbjct  247  IWAIKWDTKLLTAAYTGIVCSGLAYYIQGMIMRHRGPVFVTAFSPLCMVIVAIMSSFILA  306

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQ+  G+V+GA +I+VGLYLV+W
Sbjct  307  EQMFLGRVIGAIIIIVGLYLVLW  329



>ref|XP_004147717.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=373

 Score =   317 bits (812),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 207/264 (78%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+R KMT S+ +KI++LGLLEPVID NLY+TGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  65   RKVRTKMTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN--SQQ  354
            RLE+VN+ K  SQAKI+GT VTIGGAMIMT +RG ++ LPWTK  +H  S+S+ +  +  
Sbjct  125  RLERVNIWKRGSQAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKP-NHPSSSSSSSSINHH  183

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            + +KG+ MI  GC C ++F ILQAITLK YPA LSLT+L+C +  + G ++ LV+ERGN 
Sbjct  184  NQIKGSLMITIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNP  243

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            + WA+H+D+ LL+ +Y+GVICSGV YYI G+VM+ KGPVFVTAFNPLSMI VAIM SFIL
Sbjct  244  SAWALHFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFIL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            +E +  G+++GA  I+ GLYLV+W
Sbjct  304  SEIMLLGRIVGAVTIITGLYLVLW  327



>emb|CDX93378.1| BnaC04g45180D [Brassica napus]
Length=373

 Score =   317 bits (811),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 211/309 (68%), Gaps = 3/309 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPKMTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK  S   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGVSTQNTD--GTDINSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+ + LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ G+VMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTSTYSGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHSA  900
            Q+  G+VLGA VI  GLYLVIWG  KD    S     D     +L + R        H  
Sbjct  305  QMYLGRVLGAVVICAGLYLVIWGKGKDYEFSSMPQPNDESTQPKLELSRNG-KGSVNHEV  363

Query  901  TPIEVPGEE  927
            + I   GE 
Sbjct  364  STINNQGEH  372



>gb|KHG03072.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=391

 Score =   317 bits (813),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 202/264 (77%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMTF++F KIML+ LLEPV+D N +YTGMKYTTATFTTA+ N+LPA+TF LA I+
Sbjct  65   RKTRPKMTFNIFIKIMLISLLEPVLDHNFFYTGMKYTTATFTTAMCNILPALTFALACIV  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASH--DQSASAGNSQQ  354
            +LE+V   K+ SQAK+ GT+V +GGAMIMTL++G V+ LPWTK  +H   Q  ++G  +Q
Sbjct  125  KLERVETGKVRSQAKVAGTAVAVGGAMIMTLIKGPVLELPWTKGRNHYLGQHGASGAHKQ  184

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D V GA ++ AGCCCWA F I QA  LKSYPA LSLT+L+C MG  +G++L   VE  N 
Sbjct  185  DMVMGALLLLAGCCCWACFVISQARILKSYPAKLSLTALICIMGTFEGTILAFAVEWRNP  244

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            ++W + +D+ L+A +Y G++ +  A Y  G VMK +GPVFV+AFNPLSM+IVAI+GSF L
Sbjct  245  SVWLIGFDSKLIASLYGGLV-TAFALYAMGSVMKRRGPVFVSAFNPLSMVIVAILGSFFL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE +  G+VLG+ VIV+GLYLV+W
Sbjct  304  AEDMYLGRVLGSIVIVIGLYLVLW  327



>ref|XP_004167778.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50536.1| hypothetical protein Csa_5G181430 [Cucumis sativus]
Length=374

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 207/265 (78%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+R KMT S+ +KI++LGLLEPVID NLY+TGMKYTTATF  A+ NVLPA  F++AW  
Sbjct  65   RKVRTKMTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMAWAC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN---SQ  351
            RLE+VN+ K  SQAKI+GT VTIGGAMIMT +RG ++ LPWTK  +H  S+S+ +   + 
Sbjct  125  RLERVNIWKRGSQAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKP-NHPSSSSSSSSSINH  183

Query  352  QDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
             + +KG+ MI  GC C ++F ILQAITLK YPA LSLT+L+C +  + G ++ LV+ERGN
Sbjct  184  HNQIKGSLMITIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGN  243

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             + WA+H+D+ LL+ +Y+GVICSGV YYI G+VM+ KGPVFVTAFNPLSMI VAIM SFI
Sbjct  244  PSAWALHFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFI  303

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L+E +  G+++GA  I+ GLYLV+W
Sbjct  304  LSEIMLLGRIVGAVTIITGLYLVLW  328



>gb|KDP35589.1| hypothetical protein JCGZ_09027 [Jatropha curcas]
Length=375

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 203/266 (76%), Gaps = 4/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KI++L LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++A I+
Sbjct  66   KKVRPKMTRSIFIKILVLSLLEPVIDQNLYFLGMKYTTATFAAAIINILPAITFVMACIV  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEA----SHDQSASAGNS  348
            RLE+V +  LHSQAK++GT  T+ GAM+MT+V+G  + L  + +      H+Q  S   +
Sbjct  126  RLEKVKMTSLHSQAKVVGTIATVAGAMVMTVVKGPPVDLFNSTKGMRIYHHNQQTSDDVN  185

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
              + +KGA MI  GC  WA F ILQAITLK+YPA LSLT+ +C  G ++GS++ LV+ERG
Sbjct  186  LHNSIKGALMITIGCFGWACFVILQAITLKTYPAELSLTAWICLFGTIEGSIVALVMERG  245

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N ++W+++ D  L   +YSGV+CSG AYYI GVVMKD+GPVFVTAF+PL M+IVA+M S 
Sbjct  246  NPSVWSLNLDIKLATAVYSGVVCSGFAYYIQGVVMKDRGPVFVTAFSPLCMVIVAVMSSI  305

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            ILAEQ+  G+V+GA +IV GLYLV+W
Sbjct  306  ILAEQMFLGRVIGAIIIVGGLYLVVW  331



>gb|KHG29314.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=296

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/270 (61%), Positives = 211/270 (78%), Gaps = 1/270 (0%)
 Frame = +1

Query  73   IDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGTSVTIG  252
            +DQNL YTGMKYTTATFT+A+ NVLPA  F+LAWI++LE+VN+RKLHSQAKILGT VT G
Sbjct  1    MDQNLLYTGMKYTTATFTSAMTNVLPAFVFLLAWIVKLEKVNIRKLHSQAKILGTIVTFG  60

Query  253  GAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYILQAIT  432
            GAM+MTL+ G ++ LPWTK  ++   +SA   +QDP+KGA MI  GC CWA F ILQAIT
Sbjct  61   GAMLMTLINGPMLPLPWTKSNNNHVFSSASAVKQDPIKGALMIIFGCFCWAGFIILQAIT  120

Query  433  LKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVICSGVAY  612
            LKSYPA LSLT+ +C  G + GS++ L +E GNAA+W++H+D  LLA +YSGVICSG+ Y
Sbjct  121  LKSYPAELSLTAFICLAGTIGGSIVALAMEAGNAAVWSIHFDVKLLAAVYSGVICSGITY  180

Query  613  YISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYLVIWgs  792
            Y+ GV+M+ +GPVFVTAFNPLSM+IVAI+ SFIL+E L  G+++GA VIV+GLY+V+WG 
Sbjct  181  YVQGVIMRSRGPVFVTAFNPLSMVIVAILSSFILSEILYLGRIIGAIVIVIGLYMVLWGK  240

Query  793  skddsskssgddL-DAPVDQQLPVIRPATT  879
            SKD  S +    + +A  DQ++ VI    T
Sbjct  241  SKDQCSSNQNIKVEEASNDQKMIVIDDHQT  270



>ref|XP_004493898.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=382

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 205/262 (78%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F K++ L +LEPVIDQNLY+ GMKYTTATF  A+ NVLPAITF++A IL
Sbjct  66   KKVRPKMTFSIFMKLVTLAVLEPVIDQNLYFLGMKYTTATFAVAMINVLPAITFVMACIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            +LE++ ++  HSQAK++GT  T+ GAM+MTL++G ++ +     +S     +AG + Q P
Sbjct  126  KLEKIKMKSTHSQAKVVGTLATVLGAMVMTLLKGPILNVFGIHGSSTQIQHNAGANLQHP  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG+ MI  GC   A F ILQAITL++YPA LSLT+ +C +G ++G ++ L++ERG  ++
Sbjct  186  IKGSIMITIGCFSCACFMILQAITLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSV  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W+++WDT LLA +YSG++CSG+AYYI G +M+ +GPVFVT FNPL M+IVAIMGSF LAE
Sbjct  246  WSLNWDTKLLAAVYSGIVCSGMAYYIQGALMRYRGPVFVTTFNPLCMVIVAIMGSFFLAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+V+GA VI+ GLYLV+W
Sbjct  306  KIYLGRVIGAVVIIFGLYLVVW  327



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 200/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT SVF KIM+L  LEPV+DQNLYY GMK T+ATF++A+ NVLP ITFI+A I 
Sbjct  72   RKIRPKMTVSVFLKIMVLAFLEPVLDQNLYYVGMKSTSATFSSAIFNVLPGITFIMAIIF  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE V ++K+HSQAKI+GT VT  GAM MTL +G ++ L  ++  +H + AS+  + Q  
Sbjct  132  RLEHVKIKKIHSQAKIIGTIVTFAGAMAMTLYKGPILNLGLSRGGAHHE-ASSSAAGQHW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ A C  W+ F+ILQ+ TLK YPA LSLTSL+C MG +QG+ + LV+ER   A 
Sbjct  191  VAGTLMLLASCTGWSCFFILQSFTLKQYPAELSLTSLICFMGMVQGAAVALVMERKPGA-  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ WD+ LLA +YSGV+CSG+ YY+ G+V+K++GPVFVTAFNPL M+IVA +GS ILAE
Sbjct  250  WSLGWDSRLLAAVYSGVVCSGITYYVQGIVIKERGPVFVTAFNPLCMVIVAALGSLILAE  309

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G V+GA VIV+GLY V+W
Sbjct  310  QIHLGSVIGAIVIVIGLYSVVW  331



>ref|XP_010684183.1| PREDICTED: WAT1-related protein At2g37460-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++LL LLEPVIDQNLYY GMKYT+ATF   + NVLPAITF++AWIL
Sbjct  65   KKVRPKMTLSIFIKLLLLSLLEPVIDQNLYYMGMKYTSATFAATMVNVLPAITFVMAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASA--GNSQQ  354
            RLE+V  R + SQAKI+GT  T+GGAM+MTL++G  +   W+K  + D +       S  
Sbjct  125  RLERVKCRSIRSQAKIVGTVATVGGAMMMTLIKGPALT-SWSKNTATDHNGVKPLDISVH  183

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D +KG+ MI  GC  WA+F ILQAITLK+YP  LSLT+ +C +G L+G+ L LV+E+G +
Sbjct  184  DAIKGSIMIIIGCFSWAAFVILQAITLKTYPVELSLTAWICLLGTLEGTALALVMEKGRS  243

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            ++WA++WD  LLA +YSG+ CSG+ Y+I GVVMK++GPVFVTAF+PL M+IVAI+ +F +
Sbjct  244  SVWAINWDANLLAAVYSGIFCSGLLYFIQGVVMKERGPVFVTAFSPLCMVIVAILSTFFM  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE++  G+VLGA VIVVGLY+VIW
Sbjct  304  AEKMYLGRVLGAVVIVVGLYMVIW  327



>gb|KDO67718.1| hypothetical protein CISIN_1g043160mg, partial [Citrus sinensis]
Length=333

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMTF +F KI LLGL EPVI QNLY+TG+K +TATFT A+ N+LPA+TF++AWI 
Sbjct  62   RKTRPKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIF  121

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE+V ++ + SQAKILGT VT GGAM MTL++G ++  PW +    H+QS +  +++++
Sbjct  122  RLEKVKIKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQSETGTHNKEE  181

Query  358  PV-KGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
             + KGA MIAAGC  W+ F IL+A  LKSYPA LSLT+L+C + +++G++L L +ERGN 
Sbjct  182  HITKGALMIAAGCFSWSCFIILEAFLLKSYPAELSLTALMCFVSSVEGTILALAIERGNT  241

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             IW +H+D  LL+ +Y G + S  AY+I G +MK KGPVFV++FNPLSM+I+AI+GSF +
Sbjct  242  GIWLLHFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFI  300

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE+L  G+++GA VIV+GLY+V+W
Sbjct  301  AEELFLGRIVGAIVIVIGLYMVLW  324



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 197/262 (75%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F K M L LLEPV+DQN YY G   T+A F +AL N+LPAITF++A +L
Sbjct  64   RKVRPKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSAGFASALFNILPAITFLMAIVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+R+  SQAK++GT VT+ GA++M L +G V+   W+K  SH  +A    +  + 
Sbjct  124  RMEKVNLRQRRSQAKLVGTIVTVAGAVLMILYKGPVLDFVWSKGRSHQNTAVGHQNSSNW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG  M+ +GC CW+ F+ILQ+ T+ SYPA L+LT+L+C MGAL GS++ LV ERG+A  
Sbjct  184  LKGTLMLLSGCFCWSCFFILQSNTIDSYPAELTLTTLICLMGALMGSLVALVAERGSAKP  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WDT LLA +YSGVICSGVAYY+ G VMK++GPVFVTAFNPL MII A++GS +LAE
Sbjct  244  WIIGWDTRLLAAVYSGVICSGVAYYMQGKVMKERGPVFVTAFNPLCMIITAVLGSIVLAE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G V+GA  IV+GLY +IW
Sbjct  304  DITLGSVIGAVFIVIGLYSLIW  325



>ref|XP_007144467.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
 gb|ESW16461.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
Length=377

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 200/262 (76%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK++ KMT S+F KI++L LLEPVIDQNLY+ GMKYTTATF   + N+LPAITF+ A IL
Sbjct  67   RKVKQKMTLSIFMKILVLSLLEPVIDQNLYFLGMKYTTATFAVTMTNMLPAITFVFACIL  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N+R + SQAK++GT  T+ GAMIMTL++G V+   +    S+  S + G S Q  
Sbjct  127  RLEKINIRSIRSQAKVVGTVATVSGAMIMTLIKGPVL---FGSHVSNAHSQNNGTSTQHS  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI  GC CWASF ILQAITLK+YPA LSL++ +C MG ++G+ + LV+ERG+ ++
Sbjct  184  MTGFVMITIGCFCWASFMILQAITLKTYPAALSLSAWICLMGTIEGAAVALVMERGHPSV  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D  LL  +Y+G+ CSGV YY+ GVVMK +GPVFVTAF+PL MIIVAIMG FILAE
Sbjct  244  WSLKFDMRLLCAVYAGITCSGVGYYLQGVVMKSRGPVFVTAFSPLCMIIVAIMGFFILAE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+++GA +I +GLY V+W
Sbjct  304  QVFLGRMIGAIIICLGLYSVVW  325



>gb|AFK37263.1| unknown [Lotus japonicus]
Length=386

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 209/265 (79%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMTFS+F KI+LL LLEPVIDQNLYY GMKYTTATF  ++ N+LPAITF++A+IL
Sbjct  66   KKIRPKMTFSIFVKIVLLSLLEPVIDQNLYYLGMKYTTATFAVSMYNILPAITFLMAYIL  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK--EASHDQSASAGNSQQ  354
            +LE++ ++ + SQAK+ GT  T+ GAM+MTL++G  + L  T    ++H Q  + G + Q
Sbjct  126  KLEKIKIKSIRSQAKVFGTLATVAGAMVMTLIKGPELELFGTHGGSSTHIQH-NGGVNLQ  184

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN-  531
              +KG+ MI  GC  +A F ILQAITL++YPA LSLT+ +C +G ++G ++ LV+ERGN 
Sbjct  185  HAIKGSVMITIGCFSFAGFMILQAITLEAYPADLSLTAWICLLGTVEGGIVALVMERGNP  244

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            A +W+++W+T+LLA +Y G++CSG+ YYI G VMK KGPVFVT F+PL MIIVAI+GSFI
Sbjct  245  APVWSLNWNTSLLAAVYGGIVCSGMTYYIQGAVMKYKGPVFVTTFSPLCMIIVAILGSFI  304

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            LAEQ+  G+V+GA VI++GLYLV+W
Sbjct  305  LAEQMYLGRVIGAIVILLGLYLVVW  329



>ref|XP_009143490.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
 emb|CDX91365.1| BnaC04g07850D [Brassica napus]
 emb|CDX74958.1| BnaA05g07040D [Brassica napus]
Length=380

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 213/309 (69%), Gaps = 3/309 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT+ +F KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA++ 
Sbjct  67   KKVRPKMTWMIFGKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYLF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+VN+R + S  KI+GT  T+GGAMIMTLV+G V+ L WTK  S   +   G      
Sbjct  127  GLERVNLRCIRSAGKIIGTLATVGGAMIMTLVKGPVLDLFWTKGVSAPNTT--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++Y A LSLT+ +C MG ++G+ + LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYQAELSLTAWICLMGTIEGTAVALVMEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ G+VMK +GPVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTELLTAAYSGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHSA  900
            Q+  G+VLGA VI  GLYLVIWG  KD    S+    D     +L + R        H A
Sbjct  305  QMYLGRVLGAVVICAGLYLVIWGKGKDIEYPSTPQVGDESTQPKLELSR-NVKDSVGHEA  363

Query  901  TPIEVPGEE  927
              I   GE+
Sbjct  364  ITINNQGEQ  372



>ref|XP_009141663.1| PREDICTED: WAT1-related protein At2g37460 [Brassica rapa]
Length=370

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 196/262 (75%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RP+MT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I 
Sbjct  67   KKVRPEMTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE+V +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK AS   +   G      
Sbjct  127  GLERVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKVASAQNTD--GTDIHSA  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+ + LV+E+GN   
Sbjct  185  IKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WDT LL   YSG++CS +AYY+ G VMK + PVFVTAF+PL MIIVAIM + I AE
Sbjct  245  WAIGWDTKLLTSTYSGIVCSAIAYYVGGPVMKTRCPVFVTAFSPLCMIIVAIMSTVIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+VLGA VI  GLYLVIW
Sbjct  305  QMYLGRVLGAAVICAGLYLVIW  326



>ref|XP_004167845.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=347

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 200/263 (76%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F KI+LLGLLEPVI Q+L Y+G KYTTATF TA+ N+LPA  F++AWI 
Sbjct  39   RKIRPKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWIC  98

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS-HDQSASAGNSQQD  357
            R+E+VN+R L SQAKILGT VT+GGAM+MTL++G ++ LPWT + + +  S S   ++Q 
Sbjct  99   RMEKVNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNLNPHSYSTLPNKQQ  158

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            PVK A +I     C ++F IL A T+++YPA L+LT+ +C  GA++ ++L L  E  N +
Sbjct  159  PVKAAIVITISSICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPS  218

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W +H D+ LLA +Y G+I SG+AYY+ GVV+K KGPVFVTAFNPLSM+IVAI+ SFI A
Sbjct  219  AWVLHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFA  278

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V+GA VI++GLYLV+W
Sbjct  279  ETLRLGRVIGAAVIIIGLYLVLW  301



>ref|XP_008785769.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=651

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 220/312 (71%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F KIM L  LEPV+DQN YY G   T+A+F +A+ N+LPAITF+LA +L
Sbjct  339  RKVRPKMTLSIFLKIMALAFLEPVLDQNFYYVGSNLTSASFASAMFNILPAITFLLAIVL  398

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E +N+R+  SQAK++GT VT+ GA++M L +G V+   W+K  SH  +A  G +  + 
Sbjct  399  RIETMNLRRRRSQAKLVGTIVTVAGALLMILYKGPVLDFVWSKGRSHHNTA-VGQNGSNS  457

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG  M+  GC C +SFYILQ+ TL+SYPA L+LTSL+C MGAL  S++ LV ERG+A  
Sbjct  458  LKGTLMLLGGCFCCSSFYILQSNTLESYPAELTLTSLICLMGALMSSLVALVAERGSAKP  517

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WDT LLA +YSGV+CSGVAYY+ G VMK++GPVFVTAFNPL MI+ A++GS +LAE
Sbjct  518  WIIGWDTRLLAVVYSGVLCSGVAYYVQGKVMKERGPVFVTAFNPLCMIVTAVLGSIVLAE  577

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPV-IRPATTHQEQHS  897
            ++  G V+GA VIV+GLY +IWG SKD   + S    +   + +LP  I  A      + 
Sbjct  578  EITLGSVIGAAVIVIGLYSLIWGKSKDHLKQHSESS-EKKGEFELPTAIADAGKSGRNNQ  636

Query  898  ATPIEVPGEESV  933
            AT +E+P    +
Sbjct  637  ATAVEIPAASQI  648


 Score =   220 bits (560),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 141/195 (72%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+F K M L LLEPV+DQN YY G   T+A+F +AL N+LPAITF+LA +L
Sbjct  64   RKVRPKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSASFASALFNILPAITFLLAIVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E +N+R+  SQAK++GT VT+ GA++M L +G  +   W+K  SH  +A + N   + 
Sbjct  124  RIENMNLRRRRSQAKLVGTIVTVAGALLMILYKGPSLDFVWSKGRSHHNTAVSQNG-SNS  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG  M+  GC CW+SF+ILQ+ TL+SYPA L+LT+L+C MG L  S++ LV ERG+A  
Sbjct  183  LKGTLMLLGGCFCWSSFFILQSNTLESYPAALTLTTLICLMGTLMSSLVALVAERGSAKP  242

Query  541  WAVHWDTTLLAYIYS  585
            W + WDT LLA +YS
Sbjct  243  WIIGWDTRLLAVVYS  257



>ref|XP_004142736.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN51278.1| hypothetical protein Csa_5G512850 [Cucumis sativus]
Length=374

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 200/263 (76%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F KI+LLGLLEPVI Q+L Y+G KYTTATF TA+ N+LPA  F++AWI 
Sbjct  65   RKIRPKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWIC  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS-HDQSASAGNSQQD  357
            R+E+VN+R L SQAKILGT VT+GGAM+MTL++G ++ LPWT + + +  S S   ++Q 
Sbjct  125  RMEKVNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNLNPHSYSTLPNKQQ  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            PVK A +I     C ++F IL A T+++YPA L+LT+ +C  GA++ ++L L  E  N +
Sbjct  185  PVKAAIVITISSICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPS  244

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W +H D+ LLA +Y G+I SG+AYY+ GVV+K KGPVFVTAFNPLSM+IVAI+ SFI A
Sbjct  245  AWVLHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFA  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V+GA VI++GLYLV+W
Sbjct  305  ETLRLGRVVGAAVIIIGLYLVLW  327



>ref|XP_006294396.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
 gb|EOA27294.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
Length=385

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 188/262 (72%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R IRPKMT  +F+KI LLGLLEPVIDQNL+  GMKYTTATF TAL N LPAITFILA + 
Sbjct  61   RTIRPKMTLMIFFKIALLGLLEPVIDQNLFNLGMKYTTATFATALYNTLPAITFILALMF  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V  R + S AK+ GT  T+GG M+MTLV+G  + L WTK  S   +   G      
Sbjct  121  RLEKVKFRNIRSAAKVFGTITTVGGTMMMTLVKGPALDLFWTKGPSGQNTT--GTDIHSS  178

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQAITLK+YPA LSL +L+C MG ++G+V+ LV+E+GN   
Sbjct  179  IKGAILVTIGCFSYACFMILQAITLKTYPAELSLATLICLMGTIEGAVVALVIEKGNPTA  238

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WD  LL   YSG++CS + YYI G+VMK +GPVFVTAF PL MI+VAIM S I +E
Sbjct  239  WAIGWDNKLLTVTYSGIMCSALGYYIGGMVMKTRGPVFVTAFKPLCMIVVAIMSSIIFSE  298

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+ LGA VI  GLYLVIW
Sbjct  299  QMYLGRALGAAVICAGLYLVIW  320



>ref|XP_008463583.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=432

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 201/263 (76%), Gaps = 1/263 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F KI+LLGLLEPVI Q+L Y+G KYTTATF TA+ N+LPA  F++AWI 
Sbjct  126  RKIRPKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWIC  185

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHD-QSASAGNSQQD  357
            R+E+VN+R L SQAKILGT VT+GGAM+MTL++G ++ LPWT + + +  S S   ++Q 
Sbjct  186  RMEKVNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNFNPHSYSTLPNKQQ  245

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
            PVK A +I     C ++F IL A T+++YPA L+LT+ +C  GA++ ++L L  E  N +
Sbjct  246  PVKAAIVITISSICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPS  305

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             WA+H D+ LLA +Y G+I SG+AYY+ GVV+K KGPVFVTAFNPLSM+IVA++ SFI A
Sbjct  306  AWALHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAVISSFIFA  365

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E L  G+V+GA VI++GLYLV+W
Sbjct  366  ETLRLGRVVGAAVIIIGLYLVLW  388



>ref|XP_007009431.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18241.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=361

 Score =   309 bits (791),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 203/263 (77%), Gaps = 2/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT ++F KIML+ L EPV+D NLYYTG+KYTTATFTTA+ N+LP  TF +A I 
Sbjct  66   RKSRPKMTLTIFAKIMLISLFEPVLDHNLYYTGLKYTTATFTTAMCNMLPTFTFAMACIF  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASH-DQSASAGNSQQD  357
            +LE+V +R++HSQAK++GT VT+GGAM+MTL++G V+ LPWTK  +H DQS ++G  + D
Sbjct  126  KLERVEIRRVHSQAKVVGTMVTVGGAMVMTLIKGPVLELPWTKGRNHLDQSGASGGHEHD  185

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KG  M+ AGCCCW+ F I QA+ LKSYPA LSL +L+C MG ++G++L   VE  N +
Sbjct  186  LMKGTLMLMAGCCCWSCFIISQAVILKSYPAKLSLAALICTMGTVEGTILAFAVEWRNTS  245

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W  H D+  +A IY G+I S  A    G VMK +GPVFV+AFNPLS++IVAI+GSF+LA
Sbjct  246  VWLFHLDSKFIAAIYGGMI-SAFAVTTLGSVMKKRGPVFVSAFNPLSLVIVAILGSFLLA  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E++  G+V+G+ +IV+GLYLV+W
Sbjct  305  EEICLGRVIGSIIIVIGLYLVLW  327



>ref|XP_006410932.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52385.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=308

 Score =   307 bits (786),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 210/303 (69%), Gaps = 3/303 (1%)
 Frame = +1

Query  19   MTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVN  198
            MT  +F+KI LLGLLEPVIDQNLYY GMKYTTATF TA+ NVLPAITF+LA+I  LE+V 
Sbjct  1    MTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLERVK  60

Query  199  VRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAM  378
            +R + S  K++GT  T+GGAMIMTLV+G V+ L WTK +S   +   G      +KGA +
Sbjct  61   LRCIRSAGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGSSAQNTN--GTDIHSAIKGAVL  118

Query  379  IAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWD  558
            +  GC  +A F ILQA+TL++YPA LSLT+ +C MG ++G+ + LV+E+GN   WA+ WD
Sbjct  119  VTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWD  178

Query  559  TTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGK  738
            T LL   YSG++CS +AYYI GVVMK +GPVFVTAF+PL MIIVAIM + I AEQ+  G+
Sbjct  179  TKLLTATYSGIVCSALAYYIGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGR  238

Query  739  VLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHSATPIEVP  918
            VLGA VI  GLYLVIWG  KD    S+    D     +L +IR    + + H    +   
Sbjct  239  VLGAVVICAGLYLVIWGKGKDYEYPSTLQTDDVLTQPKLELIRNGKDNVD-HEVINVIKQ  297

Query  919  GEE  927
            GE+
Sbjct  298  GEQ  300



>ref|XP_007220060.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
 gb|EMJ21259.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
Length=378

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/299 (53%), Positives = 208/299 (70%), Gaps = 9/299 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT S+  K MLL L +P++DQNLYY  M Y+TATFT+A+ N+LPAI F +AWI 
Sbjct  65   RKSRPKMTSSILVKTMLLSLFDPLLDQNLYYMAMSYSTATFTSAMFNILPAIAFFMAWIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE VN+RKLHSQAK+LGT +T+GGA+I+TL +G  + LPWTK +  H     + ++ +D
Sbjct  125  RLETVNIRKLHSQAKVLGTIITVGGAIILTLAKGPALNLPWTKGKNQHHHQMQSDSNHKD  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE-RGNA  534
              K A + AA C CW+SF ILQA TL+SYP  LSL +L C  G ++G++L LVVE R + 
Sbjct  185  ITKSALLSAAACFCWSSFIILQAFTLRSYPCKLSLAALTCFWGLVEGAILALVVEWRNSN  244

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            A W++H D  LLA  Y G++ SGVAYYI G+V K+KGPVF +AFNPL  +I+AI+GS +L
Sbjct  245  ADWSIHLDIRLLAAFYGGIL-SGVAYYIMGMVNKEKGPVFFSAFNPLGTVIIAILGSLVL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQ  891
             E +  G ++GA VIVVGLYLV+WG +KD+           P D+      P TT Q+Q
Sbjct  304  DEHMYLGSLIGAIVIVVGLYLVLWGKTKDEPPSQLSKTQSQPNDE------PITTSQQQ  356



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 198/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RP+MT  +F +I+LLG LEPV+DQNLY+ GMKYT+ATF +A+ NVLPAITFI+A   
Sbjct  67   RKVRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALCF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+KLHS AK++GT +T+GGAMIMTL +G ++ +      SH+ S +  +S+Q  
Sbjct  127  RLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGHSHSHNSSTTE-SSEQHW  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   C  WASF+ILQ+ TLK YPA LSLT+ +C MG L+G V+T  VER   ++
Sbjct  186  IAGPLMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSGV+CSG+AYY+ GVV++++GPVFVTAF+PL MII A +G+ +LAE
Sbjct  245  WVIGWDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIITAALGAIVLAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G V+GA  IV GLY V+W
Sbjct  305  QVHLGSVIGAICIVFGLYTVVW  326



>ref|XP_010419331.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g37450-like 
[Camelina sativa]
Length=382

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 188/262 (72%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT  +F+KI LLGLLEPVIDQNL+  GMKYTTATF TAL N LPAITFILA I 
Sbjct  68   RTVRPKMTLMIFFKITLLGLLEPVIDQNLFILGMKYTTATFATALYNTLPAITFILALIF  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +R + S AK++GT  T+GG M+MTLV+G  + L WTK  S   +   G      
Sbjct  128  RLEKVKIRNIRSAAKVVGTLTTVGGTMMMTLVKGPALDLFWTKGPSAQNTT--GTDIHSS  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F ILQAITLK+YPA LSL + +C MG ++G+V+ LV+E+GN A 
Sbjct  186  IKGAILVTIGCFSYACFMILQAITLKTYPAELSLATWICLMGTVEGAVVALVIEKGNPAA  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WD  LL   YSG++CS + YYI GVVMK +GPVFVTAF PL M +VAI  S I AE
Sbjct  246  WAIGWDNKLLTVTYSGIMCSALGYYIGGVVMKTRGPVFVTAFKPLCMXVVAIKSSIIFAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+ LGA +I  GLYLVIW
Sbjct  306  QMYLGRALGAAIICAGLYLVIW  327



>ref|XP_006661686.1| PREDICTED: WAT1-related protein At4g08290-like [Oryza brachyantha]
Length=364

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 201/262 (77%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF+KIM LGLLEPV+DQN +Y G K T+A+F++AL N+LPA+TF+ A IL
Sbjct  64   RKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++++++  SQAKI+GT VT+GGAM+M L +G VI  PWTK A+++ + ++G +    
Sbjct  124  RMERISIKERRSQAKIVGTLVTVGGAMLMILFKGPVINFPWTKNANYNVADNSGQNSGHW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI   C CW++F+ILQ+ TL++YPA LSLT+L+C MG  Q   + LV+ER   A 
Sbjct  184  LMGIFMILLSCFCWSAFFILQSYTLRNYPAELSLTTLICAMGVAQSGAIALVMERDMKA-  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D  L   +YSG++CSGVAYY+ G+V+K++GPVFVTAF+PL MIIV I+GSFIL+E
Sbjct  243  WLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILSE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA +IVVGLY +IW
Sbjct  303  VVTLGRVIGAIIIVVGLYALIW  324



>ref|XP_003537193.1| PREDICTED: WAT1-related protein At2g37460-like isoform 1 [Glycine 
max]
Length=379

 Score =   307 bits (786),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 197/262 (75%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMTFS+F KI +L  +EPVIDQNLY+ GMKYTTATF   + N+LPAITFI A IL
Sbjct  64   KKVRPKMTFSIFMKIAVLSWIEPVIDQNLYFLGMKYTTATFAVTITNMLPAITFIFACIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++ +R + SQAK++GT  T+ GAM+MTL++G V+   +    S+D S   G S +  
Sbjct  124  RLEKIKIRSIRSQAKVVGTLTTVSGAMVMTLLKGPVL---FGSHGSNDHSQHNGTSMRHT  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  +I  GC CWA F ILQA TLK+YPA LSL++ +C MG L+G+ + +++ERGN ++
Sbjct  181  ITGFILITIGCFCWACFVILQATTLKTYPAELSLSAWICLMGTLEGAAVAMIMERGNPSV  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++  D  LL  +YSG++CSG++YY+ GVVMK +GPVFVTAF+PL M+IVA+M  FILAE
Sbjct  241  WSLKLDMKLLCAVYSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+V+GA +I +GLY V+W
Sbjct  301  QVFLGRVIGAVIICLGLYAVVW  322



>ref|XP_008233580.1| PREDICTED: WAT1-related protein At2g39510-like [Prunus mume]
Length=378

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 208/299 (70%), Gaps = 9/299 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S+  K MLL L +PV+DQNLYY    Y+TATFT+A+ N+LPAI F +AWI 
Sbjct  65   RKLRPKMTSSILVKTMLLSLFDPVLDQNLYYMATSYSTATFTSAMFNILPAIAFFMAWIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGNSQQD  357
            RLE VN+RKLHSQAK+LGT +T+GGA+I+TL +G  + LPWTK +  H     + ++ +D
Sbjct  125  RLETVNIRKLHSQAKVLGTIITVGGAIILTLAKGAALNLPWTKGKNQHHHQMQSDSNHKD  184

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVE-RGNA  534
              K A + AA C CW+SF ILQA TL+SYP  LSL +L C  G ++G++L LVVE R + 
Sbjct  185  ITKSALLSAAACFCWSSFIILQAFTLRSYPCKLSLATLTCFWGLVEGAILALVVEWRNSN  244

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            A W++H D  LLA  Y G++ SGVAYYI G+V K+KGPVF +AFNPL  +I+AI+GS +L
Sbjct  245  ADWSIHLDIRLLAAFYGGIL-SGVAYYIIGMVNKEKGPVFFSAFNPLGTVIIAILGSLVL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQ  891
             E    G ++G+ VIVVG+YLV+WG +KD++          P D+      P TT Q+Q
Sbjct  304  DEHTYLGSLIGSIVIVVGVYLVLWGKTKDEAPSQLSKTQSQPNDE------PITTSQQQ  356



>ref|XP_009344114.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=363

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 198/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MT  +F +I+LLG LEPV+DQNLY+ GMKYT+ATF +A+ NVLPAITFI+A   
Sbjct  67   RKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALCF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+KLHS AK++GT +T+GGAMIMTL +G ++ +      SH+ S +  +S+Q  
Sbjct  127  RLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGHSQSHNSSTTE-SSEQHW  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   C  WASF+ILQ+ TLK YPA LSLT+ +C MG L+G V+T  VER   ++
Sbjct  186  IAGPLMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSGV+CSG+AYY+ GVV++++GPVFVTAF+PL MII A +G+ +LAE
Sbjct  245  WVIGWDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIIPAALGAIVLAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G ++GA  IV GLY V+W
Sbjct  305  QVHLGSIIGAICIVFGLYTVVW  326



>ref|XP_009390255.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT  +F KIM LGLLEPV+DQN YY G KYT+A+F++AL N+LPA+TF+ A++L
Sbjct  64   RKVRPKMTLPIFLKIMALGLLEPVLDQNFYYMGTKYTSASFSSALYNILPAVTFLNAFVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+++++K HSQAKI+GT VT+ GA+IM L +G ++   W K   H Q+ +A  +    
Sbjct  124  RMEKIDIKKRHSQAKIIGTLVTVIGALIMILYKGPIVEFIWNK-GRHLQAEAAAQNDTHW  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   CCCW++F++LQ+ TLKSYPA LSLT+L+C  G  Q   + L +ERG A  
Sbjct  183  LLGTLMLLFSCCCWSAFFVLQSHTLKSYPAELSLTTLICLTGTGQAGAVALFMERG-AKP  241

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D  L   +YSG++C+GVAYY+ GVVMK++GPVFVTAFNPL MIIVA+MGS ILAE
Sbjct  242  WSIGFDMRLFTAVYSGIMCTGVAYYLQGVVMKERGPVFVTAFNPLCMIIVAVMGSIILAE  301

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+V+GA VIV+GLY +IW
Sbjct  302  EISLGRVIGAVVIVIGLYCLIW  323



>gb|KDO40045.1| hypothetical protein CISIN_1g019311mg [Citrus sinensis]
Length=343

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT ++  K++LLGLLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWI+
Sbjct  39   KKIRPKMTLAILTKLLLLGLLEPVIDQNLYFIGMKYTTATFAAAMYNILPAITFLMAWII  98

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN++ + S AK++GT  T+ GAM+MTL++G ++ L WTK A +    S+G +  + 
Sbjct  99   RLENVNLKSIRSLAKVIGTLATVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNS  158

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC  W+ F ILQAITLK+YPA LSLT+ +C  G ++G++  L++ERG A+I
Sbjct  159  IKGALMITAGCFSWSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASI  218

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+HWDT L+A +YSG+ICSG+ YYI G+VMKD+GPVFV AF+PL M+IVAIM + ILAE
Sbjct  219  WAIHWDTKLVASVYSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAE  278

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+++GA +I+ GLYLV+W
Sbjct  279  QMYLGRIIGAIIIIGGLYLVVW  300



>ref|XP_006436052.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
 ref|XP_006486061.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49292.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
Length=383

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 201/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT  +F KI L+ L EPVI QNLYYTGMKYTTATFT A+ N+LPA+TF++AWI 
Sbjct  68   RKTRPKMTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIF  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQ-SASAGNSQQ  354
            RLE+V ++  HSQAKILGT VT GGAM MTL +G ++  PW +    H+Q   S  N+++
Sbjct  128  RLEKVKIKSTHSQAKILGTIVTAGGAMCMTLFKGPILKFPWKQVRLLHNQLETSIQNNEE  187

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D  KGA +IAAGC  W+ F ILQA  LKSYPA LSLT+L+C M +++G++LTL +ERGN 
Sbjct  188  DLTKGALLIAAGCFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGNT  247

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             IW +H+D  LLA IY G + S  AY+I G +MK +GPVFV++FNPL M+I+A++GSF L
Sbjct  248  GIWLLHFDAKLLAVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFFL  306

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE+L  G+++GA +IV+GLY+V+W
Sbjct  307  AEKLYLGRIIGAVIIVIGLYMVLW  330



>ref|NP_001064323.1| Os10g0210500 [Oryza sativa Japonica Group]
 gb|ABB47053.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABB47054.2| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26237.1| Os10g0210500 [Oryza sativa Japonica Group]
 dbj|BAG90481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50726.1| hypothetical protein OsJ_31032 [Oryza sativa Japonica Group]
Length=364

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 198/262 (76%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF+KIM LGLLEPV+DQN +Y G K T+A+F++AL N+LPA+TF+ A IL
Sbjct  64   RKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++++++  SQAKI GT +T+GGAM+M L +G VI  PWTK A+H+ S S+ ++    
Sbjct  124  RMERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDHNNGHW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI   C CW++F+ILQ+ TL+ YPA LSLT+L+C MG  Q   + LV+ER   A 
Sbjct  184  LMGIFMILLSCFCWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMERDIKA-  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D  L   +YSG++CSGVAYY+ G+V+K++GPVFVTAF+PL MIIV I+GSFIL E
Sbjct  243  WLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA +IVVGLY +IW
Sbjct  303  VVTLGRVIGAIIIVVGLYALIW  324



>gb|KDP32785.1| hypothetical protein JCGZ_12077 [Jatropha curcas]
Length=375

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 198/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F +I +LG LEPV+DQNLYY GMK T+ATF +A  NVLPAITFILA I 
Sbjct  71   RKIRPKMTLPIFLRITVLGFLEPVLDQNLYYVGMKSTSATFASASVNVLPAITFILAIIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEA--SHDQSASAGNSQQ  354
            RLE+VN++++H  AKI+GT VT+ GAM+MTL +G ++    +  A   H  + S   + Q
Sbjct  131  RLEKVNIKRVHDIAKIMGTCVTVAGAMVMTLYKGPILNFLTSHGAGSHHGSTTSTEPNDQ  190

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              V G  M+ A CC WASF+ILQ+ TLK YPA LSLT+L+C MGA+QG+ ++LV+ER  +
Sbjct  191  HWVTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALICLMGAVQGAAVSLVMERDMS  250

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            A W + +D+  LA  YSG++CSGVAYY+ G+V+K++GPVFVT+F+PL MII A +G+ IL
Sbjct  251  A-WKIGFDSRFLAAAYSGIVCSGVAYYVQGMVIKERGPVFVTSFSPLCMIITAALGTIIL  309

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AEQL  G ++GA +IV+GLY V+W
Sbjct  310  AEQLRLGSIIGAILIVIGLYTVVW  333



>ref|XP_006429015.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
 ref|XP_006480748.1| PREDICTED: WAT1-related protein At2g37460-like [Citrus sinensis]
 gb|ESR42255.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
Length=370

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 209/262 (80%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT ++  K++LLGLLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWI+
Sbjct  66   KKIRPKMTLAILTKLLLLGLLEPVIDQNLYFIGMKYTTATFAAAMYNILPAITFLMAWII  125

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN++ + S AK++GT  T+ GAM+MTL++G ++ L WTK A +    S+G +  + 
Sbjct  126  RLENVNLKSIRSLAKVIGTLATVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNS  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI AGC  W+ F ILQAITLK+YPA LSLT+ +C  G ++G++  L++ERG A+I
Sbjct  186  IKGALMITAGCFSWSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASI  245

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+HWDT L+A +YSG+ICSG+ YYI G+VMKD+GPVFV AF+PL M+IVAIM + ILAE
Sbjct  246  WAIHWDTKLVASVYSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAE  305

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+++GA +I+ GLYLV+W
Sbjct  306  QMYLGRIIGAIIIIGGLYLVVW  327



>ref|XP_011019905.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Populus 
euphratica]
Length=313

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/242 (59%), Positives = 187/242 (77%), Gaps = 0/242 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F K++ L LLEPVIDQNLY+ GMKYTTATF  A+ NVLPAITFI+AWI+
Sbjct  61   KKLRPKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIV  120

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +  LHSQAK+ GT  T+ GAM+MTL++G +I     K  ++ ++ ++G      
Sbjct  121  RLEKVKIGSLHSQAKVAGTIATVAGAMLMTLMKGPLIEFFRIKGRAYHENGTSGIDLHSS  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA MI  GC  WA F ILQAITLKSYP  LSLT+ +C +G ++G+V+ LV E+G  ++
Sbjct  181  IKGALMITVGCFSWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSV  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA++WD  LLA +YSGV CSG+AYYI G+VMKD+GPVFVTAF+PL M+IVA+M S ILA+
Sbjct  241  WAINWDMKLLAAVYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIILAQ  300

Query  721  QL  726
            Q+
Sbjct  301  QM  302



>gb|EEC66707.1| hypothetical protein OsI_33030 [Oryza sativa Indica Group]
Length=364

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 198/262 (76%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF+KIM LGLLEPV+DQN +Y G K T+A+F++AL N+LPA+TF+ A IL
Sbjct  64   RKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++++++  SQAKI GT +T+GGAM+M L +G VI  PWTK A+ + S S+ ++    
Sbjct  124  RMERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKNANQNISDSSDHNNGRW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI   C CW++F+ILQ+ TL+SYPA LSLT+L+C MG  Q   + LV+ER   A 
Sbjct  184  LMGIFMILLSCFCWSAFFILQSYTLRSYPAELSLTTLICAMGVAQSGAVALVMERDIKA-  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D  L   +YSG++CSGVAYY+ G+V+K++GPVFVTAF+PL MIIV I+GSFIL E
Sbjct  243  WLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+V+GA +IVVGLY +IW
Sbjct  303  VVTLGRVIGAIIIVVGLYALIW  324



>ref|XP_002302243.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE81516.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=383

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 196/262 (75%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  +F +IM LG LEPV+DQNLYY GMKYT+ATF +A  N LPAITFI+A I 
Sbjct  71   RKIRPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALPAITFIMALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN +KLHS AK++GT +T+ GAM+MTL +G +I    ++ A+H  + S  +  Q  
Sbjct  131  RLETVNFKKLHSAAKVVGTVITVTGAMVMTLYKGPIIDFIRSQGAAHRGTTSNASGNQHW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+ A CC WASF+ILQ+ TLK YPA LSLT+L+C  G ++G+ ++LV+ER  +A 
Sbjct  191  LTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALICMTGMVEGAAVSLVMERDMSA-  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D+ LLA  YSGV+CSG+AYY+ GVV++ KGPVFVT+F+PL MII A +GS +L+E
Sbjct  250  WKIGFDSRLLAAAYSGVVCSGIAYYVQGVVIRKKGPVFVTSFSPLCMIITAALGSVVLSE  309

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G ++GA +IV GLY V+W
Sbjct  310  QIRLGSIIGAVLIVFGLYTVVW  331



>gb|KDO67719.1| hypothetical protein CISIN_1g042257mg [Citrus sinensis]
Length=383

 Score =   304 bits (779),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 202/264 (77%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT  +F KI L+ L EPVI QNLYYTGMKYTTATFT A+ N+LPA+TF++AWI 
Sbjct  68   RKTRPKMTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIF  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASA-GNSQQ  354
            RLE+V ++  HSQAKILGT VT GGAM MTL++G ++  PW +    H+Q  +   N+++
Sbjct  128  RLEKVKIKSTHSQAKILGTIVTAGGAMCMTLLKGPILKFPWKQVRLLHNQLETGIQNNEE  187

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D  KGA +IAAGC  W+ F ILQA  LKSYPA LSLT+L+C M +++G++LTL +ERGN 
Sbjct  188  DLTKGALLIAAGCFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGNT  247

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             IW +H+D  LLA IY G + S  AY+I G +MK +GPVFV++FNPL M+I+A++GSF L
Sbjct  248  GIWLLHFDAKLLAVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFFL  306

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE+L  G+++GA +IV+GLY+V+W
Sbjct  307  AEKLYLGRIIGAVIIVIGLYMVLW  330



>ref|XP_009340894.1| PREDICTED: WAT1-related protein At1g21890-like [Pyrus x bretschneideri]
Length=363

 Score =   303 bits (777),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 198/262 (76%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MT  +F +I+LLG LEPV+DQNLY+ GMKYT+ATF +A+ NVLPAITFI+A   
Sbjct  67   RKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALCF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
             LE VNV+KLHS AK++GT +T+GGAMIMTL +G ++ +      SH+ S++ G+ +Q  
Sbjct  127  GLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGHSHSHN-SSTTGSGEQHW  185

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   C  WASF+ILQ+ TLK YPA LSLT+ +C MG L+G V+T  VER   ++
Sbjct  186  IAGPLMLIGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSGV+CSG+AYY+ GVV++++GPVFVTAF+PL MII A +G+ +LAE
Sbjct  245  WVIGWDSRLLASVYSGVVCSGIAYYVQGVVIRERGPVFVTAFSPLCMIITAGLGAIVLAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G ++GA  IV GLY V+W
Sbjct  305  QVHLGSIIGAICIVFGLYTVVW  326



>ref|XP_004290852.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=368

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 202/262 (77%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MT  +F +IMLLG LEPV+DQNLY+ GMKYT+ATF +A+ NVLPAITFILA   
Sbjct  72   RKIRPRMTLPIFLRIMLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFILALCF  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+KLHS AK++GT VT+ GAMIMTL +G +I +     ++  QS+S  +S Q  
Sbjct  132  RLETVNVKKLHSLAKVIGTVVTLSGAMIMTLYKGPIIDI-VRGHSNSAQSSSTESSDQHW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+ A C  WASF+ILQ+ TLK YPA LSLT+ +C MG L+G V+TLV+ER N ++
Sbjct  191  IAGPLMLIASCGGWASFFILQSFTLKKYPAQLSLTAWICVMGVLEGGVVTLVMER-NMSV  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSGVICSG+AYY+ GVV +++GPVFVT+F+PL MII A++G+ +LAE
Sbjct  250  WVIGWDSRLLASVYSGVICSGLAYYVQGVVNRERGPVFVTSFSPLCMIITAVLGAIVLAE  309

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G +LGA +IV GLY V+W
Sbjct  310  QVHLGSILGAILIVFGLYTVVW  331



>ref|XP_006289117.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
 gb|EOA22015.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
Length=388

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 201/265 (76%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSVFWKIM LG LEPV+DQ   Y GM  T+AT+T+A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT + +GGA++MTL +G +I LPW+  + + Q+    NS QD 
Sbjct  125  RMEKVNLAEIRSKAKIIGTLIGLGGALVMTLYKGPLIPLPWSNPSMNQQNGHT-NSSQDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL+SL+C  GA+Q   + LVVER +
Sbjct  184  NNWVVGTLLILVGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGAVQSFGVALVVER-H  242

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            A+ WAV WD  L A +Y+G++ SG+ YY+ G+VMK +GPVFVTAFNPL M++VA++ SFI
Sbjct  243  ASGWAVGWDARLYAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ FG V+G  VI  GLY+V+W
Sbjct  303  LHEQIHFGCVIGGVVIAAGLYMVVW  327



>gb|KHN05928.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 196/262 (75%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KI +L  +EPVIDQNLY+ GMKYTTATF   + N+LPAITFI A IL
Sbjct  64   KKVRPKMTLSIFMKIAVLSWIEPVIDQNLYFLGMKYTTATFAVTITNMLPAITFIFACIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++ +R + SQAK++GT  T+ GAM+MTL++G V+   +    S+D S   G S +  
Sbjct  124  RLEKIKIRSIRSQAKVVGTLTTVSGAMVMTLLKGPVL---FGSHGSNDHSQHNGTSMRHT  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  +I  GC CWA F ILQA TLK+YPA LSL++ +C MG ++G+ + +++ERGN ++
Sbjct  181  ITGFILITIGCFCWACFVILQATTLKTYPAELSLSAWICLMGTIEGAAVAMIMERGNPSV  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++  D  LL  +YSG++CSG++YY+ GVVMK +GPVFVTAF+PL M+IVA+M  FILAE
Sbjct  241  WSLKLDMKLLCAVYSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+V+GA +I +GLY V+W
Sbjct  301  QVFLGRVIGAVIICLGLYAVVW  322



>gb|AFK43964.1| unknown [Medicago truncatula]
Length=291

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 193/257 (75%), Gaps = 4/257 (2%)
 Frame = +1

Query  19   MTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVN  198
            MT S+F KI+LL LLEPVIDQNLY+ GMKYTTATF  A+ N+LPAITFILA I+RLE++ 
Sbjct  1    MTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIVRLEKIK  60

Query  199  VRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQS-ASAGNSQQDPVKGAA  375
            ++ + SQAK+LG   T+ GAM+MTL++G ++   +     H QS  S+G S    + G+ 
Sbjct  61   IKSMRSQAKVLGIIATVSGAMVMTLMKGPIL---FETFGDHSQSYHSSGTSAHHTILGSV  117

Query  376  MIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHW  555
            +I  GC  WA F ILQAITL++YPA LSL+S +C  GA++G+ L LV+ER N ++W++ W
Sbjct  118  LITIGCFSWACFVILQAITLETYPAALSLSSWICLFGAIEGAALALVMERNNPSVWSIKW  177

Query  556  DTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFG  735
            D  LL+ IY+G+ CSG+ YY+ GVVMK +GPVFVT FNP  M+IVAIMG F+LAEQ+  G
Sbjct  178  DMRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPFCMVIVAIMGYFLLAEQMFLG  237

Query  736  KVLGACVIVVGLYLVIW  786
            +V+GA +I +GLYLV+W
Sbjct  238  RVIGAFIICLGLYLVVW  254



>emb|CDY29141.1| BnaA09g53940D [Brassica napus]
Length=383

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 201/265 (76%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVFWKI+LLG LEP++DQ   Y GM  T+AT+T+A+ NVLP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ SQAKI+GT V +GGA++MTL +G +I L W+   + +Q     NS QD 
Sbjct  125  RMEKVNIAEVRSQAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNT-NQHNEHSNSSQDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL++L+C  GA+Q +V+ LVVER +
Sbjct  184  NHWVGGTLLILLGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVERHS  243

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
               WAV WD  LLA +Y+G++ SG+ YY+ G+VM+ +GPVFVTAFNPL MI+VA++ SFI
Sbjct  244  RG-WAVGWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ +G V+G  VI +GLYLV+W
Sbjct  303  LHEQIHYGCVIGGTVIAMGLYLVVW  327



>ref|XP_010097389.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB67895.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=357

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 160/295 (54%), Positives = 216/295 (73%), Gaps = 6/295 (2%)
 Frame = +1

Query  58   LLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGT  237
            L +PVIDQNLY+ GMKYTTATF  A+ N+LPAITF++A IL LE+V ++ + SQAK++GT
Sbjct  65   LDKPVIDQNLYFMGMKYTTATFAAAMTNILPAITFVMACILGLEKVKIKSIRSQAKVVGT  124

Query  238  SVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYI  417
            + T+ GAM+MT+++G ++ L WT+    D++ S G S    +KG+ MI  GC  WA F I
Sbjct  125  TATVAGAMVMTVMKGPILDLFWTRGTRVDEARSGGISLSHSIKGSLMITVGCFSWACFMI  184

Query  418  LQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVIC  597
            LQAITLK+YPA LSLT+ +C +G L+G+ + LV+ERGNA++W++ WDT L+A +YSGV+C
Sbjct  185  LQAITLKTYPAELSLTAWICLLGTLEGTAVALVMERGNASVWSLKWDTKLMAALYSGVVC  244

Query  598  SGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYL  777
            SG+AYYI GV+M+D+GPVFVTAF PL M+IVAIMGS  LAEQL  G+V+GA +I+VGLYL
Sbjct  245  SGLAYYIQGVIMRDRGPVFVTAFCPLCMVIVAIMGSLFLAEQLYLGRVIGATIIIVGLYL  304

Query  778  VIWgsskddsskssgddLDAPVDQQLPVIR-PATTHQE---QHSATPIEVPGEES  930
            V+W   K    KSS   LD P+ Q+   I  P + HQ      SA+ IE+   +S
Sbjct  305  VVW--GKSKDYKSSTTSLDEPISQESKHISDPDSNHQVVTINPSASAIELQINKS  357



>ref|XP_009151422.1| PREDICTED: WAT1-related protein At4g08290 [Brassica rapa]
Length=383

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 201/265 (76%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVFWKI+LLG LEP++DQ   Y GM  T+AT+T+A+ NVLP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ SQAKI+GT V +GGA++MTL +G +I L W+   + +Q     NS QD 
Sbjct  125  RMEKVNIAEVRSQAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNT-NQHNEHSNSSQDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I  GC  W+ FY+LQ+IT+++YPA LSL++L+C  GA+Q +V+ LVVER +
Sbjct  184  NHWVGGTLLILLGCVAWSCFYVLQSITIRTYPADLSLSALICLSGAVQSTVVALVVERHS  243

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
               WAV WD  LLA +Y+G++ SG+ YY+ G+VM+ +GPVFVTAFNPL MI+VA++ SFI
Sbjct  244  RG-WAVGWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ +G V+G  VI +GLYLV+W
Sbjct  303  LHEQIHYGCVIGGTVIAMGLYLVVW  327



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 197/265 (74%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  +F +IM LG LEPV+DQNLYY GMK T+ATF +A  N+LPAITFI+A   
Sbjct  68   RKIRPKLTLPIFLRIMALGFLEPVLDQNLYYVGMKSTSATFASATVNILPAITFIMALAF  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQ---  351
            RLE+VNV+K+ S +K++GT+VT+GGAM+MTL +G ++    +    H  +   G  Q   
Sbjct  128  RLEKVNVKKIQSLSKVIGTAVTVGGAMVMTLYKGPIVDFMRSGGTGHPHAGGDGPHQSTN  187

Query  352  QDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
            Q  V G  M+ A CC W+ F+ILQ+ TLK YPA LSLT+L+C MG+++G+ +TLV+ER N
Sbjct  188  QHWVTGTLMLLASCCGWSGFFILQSFTLKKYPAELSLTALICLMGSVEGAAVTLVMER-N  246

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
              +W + WD+ LLA +YSGV+CSG+AYY+ GVV+K++GPVF+T+F+PL MII A +G+ +
Sbjct  247  MNVWRIGWDSRLLAAVYSGVVCSGIAYYVQGVVIKERGPVFITSFSPLCMIITAALGAIV  306

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            LAE +  G ++GA  IV GLY+V+W
Sbjct  307  LAETIHLGSIIGAIFIVCGLYIVVW  331



>ref|XP_002872388.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48647.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 198/265 (75%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVFWKIM LG LEPV+DQ   Y GM  T+AT+T+A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT V +GGA++MTL +G +I LPW+   + DQ     NS +D 
Sbjct  125  RMEKVNIAEIRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNP-TMDQQNGHTNSSEDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL++L+C  GA+Q   + LVVER +
Sbjct  184  NNWVVGTLLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHS  243

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            +  WAV WD  L A +Y+G++ SG+ YY+ G+VMK +GPVFVTAFNPL MI+VA++ SFI
Sbjct  244  SG-WAVGWDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ FG V+G  VI  GLY+V+W
Sbjct  303  LHEQIHFGCVIGGAVIAAGLYMVVW  327



>emb|CDX75163.1| BnaC09g25190D [Brassica napus]
Length=384

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 201/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVF KI+LLG LEP++DQ   Y GM  T+AT+T+A+ NVLP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVFLKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ SQAKI+GT V +GGA++MTL +G +I LPW+   ++  +  + +SQ   
Sbjct  125  RMEKVNIAEVRSQAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNTNQHNGHSNSSQDHN  184

Query  361  --VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL++L+C  GA+Q +V+ LVVER + 
Sbjct  185  HWVGGTLLILLGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVERHSR  244

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
              WAV WD  LLA +Y+G++ SG+ YY+ G+VM+ +GPVFVTAFNPL MI+VA++ SFIL
Sbjct  245  G-WAVGWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFIL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
             EQ+ +G V+G  VI +GLYLV+W
Sbjct  304  HEQIHYGCVIGGTVIAMGLYLVVW  327



>ref|XP_007223359.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
 gb|EMJ24558.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
Length=367

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 196/262 (75%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MT  +F +I+LLG LEPV+DQNLY+ GMKYT+ATF +A+ NVLPAITFI+A   
Sbjct  72   RKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMAVFF  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+KLHS AK++GT +T+GGAM+MTL +G ++ +      SH  S +  ++ Q  
Sbjct  132  RLESVNVKKLHSLAKVVGTVITVGGAMVMTLYKGPIVDIIRGHAHSHGTS-TTDSTNQHW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ A C  WASF+I+Q+ TLK YPA LSLT+ +C MG L+G V+T  VER   ++
Sbjct  191  VAGPLMLLASCGGWASFFIVQSFTLKKYPAELSLTAWICIMGVLEGGVITFAVER-KMSV  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSG++CSG+AYY+ GVV +++GPVFVTAF+PL MII A +G+ +LAE
Sbjct  250  WVIGWDSRLLASVYSGIVCSGLAYYVQGVVSRERGPVFVTAFSPLCMIITAALGAIVLAE  309

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G ++GA  IV GLY V+W
Sbjct  310  KVHLGSIIGAIFIVFGLYTVVW  331



>ref|XP_002306626.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
 gb|EEE93622.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
Length=387

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 195/263 (74%), Gaps = 4/263 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T S+F +IM+LG LEPV+DQNLYY GMKYT+ATF++A  N LPAITF++A   
Sbjct  71   RKIRPKLTLSIFLRIMVLGFLEPVLDQNLYYLGMKYTSATFSSATTNALPAITFLMALCF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHD-QSASAGNSQQD  357
            RLE VN +KLHS AK +GT +T+ GAM+MTL +G VI    +  A+H   S  +GN  Q 
Sbjct  131  RLETVNFKKLHSAAKAIGTVITVTGAMVMTLYKGPVIDFIRSHGAAHHGTSNESGN--QH  188

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             + G  M+   CC WA F+ILQ+ TLK YPA LSLT+L+C MG ++G+ ++LV+ER   A
Sbjct  189  RLTGTLMLLGSCCAWAGFFILQSFTLKKYPAELSLTALICVMGVVEGAAVSLVMERDMGA  248

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W + +D+ LLA  YSGV+CSG+AYY+ GVV++++GPVFVT+F+PL MI  A +GS +LA
Sbjct  249  -WKIGFDSRLLAAAYSGVVCSGIAYYVQGVVIRERGPVFVTSFSPLCMITTAALGSLVLA  307

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQ+  G ++GA +IV GLY V+W
Sbjct  308  EQIHLGSIIGAVLIVWGLYTVVW  330



>emb|CDY18443.1| BnaA04g21440D [Brassica napus]
Length=374

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 187/262 (71%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +  RPKMT  +F+KI LLGL EPVIDQNL+  GMKYTTATF TAL N LPA+TFILA I+
Sbjct  67   KAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFILALIV  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +R + S +K++GT  ++GG MIMTLV+G  + L WTK  S   +   G      
Sbjct  127  RLEKVKLRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTKGPSAQNTT--GTDIHSS  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F+IL AITLK+YP  LSLT+ +C MG L+G+ + LV+ERGN   
Sbjct  185  IKGAVLVTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WD  LL   YSG++CS + YYI G+VMK +GPVFVTAF+PL MI+VA M S I AE
Sbjct  245  WAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+ LGA VI  GLYLVIW
Sbjct  305  QMYLGRALGAAVICAGLYLVIW  326



>ref|NP_192569.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9SUF1.1|WTR31_ARATH RecName: Full=WAT1-related protein At4g08290 [Arabidopsis thaliana]
 emb|CAB45799.1| nodulin-like protein [Arabidopsis thaliana]
 emb|CAB77954.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE82622.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=384

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 194/264 (73%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SV WKIM LG LEPV+DQ   Y GM  T+AT+T+A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT V +GGA++MTL +G +I LPW+      Q+    NSQ   
Sbjct  125  RMEKVNIAEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQQNGHTNNSQDHN  184

Query  361  --VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL++L+C  GA+Q   + LVVER  +
Sbjct  185  NWVVGTLLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPS  244

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
              WAV WD  L A +Y+G++ SG+ YY+ G+VMK +GPVFVTAFNPL MI+VA++ SFIL
Sbjct  245  G-WAVGWDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFIL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
             EQ+ FG V+G  VI  GLY+V+W
Sbjct  304  HEQIHFGCVIGGAVIAAGLYMVVW  327



>dbj|BAC43205.1| putative nodulin [Arabidopsis thaliana]
 gb|AAO63397.1| At4g08290 [Arabidopsis thaliana]
Length=384

 Score =   300 bits (767),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 194/264 (73%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SV WKIM LG LEPV+DQ   Y GM  T+AT+T+A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT V +GGA++MTL +G +I LPW+      Q+    NSQ   
Sbjct  125  RMEKVNIAEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQQNGHTNNSQDHN  184

Query  361  --VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL++L+C  GA+Q   + LVVER  +
Sbjct  185  NWVVGTLLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPS  244

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
              WAV WD  L A +Y+G++ SG+ YY+ G+VMK +GPVFVTAFNPL MI+VA++ SFIL
Sbjct  245  G-WAVGWDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFIL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
             EQ+ FG V+G  VI  GLY+V+W
Sbjct  304  HEQIHFGCVIGGAVIAAGLYMVVW  327



>gb|AAM65570.1| nodulin-like protein [Arabidopsis thaliana]
Length=377

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 196/265 (74%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SV WKIM LG LEPV+DQ   Y GM  T+AT+T+A+ N+LP++TFI+AWIL
Sbjct  58   RKVRPKMTLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWIL  117

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT V +GGA++MTL +G +I LPW+   + DQ     NS QD 
Sbjct  118  RMEKVNIAEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNP-NMDQQNGHTNSSQDH  176

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL++L+C  GA+Q   + LVVER  
Sbjct  177  NNWVVGTLLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHP  236

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            +  WAV WD  L A +Y+G++ SG+ YY+ G+VMK +GPVFVTAFNPL MI+VA++ SFI
Sbjct  237  SG-WAVGWDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFI  295

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ FG V+G  VI  GLY+V+W
Sbjct  296  LHEQIHFGCVIGGAVIAAGLYMVVW  320



>ref|XP_006397315.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
 gb|ESQ38768.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
Length=382

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 197/265 (74%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVFWKI+LLG LEP++DQ   Y GM  T+AT+T+A+ NVLP++TFI+AWIL
Sbjct  65   RKVRPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+V + +  SQAKI+GT V +GGA++MTL +G +I LPW+   + DQ     NS QD 
Sbjct  125  RMEKVKIVEARSQAKIIGTLVALGGALVMTLYKGPLIPLPWSNP-NMDQHNEHSNSSQDN  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I   C  W+ FY+LQ+IT+K+YPA LSL +L+C  GA+Q + + LVVER +
Sbjct  184  NHWVAGTLLILLACVAWSCFYVLQSITIKTYPADLSLAALICLSGAIQSTAVALVVERHS  243

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            +  WAV WD  L A +Y+G++ SG+ YY+ G+VM+ +GPVFVTAFNPL MI+VA++ SFI
Sbjct  244  SG-WAVGWDARLFAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ +G V+G  VI +GLYLV+W
Sbjct  303  LHEQIHYGCVIGGTVIAMGLYLVVW  327



>emb|CDX91104.1| BnaC02g04930D [Brassica napus]
Length=379

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 199/265 (75%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R  RP++TF + ++I +L L EPV++QNLYY+GMK TTATFT+AL N LPAITFI+A I 
Sbjct  60   RNSRPRLTFKILFQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWT-KEASHDQSASAGNS--Q  351
            +LE+VN+++ HSQAK++GT V IGGAM+MT V+G VI LPWT K  S++  +   N+  Q
Sbjct  120  KLEKVNIKRRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQSHVMNTPKQ  179

Query  352  QDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
            +D  KG+ M+ A C  W+ + ILQA  L SY A LSLT+L+C MG L+ +V+ L++ER N
Sbjct  180  EDTGKGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNN  239

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             + W +H D  LLA IY G++ SG++YYI+G   K++GPVFV+AFNPLSM+IVAI+ SFI
Sbjct  240  MSAWKIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFI  298

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
              E++  G+V G+ VIV+G+YLV+W
Sbjct  299  FLEKMYIGRVDGSVVIVIGIYLVLW  323



>ref|XP_009141664.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Brassica 
rapa]
Length=374

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 187/262 (71%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +  RPKMT  +F+KI LLGL EPVIDQNL+  GMKYTTATF TAL N LPA+TF+LA I+
Sbjct  67   KAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFVLALIV  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +R + S +K++GT  ++GG MIMTLV+G  + L WTK  S   +   G      
Sbjct  127  RLEKVKLRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTKGPSAQNTT--GTDIHSS  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F+IL AITLK+YP  LSLT+ +C MG L+G+ + LV+ERGN   
Sbjct  185  IKGAILVTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WD  LL   YSG++CS + YYI G+VMK +GPVFVTAF+PL MI+VA M S I AE
Sbjct  245  WAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+ LGA VI  GLYLVIW
Sbjct  305  QMYLGRALGAAVICAGLYLVIW  326



>gb|KGN54575.1| hypothetical protein Csa_4G365050 [Cucumis sativus]
Length=374

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 220/303 (73%), Gaps = 7/303 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F +++LLG LEPV+DQNLYY G+K T+ATFT+   N+LPA+TFI+A I 
Sbjct  71   RKIRPKMTLGIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILPAVTFIMALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGL--PWTKEASHDQSASAGNSQQ  354
            RLE VN +K+ S AK+ GT VTIGGAM+MTL +G ++ +     + A+H+ S+S  ++ Q
Sbjct  131  RLESVNFKKIRSIAKVAGTLVTIGGAMVMTLYKGPIVDIFHGHGRHAAHNSSSSE-SADQ  189

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              V G  M+      W+ F+ILQ+ TL+ YPA LSLT+L+C  GA++GS++TL++ER + 
Sbjct  190  HWVLGTLMLLGSIVGWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIVTLIMER-DF  248

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             +W + WD+ LLA +Y+GVICSG+AYYI GVV++++GPVFVT+F PL MII AI+GS +L
Sbjct  249  TVWVIGWDSRLLAAVYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMIITAILGSIVL  308

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVI-RPATTHQEQ  891
            AEQ+  G ++GA  IV+GLYLV+WG +KD  +K +    +A  +  LP+   P TT  E+
Sbjct  309  AEQIHLGSIIGAIFIVMGLYLVVWGKAKDHINKLTNQKSNAATE--LPITNEPETTAAER  366

Query  892  HSA  900
             S+
Sbjct  367  CSS  369



>ref|XP_004494995.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=314

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 187/247 (76%), Gaps = 4/247 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KI+ L LLEPVIDQNLY+ GMK+TTATF  ++ N+LPAITFILA IL
Sbjct  71   KKVRPKMTISIFIKIVALSLLEPVIDQNLYFLGMKFTTATFAASMSNILPAITFILASIL  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVI-GLPWTKEASHDQSASAGNSQQD  357
            R+E++ +R + +QAK++GT  T+ GAM+MTL++G V+ G   +   +H  S   G S Q 
Sbjct  131  RIEKIKIRSIRTQAKVVGTIATVSGAMVMTLIKGPVLFGTFGSDSQNHHNS---GISTQH  187

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             + GA MI  GC  WA F ILQAITL++YPA LSL+S +C +G L+G+ + LVVERGN +
Sbjct  188  TIIGAVMITLGCFSWACFIILQAITLETYPAALSLSSWICLLGTLEGAAVALVVERGNYS  247

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W++ WD  LL+ IY+G+ CSG+ YY+ GVVMK +GPVFVT FNPL M+IVAIMG FILA
Sbjct  248  VWSIKWDVRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVAIMGYFILA  307

Query  718  EQLDFGK  738
            EQ+  G+
Sbjct  308  EQMFLGR  314



>ref|XP_009388785.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 195/262 (74%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT ++F KIM L  LEPV+DQN YY G K T+A+F++AL NVLPA+TF+ A IL
Sbjct  64   RKTRPKMTLAIFLKIMALAFLEPVLDQNFYYMGAKNTSASFSSALFNVLPAVTFVNAVIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+++++K  SQAK++GT VT+ GA++M L  G +I   WTK  SH  +  +G ++   
Sbjct  124  RMEKIDIKKRRSQAKVVGTLVTVIGALLMILYTGPIIEFVWTKGRSH-HAGDSGQNESHW  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   C CW++F+ILQ+ TLKSYPA LSL++L+C MGA QG  L LV+ER     
Sbjct  183  LIGTFMLLFSCFCWSAFFILQSHTLKSYPAELSLSTLICLMGAGQGGALALVMERSTKP-  241

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +DT L   +YSG++CSGVAYY+ G+VMK++GPVFVTAFNPL MII AIMGS ILAE
Sbjct  242  WLIGFDTRLFTAVYSGIMCSGVAYYVQGIVMKERGPVFVTAFNPLCMIITAIMGSIILAE  301

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+VLGA +IV+GLY +IW
Sbjct  302  EITLGRVLGAVIIVIGLYSLIW  323



>emb|CDX93377.1| BnaC04g45190D [Brassica napus]
Length=374

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 186/262 (71%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +  RPKMT  +F+KI LLGL EPVIDQNL+  GMKYTTATF TAL N LPA+TFILA I+
Sbjct  67   KAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFILALIV  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V +R + S +K++GT  ++GG MIMTLV+G  + L WTK  S   +   G      
Sbjct  127  RLEKVKLRSMRSASKVIGTMASVGGTMIMTLVKGPALDLFWTKGPSAQNTT--GTDIHSS  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA ++  GC  +A F+IL AITLK YP  LSLT+ +C MG L+G+ + LV+ERGN   
Sbjct  185  IKGAVLVTIGCFSYACFFILYAITLKIYPTELSLTAWICLMGTLEGAAVALVMERGNPGA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ WD  LL   YSG++CS + YYI G+VMK +GPVFVTAF+PL MI+VA M S I AE
Sbjct  245  WAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+ LGA VI  GLYLVIW
Sbjct  305  QMYLGRALGAAVICAGLYLVIW  326



>ref|XP_010421738.1| PREDICTED: WAT1-related protein At4g08290 [Camelina sativa]
Length=386

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 196/265 (74%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSVFWKIM LG LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT + +GGA++MTL +G +I LPW+   S DQ     NS QD 
Sbjct  125  RMEKVNIAEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNP-SMDQQNGHTNSSQDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  ++  GC  W+ FY+LQ+IT+K+YPA LSL+SL+C  GA+Q   + LVVER +
Sbjct  184  SHWVVGTLLLLIGCVAWSGFYVLQSITIKTYPANLSLSSLICLAGAVQSFAVALVVER-H  242

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             + WAV WD  L   +Y+G++ SG+ YY+ G+VM  +GPVFVTAFNPL M++VA++ SFI
Sbjct  243  PSGWAVGWDARLYGPLYTGIVSSGITYYVQGMVMNTRGPVFVTAFNPLCMVLVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ FG V+G  VI  GLY+V+W
Sbjct  303  LHEQIHFGCVIGGVVIAAGLYMVVW  327



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 198/262 (76%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT S+F+KI+ LGLLEPV+DQN  Y G+  T+A+F++AL N+LPA+TF+ A IL
Sbjct  64   RKTRPKMTLSIFFKILALGLLEPVLDQNFIYMGVNNTSASFSSALTNILPAVTFVNAIIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++N+++  SQAKI GT++T+GGA++M L +G ++  PWTK+ SH  S S  ++    
Sbjct  124  RMERINIKERRSQAKIAGTAITVGGALLMILFKGPIVNFPWTKDVSHAVSDSGAHNGGHW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI   C CW++F+ILQ+ TL+SYP+ LSLT+L+C +GA +   + LV+ER +   
Sbjct  184  LMGTFMILLSCFCWSAFFILQSYTLRSYPSELSLTTLICALGATESGAVALVMER-DTKT  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D  L   IYSG++CSGVAYY+ G+V+K++GPVFVTAF+PL MIIV ++GS IL+E
Sbjct  243  WSIGFDMRLFTAIYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTLLGSIILSE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+++GA VIV GLY +IW
Sbjct  303  VVTLGRLIGATVIVFGLYALIW  324



>ref|XP_011027560.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=391

 Score =   297 bits (760),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 191/262 (73%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  +F +IM LG LEPV+DQNLYY GMKYT+ATF +A  N LPAITFI+A I 
Sbjct  71   RKIRPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALPAITFIMALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN +KLHS AK++GT +T+ GAM MTL +G +I    +  A+H  + S  +  Q  
Sbjct  131  RLETVNFKKLHSAAKVVGTVITVTGAMAMTLYKGPIIDFIRSHGAAHRGTTSNASGNQHW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   CC WA F+ILQ+ TLK YPA LSLT+L+C  G ++G+ ++LV+ER   A 
Sbjct  191  LTGTLMLLGSCCGWAGFFILQSFTLKKYPAELSLTALICMTGMVEGAAVSLVMERDMNA-  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D+ LLA  YSGV+CSG+AYY+ GVV++ KGPVFVT+F+PL MII A +GS +L+E
Sbjct  250  WKLGFDSRLLAAAYSGVVCSGIAYYVQGVVIRKKGPVFVTSFSPLCMIITAALGSIVLSE  309

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G ++GA +IV GLY V+W
Sbjct  310  QIHLGSIIGAILIVFGLYTVVW  331



>gb|AGZ85011.1| hypothetical protein 6 [Cicer arietinum]
Length=393

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 206/311 (66%), Gaps = 3/311 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F +I+ LG LEPV+DQNLY  GMK T+ TF +A  NVLPAITFI+A   
Sbjct  71   RKIRPKMTLPIFLRIVALGFLEPVLDQNLYNMGMKMTSTTFASATVNVLPAITFIMALTF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN--SQQ  354
            RLE VN RK HS AK++GT +T+ GAM+MTL +G    +     A +  S +A    S Q
Sbjct  131  RLESVNWRKFHSVAKVIGTVITVSGAMVMTLYKGPAFQIIKGGGAVNHHSGAANTEPSDQ  190

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            + V G  M+ + CC WA F+ILQ+ TLK YPA LSLT+ +C MG ++GS+ +L+ ER + 
Sbjct  191  NWVMGTVMLISSCCSWAGFFILQSFTLKKYPAELSLTAWICLMGIIEGSIASLIFER-DM  249

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            ++W + WD+ LLA +YSGVICSG+AYY+ GVV +++GPVFVT+F+PL MII A +GS +L
Sbjct  250  SVWVIGWDSRLLACVYSGVICSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSLVL  309

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQH  894
            AE +  G V GA +IV+GLY V+WG SKD    +      +    QLP+     +  E  
Sbjct  310  AELVHLGSVFGAILIVIGLYTVVWGKSKDRRDNTIDTGKLSEGQDQLPIKDATKSDSENF  369

Query  895  SATPIEVPGEE  927
                I VP E+
Sbjct  370  DGIEINVPAEK  380



>gb|KDO40046.1| hypothetical protein CISIN_1g019311mg [Citrus sinensis]
Length=299

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 191/241 (79%), Gaps = 0/241 (0%)
 Frame = +1

Query  64   EPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGTSV  243
            EPVIDQNLY+ GMKYTTATF  A+ N+LPAITF++AWI+RLE VN++ + S AK++GT  
Sbjct  16   EPVIDQNLYFIGMKYTTATFAAAMYNILPAITFLMAWIIRLENVNLKSIRSLAKVIGTLA  75

Query  244  TIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYILQ  423
            T+ GAM+MTL++G ++ L WTK A +    S+G +  + +KGA MI AGC  W+ F ILQ
Sbjct  76   TVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNSIKGALMITAGCFSWSFFIILQ  135

Query  424  AITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVICSG  603
            AITLK+YPA LSLT+ +C  G ++G++  L++ERG A+IWA+HWDT L+A +YSG+ICSG
Sbjct  136  AITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASIWAIHWDTKLVASVYSGIICSG  195

Query  604  VAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYLVI  783
            + YYI G+VMKD+GPVFV AF+PL M+IVAIM + ILAEQ+  G+++GA +I+ GLYLV+
Sbjct  196  LTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAEQMYLGRIIGAIIIIGGLYLVV  255

Query  784  W  786
            W
Sbjct  256  W  256



>ref|XP_008461651.1| PREDICTED: WAT1-related protein At2g39510-like isoform X3 [Cucumis 
melo]
Length=357

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 204/295 (69%), Gaps = 9/295 (3%)
 Frame = +1

Query  64   EPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGTSV  243
             PVIDQNL+YTGMKYTTATF  A+ NVLPA  F++AW  RLE+VN+ K  SQAKILGT V
Sbjct  65   RPVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLMAWACRLEKVNIMKRGSQAKILGTIV  124

Query  244  TIGGAMIMTLVRGGVIGLPWTKEASHDQSASAG-----NSQQDPVKGAAMIAAGCCCWAS  408
            T+GGAMIMT ++G ++ LPW+K  +H  ++S+         Q+ + G  M+  GC CWA+
Sbjct  125  TVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSAASTDHQNQIIGFLMLTTGCICWAA  184

Query  409  FYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSG  588
            F  LQAITLK YPA LSLT+L+C +G + GS + LV+ERGN + WA+H+D  LLA +YSG
Sbjct  185  FITLQAITLKEYPAELSLTALICLVGTIGGSGVALVIERGNPSAWALHFDRQLLAVVYSG  244

Query  589  VICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVG  768
            VICSGV YYI GVVM+ KGPVF +AFNPL+M++VAIM  FIL+E +  G+++G  +I+ G
Sbjct  245  VICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAIMSFFILSEIMFLGRMIGVVIIICG  304

Query  769  LYLVIWgsskddsskssgddLD-APVDQQLPVIRPATTHQEQHSATPIEVPGEES  930
            LY+V+WG ++D       +     P +QQ+   +  TT Q       ++V  EE 
Sbjct  305  LYMVLWGKTRDQPPVLKSECDKITPCEQQM---KTTTTVQSSQDFLALDVAKEEK  356



>gb|KCW65508.1| hypothetical protein EUGRSUZ_G02912 [Eucalyptus grandis]
Length=369

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 176/228 (77%), Gaps = 2/228 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF KI+LLGLLEPVIDQNL+YTGMKYTTA+FT A+ N+LPA TF++AW  
Sbjct  69   RKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPAFTFLMAWFF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++++R  HSQAKILGT VTIGGAMIMTL +G V+ LPWTK  S           Q P
Sbjct  129  RLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTS--AHVDLDGVAQKP  186

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            ++GA MI AGC CWASF ILQAITLKSYPA L+LT+L+C  G  QG+V    +ER N A 
Sbjct  187  IEGALMITAGCFCWASFIILQAITLKSYPAELTLTTLICMTGTFQGAVFAFAMERSNFAA  246

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMI  684
            W++ +D  LLA +YSG+ICSGV YYI GVVM+ KGPVF+TAFNPL M+
Sbjct  247  WSIQFDVRLLAVVYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMV  294



>gb|EMS57240.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=343

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 184/266 (69%), Gaps = 4/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT ++F K+M L  LEPV+DQNLY+ G K T+A F TAL N+LPA+TF+LA IL
Sbjct  27   RGLRPKMTITIFIKVMGLAFLEPVMDQNLYFMGAKLTSAGFATALVNILPAVTFVLALIL  86

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASH----DQSASAGNS  348
            R+E+V +R LHSQAKI GT +T+ GA++M L  G ++  PWTK   H     Q   +   
Sbjct  87   RMEKVRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGVGSAAD  146

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D + G  M+   C  WA F+ILQ+ TLKSYPA LSLT L+CGMG+L    + LV ER 
Sbjct  147  ARDWLNGTIMVIIACVAWACFFILQSNTLKSYPAELSLTVLICGMGSLMSGAIALVAERA  206

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N   W + +D  L   +Y+G++CSGVAYY+ G+V   +GPVFVTAFNPL MII A+MGS 
Sbjct  207  NTQAWVIGFDMRLFTAVYAGIVCSGVAYYVQGIVSSQRGPVFVTAFNPLCMIITAVMGSI  266

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            IL E+++ G V+GA +IV GLY +IW
Sbjct  267  ILKEEINLGSVIGAAIIVGGLYFLIW  292



>gb|EYU22954.1| hypothetical protein MIMGU_mgv1a0088041mg [Erythranthe guttata]
Length=362

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 197/265 (74%), Gaps = 7/265 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT SVF+KIM+L  LEPV+DQNLYY GM+YT+ATF +A  NVLPAITFI+A I 
Sbjct  49   KKIRPKMTKSVFFKIMVLAFLEPVLDQNLYYVGMQYTSATFASATVNVLPAITFIMAVIF  108

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N++K+HS AK++GT +T+ GAM+MTL +G V+ + W         A++  + Q  
Sbjct  109  RLEKINLKKIHSLAKVIGTLITVTGAMLMTLYKGPVVDILWYSHGGSHHKAASAATDQHW  168

Query  361  VKGAAMIAAGCCC---WASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
            V G  M+    CC   W++F+ILQ  TL+ YPA LSLTSL+C MG ++G +  +++ER  
Sbjct  169  VTGTIML---LCCIVGWSAFFILQNKTLEEYPAELSLTSLICIMGMVEGGIAAVIMERRK  225

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            +A W + +D+ LLA  YSG++CSG+AYY+  VV K +GPVFVTAF+PLSMII A++G+ I
Sbjct  226  SA-WVIGFDSRLLAAAYSGIVCSGIAYYMQSVVNKSRGPVFVTAFSPLSMIITAVLGAII  284

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L+EQ+  G ++GA +IVVGLY V+W
Sbjct  285  LSEQVHLGSLIGAAIIVVGLYSVVW  309



>ref|XP_006399861.1| hypothetical protein EUTSA_v10013837mg [Eutrema salsugineum]
 gb|ESQ41314.1| hypothetical protein EUTSA_v10013837mg [Eutrema salsugineum]
Length=377

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 197/265 (74%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R  RPKMTF + ++I +L L EPV++QNLYY+GMK TTATFT+AL N LPA+TFI+A I 
Sbjct  60   RNSRPKMTFKILFRISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEAS--HDQSASAGNSQQ  354
            +LE+VN+++ HSQAK++GT V +GGAM+MT V+G  I LPWT ++     QS +    +Q
Sbjct  120  KLEKVNIKRRHSQAKLVGTMVAVGGAMLMTFVKGNAIDLPWTSKSRGFTGQSHAMNTPKQ  179

Query  355  DPV-KGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
            D + +G+ M+ A C  W+ F ILQA  L  Y A LSLT+L+C MG L+ +V+ L++ER +
Sbjct  180  DDIGRGSVMLVASCLSWSCFIILQANILSLYQAELSLTALMCFMGMLEATVMALILERED  239

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             ++W +H D  LLA IY G++ SG+AYY+ G   K++GPVFV+AFNPLSM++VAI+ SFI
Sbjct  240  MSVWKIHPDMRLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSSFI  298

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
              E++  G+VLG+ VIV+G+Y+V+W
Sbjct  299  FLEKMYLGRVLGSVVIVIGIYMVLW  323



>ref|NP_001137108.1| hypothetical protein [Zea mays]
 gb|ACF83274.1| unknown [Zea mays]
 tpg|DAA46823.1| TPA: hypothetical protein ZEAMMB73_893748 [Zea mays]
Length=364

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 196/262 (75%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKM+  VF KI+ LGLLEPV+DQN  Y G+  T+A+F++AL N+LPA+TF+ A IL
Sbjct  64   RKTRPKMSLPVFIKILALGLLEPVLDQNFIYMGVNSTSASFSSALTNILPALTFVNAIIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++ +++  SQAKI GT++T+ GA++M L +G +I  PW+K ASH  S S  ++    
Sbjct  124  RMERIVIKERRSQAKIAGTAITVCGALLMILFKGPIINFPWSKHASHAVSDSGVHNSGHW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI   C CW++F+ILQ+ TL+SYP+ LSLT+L+C MGA +   + LV+ER   A 
Sbjct  184  LMGTFMILLSCFCWSAFFILQSYTLRSYPSELSLTTLICAMGATESGAVALVMERDTKA-  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++ +D  L   IYSG++CSGVAYY+ G+V+KD+GPVFVTAF+PL MI+V ++GSFIL+E
Sbjct  243  WSIGFDMRLFTAIYSGIMCSGVAYYVQGIVIKDRGPVFVTAFSPLCMILVTVLGSFILSE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G+++GA VIVVGLY +IW
Sbjct  303  VVTLGRLIGATVIVVGLYALIW  324



>ref|XP_002454615.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
 gb|EES07591.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
Length=385

 Score =   294 bits (753),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 185/262 (71%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RP+MT  +F KIM L LLEPV+DQNLY+ G   T+A F +AL N+LPA+TF++A +L
Sbjct  64   RKSRPRMTIKIFLKIMGLTLLEPVLDQNLYFMGANLTSAGFASALINILPAVTFVMALVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+V +R +HSQAKI+GT +T+ GA++M L  G V+  PW+K   HD  A    S    
Sbjct  124  RMEKVRLRSVHSQAKIVGTVLTVAGAVLMILYHGPVVQFPWSKGHHHDAGAQGAASSGSF  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G   I   C CW++F++LQA TLKSYPA LSLT+L+C MG+L    + LV ER N   
Sbjct  184  LTGIITIIVACVCWSAFFVLQANTLKSYPAELSLTTLICLMGSLMSGSVALVAERNNTQA  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +DT L    Y+G++CSGVAYY+ G+V + +GPVFVTAFNPL MII AIMGS IL E
Sbjct  244  WVIGFDTRLFTCAYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G V+GA +IV+GLY +IW
Sbjct  304  EITRGSVIGAAIIVLGLYALIW  325



>gb|EYU28757.1| hypothetical protein MIMGU_mgv1a023410mg, partial [Erythranthe 
guttata]
Length=302

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 183/246 (74%), Gaps = 3/246 (1%)
 Frame = +1

Query  1    RKI-RPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWI  177
            +KI RPKMT  +F+KIML  L  PVI QNLY+ GMKYT+ATF  ++ NVLPA+TF++A +
Sbjct  59   KKIQRPKMTLVIFFKIMLTSLFGPVISQNLYFLGMKYTSATFIASMTNVLPAVTFVIACL  118

Query  178  LRLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQD  357
            LR E+V +   HSQAKI+GT V+IGGAMIMTLVRG  + LPWT+    D     G    +
Sbjct  119  LRHEKVKMTSTHSQAKIIGTLVSIGGAMIMTLVRGPNLDLPWTRGNHQDHKN--GEDFNN  176

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KGA MIA     WA F I  AITL++YPA LSLT+ +C +G ++G+ L L++ERGN+A
Sbjct  177  SIKGALMIAIASFAWAGFMISHAITLQTYPAALSLTAWICMLGTVEGAALALIMERGNSA  236

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W++ WDT LL  +YSG+ CSG+ YY+ G+V+K++GPVFVTAF+PLSM++VA+M SFIL 
Sbjct  237  VWSIKWDTKLLGAVYSGIFCSGITYYVQGIVLKERGPVFVTAFSPLSMVLVAVMSSFILR  296

Query  718  EQLDFG  735
            EQ+  G
Sbjct  297  EQMYLG  302



>ref|XP_011023643.1| PREDICTED: WAT1-related protein At5g13670-like [Populus euphratica]
Length=375

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 195/263 (74%), Gaps = 3/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R  RPKMTF +F KI LL   EPV+DQNL+Y GMK TT  F  A+ N+LPA+TF++A I 
Sbjct  67   RNSRPKMTFWMFAKITLLSFFEPVLDQNLFYAGMKITTPAFVLAMCNILPAMTFVMACIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEA-SHDQSASAGNSQQD  357
            +LE+V++R+LH QAK+ GT VTIGGAM++    G ++ LPWTK      QSA + +  QD
Sbjct  127  KLEKVDMRRLHFQAKVAGTLVTIGGAMLLPFAHGPLLHLPWTKRNFCRGQSAQSAHI-QD  185

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             +KGA M+  GC  W+SF ILQA+ LKSYPA LSL + +C MG ++ ++LT  VER N A
Sbjct  186  LIKGAVMVVFGCLSWSSFIILQAMILKSYPAKLSLAAFMCIMGTVESTILTFAVERANTA  245

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W+V++D  LLA +Y G++ SG+AYYI G+++K++GPVF++A NPLS+++VAI+GSFI  
Sbjct  246  VWSVYFDVRLLAAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFIFK  304

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E+   G+ +GA VI++GLYLV+W
Sbjct  305  EKFYLGRAIGAIVIILGLYLVLW  327



>gb|KFK32145.1| hypothetical protein AALP_AA6G204100 [Arabis alpina]
Length=383

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 190/262 (73%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVFWKIMLLG LEP++DQ   Y GM  T+AT+T+A+ NVLP++TF++AWIL
Sbjct  65   RKVRPKMTLSVFWKIMLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFVIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+V + ++ SQAKI GT V + GA++MTL +G +I LPW+     + +  +       
Sbjct  125  RMERVTIVEVRSQAKIAGTLVALAGALVMTLYKGPLIPLPWSNPDQLNGNTKSSQDHNHW  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  +I   C  W+ FY+LQ+IT+K YPA LSL +L+C  GA+Q + + LV+ER ++  
Sbjct  185  VAGTLLILLACVAWSCFYVLQSITIKKYPADLSLAALICLSGAVQSTAVALVMERHSSG-  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WAV WD  L A +Y+GV+ SG+ YY+ G+VMK +GPVFVTAFNPL MI+VA++ SFIL E
Sbjct  244  WAVGWDARLFAPLYTGVVSSGLTYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+ FG V+G  VI  GLY+V+W
Sbjct  304  QIHFGCVIGGAVIAAGLYMVVW  325



>ref|XP_003601053.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES71304.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=394

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 208/311 (67%), Gaps = 4/311 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT  +F +I+ LG LEPV+DQNLY  GMK T+ TF +A  NVLPAITFI+A   
Sbjct  73   RKTRPKMTLPIFLRIVALGFLEPVLDQNLYNMGMKMTSTTFASATVNVLPAITFIMALTF  132

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEA-SHDQSASAGN-SQQ  354
            RLE VN RK HS AK++GT VT+ GAM+MTL +G    +     A +H  SA+    S+Q
Sbjct  133  RLESVNWRKFHSVAKVIGTVVTVSGAMVMTLYKGPAYQIIKGGGAINHHASATTDQPSEQ  192

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            + + G  M+ + CC WA F+ILQ+ TLK YPA LSLT+ +C MG ++GS+ +L+ ER + 
Sbjct  193  NWLMGTVMLISSCCSWAGFFILQSFTLKKYPAELSLTAWICLMGIIEGSIASLIFER-DM  251

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            ++W + WD+ LLA +YSGVICSG+AYY+ GVV +++GPVFVT+F+PL MII A +GS +L
Sbjct  252  SVWVIGWDSRLLACVYSGVICSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSLVL  311

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQH  894
            AEQ+  G + GA +IV+GLY V+WG SKD    +         D QLP+     +  E  
Sbjct  312  AEQVHLGSIFGAIIIVIGLYTVVWGKSKDRRESADEIGKGESKD-QLPIKNGTKSGSEIF  370

Query  895  SATPIEVPGEE  927
                I VP E+
Sbjct  371  DGIEINVPAEK  381



>gb|KDP22890.1| hypothetical protein JCGZ_01964 [Jatropha curcas]
Length=354

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 200/266 (75%), Gaps = 6/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPK+TF +  +I +LGLL PVIDQN YY G+K+T+ TF+ A+ N+LPA+TF++A + 
Sbjct  39   RKVRPKITFPILLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLC  98

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSAS----AGNS  348
            R+E+V+++K+  QAK++GT VT+GGAM+MTL +G VI L W+ E  H  ++S     G+ 
Sbjct  99   RMEKVDIKKVRCQAKVIGTVVTVGGAMLMTLYKGHVINLIWS-EHVHTHTSSLPDTTGSD  157

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D +KG+ ++      WASF+ILQA+TLK Y A LSLTSL+C MG LQ  V+T+V+E  
Sbjct  158  DKDWLKGSILLILATLAWASFFILQAVTLKRYSAQLSLTSLVCFMGTLQSIVVTIVMEH-  216

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
             A+ WA+ WD  LLA  Y+G++ S +AYY+ G+VM+ +GPVFVTAF+PL MI+VAIMGSF
Sbjct  217  KASAWAIGWDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMIVVAIMGSF  276

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            ILAE++  G VLG  +IV GLYLV+W
Sbjct  277  ILAEKIYLGGVLGGVLIVAGLYLVLW  302



>ref|XP_006486497.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
Length=341

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 197/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMTF +F KI LLGL EPVI QNLY+TG+K +TATFT A+ N+LPA+TF++AWI 
Sbjct  69   RKTRPKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQ-SASAGNSQQ  354
            RLE+V  + + SQAKILGT VT GGAM MTL++G ++  PW +    H+Q      N ++
Sbjct  129  RLEKVKTKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQLETGTHNKEE  188

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
               KGA MIAA C  W+ F ILQA  LKSYPA LSLT+L+C + +++G++L L +E+GN 
Sbjct  189  HMTKGALMIAAACFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILALAIEQGNT  248

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             IW +H+D  LL+ +Y G + S  AY+I G +MK KGPVFV++FNPLSM+I+AI+GSF +
Sbjct  249  GIWLLHFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFI  307

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE+L  G+++G  VIV+GLY+V+W
Sbjct  308  AEELFLGRIVGGIVIVIGLYMVLW  331



>ref|XP_002312070.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
 gb|EEE89437.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
Length=368

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 195/262 (74%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R  RPKMT+ +F KI LL   EPV+DQNL+Y GMK TT TF  A+ N+LPA+TF++A I 
Sbjct  65   RNSRPKMTWWMFAKIALLSFFEPVLDQNLFYAGMKITTPTFVLAMCNILPAMTFVMACIF  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            +LE+V++R+LH QAK++GT VTIGGAM++ L  G +I LPWTK       ++     QD 
Sbjct  125  KLEKVDMRRLHFQAKVVGTLVTIGGAMLLPLAHGPLINLPWTKRNFCRGQSAHSVHIQDL  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KGA M+  GC  W+SF ILQA+ L+SYPA LSL +L+C MG ++ ++L   VER N A+
Sbjct  185  IKGAVMVIFGCLSWSSFIILQAMILESYPAKLSLAALMCIMGTVESTILAFAVERANTAV  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W+V++D  LLA +Y G++ SG+AYYI G+++K++GPVF++A NPLS+++VAI+GSFI  E
Sbjct  245  WSVYFDIRLLAAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFIFKE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            +   G+ +GA VIV+GLYLV+W
Sbjct  304  KFYLGRAIGAIVIVLGLYLVLW  325



>ref|XP_008802062.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=373

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 191/262 (73%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT S F KIM LGLLEPV+DQNLYY G K T A+F++AL NVLPA+TF+ A +L
Sbjct  64   RKVRPKMTVSNFLKIMALGLLEPVLDQNLYYMGAKNTNASFSSALYNVLPAVTFLSAIVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E++NV+K  SQAKI+GT VT+ GA++M L +G V+   WTK  SH  + +        
Sbjct  124  RMEKINVKKRRSQAKIIGTLVTVVGALLMILYKGPVVEFIWTKGRSHHNNTAGSQDDSHW  183

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   C  W++F+ILQ+ TLKSYPA LSLT  +C MGA Q   + LV+ER +   
Sbjct  184  LAGVFMLLGSCFSWSAFFILQSNTLKSYPAELSLTVWICFMGAAQSGAVALVMER-SVKP  242

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D  LL   YSGV+CSG+AYY+ G VMK++GPVFVTAFNPL MIIVA++GS ILAE
Sbjct  243  WLIGFDMRLLTAAYSGVMCSGIAYYVQGKVMKERGPVFVTAFNPLCMIIVAVLGSIILAE  302

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+++GA +IV+GLY +IW
Sbjct  303  EITLGRLIGAIIIVIGLYSLIW  324



>ref|XP_006436051.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
 gb|ESR49291.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
Length=339

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 197/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMTF +F KI LLGL EPVI QNLY+TG+K +TATFT A+ N+LPA+TF++AWI 
Sbjct  68   RKTRPKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIF  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQ-SASAGNSQQ  354
            RLE+V  + + SQAKILGT VT GGAM MTL++G ++  PW +    H+Q      N ++
Sbjct  128  RLEKVKTKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQLETGTHNKEE  187

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
               KGA MIAA C  W+ F ILQA  LKSYPA LSLT+L+C + +++G++L L +E+GN 
Sbjct  188  HMTKGALMIAAACFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILALAIEQGNT  247

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             IW +H+D  LL+ +Y G + S  AY+I G +MK KGPVFV++FNPLSM+I+AI+GSF +
Sbjct  248  GIWLLHFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFI  306

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE+L  G+++G  VIV+GLY+V+W
Sbjct  307  AEELFLGRIVGGIVIVIGLYMVLW  330



>ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-like [Citrus sinensis]
 gb|KDO80699.1| hypothetical protein CISIN_1g016580mg [Citrus sinensis]
Length=387

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 201/287 (70%), Gaps = 2/287 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  VF +IM LG LEPV+DQNLYY GMKYTTATF +A  N+LPA+TFILA I 
Sbjct  71   RKIRPKLTLPVFLRIMALGFLEPVLDQNLYYLGMKYTTATFASATVNILPAVTFILAIIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNVR+L S AK++GT+VT+ GAM+MTL +G +I        SH  S S  +S    
Sbjct  131  RLETVNVRRLQSLAKVIGTAVTVAGAMVMTLYKGPIINFTSGGAGSHHGS-SVDSSDSHF  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
              G  M+   C  WA F+ILQ+ TLK YPA LSL++L+C MG ++G+ ++L++ER  +A 
Sbjct  190  FTGTLMLIGSCFGWAGFFILQSFTLKKYPAELSLSTLICLMGVVEGAAVSLIMERDMSA-  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D+ LLA  YSGV+CSG+AYY+ G V K KGPVFVT+F+PL MII + +G  ILAE
Sbjct  249  WKIGFDSRLLAAAYSGVVCSGIAYYVQGFVSKQKGPVFVTSFSPLCMIITSALGVIILAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPV  861
             +  G +LGA +IV GLY V+WG SKD  S ++    +    Q+LP+
Sbjct  309  LVHLGSILGAILIVFGLYTVVWGKSKDPPSSAASFTDEKAAAQELPI  355



>ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
 gb|ESR47405.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
Length=387

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 201/287 (70%), Gaps = 2/287 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  VF +IM LG LEPV+DQNLYY GMKYTTATF +A  N+LPA+TFILA I 
Sbjct  71   RKIRPKLTLPVFLRIMALGFLEPVLDQNLYYLGMKYTTATFASATVNILPAVTFILAIIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNVR+L S AK++GT+VT+ GAM+MTL +G +I        SH  S S  +S    
Sbjct  131  RLETVNVRRLQSLAKVIGTAVTVAGAMVMTLYKGPIINFTSGGAGSHHGS-SVDSSDSHF  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
              G  M+   C  WA F+ILQ+ TLK YPA LSL++L+C MG ++G+ ++L++ER  +A 
Sbjct  190  FTGTLMLIGSCFGWAGFFILQSFTLKKYPAELSLSTLICLMGVVEGAAVSLIMERDMSA-  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D+ LLA  YSGV+CSG+AYY+ G V K KGPVFVT+F+PL MII + +G  ILAE
Sbjct  249  WKIGFDSRLLAAAYSGVVCSGIAYYVQGFVSKQKGPVFVTSFSPLCMIITSALGVIILAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPV  861
             +  G +LGA +IV GLY V+WG SKD  S ++    +    Q+LP+
Sbjct  309  LVHLGSILGAILIVFGLYTVVWGKSKDPPSSAASFTDEKAAAQELPI  355



>ref|XP_010999364.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=387

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 192/263 (73%), Gaps = 4/263 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT S+F +IM+LG LEPV+DQNLYY GMKYT+ATF++A  N LPAITF++A   
Sbjct  71   RKIRPKMTLSIFLRIMVLGFLEPVLDQNLYYLGMKYTSATFSSATTNALPAITFLMALCF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHD-QSASAGNSQQD  357
            RLE VN +KLHS AK +GT +T+ GAM+MTL +G +I    +  A+H   S  +GN  Q 
Sbjct  131  RLETVNFKKLHSAAKAIGTVITVTGAMVMTLYKGPIIDFIRSHGAAHHGTSNESGN--QH  188

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             + G  M+   CC WA F+ILQ+ TLK YPA LSLT+L+C MG ++G+ ++LV+ER   A
Sbjct  189  RLTGTLMLLGSCCAWAGFFILQSFTLKKYPAELSLTALICVMGVVEGAAVSLVMERDMDA  248

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             W + +D+ LLA  YSGV+CSG+AYY+ G V +++G VFVT+F+PL MI  A +GS +LA
Sbjct  249  -WKIGFDSRLLAAAYSGVVCSGIAYYVQGEVKRERGLVFVTSFSPLCMITTAALGSIVLA  307

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQ+  G ++GA +IV GLY V+W
Sbjct  308  EQIHLGSIIGAFLIVWGLYTVVW  330



>ref|XP_009141665.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Brassica 
rapa]
Length=302

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 2/256 (1%)
 Frame = +1

Query  19   MTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVN  198
            MT  +F+KI LLGL EPVIDQNL+  GMKYTTATF TAL N LPA+TF+LA I+RLE+V 
Sbjct  1    MTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFVLALIVRLEKVK  60

Query  199  VRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDPVKGAAM  378
            +R + S +K++GT  ++GG MIMTLV+G  + L WTK  S   +   G      +KGA +
Sbjct  61   LRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTKGPSAQNTT--GTDIHSSIKGAIL  118

Query  379  IAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWD  558
            +  GC  +A F+IL AITLK+YP  LSLT+ +C MG L+G+ + LV+ERGN   WA+ WD
Sbjct  119  VTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGAWAIGWD  178

Query  559  TTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGK  738
              LL   YSG++CS + YYI G+VMK +GPVFVTAF+PL MI+VA M S I AEQ+  G+
Sbjct  179  NKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAEQMYLGR  238

Query  739  VLGACVIVVGLYLVIW  786
             LGA VI  GLYLVIW
Sbjct  239  ALGAAVICAGLYLVIW  254



>ref|XP_010438422.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=386

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 195/265 (74%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTFSVFWKIM LG LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+V++ ++ S+AKI+GT + +GGA++MTL +G +I LPW+   S DQ     NS QD 
Sbjct  125  RMEKVSIAEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNP-SMDQQNGHTNSSQDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I  GC  W+ FY+LQ+IT+K+YPA LSL+SL+C  G +Q   + LVVER +
Sbjct  184  SNWVVGTLLILIGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGVVQSFAVALVVER-H  242

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             + WAV WD  L   +Y+G++ SG+ YY+ G+VMK +GPVFVTAFNPL M++VA++ SFI
Sbjct  243  PSGWAVGWDARLYGPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L E++  G V+G  +I  GLYLV+W
Sbjct  303  LHEKIHVGCVIGGVIIAAGLYLVVW  327



>ref|XP_011069552.1| PREDICTED: WAT1-related protein At1g21890-like [Sesamum indicum]
Length=384

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 213/295 (72%), Gaps = 6/295 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +KIRPKMT S+F KI++L  LEPV+DQNLYY GM+YT+ATF +A+ NVLPAITFI+A I 
Sbjct  71   KKIRPKMTKSIFLKIVVLAFLEPVLDQNLYYVGMQYTSATFASAMVNVLPAITFIMAVIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEA-SHDQSASAGNSQQD  357
            RLE +N++K+ S AK++GT +T+ GAM+MTL +G V+ + W   A SH ++A+A  + Q 
Sbjct  131  RLETINLKKISSIAKVVGTLITVTGAMLMTLYKGPVVNILWYSHAGSHHKAAAAAATDQH  190

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             V G  M+ +    W++F+ILQ  TLK YPA LSLTSL+C MG ++G ++ +++ER  +A
Sbjct  191  LVTGTIMLISCIVGWSAFFILQNKTLKEYPAELSLTSLICLMGFVEGGIVGVIMERRKSA  250

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             WA+ +D+ LLA  YSG++CSG+AYY+  +V K +GPVFVTAF+PLSMII A++G+ +LA
Sbjct  251  -WAIGFDSRLLAAAYSGIVCSGIAYYMQSIVNKSRGPVFVTAFSPLSMIITAVLGAIVLA  309

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAP-VDQQLPVIRPATT  879
            EQ+  G ++GA +IV GLY V+W         +S   +D    DQ+LPV+   T+
Sbjct  310  EQVHLGSLIGAVIIVSGLYSVVW---GKSKESASNKLVDGEGRDQELPVVDKQTS  361



>ref|XP_009398157.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 193/262 (74%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT  +F KIM +GLLEPV+DQN YY G K T+A+F++A+ NVLPA+TF+ A IL
Sbjct  64   RKTRPKMTLPIFLKIMAMGLLEPVLDQNFYYMGAKNTSASFSSAIYNVLPAMTFVNAIIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+++++K  SQAK++GT VT+ GA++M L +G  I   WTK  SH     + N Q   
Sbjct  124  RMEKIDIKKRRSQAKVVGTLVTVIGALLMILYKGPAIEFIWTKGRSHHADDGSQN-QSHW  182

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+   C CW++F+ILQ+ TLKSYPA LSL++L+C  GA Q   L LV+ER +A  
Sbjct  183  LVGTFMLLFSCFCWSAFFILQSHTLKSYPAELSLSTLICLTGAGQSGALALVMER-SAQP  241

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +DT L   +YSG++CSG+AYY+ G+VMK++GPVFVTAFNPL MII AIMGS ILAE
Sbjct  242  WLIGFDTRLFTAVYSGIMCSGIAYYVQGMVMKERGPVFVTAFNPLCMIITAIMGSIILAE  301

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G++LGA +IV+GLY +IW
Sbjct  302  DITLGRLLGAVIIVIGLYFLIW  323



>ref|XP_010091381.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB44371.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=368

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 193/262 (74%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F +IM+LG LEPV+DQNLY  GMKYT+ATF  A+ NVLPAITFI+A I 
Sbjct  55   RKIRPKMTLPIFLRIMVLGFLEPVLDQNLYNLGMKYTSATFGAAIVNVLPAITFIMALIF  114

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+K+ S AK++GT +T+ GAM+MTL +G ++ + +      +++++A  SQ   
Sbjct  115  RLETVNVKKISSLAKVIGTVITVSGAMVMTLYKGPILDI-FHNHGHSNETSTAEASQHHW  173

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+   C  W+SF+I+Q+ TLK YPA LSLT+ +C MG L+G ++T V E  +  +
Sbjct  174  VTGTLMLIGSCAGWSSFFIVQSFTLKKYPAELSLTAWICLMGVLEGGIVTFVFEH-DMHV  232

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSGVICSG+AYY+ G+V++++GPVFVT+F+PL MII   +G+ +LAE
Sbjct  233  WVLGWDSRLLAAVYSGVICSGIAYYVQGMVIRERGPVFVTSFSPLCMIITFALGAIVLAE  292

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G ++GA  IV GLY V+W
Sbjct  293  QVHLGSIVGAIFIVFGLYTVVW  314



>ref|XP_008219763.1| PREDICTED: WAT1-related protein At4g08300 [Prunus mume]
Length=367

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 196/262 (75%), Gaps = 2/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRP+MT  +F +I+LLG LEPV+DQNLY+ GMKYT+ATF +A+ NVLPAITFI+A   
Sbjct  72   RKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMAVFF  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VNV+KLHS AK++GT +T+GGAM+MTL +G ++ +          +++  ++ Q  
Sbjct  132  RLESVNVKKLHSLAKVVGTVITVGGAMVMTLYKGPIVDI-IRGHTHSHSTSTTDSTNQHW  190

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ A C  WASF+I+Q+ TLK YPA LSLT+ +C MG L+G V+TL VER   ++
Sbjct  191  VAGPLMLLASCGGWASFFIVQSFTLKKYPAELSLTAWICIMGVLEGGVITLAVER-KLSV  249

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA +YSG++CSG+AYY+ GVV +++GPVFVTAF+PL MII A +G+ +LAE
Sbjct  250  WVIGWDSRLLASVYSGIVCSGLAYYVQGVVSRERGPVFVTAFSPLCMIITAALGAIVLAE  309

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G ++GA  IV GLY V+W
Sbjct  310  RVHLGSIIGAIFIVFGLYTVVW  331



>gb|EMT04611.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 183/262 (70%), Gaps = 0/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT ++F KIM L LLEPV+DQNLYY G   T+A F TAL N+LPA+TF+LA IL
Sbjct  65   RGVRPKMTITIFIKIMGLALLEPVLDQNLYYMGANLTSAGFATALVNILPAVTFVLALIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+V +R LHSQAKI GT +T+ GA++M L  G V+  PWTK   H   A+        
Sbjct  125  RMEKVRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPVVQFPWTKGQHHAGGAATAADGAAW  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            +KG  M  A C  W+ F+ILQ+ TL+ YPA LSLT L+CG+G++  + + +V ER N   
Sbjct  185  LKGTIMTVAACVAWSCFFILQSSTLRDYPAELSLTVLICGVGSVMSTAVAVVAERANTHA  244

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +DT L   +Y G++CSGVAYY+ GVV + +GPVFVTAFNPL MI+ A+MGS IL E
Sbjct  245  WVIGFDTRLFTVVYGGIVCSGVAYYVQGVVSRQRGPVFVTAFNPLCMIVTAVMGSIILKE  304

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
             +  G V+GA +IVVGLY +IW
Sbjct  305  AITLGSVIGAVIIVVGLYFLIW  326



>gb|AFK47115.1| unknown [Medicago truncatula]
 gb|KEH40539.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=382

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 214/313 (68%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F ++ +LG LEPV+DQNLY  GMK T+ TF +A  N+LPAITFI+A I 
Sbjct  69   RKIRPKMTLPIFLRLAVLGFLEPVLDQNLYNLGMKNTSTTFASATVNILPAITFIMAIIF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN++K+HS AKI+GT VT+ GAM+MTL +G    +   + ++  +S +   ++Q+ 
Sbjct  129  RLETVNLKKIHSIAKIVGTVVTVSGAMVMTLYKGPAFQIIKGQSSNQHESGTTEPTEQNF  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ + C  WASF+ILQ+ TLK YPA LS+T+ +C +G  +G + TL+ ER + ++
Sbjct  189  VLGTIMLISSCGGWASFFILQSFTLKMYPAELSMTAWICFLGIFEGGIATLIFER-DFSV  247

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ +D+ LLA +YSG++CSG+AYY+ GVV +++GPVFVT+F+PL MII A +GS +LAE
Sbjct  248  WAIGFDSRLLACVYSGIVCSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSIVLAE  307

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVD--QQLPVIRPATTHQEQH  894
            Q   G ++GA +IV GLY V+W       SK S + +DAP    Q+LP+     T  +  
Sbjct  308  QTHLGSIIGAIIIVCGLYTVVW-----GKSKDSVNTIDAPKSEGQELPIKDGTRTGSDIF  362

Query  895  SATPIEVPGEESV  933
             +  + VP +  V
Sbjct  363  ESIEVNVPKDMKV  375



>dbj|BAK04730.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 196/263 (75%), Gaps = 2/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT SVF+KI+ L LLEPV+DQN +Y G   T+A+F++AL N+LPA+TF+ A ++
Sbjct  64   RKTRPKMTLSVFYKIVALALLEPVLDQNFFYIGAHNTSASFSSALTNILPAVTFVNAILI  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEA-SHDQSASAGNSQQD  357
            R+E++N+++  SQAKI GT +T+GGA++M L  G VI  PWTK A SH  + +A +S   
Sbjct  124  RMERINIKERRSQAKIAGTLITVGGALLMVLFSGPVINFPWTKHAGSHAVTNTASHSSGC  183

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             + G  MI   C CW++F+ILQ+ TL+SYP+ LSLT+L+C  G +Q  V+ LV+ER   A
Sbjct  184  WLLGIFMILLSCFCWSAFFILQSHTLRSYPSELSLTTLICTTGVVQSGVVALVMERDTKA  243

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
             WA+ +D  L   +YSG++CSGVAYY+ G+V++++GPVF+TAF PL MIIV ++GSFIL+
Sbjct  244  -WAIGFDMRLFTAVYSGIMCSGVAYYVQGIVIQERGPVFITAFCPLCMIIVTVLGSFILS  302

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            E +  G++ GA +IVVGLY +IW
Sbjct  303  EVITLGRITGAMIIVVGLYALIW  325



>dbj|BAJ98418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 187/266 (70%), Gaps = 4/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R +RPKMT ++F K+M L  LEPV+DQNLY+ G K T+A F TAL N+LPA+TF+LA IL
Sbjct  65   RGLRPKMTITIFIKVMGLAFLEPVMDQNLYFMGAKLTSAGFATALVNILPAVTFVLALIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQ---  351
            R+E+V +R LHSQAKI GT +T+ GA++M L  G ++  PWTK   H  ++  G      
Sbjct  125  RMEKVRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGAGGAAA  184

Query  352  -QDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D + G  M+   C  WA F+ILQ+ TL+SYPA LSLT L+CGMG+L    + LV ER 
Sbjct  185  ARDWLNGTIMVIIACVAWACFFILQSNTLRSYPAELSLTVLICGMGSLMSGAIALVAERA  244

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N   W + +DT L   +Y+G++CSGVAYY+ G+V + +GPVFVTAFNPL MII A+MGS 
Sbjct  245  NTQAWVIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSI  304

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            IL E+++ G V+GA +IV GLY +IW
Sbjct  305  ILKEEINLGSVIGAAIIVGGLYFLIW  330



>emb|CDP15800.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 193/262 (74%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  VF KI+ LGLLEPV+DQNLYY GMK T+ATF +A  NVLPA+TF++A   
Sbjct  72   RKIRPKLTLRVFLKILALGLLEPVLDQNLYYVGMKSTSATFASAFVNVLPAVTFVMAIAF  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN++K+HS AK++GT++T+ GAM+MTL +G +I + +T    H  S +A +  Q  
Sbjct  132  RLETVNLKKIHSLAKVIGTAITVSGAMVMTLYKGPIINILFTHGGGHHSSTNASSEPQHW  191

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G   + +    W+ F+ILQ++TLK YPA LSLT+L+C MG ++  ++ L+ ER N + 
Sbjct  192  VTGIITLISCIFGWSGFFILQSMTLKEYPAELSLTALVCLMGMIESGIVALIFER-NMSA  250

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D+  LA +YSGV+CSG+AYY+  VV K +GPVFVTAF+PLSM+I A++G+ +LAE
Sbjct  251  WVIGFDSRFLAAVYSGVVCSGIAYYMQSVVNKIRGPVFVTAFSPLSMVITAVLGAIVLAE  310

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q   G ++GA VIV+GLY VIW
Sbjct  311  QTHLGSLIGATVIVIGLYSVIW  332



>ref|XP_006649078.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=357

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 185/264 (70%), Gaps = 2/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R++RP+MT  +F KIM L LLEPV+DQNLYY G   T+A F +AL NVLPA+TF++A +L
Sbjct  64   RRVRPRMTLVIFLKIMGLALLEPVLDQNLYYMGANLTSAGFASALINVLPAVTFVMALVL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+V +R +HSQAKI GT  T+ GA++M L  G V+  PWTK   HD ++         
Sbjct  124  RMERVRLRSVHSQAKIAGTLFTVAGAVLMVLYHGPVVQFPWTKGQHHDGASGGAGGAAGG  183

Query  361  --VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              ++G   I   C CW+ F++LQ+ TL+SYPA LSLT+L+C MG++    + LV ER N 
Sbjct  184  GFLQGTIFIVVACVCWSGFFVLQSNTLQSYPAELSLTTLICLMGSVMSGAVALVAERHNT  243

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
              W + +DT L   +Y+G++CSGVAYY+ G+V + +GPVFVTAFNPL MII AIMGS IL
Sbjct  244  RAWLIGFDTRLFTCVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIIL  303

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
             E++  G V+GA +IVVGLY +IW
Sbjct  304  KEEIRLGSVIGAVIIVVGLYALIW  327



>ref|XP_004249118.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 198/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMTF +F++I +LGLL PVIDQN YY G+K+T+ TF+ A+ N+LPA+TF++A + 
Sbjct  72   RKLRPKMTFMMFFQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLC  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN--SQQ  354
            R+E+V+++KL  QAK++GT VT+ GAM+MTL +G VI L W+     + + S  N  S +
Sbjct  132  RMEKVHIKKLRCQAKVIGTIVTVAGAMLMTLYKGHVINLVWSNNIHTNNNVSQSNETSDK  191

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D +KG+ ++      WASF+ILQAIT+K Y A LSLT+L+C MG LQ   +TLV+E   +
Sbjct  192  DWLKGSILLIGATFAWASFFILQAITMKKYTAPLSLTTLVCFMGTLQSIAVTLVMEHKPS  251

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            A WAV +D  LLA  Y+G++ S +AYY+ G+VM+ +GPVFVTAF+PL MIIVAIMGSFIL
Sbjct  252  A-WAVGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFIL  310

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
            AE++  G VLGA +IV GLY V+W
Sbjct  311  AEKIYLGGVLGAVLIVAGLYSVLW  334



>ref|XP_010455250.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=387

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 194/265 (73%), Gaps = 5/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPKMT SVFWKIM LG LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TFI+AWIL
Sbjct  65   RKVRPKMTISVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+VN+ ++ S+AKI+GT + +GGA++MTL +G +I LPW+  ++ DQ     NS QD 
Sbjct  125  RIEKVNIVEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPST-DQQNGHTNSSQDH  183

Query  361  ---VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
               V G  +I   C  W+ FY+LQ+IT+K+YPA LSL+SL+C  GA+Q   + LV+ER  
Sbjct  184  SNWVVGTLLILICCVAWSCFYVLQSITIKTYPADLSLSSLICLAGAVQSFAVALVMERHP  243

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
            +  WAV WD  L   +Y+G++ SG+ YY+ G VMK +GPVFVTAFNPL M++VA++ SFI
Sbjct  244  SG-WAVGWDARLYGPLYTGIVSSGITYYVQGKVMKTRGPVFVTAFNPLCMVLVALLASFI  302

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
            L EQ+ FG V+G  VI  GLY+V+W
Sbjct  303  LHEQIHFGCVIGGIVIAAGLYMVVW  327



>ref|XP_010999362.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Populus 
euphratica]
Length=363

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 208/294 (71%), Gaps = 5/294 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPK+T  +F +IM LG LEP++DQ   Y GM+YT+A+FT+A+ N +P++TF++A I 
Sbjct  71   RKTRPKITLPIFLRIMALGFLEPILDQGFSYLGMQYTSASFTSAIMNAVPSVTFVIALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+V ++++ SQAK++GT VT+GGA++MT+ +G VIGLPW+++ S   S +A +S +  
Sbjct  131  RLERVRIKEIRSQAKVVGTLVTLGGALLMTVYKGPVIGLPWSQKTSQHGS-TAASSDKHW  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  ++  GC  W++FY+LQ  TLK YPA LSL SL+C  G++Q   + LVV   + + 
Sbjct  190  VTGTLLLLVGCVSWSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIALVVAH-HPSS  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WAV WDT L   +Y+G++ SGV YY+ G+VMK +GPVFVTAFNPL MIIVA +GS ILAE
Sbjct  249  WAVGWDTRLFTPLYTGIVASGVTYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGSLILAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTH  882
            +L  G VLG  +I +GLY V+WG  KD +S        A  +Q+LP+   ATT+
Sbjct  309  KLHLGSVLGGIIIAIGLYSVVWGKRKDYASPEDLSTTAAKGNQELPI---ATTN  359



>gb|AFK35679.1| unknown [Medicago truncatula]
Length=382

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 214/313 (68%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F ++ +LG LEPV+DQNLY  GMK T+ TF +A  N+LPAITFI+A I 
Sbjct  69   RKIRPKMTLPIFLRLAVLGFLEPVLDQNLYNLGMKNTSTTFASATVNILPAITFIMAIIF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E VN++K+HS AKI+GT VT+ GAM+MTL +G    +   + ++  +S +   ++Q+ 
Sbjct  129  RVETVNLKKIHSIAKIVGTVVTVSGAMVMTLYKGPAFQIIKGQSSNQHESGTTEPTEQNF  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ + C  WASF+ILQ+ TLK YPA LS+T+ +C +G  +G + TL+ ER + ++
Sbjct  189  VLGTIMLISSCGGWASFFILQSFTLKMYPAELSMTAWICFLGIFEGGIATLIFER-DFSV  247

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ +D+ LLA +YSG++CSG+AYY+ GVV +++GPVFVT+F+PL MII A +GS +LAE
Sbjct  248  WAIGFDSRLLACVYSGIVCSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSIVLAE  307

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVD--QQLPVIRPATTHQEQH  894
            Q   G ++GA +IV GLY V+W       SK S + +DAP    Q+LP+     T  +  
Sbjct  308  QTHLGSIIGAIIIVCGLYTVVW-----GKSKDSVNTIDAPKSEGQELPIKDGTRTGSDIF  362

Query  895  SATPIEVPGEESV  933
             +  + VP +  V
Sbjct  363  ESIEVNVPKDMKV  375



>ref|XP_008219662.1| PREDICTED: WAT1-related protein At1g21890-like [Prunus mume]
Length=381

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 217/312 (70%), Gaps = 4/312 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPK+T  +F +IM+LG LEPV  QNLY+ GM YT+ATF +A  N+LPAITFI A + 
Sbjct  71   RKIRPKLTLPIFLRIMVLGFLEPVFAQNLYFVGMTYTSATFASATANILPAITFIFALLF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++N +K+ S AK++GT +T+ GAM+MT  +G ++ +   +   H  + +A +++Q  
Sbjct  131  RLEKINFKKIPSVAKVIGTVITVMGAMVMTWYKGPIVEIIKGQTQGHHNT-TALSAEQHW  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  M+ A CC W+ F+ILQ+ TLK YPA LSLT+L+C MGAL+G+V T ++E  N ++
Sbjct  190  ITGTFMLLARCCGWSGFFILQSFTLKLYPAELSLTALICLMGALEGAVATFILEH-NMSV  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ L+A  YSGV+CSG+AYY+ G+VMK++GPVFVTAF+PL+MII A + + ILAE
Sbjct  249  WVIGWDSRLIAAGYSGVVCSGIAYYVQGIVMKEQGPVFVTAFSPLAMIITAALAAVILAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHSA  900
            Q+  G +LG  +IV+GLY V+WG SKD ++ S   + +  V  +LPV     T       
Sbjct  309  QIHLGSILGTILIVIGLYAVVWGKSKDPTASSLLIEDEKVVALELPVTVDNKTDGTGPPG  368

Query  901  TPIEVP--GEES  930
              I+VP   +ES
Sbjct  369  DFIKVPIKAQES  380



>ref|XP_011070079.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=404

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 199/266 (75%), Gaps = 5/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPK+TF++F ++ +LGLL PVIDQNLYY G+K+T+ TF+ A+ N+LPA+TF++A I 
Sbjct  70   RKVRPKITFTIFMQLFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLPAMTFVMAVIC  129

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK----EASHDQSASAGNS  348
            R+E+VN++KL  QAK++GT VT+ GAM+MTL +G VI + W+     + S+  +    N+
Sbjct  130  RMEKVNLKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINMVWSNYIHPQKSYVPTTIDSNT  189

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D VKG+ ++      WASF+ILQAITL+ Y A LSLT+L+C MG LQ   +T V+E  
Sbjct  190  DKDWVKGSILLIIATLAWASFFILQAITLRKYTAQLSLTALVCFMGTLQSIAVTFVMEHK  249

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
              A WA+ +D  LLA  Y+G++ S +AYY+ G+VM+ +GPVFVTAF+PL MIIVAIMGSF
Sbjct  250  PHA-WAIGFDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  308

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            ILAE++  G VLGA +IV+GLY V+W
Sbjct  309  ILAEKIYLGGVLGAVLIVIGLYSVLW  334



>ref|XP_003542469.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=379

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 195/262 (74%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KI +L LLEPVIDQNLY+ GMKYTTATF  A  N+LPAITFI A IL
Sbjct  64   KKVRPKMTLSIFMKIAVLSLLEPVIDQNLYFLGMKYTTATFAVATTNMLPAITFIFACIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++ ++ + SQAK++GT  T+ GAM+MTL++G V+        S+D     G S Q  
Sbjct  124  RLEKIKIKSIRSQAKVVGTLATVSGAMVMTLLKGPVL---LGSHRSNDHGQHNGTSMQHT  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI  GC  WA F ILQAITLK+YPA LSL++ +C MG ++G+ + L++ERGN ++
Sbjct  181  ITGFIMITIGCFSWACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSV  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++  D  LL  +Y+G++CSG+ YY+ GVVMK +GPVFVTAF+PL M+IVA+M  FILAE
Sbjct  241  WSLKLDMKLLCAVYTGIVCSGMGYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+++GA +I +GLY+V+W
Sbjct  301  QVFLGRMIGAVIICLGLYVVVW  322



>ref|XP_007141061.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
 gb|ESW13055.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
Length=385

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  VF ++  LG LEPV+DQNLY  GMK T+ TF +A  NVLPAITFI+A I 
Sbjct  71   RKIRPKMTLPVFLRLAALGFLEPVLDQNLYNMGMKNTSTTFASATVNVLPAITFIMALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTK-EASHDQSASAGN-SQQ  354
            RLE VN+RK+HS AK++GT+VT+ GAM+MTL +G    L + K +A+H +S S    S+Q
Sbjct  131  RLETVNLRKIHSVAKVIGTAVTVTGAMVMTLYKGS--ALQFVKGQANHQESGSTTQPSEQ  188

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            + V G  M+ A C  WASF+ILQ+ TLK YPA LS+T+ +C +G  +GS+ + + ER + 
Sbjct  189  NWVLGTVMLLASCGGWASFFILQSFTLKMYPAELSVTAWICFLGIFEGSIASFIFER-DM  247

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            ++W++  D+ LLA +YSGV+CSG+AYY+ GVV +++GPVFVT+F+PL MII A +GS +L
Sbjct  248  SVWSIGIDSRLLACVYSGVVCSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSIVL  307

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQH  894
            AEQ+  G V+GA +IV GLY V+WG SKD+ +K+     +    Q+LP+   A +     
Sbjct  308  AEQVYMGSVIGAIIIVSGLYTVVWGKSKDNVNKTEA---EKSEGQELPIKDSAASGSGIF  364

Query  895  SATPIEVP  918
             +  I VP
Sbjct  365  DSIEINVP  372



>ref|XP_010926422.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=374

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 188/262 (72%), Gaps = 1/262 (0%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK RPKMT S F KIM L LLEPV+DQN YY G K T A+F +AL NVLPA+TF+ A IL
Sbjct  65   RKARPKMTLSNFLKIMALALLEPVLDQNFYYMGAKNTNASFASALYNVLPAMTFVNAVIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            R+E+++++K HSQAKI GT VT+ GA++M L +G V+   WTK  +H  + +        
Sbjct  125  RMEKIDIKKRHSQAKIAGTLVTLVGALLMILYKGQVVEFIWTKGRNHYNNNAGSQDDSHW  184

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            ++G  M+   C CW++F++LQ+ TLKSYPA LSLT+ +C MGA+Q   + LV+E   A  
Sbjct  185  LEGVFMLLFSCFCWSAFFLLQSHTLKSYPAELSLTTWICFMGAVQSGAVALVMEH-EAKP  243

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + +D  LL   YSG++CSG+ YYI G VMK++GPVFVTAFNPL MIIV IMGS ILAE
Sbjct  244  WLIGFDLRLLTAAYSGIMCSGITYYIQGKVMKERGPVFVTAFNPLCMIIVTIMGSIILAE  303

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            ++  G+V+GA +IV+GLY +IW
Sbjct  304  EITLGRVVGATIIVIGLYSLIW  325



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 198/266 (74%), Gaps = 6/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPK+TF +F +I +LGLL PVIDQN YY G+K+T+ TF+ A+ N+LPA+TF++A + 
Sbjct  68   RKVRPKITFPMFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLC  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQS----ASAGNS  348
            R+E+V+++K+  QAK++GT VT+ GAM+MTL +G VI   W+ E  H Q+    A+ G+S
Sbjct  128  RMEKVDIKKVRCQAKVIGTIVTVAGAMLMTLYKGHVINFIWS-EHVHSQTSAPAATTGSS  186

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D +KG+ ++      WASF+ILQA+TL+ Y A LSLTSL+C MG LQ   +T V+E  
Sbjct  187  DKDWLKGSILLIIATLAWASFFILQAVTLRRYAAQLSLTSLVCFMGTLQSIAVTFVMEHK  246

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
             +A W + WD  LLA  Y+G++ SG+AYY+ G+VM+ +GPVFVTAF+PL MIIVAIMGSF
Sbjct  247  PSA-WTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSF  305

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            IL E++  G VLGA +IV GLY V+W
Sbjct  306  ILTEKIFLGGVLGAVLIVAGLYAVLW  331



>ref|XP_007019027.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY16252.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=386

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 214/293 (73%), Gaps = 5/293 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F +I+LLG LEPV+DQNLYY GMKYTTAT+ +A  N+LPA+TFILA I 
Sbjct  71   RKIRPKMTLPIFLRIVLLGFLEPVLDQNLYYLGMKYTTATYASAFVNMLPAVTFILAMIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++NV+K+ S AK++GT++T+ GAM+MTL +G +I    +  A+H  + +  ++ +  
Sbjct  131  RLEKINVKKIRSLAKVVGTAITVVGAMVMTLYKGPIIDFIKSGGATHSGTTTE-SADRHW  189

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+      W+SF+ILQ+ TLK YPA LSLT+ +C MG ++G+ ++L++ R  +A 
Sbjct  190  VTGTIMLLGSIFGWSSFFILQSFTLKKYPAELSLTAWICFMGMVEGTGVSLIMVRDFSA-  248

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W V WD+ LLA  YSG++CSG+AYY+ GVV++++GPVFVT+F+PL MII A +G  +LAE
Sbjct  249  WKVGWDSRLLAASYSGIVCSGIAYYVQGVVIRERGPVFVTSFSPLCMIITAALGVVVLAE  308

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATT  879
            ++ FG +LGA +IV GLY+V+WG SKD  +  +    +  ++Q+LP+   A +
Sbjct  309  KIHFGSILGAIIIVSGLYIVVWGKSKDAKNSETD---EKSIEQELPITNNARS  358



>gb|EMS60728.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 187/264 (71%), Gaps = 4/264 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R+ RPKMT ++F KIM L  LEPV+DQNLY+ G K T+A F TAL N LPA+TF+LA IL
Sbjct  65   RERRPKMTTTIFIKIMWLAFLEPVLDQNLYFMGAKLTSAGFATALLNTLPAVTFVLALIL  124

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN--SQQ  354
            R+E+V +R LHSQAKI GT + + GA++M L  G V+  PWT  + H  +   G   + +
Sbjct  125  RMEKVRLRSLHSQAKIAGTVLAVAGAVLMVLYHGPVVRFPWT--SGHHDATIGGQVAAAR  182

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
            D + G  M+ A C  W  F+ILQA TL SYPA LSLT+L+CGMG+L    + LV ER + 
Sbjct  183  DWLIGTVMLIASCMIWPGFFILQANTLGSYPAELSLTALICGMGSLMSGAIALVAERADT  242

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
             +W V +D+ LL  +Y+G++CSGVAYY+ GVV + +GPVFVTAF+PLSMII A+MGS IL
Sbjct  243  QVWVVGFDSRLLTVVYAGIVCSGVAYYLQGVVSRQRGPVFVTAFSPLSMIITAVMGSIIL  302

Query  715  AEQLDFGKVLGACVIVVGLYLVIW  786
             E++  G V+GA +IV GLY +IW
Sbjct  303  KEEITLGSVIGAVIIVTGLYFIIW  326



>ref|NP_001242267.1| uncharacterized protein LOC100811617 [Glycine max]
 gb|ACU19947.1| unknown [Glycine max]
Length=393

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 197/266 (74%), Gaps = 5/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPK+TF +F +I +LGLL PVIDQNLYY G+K+T+ T++ A+ N+LPA TF++A I 
Sbjct  68   RKVRPKITFLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNMLPATTFVMAAIF  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNS----  348
            R+E++NVRK+  QAK++GT VT+ GAM+MTL +G VI    +K   H ++    N+    
Sbjct  128  RMEKLNVRKVRCQAKVIGTVVTVAGAMLMTLYKGQVISFLGSKYMHHPRNYVPENNTDSG  187

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
            ++D  KG+ ++      WASF+ILQA+TL+ YPA LSLT+L+C +G LQ   +T V+E  
Sbjct  188  EKDWFKGSVLLVLATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSIAVTFVMEH-  246

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
              ++W + WD  LLA  Y+G+I SG+AYY+ G+VM+ KGPVFVTAF+PL MIIVAIMG+F
Sbjct  247  KPSVWTIGWDMNLLAAAYAGIISSGIAYYVQGIVMQKKGPVFVTAFSPLMMIIVAIMGTF  306

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            ILAE++  G V+GA +IV+GLY V+W
Sbjct  307  ILAEKIYLGGVIGAILIVMGLYSVLW  332



>ref|XP_010669710.1| PREDICTED: WAT1-related protein At4g08300-like [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 155/306 (51%), Positives = 206/306 (67%), Gaps = 7/306 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK R KMT SVF KIM+L  LEPV+DQNLYY G++YT+AT T+A  N+LPAITFI+A I 
Sbjct  67   RKTRSKMTLSVFLKIMVLAFLEPVLDQNLYYVGLQYTSATLTSASVNILPAITFIMATIF  126

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHD--QSASAGNSQQ  354
            RLE+V++RKL SQAKI+GT VT+ GAM+MT+ RG V+ L       H    +A+A  S Q
Sbjct  127  RLEKVDIRKLPSQAKIIGTIVTVSGAMVMTMYRGPVVNLFGNHGVGHHLANAATATPSTQ  186

Query  355  DPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNA  534
              V G   +   C  WA+F+ILQ+ TL  YP+ LSLT+ +C MG L+G V++LV+ R   
Sbjct  187  HWVVGTICVLGSCLGWAAFFILQSFTLNEYPSQLSLTAWICFMGTLEGGVVSLVMVRDMK  246

Query  535  AIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFIL  714
            A W + WD+ LLA +Y+GVICSG+AYY+ GVV +++GPVFVT F+PL MII A  GS IL
Sbjct  247  A-WQLGWDSRLLASVYTGVICSGIAYYVQGVVNRERGPVFVTVFSPLCMIITAASGSLIL  305

Query  715  AEQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQH  894
             E L  G ++GA +IV+GLY V+WG SKD             V  +LP++  +T +    
Sbjct  306  HELLHLGSIIGALIIVIGLYTVVWGKSKDLRISDE----KGKVQAELPIVHDSTINTIAA  361

Query  895  SATPIE  912
            + TP +
Sbjct  362  ATTPTK  367



>emb|CDY65991.1| BnaA10g29860D [Brassica napus]
Length=378

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 193/265 (73%), Gaps = 4/265 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R  RP++TF +F +I +L L EPV++QNLYY+GMK TTATFT+AL N LPA+TFI+A I 
Sbjct  60   RNSRPRLTFKIFLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIF  119

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASH--DQSASAGNSQQ  354
            +LE+VN+R+ HSQAK++GT V IGGAM+MT  +G VI LPWT +      Q+ S    +Q
Sbjct  120  KLEKVNIRRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPMGIIGQAHSMNTPKQ  179

Query  355  DPV-KGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGN  531
            + + KG+ M+ A C  W+ + ILQA  L +Y A LSLT+L+C MG L+ SV+ L+ ER N
Sbjct  180  EDIGKGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKN  239

Query  532  AAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFI  711
             ++W +H D  LLA IY G++ SG+AYY  G   K +GPVFV+AFNPLSM+IVAI+ SF+
Sbjct  240  MSVWKIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVAILSSFV  298

Query  712  LAEQLDFGKVLGACVIVVGLYLVIW  786
              E+L  G+V+G+ VIV G+YLV+W
Sbjct  299  FLEKLYLGRVVGSVVIVFGVYLVLW  323



>ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
Length=405

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 200/266 (75%), Gaps = 5/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPK+TF +F ++ +LGLL PVIDQN YY G+K+T+ TF+ A+ N+LPA+TF++A + 
Sbjct  68   RKVRPKITFPIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLC  127

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKE-ASHDQS---ASAGNS  348
            R+E+V ++K+  QAK++GT VT+ GAM+MT+ +G VI L W++   SH  S   A+  +S
Sbjct  128  RMEKVEIKKIRCQAKMVGTIVTVAGAMLMTIYKGNVINLVWSQHIHSHTSSPVPAATTSS  187

Query  349  QQDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D +KG+ ++      WASF+ILQA+T++ YPA LSLT+++C +G LQ   +T V+E  
Sbjct  188  DKDWLKGSILLILATLAWASFFILQAVTMRRYPAHLSLTAIVCFLGTLQSIAVTFVMEH-  246

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
             A++W + WD  LLA  Y+G++ SG+AYY+ G+VM+ +GPVFVTAF+PL MIIVAIMGSF
Sbjct  247  KASVWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSF  306

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            ILAE++  G  LGA VIV+GLY V+W
Sbjct  307  ILAEKIYVGGALGAVVIVIGLYAVLW  332



>gb|EMT07558.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=354

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/298 (50%), Positives = 199/298 (67%), Gaps = 1/298 (0%)
 Frame = +1

Query  7    IRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRL  186
            +RPKMT ++F K+M L  LEPV+DQNLY+ G K T+A F TAL N+LPA+TF+LA ILR+
Sbjct  29   LRPKMTITIFIKVMGLAFLEPVMDQNLYFMGAKLTSAGFATALVNILPAVTFVLALILRM  88

Query  187  EQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQ-QDPV  363
            E+V +R LH QAK  GT +T+ GA++M L  G V+  PWTK   H  +   G    +D +
Sbjct  89   EKVRLRSLHCQAKNAGTVLTVAGAVLMVLYHGPVVQFPWTKGQHHSTAGGQGAGGARDWL  148

Query  364  KGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIW  543
             G  M+   C  WA F+ILQ+ TL+SYPA LSLT L+C MG+L    + LV ERGN   W
Sbjct  149  NGTIMVIIACVAWACFFILQSNTLRSYPAELSLTVLICSMGSLMSGAIALVAERGNTQAW  208

Query  544  AVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQ  723
             + +DT L   +Y+G++CSGVAYY+ G+V + +GPVFVTAFNPL MII A+MGS IL E+
Sbjct  209  VIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILKEE  268

Query  724  LDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPATTHQEQHS  897
            ++ G V+GA +IV GLY +IWG SKD+ +K S   +    +  L  +     H +QH 
Sbjct  269  INLGSVIGAAIIVGGLYFLIWGKSKDEINKVSDVSVKGAGELPLTSVTNDHGHGKQHE  326



>ref|XP_004290853.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=385

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/292 (51%), Positives = 209/292 (72%), Gaps = 6/292 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RK+RPK+T  +F +IM+LG LEPV+ QNLY+ GM YT+ATF +A  N+LPAITFI A I 
Sbjct  71   RKVRPKLTLPIFLRIMVLGFLEPVLAQNLYFVGMTYTSATFASATANILPAITFIFALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE+VN +K+ S AK++GT +T+ GAM+MT  +G ++     + + H  SA+A +     
Sbjct  131  RLEKVNFKKIPSVAKVIGTVITVSGAMLMTFYKGPIVEFISAQASHHATSATATDKHW--  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ A CC W+ F+ILQ+ TLK YPA LSLT+L+C MGAL+G+V TLV+E  N ++
Sbjct  189  VLGTVMLLARCCGWSGFFILQSFTLKVYPAELSLTALICFMGALEGAVATLVIEH-NMSV  247

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W + WD+ LLA  YSG++CSG+A+Y+ G+VMK++GPVFVTAF+PL+MII A + + IL+E
Sbjct  248  WVIGWDSRLLAAAYSGIVCSGIAFYVQGIVMKEQGPVFVTAFSPLAMIITAALAAIILSE  307

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPVIRPAT  876
            Q+  G V+G  +IV+GLY V+WG SK+ S+          +D +LP+   AT
Sbjct  308  QVRLGSVIGTMLIVIGLYAVVWGKSKERSASMKDV---KTIDHELPITNVAT  356



>gb|ACJ84735.1| unknown [Medicago truncatula]
Length=372

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 211/308 (69%), Gaps = 8/308 (3%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  +F ++ +LG LEPV+DQNLY  GMK T+ TF +A  N+LPAITFI+A I 
Sbjct  69   RKIRPKMTLPIFLRLAVLGFLEPVLDQNLYNLGMKNTSTTFASATVNILPAITFIMAIIF  128

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE VN++K+HS AKI+GT VT+ GAM+MTL +G    +   + ++  +S +   ++Q+ 
Sbjct  129  RLETVNLKKIHSIAKIVGTVVTVSGAMVMTLYKGPAFQIIKGQSSNQHESGTTEPTEQNF  188

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            V G  M+ + C  WASF+ILQ+ TLK YPA LS+T+ +C +G  +G + TL+ ER + ++
Sbjct  189  VLGTIMLISSCGGWASFFILQSFTLKMYPAELSMTAWICFLGIFEGGIATLIFER-DFSV  247

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            WA+ +D+ LLA +YSG++CSG+AYY+ GVV +++GPV VT+F+PL MII A +GS +LAE
Sbjct  248  WAIGFDSRLLACVYSGIVCSGMAYYVQGVVTRERGPVLVTSFSPLCMIITAALGSIVLAE  307

Query  721  QLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVD--QQLPVIRPATTHQEQH  894
            Q   G ++GA +IV GLY V+W       SK S + +DAP    Q+LP+     T  +  
Sbjct  308  QTHLGSIIGAIIIVCGLYTVVW-----GKSKDSVNTIDAPKSEGQELPIKDGTRTGSDIF  362

Query  895  SATPIEVP  918
             +  + VP
Sbjct  363  ESIEVNVP  370



>ref|XP_004494994.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=330

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/242 (57%), Positives = 184/242 (76%), Gaps = 4/242 (2%)
 Frame = +1

Query  64   EPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWILRLEQVNVRKLHSQAKILGTSV  243
            +PVIDQNLY+ GMK+TTATF  ++ N+LPAITFILA ILR+E++ +R + +QAK++GT  
Sbjct  71   KPVIDQNLYFLGMKFTTATFAASMSNILPAITFILASILRIEKIKIRSIRTQAKVVGTIA  130

Query  244  TIGGAMIMTLVRGGVI-GLPWTKEASHDQSASAGNSQQDPVKGAAMIAAGCCCWASFYIL  420
            T+ GAM+MTL++G V+ G   +   +H  S   G S Q  + GA MI  GC  WA F IL
Sbjct  131  TVSGAMVMTLIKGPVLFGTFGSDSQNHHNS---GISTQHTIIGAVMITLGCFSWACFIIL  187

Query  421  QAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAIWAVHWDTTLLAYIYSGVICS  600
            QAITL++YPA LSL+S +C +G L+G+ + LVVERGN ++W++ WD  LL+ IY+G+ CS
Sbjct  188  QAITLETYPAALSLSSWICLLGTLEGAAVALVVERGNYSVWSIKWDVRLLSAIYTGIFCS  247

Query  601  GVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAEQLDFGKVLGACVIVVGLYLV  780
            G+ YY+ GVVMK +GPVFVT FNPL M+IVAIMG FILAEQ+  G+V+GA +I +GLYLV
Sbjct  248  GLGYYLQGVVMKTRGPVFVTTFNPLCMVIVAIMGYFILAEQMFLGRVVGAFIICLGLYLV  307

Query  781  IW  786
            +W
Sbjct  308  VW  309



>ref|XP_008444144.1| PREDICTED: WAT1-related protein At1g44800-like [Cucumis melo]
Length=374

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 219/302 (73%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT ++F +++LLG LEPV+DQNLYY G+K T+ATFT+   N+LPA+TFI+A I 
Sbjct  71   RKIRPKMTLAIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILPAVTFIMALIF  130

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGL-PWTKEASHDQSASAGNSQQD  357
            RLE VN +K+ S AK++GT VTIGGAM+MTL +G ++ +       +   S+S+ ++ Q 
Sbjct  131  RLESVNFKKIRSIAKVVGTLVTIGGAMVMTLYKGPIVDIFHGHGRHAAHHSSSSESADQH  190

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             V G  M+      W+ F+ILQ+ TL+ YPA LSLT+L+C  GA++GS++TL++ER + +
Sbjct  191  WVLGTLMLLGSIVGWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIVTLIMER-DFS  249

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W + WD+ LLA +Y+GVICSG+AYYI GVV++++GPVFVT+F PL MII AI+GS +LA
Sbjct  250  VWVIGWDSRLLAAVYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMIITAILGSIVLA  309

Query  718  EQLDFGKVLGACVIVVGLYLVIWgsskddsskssgddLDAPVDQQLPV-IRPATTHQEQH  894
            EQ+  G ++GA  IV+GLYLV+WG +KD  +K +     A  +  LP+   P TT  E+ 
Sbjct  310  EQIHLGSIIGAIFIVMGLYLVVWGKAKDHLNKLTNQKSSAATE--LPITTEPETTAAERC  367

Query  895  SA  900
            S+
Sbjct  368  SS  369



>gb|KHN48995.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 195/262 (74%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            +K+RPKMT S+F KI +L LLEPVIDQNLY+ GMKYTTATF  A  N+LPAITFI A IL
Sbjct  64   KKVRPKMTLSIFMKIAVLSLLEPVIDQNLYFLGMKYTTATFAVATTNMLPAITFIFACIL  123

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQQDP  360
            RLE++ ++ + SQAK++GT  T+ GAM+MTL++G V+        S+D     G S Q  
Sbjct  124  RLEKIKIKSIRSQAKVVGTLATVSGAMVMTLLKGPVL---LGSHRSNDHGQHNGTSMQHT  180

Query  361  VKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAAI  540
            + G  MI  GC  WA F ILQAITLK+YPA LSL++ +C MG ++G+ + L++ERGN ++
Sbjct  181  ITGFIMITIGCFSWACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSV  240

Query  541  WAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILAE  720
            W++  D  LL  +Y+G++CSG+ YY+ GVV+K +GPVFVTAF+PL M+IVA+M  FILAE
Sbjct  241  WSLKLDMKLLCAVYTGIVCSGMGYYLQGVVIKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  721  QLDFGKVLGACVIVVGLYLVIW  786
            Q+  G+++GA +I +GLY+V+W
Sbjct  301  QVFLGRMIGAVIICLGLYVVVW  322



>ref|XP_003544681.1| PREDICTED: WAT1-related protein At1g44800-like [Glycine max]
Length=387

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 196/263 (75%), Gaps = 2/263 (1%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            RKIRPKMT  VF ++ +LG LEPV+DQNLY  GMK T+ TF +A  NV+PAITFI+A I 
Sbjct  72   RKIRPKMTLPVFLRLAVLGFLEPVLDQNLYNMGMKNTSTTFASATVNVMPAITFIMALIC  131

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGN-SQQD  357
            RLE VN+RK+HS AK++GT+VT+ GAM+MTL +G  +     + A+H +S S+   S+Q+
Sbjct  132  RLETVNLRKIHSVAKVVGTAVTVSGAMVMTLYKGPALQFIKGQAATHHESGSSTQPSEQN  191

Query  358  PVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERGNAA  537
             V G   + A C  WASF+ILQ+ TLK YPA LS+T+ +C +G  +G++ TL+ ER + +
Sbjct  192  WVLGTVELIASCGGWASFFILQSFTLKMYPAELSVTAWICFLGIFEGAIATLIFER-DMS  250

Query  538  IWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSFILA  717
            +W++  D+ LLA +YSGV+CSG+AYY+ GVV +++GPVFVT+F+PL MII A +GS +LA
Sbjct  251  VWSIGMDSRLLACVYSGVVCSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSIVLA  310

Query  718  EQLDFGKVLGACVIVVGLYLVIW  786
            EQ+  G V+GA +IV GLY V+W
Sbjct  311  EQVYLGSVIGAIIIVSGLYTVVW  333



>gb|EMS60727.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=377

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 186/266 (70%), Gaps = 4/266 (2%)
 Frame = +1

Query  1    RKIRPKMTFSVFWKIMLLGLLEPVIDQNLYYTGMKYTTATFTTALGNVLPAITFILAWIL  180
            R  RPKMT ++F KIM L +LEPVIDQNLY+ G K T+A F TAL N LPA+TF+LA IL
Sbjct  49   RGRRPKMTTAIFLKIMGLAILEPVIDQNLYFLGAKLTSAGFATALLNTLPAVTFVLALIL  108

Query  181  RLEQVNVRKLHSQAKILGTSVTIGGAMIMTLVRGGVIGLPWTKEASHDQSASAGNSQ---  351
            R+E+V +R LHSQAKI GT +T+ GA++M L  G  +  PWTK   H  +   G      
Sbjct  109  RMEKVRLRSLHSQAKIAGTVLTVAGAVLMILYHGPAMQFPWTKGQHHAAAGGQGAVGAAA  168

Query  352  -QDPVKGAAMIAAGCCCWASFYILQAITLKSYPAGLSLTSLLCGMGALQGSVLTLVVERG  528
             +D +KG  M+   C  W+ F+ILQ+ TL+SYPA LS+T+L+CGMG+L    + LV ER 
Sbjct  169  ARDWLKGTMMLIGSCMVWSCFFILQSSTLRSYPAELSVTALICGMGSLMSGAVALVAERA  228

Query  529  NAAIWAVHWDTTLLAYIYSGVICSGVAYYISGVVMKDKGPVFVTAFNPLSMIIVAIMGSF  708
            N   W + +DT LL  +Y+G++CSGVAYY+ GVV + +GPVFVTAFNPL MII A+MGS 
Sbjct  229  NTHAWVIGFDTRLLTVVYAGIVCSGVAYYLQGVVSRQRGPVFVTAFNPLCMIITAVMGSI  288

Query  709  ILAEQLDFGKVLGACVIVVGLYLVIW  786
            IL E++  G V+GA +IV GLY +IW
Sbjct  289  ILKEEITLGSVIGAVIIVAGLYFLIW  314



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2436594696768