BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85420_g1_i1 len=728 path=[1:0-727]

Length=728
                                                                      Score     E

ref|XP_010269468.1|  PREDICTED: abl interactor homolog                78.2    7e-14   
ref|XP_011090948.1|  PREDICTED: protein diaphanous homolog 1-like     76.3    7e-13   
ref|XP_009592495.1|  PREDICTED: cytokinesis protein sepA              75.5    8e-13   
ref|XP_007154268.1|  hypothetical protein PHAVU_003G104400g           74.7    9e-13   
ref|XP_009779515.1|  PREDICTED: formin-like protein 18                75.1    1e-12   
ref|XP_004508275.1|  PREDICTED: uncharacterized protein LOC101495376  72.4    3e-12   
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         72.0    1e-11   Vitis vinifera
gb|EPS57822.1|  hypothetical protein M569_16995                       69.7    1e-11   
ref|XP_007030973.1|  Soybean gene regulated by cold-2, putative       72.0    1e-11   
ref|XP_006342789.1|  PREDICTED: formin-A-like isoform X1              71.6    2e-11   
gb|KDP27783.1|  hypothetical protein JCGZ_18863                       71.2    3e-11   
ref|XP_007035560.1|  Soybean gene regulated by cold-2, putative       70.9    3e-11   
ref|XP_009339820.1|  PREDICTED: uncharacterized protein LOC103932014  68.9    3e-11   
ref|XP_010501388.1|  PREDICTED: uncharacterized protein LOC104778636  69.3    5e-11   
ref|NP_563835.1|  protein SRC2                                        70.9    5e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA07573.1|  src2-like protein                                    70.9    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090794.1|  16 kDa phloem protein 2                          69.7    8e-11   
ref|XP_008438876.1|  PREDICTED: protein diaphanous homolog 1          70.5    8e-11   
gb|AGW45467.1|  cold-regulated protein                                68.9    8e-11   
ref|XP_009343995.1|  PREDICTED: uncharacterized protein LOC103935902  69.3    1e-10   
gb|EYU43935.1|  hypothetical protein MIMGU_mgv1a013059mg              68.2    2e-10   
ref|XP_006305375.1|  hypothetical protein CARUB_v10009766mg           69.3    2e-10   
emb|CDP19538.1|  unnamed protein product                              69.3    2e-10   
gb|EYU45555.1|  hypothetical protein MIMGU_mgv1a018032mg              68.9    2e-10   
ref|XP_004159813.1|  PREDICTED: uncharacterized protein LOC101229597  69.3    2e-10   
ref|XP_010458174.1|  PREDICTED: cleavage and polyadenylation spec...  68.9    2e-10   
ref|XP_004134204.1|  PREDICTED: uncharacterized protein LOC101222610  68.9    2e-10   
emb|CDY22649.1|  BnaC08g42830D                                        68.6    3e-10   
emb|CDY06346.1|  BnaA09g48570D                                        67.8    3e-10   
ref|XP_009118327.1|  PREDICTED: basic salivary proline-rich prote...  68.6    3e-10   
ref|XP_004229314.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  68.2    3e-10   
ref|XP_009352334.1|  PREDICTED: uncharacterized protein LOC103943719  67.0    3e-10   
ref|XP_010098296.1|  hypothetical protein L484_023544                 67.8    4e-10   
ref|XP_002889732.1|  hypothetical protein ARALYDRAFT_470988           67.8    5e-10   
ref|XP_010259665.1|  PREDICTED: uncharacterized protein LOC104599004  65.5    6e-10   
gb|ABE98328.1|  SRC2-like protein                                     67.0    7e-10   Capsicum annuum
gb|KDP23491.1|  hypothetical protein JCGZ_23324                       67.0    8e-10   
ref|XP_002315561.1|  shock protein SRC2                               67.0    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  66.6    1e-09   
ref|XP_006419602.1|  hypothetical protein CICLE_v10005548mg           66.6    1e-09   
ref|XP_010489684.1|  PREDICTED: basic salivary proline-rich prote...  66.6    1e-09   
ref|XP_011071658.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  66.2    1e-09   
ref|XP_008367154.1|  PREDICTED: LOW QUALITY PROTEIN: vasodilator-...  66.6    2e-09   
ref|XP_010549744.1|  PREDICTED: small nuclear ribonucleoprotein-a...  65.9    3e-09   
emb|CDP19532.1|  unnamed protein product                              64.7    5e-09   
ref|XP_006417616.1|  hypothetical protein EUTSA_v10008221mg           65.1    5e-09   
dbj|BAG49728.1|  SRC2 homolog                                         64.3    5e-09   Capsicum chinense [bonnet pepper]
ref|XP_010475730.1|  PREDICTED: small nuclear ribonucleoprotein-a...  64.7    6e-09   
gb|AFK33423.1|  unknown                                               63.2    1e-08   
ref|XP_008353231.1|  PREDICTED: protein diaphanous homolog 1-like     63.9    1e-08   
ref|XP_003609663.1|  hypothetical protein MTR_4g119780                62.8    1e-08   
ref|XP_002516905.1|  conserved hypothetical protein                   62.8    2e-08   Ricinus communis
gb|KHN26566.1|  hypothetical protein glysoja_019805                   62.0    3e-08   
ref|XP_009352335.1|  PREDICTED: DNA-directed RNA polymerase II su...  62.0    3e-08   
ref|XP_011012859.1|  PREDICTED: formin-like protein 18                62.4    4e-08   
ref|XP_004230221.1|  PREDICTED: uncharacterized protein LOC101248717  62.0    5e-08   
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        62.0    5e-08   
ref|XP_008450640.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  61.6    5e-08   
ref|XP_010545020.1|  PREDICTED: uncharacterized protein LOC104817502  61.2    6e-08   
ref|XP_004487863.1|  PREDICTED: ribonucleoprotein RB97D-like          61.6    6e-08   
ref|XP_006489103.1|  PREDICTED: uncharacterized protein LOC102622...  60.1    6e-08   
gb|KCW85018.1|  hypothetical protein EUGRSUZ_B01852                   60.1    7e-08   
ref|XP_006402342.1|  hypothetical protein EUTSA_v10006364mg           61.2    7e-08   
dbj|BAK04679.1|  predicted protein                                    60.8    9e-08   
ref|XP_004135614.1|  PREDICTED: uncharacterized protein LOC101206742  61.2    9e-08   
ref|XP_006344643.1|  PREDICTED: uncharacterized protein LOC102596739  61.2    9e-08   
gb|KGN60948.1|  hypothetical protein Csa_2G030090                     61.2    1e-07   
ref|XP_004144785.1|  PREDICTED: uncharacterized protein LOC101212570  60.8    1e-07   
gb|KDO36355.1|  hypothetical protein CISIN_1g021949mg                 61.2    1e-07   
ref|XP_004170656.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.8    1e-07   
ref|XP_006489264.1|  PREDICTED: uncharacterized protein LOC102618659  61.2    2e-07   
gb|EMT21195.1|  hypothetical protein F775_15531                       60.1    2e-07   
ref|NP_001238642.1|  cold-regulated protein                           60.5    2e-07   
ref|XP_011036850.1|  PREDICTED: uncharacterized protein LOC105134212  60.5    2e-07   
ref|XP_002512414.1|  conserved hypothetical protein                   59.7    3e-07   Ricinus communis
ref|XP_010067355.1|  PREDICTED: uncharacterized protein LOC104454253  58.9    3e-07   
ref|XP_007224302.1|  hypothetical protein PRUPE_ppa020127mg           59.7    3e-07   
ref|XP_008223177.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  59.7    3e-07   
gb|EAY96559.1|  hypothetical protein OsI_18464                        59.7    3e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001054654.1|  Os05g0149100                                     59.7    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010024687.1|  PREDICTED: formin-F-like                         59.7    4e-07   
ref|XP_008454313.1|  PREDICTED: protein enabled homolog               59.3    4e-07   
ref|XP_008390713.1|  PREDICTED: C2 domain-containing protein At1g...  58.5    6e-07   
ref|XP_006389230.1|  shock protein SRC2                               58.9    6e-07   
ref|XP_004963414.1|  PREDICTED: uncharacterized protein LOC101762556  58.9    6e-07   
gb|KCW65470.1|  hypothetical protein EUGRSUZ_G02880                   58.9    6e-07   
ref|XP_010046182.1|  PREDICTED: uncharacterized protein LOC104435055  58.9    7e-07   
ref|XP_010104923.1|  hypothetical protein L484_006665                 57.8    7e-07   
ref|XP_006382496.1|  hypothetical protein POPTR_0005s02680g           58.5    1e-06   
ref|XP_010103360.1|  hypothetical protein L484_002544                 57.4    1e-06   
ref|XP_010024685.1|  PREDICTED: uncharacterized protein LOC104415126  55.8    1e-06   
gb|EYU23908.1|  hypothetical protein MIMGU_mgv1a025191mg              55.5    1e-06   
gb|KEH37271.1|  C2 domain protein                                     57.4    2e-06   
gb|EPS60709.1|  hypothetical protein M569_14094                       56.6    2e-06   
gb|ABO82573.1|  unknown                                               56.6    3e-06   Helianthus petiolaris
ref|XP_010528895.1|  PREDICTED: uncharacterized protein LOC104805887  57.4    3e-06   
ref|XP_003594901.1|  Cold-regulated protein                           55.1    3e-06   
ref|XP_008223176.1|  PREDICTED: uncharacterized protein LOC103322998  55.8    3e-06   
gb|EPS59428.1|  hypothetical protein M569_15381                       56.6    3e-06   
ref|NP_001236659.1|  src2 protein                                     56.6    3e-06   
gb|ABO82521.1|  unknown                                               55.5    3e-06   Helianthus annuus
gb|ABO82553.1|  unknown                                               55.8    4e-06   Helianthus anomalus
gb|ABO82566.1|  unknown                                               55.8    4e-06   Helianthus petiolaris
gb|EYU23910.1|  hypothetical protein MIMGU_mgv1a015398mg              54.7    4e-06   
ref|XP_007138900.1|  hypothetical protein PHAVU_009G247100g           56.2    5e-06   
gb|ABO82557.1|  unknown                                               55.5    5e-06   Helianthus anomalus
ref|XP_009138716.1|  PREDICTED: uncharacterized protein LOC103862775  56.2    5e-06   
gb|ABO82532.1|  unknown                                               55.5    5e-06   Helianthus annuus
gb|ABO82534.1|  unknown                                               55.5    5e-06   Helianthus annuus
ref|XP_004296826.1|  PREDICTED: uncharacterized protein LOC101304564  56.2    5e-06   
emb|CDX89149.1|  BnaA04g00370D                                        55.8    6e-06   
gb|ABO82547.1|  unknown                                               55.5    6e-06   Helianthus anomalus
gb|AEJ08746.1|  RSI4                                                  55.8    6e-06   
gb|ABO82548.1|  unknown                                               55.5    6e-06   Helianthus anomalus
ref|XP_009589677.1|  PREDICTED: protein cappuccino-like               55.8    6e-06   
gb|ABO82555.1|  unknown                                               55.5    7e-06   Helianthus anomalus
gb|ABO82530.1|  unknown                                               55.5    7e-06   Helianthus annuus
gb|ABO82575.1|  unknown                                               55.1    7e-06   Helianthus petiolaris
gb|ABO82574.1|  unknown                                               55.1    8e-06   Helianthus petiolaris
gb|ABO82558.1|  unknown                                               55.1    8e-06   Helianthus anomalus
gb|ABO82544.1|  unknown                                               55.1    9e-06   Helianthus anomalus
gb|EYU23914.1|  hypothetical protein MIMGU_mgv1a014694mg              54.3    9e-06   
ref|XP_010652026.1|  PREDICTED: uncharacterized protein LOC104879761  55.1    1e-05   
ref|XP_009384169.1|  PREDICTED: basic proline-rich protein-like       55.5    1e-05   
ref|XP_010684409.1|  PREDICTED: splicing factor 3B subunit 4-like     55.5    1e-05   
gb|ABO82522.1|  unknown                                               53.9    1e-05   Helianthus annuus
ref|XP_008354349.1|  PREDICTED: protein diaphanous homolog 1-like     55.5    1e-05   
gb|KCW65300.1|  hypothetical protein EUGRSUZ_G02756                   53.1    1e-05   
gb|ABO82568.1|  unknown                                               54.7    1e-05   Helianthus petiolaris
gb|ABO82551.1|  unknown                                               54.7    1e-05   Helianthus anomalus
ref|XP_007208693.1|  hypothetical protein PRUPE_ppa1027138mg          53.9    1e-05   
gb|ABO82543.1|  unknown                                               54.7    1e-05   Helianthus anomalus
gb|ABO82524.1|  unknown                                               54.7    1e-05   Helianthus annuus
gb|ABO82541.1|  unknown                                               54.7    1e-05   Helianthus anomalus
gb|ABO82559.1|  unknown                                               54.7    1e-05   Helianthus petiolaris
gb|ABO82540.1|  unknown                                               54.7    1e-05   Helianthus anomalus
ref|XP_002319528.1|  C2 domain-containing family protein              55.1    1e-05   Populus trichocarpa [western balsam poplar]
gb|ABO82535.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82528.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82525.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82538.1|  unknown                                               54.3    1e-05   Helianthus annuus
ref|XP_009798433.1|  PREDICTED: adhesive plaque matrix protein-like   55.1    1e-05   
gb|EYU22926.1|  hypothetical protein MIMGU_mgv1a015358mg              53.1    1e-05   
gb|ABO82549.1|  unknown                                               54.3    1e-05   Helianthus anomalus
gb|ABO82562.1|  unknown                                               54.3    1e-05   Helianthus petiolaris
gb|ABO82564.1|  unknown                                               54.3    1e-05   Helianthus petiolaris
gb|ABO82536.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82519.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82561.1|  unknown                                               54.3    1e-05   Helianthus petiolaris
gb|ABO82560.1|  unknown                                               54.3    1e-05   Helianthus petiolaris
gb|ABO82523.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82520.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82531.1|  unknown                                               54.3    1e-05   Helianthus annuus
gb|ABO82537.1|  unknown                                               54.3    2e-05   Helianthus annuus
gb|ABO82567.1|  unknown                                               54.3    2e-05   Helianthus petiolaris
gb|ABO82571.1|  unknown                                               54.3    2e-05   Helianthus petiolaris
ref|XP_006489104.1|  PREDICTED: uncharacterized protein LOC102622...  53.5    2e-05   
gb|ABO82542.1|  unknown                                               54.3    2e-05   Helianthus anomalus
gb|ABO82556.1|  unknown                                               53.9    2e-05   Helianthus anomalus
gb|ABO82552.1|  unknown                                               53.5    3e-05   Helianthus anomalus
ref|XP_010445373.1|  PREDICTED: uncharacterized protein LOC104728029  53.9    3e-05   
ref|XP_011023669.1|  PREDICTED: WW domain-binding protein 2-like      53.5    4e-05   
gb|ABO82554.1|  unknown                                               53.1    4e-05   Helianthus anomalus
ref|XP_002299823.2|  hypothetical protein POPTR_0001s25640g           53.1    5e-05   Populus trichocarpa [western balsam poplar]
gb|EYU23912.1|  hypothetical protein MIMGU_mgv1a014817mg              52.0    6e-05   
ref|XP_010674816.1|  PREDICTED: uncharacterized protein LOC104890897  53.1    6e-05   
emb|CDY72474.1|  BnaCnng77840D                                        52.4    6e-05   
ref|XP_009136710.1|  PREDICTED: uncharacterized protein LOC103860797  52.4    6e-05   
ref|XP_011035190.1|  PREDICTED: uncharacterized protein LOC105133...  53.1    7e-05   
gb|ABE98329.1|  SRC2-like protein                                     52.8    8e-05   Nicotiana benthamiana
emb|CDP15793.1|  unnamed protein product                              51.6    8e-05   
ref|XP_003594708.1|  hypothetical protein MTR_2g033730                52.8    9e-05   
gb|AES64959.2|  SRC2-like protein, putative                           52.8    1e-04   
emb|CDP15795.1|  unnamed protein product                              50.8    1e-04   
gb|ABN09103.1|  C2                                                    52.4    1e-04   Medicago truncatula
gb|KCW65474.1|  hypothetical protein EUGRSUZ_G02885                   51.6    1e-04   
gb|EYU23913.1|  hypothetical protein MIMGU_mgv1a024879mg              50.4    1e-04   
ref|XP_010666732.1|  PREDICTED: uncharacterized protein LOC104883866  51.6    2e-04   
ref|XP_008801062.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  52.0    2e-04   
ref|XP_011087410.1|  PREDICTED: uncharacterized protein LOC105168911  51.6    2e-04   
gb|ABO82545.1|  unknown                                               50.8    3e-04   Helianthus anomalus
gb|EYU23907.1|  hypothetical protein MIMGU_mgv1a024503mg              49.3    3e-04   
ref|XP_006289418.1|  hypothetical protein CARUB_v10002917mg           49.3    3e-04   
ref|XP_008800861.1|  PREDICTED: formin-like protein 18                50.8    3e-04   
ref|XP_010921798.1|  PREDICTED: ingression protein fic1-like          50.8    4e-04   
gb|EYU23915.1|  hypothetical protein MIMGU_mgv1a014535mg              49.7    4e-04   
ref|XP_006282258.1|  hypothetical protein CARUB_v10028535mg           48.9    4e-04   
emb|CDX74290.1|  BnaA03g27570D                                        49.7    4e-04   
ref|XP_011075026.1|  PREDICTED: uncharacterized protein LOC105159610  48.5    6e-04   
ref|XP_010259736.1|  PREDICTED: uncharacterized protein LOC104599071  49.7    6e-04   
emb|CDX91956.1|  BnaC03g32580D                                        49.3    7e-04   
ref|XP_004968753.1|  PREDICTED: formin-like protein 18-like           49.7    8e-04   
ref|XP_008789935.1|  PREDICTED: small nuclear ribonucleoprotein-a...  49.7    0.001   



>ref|XP_010269468.1| PREDICTED: abl interactor homolog [Nelumbo nucifera]
Length=278

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL+IT+ SA+  K  V    KM +YA   L G  R  ++ +T +D+  G+ P W     F
Sbjct  5    TLDITVISAKDLKD-VNLFSKMDVYAVVSLSGDSR--SKHKTPIDKDGGTSPSWNFPMKF  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               E+  + + ++LVFE++C +++G DK +G  +VP+K+  D     G   Q V+  +  
Sbjct  62   TVDEAAAKQNRLMLVFELRCDRSLG-DKDIGQVHVPVKELLDNT-GDGKSAQFVSYQVRK  119

Query  371  KLGKPRGVLYLSYVF  415
              GKP+G L  SY F
Sbjct  120  PSGKPKGTLNFSYKF  134



>ref|XP_011090948.1| PREDICTED: protein diaphanous homolog 1-like [Sesamum indicum]
Length=331

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 81/163 (50%), Gaps = 8/163 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TL+IT++ A+   K V  + KM +YA   + GGD+NS +  +T VD      P W     
Sbjct  5    TLDITLQYAKDLNK-VNFITKMDVYAVVSISGGDKNSKQKTKTPVDHDGDDNPTWNFPMK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQ-YQDVALGI  364
            F   E+ ++ + + L F++ C++ +G DK VG  +VPIK+  D     G    Q V+  +
Sbjct  64   FTVDEAALQMNRLTLDFKLICERALG-DKDVGEVHVPIKELLDSPAKPGADGKQFVSYQV  122

Query  365  SSKLGKPRGVLYLSYVFT----AYNFLNFPRLYVPSAPPMFRA  481
                GKP+G L  SY F+      +        +P APP  +A
Sbjct  123  RKPSGKPKGQLSFSYQFSEKTVGASAAPPHASAIPLAPPSGKA  165



>ref|XP_009592495.1| PREDICTED: cytokinesis protein sepA [Nicotiana tomentosiformis]
Length=307

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 72/137 (53%), Gaps = 4/137 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-RNSAECRTHVDEYRGSRPIWWILAS  187
            TLEI + S +   K V  + KM +Y    + G D R+  + +THVD    + P W     
Sbjct  5    TLEINVMSGKDLNK-VNLITKMDVYVVVSISGADDRSDQKTKTHVDHDGDNNPTWNFPIK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   ++   ++ + LVF+++C++ +G DK +G   VPIK+  D   S G + Q V+  I 
Sbjct  64   FTIDDNAAVHNRLNLVFKLRCQRALG-DKDIGEVTVPIKELLDSPNSTGSK-QFVSYQIR  121

Query  368  SKLGKPRGVLYLSYVFT  418
               GKP+G L  SY F+
Sbjct  122  KPSGKPKGQLTFSYQFS  138



>ref|XP_007154268.1| hypothetical protein PHAVU_003G104400g [Phaseolus vulgaris]
 gb|ESW26262.1| hypothetical protein PHAVU_003G104400g [Phaseolus vulgaris]
Length=266

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL +++ SA+  KK V    KM +YA   L G  +     +T VD   G+ P W +  + 
Sbjct  5    TLLLSLGSAKDLKK-VNFFSKMDVYAVVSLSGVQK----IKTPVDRNGGANPTWNVTENI  59

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +ES  R + + L  +++C++N+  DK +G   VP+K+  DQ    G  +Q V+  +  
Sbjct  60   TINESLARQNRLTLEIKLRCERNLSTDKEIGQVLVPVKELLDQP-GDGKSFQHVSYQVRK  118

Query  371  KLGKPRGVLYLSYVFT  418
              GKP+G L  SY F+
Sbjct  119  PSGKPKGALSFSYKFS  134



>ref|XP_009779515.1| PREDICTED: formin-like protein 18 [Nicotiana sylvestris]
Length=306

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 72/137 (53%), Gaps = 4/137 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-RNSAECRTHVDEYRGSRPIWWILAS  187
            TLEI + S +   K V  + KM +Y    + G D R+  + +THVD    + P W     
Sbjct  5    TLEINVMSGKDLNK-VNLITKMDVYVVVSISGADDRSDQKTKTHVDHDGDNNPTWNFPIK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   ++   ++ + LVF+++C++ +G DK +G   VPIK+  D   S G + Q V+  I 
Sbjct  64   FTIDDNAAVHTRLNLVFKLRCQRALG-DKDIGEVTVPIKELLDSPNSTGSK-QFVSYQIR  121

Query  368  SKLGKPRGVLYLSYVFT  418
               GKP+G L  SY F+
Sbjct  122  KPSGKPKGQLTFSYQFS  138



>ref|XP_004508275.1| PREDICTED: uncharacterized protein LOC101495376 [Cicer arietinum]
Length=215

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (50%), Gaps = 2/137 (1%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            T E+ + SA+  K  V    KM++YA   + G   ++   +T +D+  G+ P W      
Sbjct  5    TFELNLTSAKDLKN-VNLFAKMEVYAVVSISGDPLHTQNTKTPIDKESGTNPAWNFPVKL  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +E+  R + + L   ++C +N+  DK +G+  +P+++  +     G  +Q V+  +  
Sbjct  64   TFNETLARQNRLTLEINLRCARNLAADKDIGSVQIPLRELQNHT-GDGKSFQHVSYQVRK  122

Query  371  KLGKPRGVLYLSYVFTA  421
              GKP+G    SY FTA
Sbjct  123  PSGKPKGAFNFSYKFTA  139



>ref|XP_002272904.1| PREDICTED: cytokinesis protein sepA-like [Vitis vinifera]
Length=291

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 71/136 (52%), Gaps = 7/136 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLEI + SA+  K  V  + KM +Y    + G  R  ++ +T VD   G+ P W     F
Sbjct  5    TLEINVISAKDLKD-VNLISKMDVYVVVSINGDSR--SKQKTPVDRDGGTNPTWNFPMKF  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC-VSQGFQYQDVALGIS  367
               ES  + + + L F+++C++ +G DK +G   VPIK+  D    S+  Q+  V+  + 
Sbjct  62   TVDESAAQQNRLTLSFKLRCERTLG-DKDIGEVNVPIKELLDPAGESKPIQF--VSYQVR  118

Query  368  SKLGKPRGVLYLSYVF  415
               GKP+G L LSY F
Sbjct  119  KPSGKPKGELNLSYKF  134



>gb|EPS57822.1| hypothetical protein M569_16995, partial [Genlisea aurea]
Length=136

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 72/139 (52%), Gaps = 9/139 (6%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGG-DRNSAECRTHVDEYRGSRPIWWILASF  190
            LEIT++ A+   K  L   KM +YA   +VGG +  + + +T  D      P W    +F
Sbjct  2    LEITLQYAKDLNKVNLLT-KMDVYAEVFIVGGGNTTNLKVKTPADHRGDDSPTWDFPMNF  60

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQ----CVSQGFQYQDVAL  358
            R  E E++ S + LVF++ CK+ +G DK VG T VPIK+  +       + G  +  V+ 
Sbjct  61   RIDEREMKYSRLALVFKLVCKRALG-DKVVGETQVPIKELLETQEKGTAADGRVF--VSY  117

Query  359  GISSKLGKPRGVLYLSYVF  415
             +    GKP+G +  SY F
Sbjct  118  QVRKPDGKPKGQISFSYKF  136



>ref|XP_007030973.1| Soybean gene regulated by cold-2, putative [Theobroma cacao]
 gb|EOY11475.1| Soybean gene regulated by cold-2, putative [Theobroma cacao]
Length=286

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 73/154 (47%), Gaps = 4/154 (3%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LEI + S +  K   L   KM +YA   + G  R S   +T VD+  GS P W     F 
Sbjct  6    LEINVISGKDLKDVNLFT-KMDVYAVVSINGDHRTSQ--KTPVDKDCGSNPKWNYTMRFT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E+  R + + LVF +K ++ +G DK +G   VPIK+  D   +     Q+V+  +   
Sbjct  63   VDEANARQNRLNLVFRLKSERQLG-DKDIGVVQVPIKELLDHNNADEKVEQNVSYSVRLP  121

Query  374  LGKPRGVLYLSYVFTAYNFLNFPRLYVPSAPPMF  475
             GK +GVL  SY F        P+  VP A  M+
Sbjct  122  NGKAKGVLDFSYKFGEKFSKPVPQPPVPGAEAMY  155



>ref|XP_006342789.1| PREDICTED: formin-A-like isoform X1 [Solanum tuberosum]
 ref|XP_006342790.1| PREDICTED: formin-A-like isoform X2 [Solanum tuberosum]
Length=299

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 70/138 (51%), Gaps = 4/138 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD--RNSAECRTHVDEYRGSRPIWWILA  184
            TL+I + S +   K V  + KM +Y    + G D  R++ + +THVD    + P W    
Sbjct  5    TLDINVVSGKDLNK-VNLITKMDVYVVISISGADDDRSNQKTKTHVDHDGDNNPTWNFPI  63

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI  364
             F   ++    + + LVF+++C+K +G DK +G   VPIK+  +   S     Q V+  I
Sbjct  64   KFTIDDNAAVQNRLHLVFKLRCQKALG-DKDIGQVDVPIKELLESSNSSNGSKQFVSYQI  122

Query  365  SSKLGKPRGVLYLSYVFT  418
                GKP+G L  SY F+
Sbjct  123  RKPSGKPKGQLTFSYQFS  140



>gb|KDP27783.1| hypothetical protein JCGZ_18863 [Jatropha curcas]
Length=311

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 73/146 (50%), Gaps = 4/146 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TLEI + SA+  K  V    KM +YA   + G  +   +  +T VD   G+ P W   A 
Sbjct  5    TLEINLISAKDLKD-VNLFSKMDVYAVVSISGDSQQPKQKIKTPVDHDGGTNPTWNFPAK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   E+  + + ++LV  ++C++ +G DK +G   VPIK+   + +  G   Q V+  + 
Sbjct  64   FTILEAPAQQNRLILVINLRCERALG-DKDIGEVNVPIKELL-ETMGDGKSMQFVSYQVR  121

Query  368  SKLGKPRGVLYLSYVFTAYNFLNFPR  445
               GKP+G L  SY F+    ++ P 
Sbjct  122  KPSGKPKGQLNFSYKFSEKAIVSGPE  147



>ref|XP_007035560.1| Soybean gene regulated by cold-2, putative [Theobroma cacao]
 gb|EOY06486.1| Soybean gene regulated by cold-2, putative [Theobroma cacao]
Length=290

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 4/136 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVG-GDRNSAECRTHVDEYRGSRPIWWILAS  187
            T EI + SA+  K   L + KM +YA   L G   ++  + +T VD+  G  P W     
Sbjct  7    TFEINVISAKGLKNVNL-IDKMDVYAIVSLKGDSSKDKQKTKTPVDKDCGKDPTWNFPVK  65

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   ES  + +N+ L F++KC++ +G DK +G   VP+K+  D   S+G   + V+  + 
Sbjct  66   FTIDESLAQKNNLNLKFKIKCERILG-DKELGQVNVPVKELLD-STSEGGSMKFVSYQVR  123

Query  368  SKLGKPRGVLYLSYVF  415
               GKP G L  SY F
Sbjct  124  KPSGKPEGTLNFSYKF  139



>ref|XP_009339820.1| PREDICTED: uncharacterized protein LOC103932014 [Pyrus x bretschneideri]
Length=177

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 69/138 (50%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD---RNSAECRTHVDEYRGSRPIWWIL  181
            TLE+ + SA+  K   L + KM +YA   L G D   R   + +T V    G+ P W   
Sbjct  5    TLELELISAKDIKDVNL-ISKMDVYAVVSLQGDDDSRRKQQKTKTEVARGCGTHPTWNFH  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   E   + + + +VF++ C++++G DK +G   VP+K+ FD   +     + VA  
Sbjct  64   TKFVLDEFLTQQNRLFIVFKLVCQRSLG-DKDIGQVVVPVKELFDSVKADAASMKFVAYQ  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKP+G L  SY F
Sbjct  123  VRKPSGKPKGELNFSYKF  140



>ref|XP_010501388.1| PREDICTED: uncharacterized protein LOC104778636 [Camelina sativa]
Length=214

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 76/159 (48%), Gaps = 7/159 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K   L +GK  LYA   + G  R   + +T VD+  G++P W      
Sbjct  5    SLDLTIISAEDLKDIQL-IGKQDLYAVVSINGDAR--TKQKTKVDKDCGTKPKWKHPMKL  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R + + LVF++   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  62   TVDDAAARENRLTLVFQIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  119

Query  371  KLGKPRGVLYLSYVFTAYNFLNFPRLYVPSAPPMFRALD  487
              GK +G L  S+ F       F     P AP    ALD
Sbjct  120  PNGKTKGSLKFSFKFGEK--YTFGSSSAPHAPVNPSALD  156



>ref|NP_563835.1| protein SRC2 [Arabidopsis thaliana]
 gb|AAB70401.1| Similar to Glycine SRC2 (gb|AB000130). ESTs gb|H76869,gb|T21700,gb|ATTS5089 
come from this gene [Arabidopsis thaliana]
 gb|AAK73938.1| At1g09070/F7G19_6 [Arabidopsis thaliana]
 gb|AAM98291.1| At1g09070/F7G19_6 [Arabidopsis thaliana]
 gb|AEE28391.1| uncharacterized protein AT1G09070 [Arabidopsis thaliana]
Length=324

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 8/154 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K  V  +GK  LYA   + G  R   + +T VD+  G++P W      
Sbjct  5    SLDLTIISAEDLKD-VQLIGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKL  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R++ + LVFE+   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  62   TVDDAAARDNRLTLVFEIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  119

Query  371  KLGKPRGVLYLSYVFT---AYNFLNFPRLYVPSA  463
              GK +G L  S+ F     Y   + P   VPSA
Sbjct  120  PNGKAKGSLKFSFKFGEKYTYGSSSGPHAPVPSA  153



>emb|CAA07573.1| src2-like protein [Arabidopsis thaliana]
Length=324

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 8/154 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K  V  +GK  LYA   + G  R   + +T VD+  G++P W      
Sbjct  5    SLDLTIISAEDLKD-VQLIGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKL  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R++ + LVFE+   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  62   TVDDAAARDNRLTLVFEIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  119

Query  371  KLGKPRGVLYLSYVFT---AYNFLNFPRLYVPSA  463
              GK +G L  S+ F     Y   + P   VPSA
Sbjct  120  PNGKAKGSLKFSFKFGEKYTYGSSSGPHAPVPSA  153



>ref|XP_010090794.1| 16 kDa phloem protein 2 [Morus notabilis]
 gb|EXB40827.1| 16 kDa phloem protein 2 [Morus notabilis]
Length=271

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (49%), Gaps = 4/135 (3%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            +EITI SA+  K+ V  + KM +Y    L GG +   E +T VD+  G  P W    +F 
Sbjct  6    MEITIISAKDLKR-VKHLSKMDVYVLVSLSGGPQ--IEQKTPVDKGSGPNPTWNFPMNFN  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E + +   ++L F+V C + +  DK +G   VP+K+  D      F  + V   +   
Sbjct  63   IDEEDAKKDRLILNFKVMCHRRIHSDKEIGEANVPVKELLDNGGDGKF-VKYVTYQLKKP  121

Query  374  LGKPRGVLYLSYVFT  418
             GK RG L LSY F 
Sbjct  122  NGKHRGQLNLSYKFA  136



>ref|XP_008438876.1| PREDICTED: protein diaphanous homolog 1 [Cucumis melo]
Length=358

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 74/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-------RNSAECRTHVDEYRGSRPI  169
            ++EI I SA       L + KM +Y    L+  D       +++ +  T VD+  GS PI
Sbjct  4    SMEIKIVSARDLYNVNLLM-KMDVYVVVKLLVTDASGKSKPKSAQKFMTPVDKEGGSNPI  62

Query  170  WWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVS-QGFQYQ  346
            W     F   E+ VR + + LVF+++C++N+G D+ +G  YVP+K+  D     +G   Q
Sbjct  63   WNFSVKFSVDEAAVRANCLTLVFKLRCQRNLG-DRDIGEVYVPVKELLDSASEGKGDSMQ  121

Query  347  DVALGISSKLGKPRGVLYLSYVF  415
             ++  +    G P+GVL  ++ F
Sbjct  122  HLSYQVRKPSGNPQGVLNFAFRF  144



>gb|AGW45467.1| cold-regulated protein, partial [Reaumuria trigyna]
Length=252

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 6/140 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNS-----AECRTHVDEYRGSRPIWW  175
            TL++T+ SA+   K V  + K+  YA   L   + +         +T +D+     P W 
Sbjct  5    TLDLTVSSAQDLIK-VNSITKLGTYAVVSLHNHNDHQYASGFTHLKTQIDKKNKENPTWN  63

Query  176  ILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVA  355
                F   ES  +N+++ LVF++K ++ +G DK +G  + PIK+              V+
Sbjct  64   FPMRFTIDESAAQNNSLTLVFQIKSRRLIGTDKLIGEVHAPIKELLSTSTESAKHSHIVS  123

Query  356  LGISSKLGKPRGVLYLSYVF  415
              +    GKP+G+L   Y F
Sbjct  124  YQVQEPSGKPKGMLTFKYQF  143



>ref|XP_009343995.1| PREDICTED: uncharacterized protein LOC103935902 [Pyrus x bretschneideri]
Length=306

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 69/138 (50%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD---RNSAECRTHVDEYRGSRPIWWIL  181
            TLE+ + SA+  K   L + KM +YA   L G D   R   + +T V    G+ P W   
Sbjct  5    TLELELISAKDIKDVNL-ISKMDVYAVVSLQGDDDSRRKQQKTKTEVARGCGTHPTWNFH  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   E   + + + +VF++ C++++G DK +G   VP+K+ FD   +     + VA  
Sbjct  64   TKFVLDEFLTQQNRLFIVFKLVCQRSLG-DKDIGQVVVPVKELFDSVKADAASMKFVAYQ  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKP+G L  SY F
Sbjct  123  VRKPSGKPKGELNFSYKF  140



>gb|EYU43935.1| hypothetical protein MIMGU_mgv1a013059mg [Erythranthe guttata]
Length=231

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 4/138 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
             LEIT++ A+   K V  + KM +Y    + GGD+ S +  ++ VD    + P W    +
Sbjct  5    NLEITLQDAKDLNK-VNLISKMDVYVVVSISGGDKKSKQKTKSPVDHDGDANPKWNFTMN  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD-VALGI  364
            F+  ES ++ + + L F++ C++ +G DK VG   VPIK+  D     G   +  V+  +
Sbjct  64   FKVDESGLQANRLTLDFKLVCERALG-DKDVGEVSVPIKELLDSPARAGGDGKHFVSYQV  122

Query  365  SSKLGKPRGVLYLSYVFT  418
                GKP+G +  SY  +
Sbjct  123  RKPNGKPKGQIAFSYQLS  140



>ref|XP_006305375.1| hypothetical protein CARUB_v10009766mg [Capsella rubella]
 gb|EOA38273.1| hypothetical protein CARUB_v10009766mg [Capsella rubella]
Length=320

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 76/150 (51%), Gaps = 6/150 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K   L +GK  LYA   + G  R   + +T+VD+  G++P W      
Sbjct  5    SLDLTIISAEDLKDIQL-IGKQDLYAVVSINGDART--KQKTNVDKDCGTKPKWKHQMKL  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R++ + LVF++   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  62   TVDDAAARDNRLTLVFQIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  119

Query  371  KLGKPRGVLYLSYVF-TAYNFLNFPRLYVP  457
              GK +G L  S+ F   Y F +    + P
Sbjct  120  PNGKAKGTLKFSFKFGDKYTFGSPSATHAP  149



>emb|CDP19538.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 7/139 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGG-DRNSAECRTHVDEYRGSRPIWWILAS  187
            TLEI   SA+   K V  + KM +Y    + GG D+   + +T VD    + P W     
Sbjct  5    TLEINQLSAKDLNK-VNLITKMDVYVVVSISGGGDKTKQKTKTPVDHDGDTSPSWNFPIK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQ---CVSQGFQYQDVAL  358
            F   E+  R + + LVF+++C++ +G DK +G  +VP+K+  +      + G Q Q V+ 
Sbjct  64   FTVDETAARQNRLTLVFQLRCERALG-DKDIGEVHVPMKELLESAGGAAADGKQ-QFVSY  121

Query  359  GISSKLGKPRGVLYLSYVF  415
             +    GKP+G L  SY F
Sbjct  122  QVRKPSGKPKGQLTFSYKF  140



>gb|EYU45555.1| hypothetical protein MIMGU_mgv1a018032mg [Erythranthe guttata]
Length=314

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 70/140 (50%), Gaps = 6/140 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRN-SAECRTHVDEYRGSRPIWWILAS  187
            TLEITI++A+  KK V  + KM  Y    + GGD+      +T VD    + P W     
Sbjct  5    TLEITIQNAKDLKK-VNLITKMDAYVVVSISGGDKKWRQRTKTPVDHDGDANPTWNFPMK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VAL  358
            F   E+ ++ + +++ F + C++ +G DK +G  +VPIK+  D     G        V+ 
Sbjct  64   FTVEEAALQQNRLIIDFNLVCQRALG-DKDIGEVHVPIKELLDTPAKGGAAAAGKRFVSY  122

Query  359  GISSKLGKPRGVLYLSYVFT  418
             +    GKP+G L  SY F+
Sbjct  123  QVKKPSGKPKGQLSFSYKFS  142



>ref|XP_004159813.1| PREDICTED: uncharacterized protein LOC101229597 [Cucumis sativus]
Length=357

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 74/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-------RNSAECRTHVDEYRGSRPI  169
            ++EI + SA       L + KM +Y    L+  D       +++ +  T VD+  GS PI
Sbjct  4    SMEIKVVSARDLNNVNLLM-KMDVYVLVKLLVTDISGKTKPKSAQKFMTPVDKEGGSNPI  62

Query  170  WWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC-VSQGFQYQ  346
            W     F   E+ VR + + LVF+++C++N+G D+ +G  YVP+K+  D     +G   Q
Sbjct  63   WNFSVKFSVDEAAVRANCLTLVFKLRCQRNLG-DRDIGEVYVPVKELLDSAGEGKGDLMQ  121

Query  347  DVALGISSKLGKPRGVLYLSYVF  415
             ++  +    G P+GVL  ++ F
Sbjct  122  HLSYQVRKPSGSPQGVLNFAFRF  144



>ref|XP_010458174.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
6-like [Camelina sativa]
Length=320

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 77/154 (50%), Gaps = 8/154 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K  +  +GK  LYA   + G  R   + +T VD+  G++P W      
Sbjct  5    SLDLTIISAEDLKD-IQLIGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKL  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R + + LVF++   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  62   TVDDAAARENRLTLVFQIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  119

Query  371  KLGKPRGVLYLSYVF-TAYNF--LNFPRLYVPSA  463
              GK +G L  S+ F   Y F   + P   VPSA
Sbjct  120  PNGKTKGSLKFSFKFGEKYTFGSSSAPHAPVPSA  153



>ref|XP_004134204.1| PREDICTED: uncharacterized protein LOC101222610 [Cucumis sativus]
 gb|KGN57099.1| hypothetical protein Csa_3G153730 [Cucumis sativus]
Length=357

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 74/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-------RNSAECRTHVDEYRGSRPI  169
            ++EI + SA       L + KM +Y    L+  D       +++ +  T VD+  GS PI
Sbjct  4    SMEIKVVSARDLNNVNLLM-KMDVYVLVKLLVTDISGKSKPKSAQKFMTPVDKEGGSNPI  62

Query  170  WWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC-VSQGFQYQ  346
            W     F   E+ VR + + LVF+++C++N+G D+ +G  YVP+K+  D     +G   Q
Sbjct  63   WNFSVKFSVDEAAVRANCLTLVFKLRCQRNLG-DRDIGEVYVPVKELLDSAGEGKGDLMQ  121

Query  347  DVALGISSKLGKPRGVLYLSYVF  415
             ++  +    G P+GVL  ++ F
Sbjct  122  HLSYQVRKPSGSPQGVLNFAFRF  144



>emb|CDY22649.1| BnaC08g42830D [Brassica napus]
Length=306

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 70/152 (46%), Gaps = 6/152 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++TI SAE  K   L +GK  LYA   + G  R   + +T VD+  G++P W       
Sbjct  6    LDLTIISAEDLKDIQL-IGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKLT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  R + + LV E+   + +  DK VG   VP+K+  DQ    G + + V   +   
Sbjct  63   VDDAAARENRLTLVIEIVADRPIAGDKPVGEVSVPVKELLDQNKDGGEEEKTVTYAVRLP  122

Query  374  LGKPRGVLYLSYVFT---AYNFLNFPRLYVPS  460
             GK +G L  S+ F     Y     P   VPS
Sbjct  123  NGKAKGSLKFSFKFGEKYTYGSAIAPHAPVPS  154



>emb|CDY06346.1| BnaA09g48570D [Brassica napus]
Length=256

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 6/152 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++TI SAE  K   L +GK  LYA   + G  R   + +T VD+  G++P W       
Sbjct  6    LDLTIISAEDLKDIQL-IGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKLT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  R + + LV E+   + +  DK VG   VP+K+  DQ    G + + V   +   
Sbjct  63   VDDAAARENRLTLVIEIVADRPIAGDKPVGEVSVPVKELLDQNKDGGEEEKTVTYAVRLP  122

Query  374  LGKPRGVLYLSYVFT---AYNFLNFPRLYVPS  460
             GK +G L  S+ F     Y   + P    PS
Sbjct  123  NGKAKGSLKFSFKFGEKYTYGSASAPHAPGPS  154



>ref|XP_009118327.1| PREDICTED: basic salivary proline-rich protein 2 [Brassica rapa]
Length=322

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 6/152 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++TI SAE  K   L +GK  LYA   + G  R   + +T VD+  G++P W       
Sbjct  6    LDLTIISAEDLKDIQL-IGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKLT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  R + + LV E+   + +  DK VG   VP+K+  DQ    G + + V   +   
Sbjct  63   VDDAAARENRLTLVIEIVADRPIAGDKPVGEVSVPVKELLDQDKDGGEEEKTVTYAVRLP  122

Query  374  LGKPRGVLYLSYVFT---AYNFLNFPRLYVPS  460
             GK +G L  S+ F     Y   + P    PS
Sbjct  123  NGKAKGSLKFSFKFGEKYTYGSASAPHAPGPS  154



>ref|XP_004229314.1| PREDICTED: U1 small nuclear ribonucleoprotein C-like [Solanum 
lycopersicum]
Length=314

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 70/138 (51%), Gaps = 7/138 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD--RNSAECRTHVDEYRGSRPIWWILA  184
            TL+I + S +   K V  + KM +Y    + G D  R++ + +THVD    + P W    
Sbjct  5    TLDINVVSGKDLNK-VNLITKMDVYVVVSISGADDDRSNQKTKTHVDHDGDNNPTWNFPI  63

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI  364
             F   +S    + + LVF+++C++ +G DK +G   VPIK+  +   S     Q V+  I
Sbjct  64   KFTIDDSPAVQNRLHLVFKLRCQRALG-DKDIGQVEVPIKELLE---SSNTTKQFVSYQI  119

Query  365  SSKLGKPRGVLYLSYVFT  418
                GKP+G L  SY F+
Sbjct  120  RKPSGKPKGQLTFSYQFS  137



>ref|XP_009352334.1| PREDICTED: uncharacterized protein LOC103943719 [Pyrus x bretschneideri]
Length=220

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 5/137 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSA---ECRTHVDEYRGSRPIWWILA  184
            LE+ + SA+  K   L + KM +YA   L G D + A   + +T V +  G+ P W    
Sbjct  6    LELELISAKDIKDVNL-ISKMDVYAVVSLQGDDVSRAGKQKTKTKVSQGCGTHPTWNFHM  64

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI  364
             F   E  ++ + + LVF++ C++++G DK +G   VP+K+  D   +     + VA  +
Sbjct  65   KFVLDEYLIQQNRISLVFKLVCQRSLG-DKDIGQVLVPVKELLDSVKADAASMKFVAYQV  123

Query  365  SSKLGKPRGVLYLSYVF  415
                GKP+G L  SY F
Sbjct  124  RMPSGKPKGELEFSYKF  140



>ref|XP_010098296.1| hypothetical protein L484_023544 [Morus notabilis]
 gb|EXB74800.1| hypothetical protein L484_023544 [Morus notabilis]
Length=290

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 73/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TLEI + SA   K  V  V KM +YA   + G  ++  +  +T+V    G+ P W    S
Sbjct  5    TLEINVISASDLKD-VNLVTKMDVYAVVSISGDSKHPKKKAKTNVHRGSGTNPTWNFPLS  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFF---DQCVSQGFQYQDVAL  358
            F   ES  +N+ + LVF++  ++++G DK VG   VPIK+ F   D+  +   ++  V+ 
Sbjct  64   FTIDESLAQNNRLTLVFKLVSQRSLG-DKDVGEVNVPIKELFASRDEGNNNSMKF--VSY  120

Query  359  GISSKLGKPRGVLYLSYVF  415
             +    GKP+G L  SY F
Sbjct  121  QVRKPSGKPKGELRFSYRF  139



>ref|XP_002889732.1| hypothetical protein ARALYDRAFT_470988 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65991.1| hypothetical protein ARALYDRAFT_470988 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 77/154 (50%), Gaps = 8/154 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K  +  +GK  LYA   + G  R   + +T VD+  G++P W      
Sbjct  2    SLDLTIISAEDLKD-IQLIGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKL  58

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R + + LVFE+   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  59   TVDDAAARENRLTLVFEIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  116

Query  371  KLGKPRGVLYLSYVF-TAYNF--LNFPRLYVPSA  463
              GK +G L  S+ F   Y F   + P   VPS+
Sbjct  117  PNGKAKGSLKFSFKFGDKYTFGSSSAPHAPVPSS  150



>ref|XP_010259665.1| PREDICTED: uncharacterized protein LOC104599004 [Nelumbo nucifera]
Length=166

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 74/158 (47%), Gaps = 15/158 (9%)
 Frame = +2

Query  11   TLEITIKSAE----VFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWI  178
            TL+I + SA+    V K  V  + KM++Y     + GD +S + +T  D    + P W  
Sbjct  5    TLDIRLISAQGVKNVRKLQVRSLFKMKVYVVG-FIDGDPDSKQ-QTPADNDGSTNPFWDF  62

Query  179  LASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVAL  358
               F+ HES +R+    LV E+ C + +   K VG   VPIK+ FD+    G +  D+A+
Sbjct  63   QMKFKIHESAIRDDQAHLVLELYCDRRLADPKYVGEVRVPIKELFDRA---GERTSDLAV  119

Query  359  G--ISSKLGKPRGVLYLSYVFTAYNFLNFPRLYVPSAP  466
               ++     P G L   Y F   +  N     +PS P
Sbjct  120  SYPVTQPSQDPEGKLNFWYKFVGVSLPN----EIPSPP  153



>gb|ABE98328.1| SRC2-like protein [Capsicum annuum]
Length=276

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 64/134 (48%), Gaps = 2/134 (1%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + SAE  K  V    KM +YA   +      S   +T VD+  G  P W     F 
Sbjct  6    LDIKVISAENIKN-VNTFSKMDVYAEVFISSYSNKSYRQKTLVDKNSGPNPKWNHSMKFT  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ES +    + LV  +K ++ +G DK +G   VP+ + F+Q  S G   + V   + ++
Sbjct  65   LDESSINKPGLYLVIRLKSERTLG-DKEIGEVSVPVNEMFNQETSSGAAERFVEYPVVTE  123

Query  374  LGKPRGVLYLSYVF  415
             GKP+G L  SY F
Sbjct  124  SGKPKGTLIFSYKF  137



>gb|KDP23491.1| hypothetical protein JCGZ_23324 [Jatropha curcas]
Length=292

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 72/137 (53%), Gaps = 5/137 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILASF  190
            L+IT+ SA+  K  V    KM +YA   + G   NS +  +THVD+  G+ P W     F
Sbjct  6    LQITVISAKDIKD-VNVFSKMDVYAEVSIRGDLYNSKQKQKTHVDKDSGTNPKWNFPMKF  64

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQG--FQYQDVALGI  364
              HE+  + + + L F++   +++G D+ +G  +VPIK+  D+    G   Q Q V+  +
Sbjct  65   TIHETSAQANRLTLQFKLVSDRSLG-DREIGEVHVPIKELLDKKSGDGKTEQEQIVSYSV  123

Query  365  SSKLGKPRGVLYLSYVF  415
             +  GK +G L  S+ F
Sbjct  124  RTPKGKSKGTLNFSFKF  140



>ref|XP_002315561.1| shock protein SRC2 [Populus trichocarpa]
 gb|EEF01732.1| shock protein SRC2 [Populus trichocarpa]
Length=289

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 69/138 (50%), Gaps = 6/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD---RNSAECRTHVDEYRGSRPIWWIL  181
            TLEI + SA   K  V  + KM +YA   + G D   +   + +T VD   G  P W   
Sbjct  5    TLEINVISARDLKD-VNYISKMDVYAVVSISGVDSKQQPKQKTKTPVDRDGGKNPTWNFP  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   E+ +  +++ LVF++KC++ +G DK +G   VPIK+  D     G   + V+  
Sbjct  64   IKFTIPETSLAENHLSLVFKLKCERALG-DKDIGEVNVPIKELLDSA-GDGKSMKFVSYQ  121

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKP+G +  S+ F
Sbjct  122  VRKPSGKPKGEINFSFKF  139



>ref|XP_011044520.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan-1-like 
[Populus euphratica]
Length=289

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 68/138 (49%), Gaps = 6/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD---RNSAECRTHVDEYRGSRPIWWIL  181
            TLEI + SA   K  V  + KM +YA   + G D   +   + +T VD   G  P W   
Sbjct  5    TLEINVISARDLKD-VNYISKMDVYAVVSISGVDSKQQPKQKTKTPVDRAGGKNPTWNFP  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   E+ +  + + LVF++KC++ +G DK +G   VPIK+  D     G   + V+  
Sbjct  64   IKFTIPETSLAENRLSLVFKLKCERALG-DKDIGEVNVPIKELLDSA-GDGKSMKFVSYQ  121

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKP+G +  S+ F
Sbjct  122  VRKPSGKPKGEISFSFKF  139



>ref|XP_006419602.1| hypothetical protein CICLE_v10005548mg [Citrus clementina]
 gb|ESR32842.1| hypothetical protein CICLE_v10005548mg [Citrus clementina]
Length=293

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 68/143 (48%), Gaps = 9/143 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR-NSAECRTHVDEYRGSRPIWWILAS  187
            TL++ + SA+  K  V  + KM +YA   + G       + +THVD   GS P W     
Sbjct  6    TLDLNVISAKHLKD-VHFISKMDVYAVVSISGDHTIKKQKVKTHVDRSGGSNPTWNFPIK  64

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD------  349
            F  +ES  + + + L F++K    +G DK VG   VPIK+  D   S      D      
Sbjct  65   FTFNESLAQQNRLTLDFKIKSDGLLG-DKTVGEVIVPIKELLDSSSSSSSSSGDAKSMKF  123

Query  350  VALGISSKLGKPRGVLYLSYVFT  418
            V   + S  GKP+G L+ SY F+
Sbjct  124  VTYQVRSSSGKPKGELHFSYKFS  146



>ref|XP_010489684.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=320

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 76/159 (48%), Gaps = 7/159 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K  +  +GK  LYA   + G  R   + +T VD+  G++P W      
Sbjct  5    SLDLTIISAEDLKD-IQLIGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHPMKL  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R + + LVF++   + +  DK VG   VP+K+  DQ  ++G + + V   +  
Sbjct  62   TVDDAAARENRLTLVFQIVADRPIAGDKPVGEVSVPVKELLDQ--NKGDEEKTVTYAVRL  119

Query  371  KLGKPRGVLYLSYVFTAYNFLNFPRLYVPSAPPMFRALD  487
              GK +G L  S+ F       F     P AP    ALD
Sbjct  120  PNGKTKGSLKFSFKFG--EKYTFGSSSAPHAPVNPSALD  156



>ref|XP_011071658.1| PREDICTED: neural Wiskott-Aldrich syndrome protein [Sesamum indicum]
Length=284

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 72/137 (53%), Gaps = 6/137 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAEC-RTHVDEYRGSRPIWWILAS  187
            TL+IT++ A+  KK  L +  M +YA   + GG  NS +  RT  D   G  P W     
Sbjct  15   TLDITLRYAKDLKKINL-ISTMDVYAIVSISGGCENSNQTTRTPADREGGRNPTWDFPMR  73

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   E+ ++ + + L  +++C++ +G DK +G  +VP+K+  D     G ++  V+  + 
Sbjct  74   FVVEEAALQQNRLTLDVKLRCERVLG-DKDIGEVHVPVKELLDGGAG-GRKF--VSYQVR  129

Query  368  SKLGKPRGVLYLSYVFT  418
               G+P+G L  SY F+
Sbjct  130  KPSGRPKGQLTFSYKFS  146



>ref|XP_008367154.1| PREDICTED: LOW QUALITY PROTEIN: vasodilator-stimulated phosphoprotein-like 
[Malus domestica]
Length=329

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 70/137 (51%), Gaps = 5/137 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSA---ECRTHVDEYRGSRPIWWILA  184
            LE+ + SA+  K  V  + KM +YA   L G + + A   + +T V +  G+ P W    
Sbjct  6    LELELISAKDIKD-VNLLSKMDVYAVVSLQGDBVSRAXKQKTKTKVSQGCGTHPTWNFHM  64

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI  364
             F   E  ++ + + LVF++ C++++G DK +G   VP+K+  D   +     + VA  +
Sbjct  65   KFVLDEYLIQQNRISLVFKLVCQRSLG-DKDIGQVVVPVKELLDSVKADAASMKFVAYQV  123

Query  365  SSKLGKPRGVLYLSYVF  415
                GKP+G L  SY F
Sbjct  124  RKPSGKPKGELEFSYKF  140



>ref|XP_010549744.1| PREDICTED: small nuclear ribonucleoprotein-associated protein 
B-like [Tarenaya hassleriana]
Length=316

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 3/134 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++TI SAE  K  +  +GK  +YA   + G  R   + +T VD+  G++P W       
Sbjct  6    LDLTIISAEDLKD-IQMIGKQDVYAVVSINGDART--KQKTPVDKDCGTKPKWKHHVKLT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  R + + LVF++   + +  DK +G   VP+K+  DQ    G + + V   +   
Sbjct  63   VDDTAARENRLTLVFQIIADRPIAGDKVIGEVSVPVKELLDQNSKSGDEEKTVTYAVRLP  122

Query  374  LGKPRGVLYLSYVF  415
             GK +G L  S+ F
Sbjct  123  NGKAKGSLKFSFKF  136



>emb|CDP19532.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (48%), Gaps = 16/142 (11%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++TI SAE  K  V    +M +YA   ++G  +N  + +THVD+  G+ P W     F 
Sbjct  6    LDLTIISAEGLKN-VNVFSRMDVYAKVKILGYPKN--KQKTHVDKNGGTAPKWNHHMKFI  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQG--------FQYQD  349
              E  + N  V L+ ++K  +  G DK +G   +PI + F+  V            +YQ 
Sbjct  63   IDEPSLNNPGVSLLIKLKSDRTFGSDKEIGEVNLPISELFNGGVDADTKDSGERVLEYQ-  121

Query  350  VALGISSKLGKPRGVLYLSYVF  415
                + +  GKP+G +  SY F
Sbjct  122  ----VRTSSGKPKGTIKFSYKF  139



>ref|XP_006417616.1| hypothetical protein EUTSA_v10008221mg [Eutrema salsugineum]
 gb|ESQ35969.1| hypothetical protein EUTSA_v10008221mg [Eutrema salsugineum]
Length=320

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 7/154 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++TI SAE  K  +  +GK  LYA   + G  R   + +T VD+  G++P W     F
Sbjct  5    SLDLTIISAEDLKD-IQMIGKQDLYAVVSINGDART--KQKTKVDKDCGTKPKWKHQMKF  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ++  R + + LV E+   + +  DK VG   VP+K+  DQ    G + + V   +  
Sbjct  62   TVDDAAARENRLTLVIEIVADRPIAGDKPVGEVSVPVKEILDQN-KIGDEEKTVTYSVRL  120

Query  371  KLGKPRGVLYLSYVF-TAYNF--LNFPRLYVPSA  463
              GK +G L  S+ F   Y F   + P    PSA
Sbjct  121  PNGKAKGSLKFSFKFGEKYTFGASSAPHAPGPSA  154



>dbj|BAG49728.1| SRC2 homolog [Capsicum chinense]
 dbj|BAG49736.1| SRC2 homolog [Capsicum frutescens]
 dbj|BAG49737.1| SRC2 homolog [Capsicum baccatum]
 dbj|BAG49738.1| SRC2 homolog [Capsicum chacoense]
Length=262

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 2/132 (2%)
 Frame = +2

Query  20   ITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFRTH  199
            I + SAE  K  V    KM +YA   +      S   +T VD+  G  P W     F   
Sbjct  1    IKVISAENIKN-VNTFSKMDVYAEVFISSYSNKSYRQKTLVDKNSGPNPKWNHSMKFTLD  59

Query  200  ESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSKLG  379
            ES +    + LV  +K ++ +G DK +G   VP+ + F+Q  S G   + V   + ++ G
Sbjct  60   ESSINKPGLYLVIRLKSERTLG-DKEIGEVSVPVNEMFNQETSSGAAERFVEYPVVTESG  118

Query  380  KPRGVLYLSYVF  415
            KP+G L  SY F
Sbjct  119  KPKGTLKFSYKF  130



>ref|XP_010475730.1| PREDICTED: small nuclear ribonucleoprotein-associated protein 
B-like [Camelina sativa]
Length=325

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 79/156 (51%), Gaps = 10/156 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNS-AECRTHVDEYRGSRPIWWILAS  187
            +L++TI SAE  K  +  +GK  LYA   +   +R++  + +T VD+  G++P W     
Sbjct  5    SLDLTIISAEDLKD-IQLIGKQDLYAVVSI---NRDARTKQKTKVDKDCGTKPKWKHQMK  60

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
                ++  R + + LVFE+   + +  DK VG   VP+K+  DQ  ++G + + V   + 
Sbjct  61   LTVDDAAARENRLTLVFEIVADRPIAGDKPVGEVSVPVKELLDQQ-NKGDEEKTVTYAVR  119

Query  368  SKLGKPRGVLYLSYVF-TAYNFLNF---PRLYVPSA  463
               GK +G L LS+ F   Y F +    P   VPS 
Sbjct  120  LPNGKTKGSLKLSFKFGEKYTFGSSSAPPHAPVPSG  155



>gb|AFK33423.1| unknown [Medicago truncatula]
Length=233

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 63/135 (47%), Gaps = 2/135 (1%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ + SA+      L   KM +YA   + G   +  + +T +D   G+ P W     F
Sbjct  5    TLELNLSSAKDLNNVNLFY-KMDVYAVVSIFGDPLHKQKTKTPLDREAGTNPTWNFSVKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +E   R + + L   ++C +N+  DK +G+  +P+++        G  +Q V+  +  
Sbjct  64   TFNELLARQNRLTLKITLRCLRNLV-DKNIGSVKIPLRELVHDHTGDGELFQHVSYQVRK  122

Query  371  KLGKPRGVLYLSYVF  415
              GKP+G    SY F
Sbjct  123  PSGKPKGSFNFSYKF  137



>ref|XP_008353231.1| PREDICTED: protein diaphanous homolog 1-like [Malus domestica]
Length=301

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 68/138 (49%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE---CRTHVDEYRGSRPIWWIL  181
            TLE+ + SA+  K  V  + KM +YA   L G D +  +    +T V    G+ P W   
Sbjct  5    TLELELISAKDIKD-VNLMSKMDVYAVVSLQGDDDSGGKQQKTKTKVVRGCGTHPTWNFX  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   E   + + + +VF++ C++++G DK +G   VP+K+ FD   +     + V   
Sbjct  64   TKFVLDEYLTQQNRLFIVFKLVCQRSLG-DKDIGQVVVPVKELFDSVKADAASMKFVXYQ  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKP+G L  SY F
Sbjct  123  VRKPSGKPKGELNFSYKF  140



>ref|XP_003609663.1| hypothetical protein MTR_4g119780 [Medicago truncatula]
 gb|ACJ84338.1| unknown [Medicago truncatula]
 gb|AES91860.1| C2 domain protein [Medicago truncatula]
 gb|AFK45368.1| unknown [Medicago truncatula]
Length=233

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (46%), Gaps = 2/137 (1%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ + SA+      L   KM +YA   + G   +  + +T +D   G+ P W     F
Sbjct  5    TLELNLSSAKDLNNVNLFY-KMDVYAVVSIFGDPLHKQKTKTPLDREAGTNPTWNFSVKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +E   R + + L   ++C +N+  DK +G+  +P+++        G  +Q V+  +  
Sbjct  64   TFNELLARQNRLTLKITLRCLRNLV-DKNIGSVKIPLRELVHDHTGDGELFQHVSYQVRK  122

Query  371  KLGKPRGVLYLSYVFTA  421
              GKP+G    SY F  
Sbjct  123  PSGKPKGSFNFSYKFNP  139



>ref|XP_002516905.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45519.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 66/137 (48%), Gaps = 3/137 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TLEI + SA+  K  V    KM +YA   + G  +   +  +T VD   G  P W   A 
Sbjct  5    TLEIKLISAKDLKD-VNLFSKMDVYAVLSISGDSQQPKQKTKTPVDHDGGINPTWNFPAK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   E+  + + + L  +++C++ +G DK VG  +VPIK+  D     G   Q V   + 
Sbjct  64   FIIIETPAQQNRLNLDIKLRCERALG-DKDVGEVHVPIKELLDSINGDGNSMQFVNYQVR  122

Query  368  SKLGKPRGVLYLSYVFT  418
               GK +G L  S+ F+
Sbjct  123  KPSGKSKGELSFSFKFS  139



>gb|KHN26566.1| hypothetical protein glysoja_019805 [Glycine soja]
Length=259

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 3/133 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA+  K  V    KM +YA   L G   +     THV +  GS P W     F
Sbjct  5    TLELNIISAKDIKN-VNLFSKMDVYAAVSLSGDPLHPQGATTHVHKDAGSNPTWNYPVKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +ES  + + + L  ++   + +G D  +GT +VP+++  D     G  ++ V+  +  
Sbjct  64   SVNESLAKENRLSLEIKLVSDRTLG-DTVIGTVHVPLRELMDNPGDDG-SFRQVSYQVMK  121

Query  371  KLGKPRGVLYLSY  409
            + GK +G L  SY
Sbjct  122  QSGKSKGSLNFSY  134



>ref|XP_009352335.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB1-like [Pyrus 
x bretschneideri]
Length=238

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 69/139 (50%), Gaps = 5/139 (4%)
 Frame = +2

Query  8    LTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWW-IL  181
            +TLE+ + SA+  K  V    KM +YA   ++ GD +  +  ++ V +  G+ P W    
Sbjct  4    MTLEVELISAKGLKD-VNFFTKMSVYAVVSVLDGDSHEQQKTKSFVSQNCGTHPTWNNFH  62

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F    S  + S + L F++ CK+ +G DK +G    PIK+ FD   +       VA  
Sbjct  63   MDFTIDGSLAQQSRLALAFKLFCKRRLG-DKYIGQVVAPIKELFDTMANPNSTMTFVAYH  121

Query  362  ISSK-LGKPRGVLYLSYVF  415
            + SK   KP+G L+ SY F
Sbjct  122  VISKPSSKPKGELHFSYKF  140



>ref|XP_011012859.1| PREDICTED: formin-like protein 18 [Populus euphratica]
Length=302

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 65/140 (46%), Gaps = 6/140 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTH---VDEYRGSRPIWWIL  181
            TLEI + SA   K  V  + KM +YA   + G D      +     VD   G  P W   
Sbjct  5    TLEINVISARGLKD-VNYISKMDVYAVVSISGDDSKQKPKQKTKTPVDRAGGKNPTWNFP  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F    + +  + + LVF +KC++ +G DK VG   VP+K+  D   S G   + V+  
Sbjct  64   IKFSIPPTPLAENRLNLVFNLKCERALG-DKDVGEVNVPVKELLDSA-SDGKSMKFVSYQ  121

Query  362  ISSKLGKPRGVLYLSYVFTA  421
            +    GKP+G +  S+ F+ 
Sbjct  122  VRKPSGKPKGEVSFSFKFSG  141



>ref|XP_004230221.1| PREDICTED: uncharacterized protein LOC101248717 [Solanum lycopersicum]
Length=278

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 5/134 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + SA+  K YV    KM +Y   ++      +++ +T VD+  GS P W     F 
Sbjct  6    LDIKVISADGIK-YVNTFSKMDVYTEVYISSYASKASKQKTFVDKNSGSNPKWNHSMKFT  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ES +  S   LVF +K  + +G DK +G   VP+   F+   S G   + V   + ++
Sbjct  65   LDESFLTKSGTYLVFRLKSDRTLG-DKDIGEVSVPVHDLFN---SNGTVERLVEYPVITE  120

Query  374  LGKPRGVLYLSYVF  415
             GKP+G L  SY F
Sbjct  121  SGKPKGTLKFSYKF  134



>ref|XP_006855523.1| hypothetical protein AMTR_s00057p00209740 [Amborella trichopoda]
 gb|ERN16990.1| hypothetical protein AMTR_s00057p00209740 [Amborella trichopoda]
Length=304

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++T+ SA+  K  V   GKM++YA A+L    R   + RT +D      P W     F 
Sbjct  6    LDVTLVSAKDLKD-VSFFGKMEVYAVAYLSTDPRT--KHRTTIDHSGDRNPSWNFPVKFS  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFF--DQCVSQGFQYQDVALGIS  367
              E+ ++  +  L   ++ +K +G DK VG   +P+K+ F  +Q  ++   YQ     + 
Sbjct  63   VPEAAIQQGHAALQVTIRAEKALG-DKDVGEVKIPLKELFSGEQNTAKTVTYQ-----VL  116

Query  368  SKLGKPRGVLYLSYVF  415
               GKP+G L  SY+F
Sbjct  117  KPSGKPKGSLTFSYMF  132



>ref|XP_008450640.1| PREDICTED: U1 small nuclear ribonucleoprotein C-like [Cucumis 
melo]
Length=268

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 74/159 (47%), Gaps = 10/159 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +LEI I  A   +  V  + KM +YA   + G   N+ + +T VD+  G  P W    SF
Sbjct  5    SLEIRIIKANDLR-VVNLINKMDVYAVVSISGDHLNNQKQKTTVDKDAGPNPNWNFPMSF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDV------  352
               ++ V ++ + L  ++   +++G D+ +G  YV IK+ FD  V +     D       
Sbjct  64   TVDDAAVHDNRLTLKIKLLSDRSLG-DREIGVVYVQIKELFDSIVQREGGGDDTGNKEKF  122

Query  353  -ALGISSKLGKPRGVLYLSYVF-TAYNFLNFPRLYVPSA  463
             +  +    GK +G L L+Y F   YN  + P L   SA
Sbjct  123  GSYSVRLSNGKQKGTLDLAYKFGEKYNVESLPPLPPHSA  161



>ref|XP_010545020.1| PREDICTED: uncharacterized protein LOC104817502 [Tarenaya hassleriana]
Length=254

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 68/138 (49%), Gaps = 7/138 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSA--ECRTHVDEYRGSRPIWWILA  184
            +LEIT+ SA+  KK V  + KM +Y T  L G    +   E RTHV +  G+ P W   A
Sbjct  8    SLEITVASAKGLKK-VKHLSKMDVYVTVKLSGDPAYTGQLEHRTHVAKDGGTSPTWSNSA  66

Query  185  -SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
             +F   E+    + +V+ F++ C ++   +K +G  +VP++   D   +     + +   
Sbjct  67   FTFTIREALANANRLVITFKITCDRS---NKDIGEAHVPVRDLLDHVGADKAGQRYITYK  123

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKPRG +   Y F
Sbjct  124  VKKPNGKPRGEINFFYRF  141



>ref|XP_004487863.1| PREDICTED: ribonucleoprotein RB97D-like [Cicer arietinum]
Length=297

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 3/135 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL++ I SA+  K  V    KM ++A   + G   N     TH     G  P W     F
Sbjct  5    TLDLNILSAKDLKD-VNLFSKMDVFAVVSIAGDPLNPQTATTHTHRDGGKNPTWNYPVKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +ES    + + L  ++   + +  +  +GT ++P+K+  D     G  Y+ V+  +  
Sbjct  64   TVNESLANQNRLSLEVKLISDRTLSGNTVIGTVHIPLKELLDNPA--GDSYRQVSYQVVK  121

Query  371  KLGKPRGVLYLSYVF  415
              GKP+G L LSY F
Sbjct  122  SSGKPQGTLNLSYKF  136



>ref|XP_006489103.1| PREDICTED: uncharacterized protein LOC102622800 isoform X1 [Citrus 
sinensis]
Length=191

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 14/148 (9%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR-NSAECRTHVDEYRGSRPIWWILAS  187
            TL++ + SA+  K  V  + KM +YA   + G       + +THVD   GS P W     
Sbjct  6    TLDLNVISAKHLKD-VHFISKMDVYAVVSISGDHTIKKQKVKTHVDRSGGSNPTWNFPIK  64

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCV-----------SQG  334
            F  +ES  + + + L F++K    +G DK VG   VPIK+  D               + 
Sbjct  65   FTFNESLAQQNRLTLDFKIKSDGLLG-DKTVGEVIVPIKELLDSSSSSSSSSSSRERERD  123

Query  335  FQYQDVALGISSKLGKPRGVLYLSYVFT  418
             +   +   + S  G P+G L+ SY F+
Sbjct  124  AKSMKLITQVRSSSGNPKGELHFSYKFS  151



>gb|KCW85018.1| hypothetical protein EUGRSUZ_B01852 [Eucalyptus grandis]
Length=186

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 5/102 (5%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  K  +  + +M  Y +  L  G     E  THV E  G+ P W  L +F 
Sbjct  6    LEVTVMSAKDLKD-INHLHRMDPYVSVSLTAG----GEQYTHVHENGGTSPRWEDLVTFI  60

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQ  319
              E+  R   + L F++  KK +G DK VGT  +P+K+  +Q
Sbjct  61   VDEATARAGLLSLNFKIMTKKTIGDDKEVGTVELPVKELLEQ  102



>ref|XP_006402342.1| hypothetical protein EUTSA_v10006364mg [Eutrema salsugineum]
 gb|ESQ43795.1| hypothetical protein EUTSA_v10006364mg [Eutrema salsugineum]
Length=264

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/141 (28%), Positives = 72/141 (51%), Gaps = 9/141 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR--NSAECRTHVDEYRGSRPIWWI--  178
            +LEIT+ SA+  +K    V KM ++    L G  +  +  E RT +  + G+  + WI  
Sbjct  5    SLEITVASAKGLEK----VSKMDVFVAVKLSGDPKCSDHREQRTQMAIHSGTS-LKWINE  59

Query  179  LASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVAL  358
            +  F   ++  + + +VL F++KC++  G DK +G  ++P+K+  D   +     + +  
Sbjct  60   VVKFTIDQTLAQANRLVLTFKIKCEQRGGGDKDIGEVHIPVKELLDHLGNDKAGQRYLTY  119

Query  359  GISSKLGKPRGVLYLSYVFTA  421
             I    GKPRG +  +Y F +
Sbjct  120  KIKKANGKPRGDISFTYSFAS  140



>dbj|BAK04679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=263

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 69/136 (51%), Gaps = 5/136 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  KK V    KM++YA   + GGD  +   RTH D + G  P+W     F 
Sbjct  6    LEVTLISAKDLKK-VTVFSKMRVYAVVSISGGDPRTPTHRTHSDRHGGRNPMWHAPLRFP  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
               +      + L   ++ +++ G D+ VG   VP++         G +++ ++  + S 
Sbjct  65   I-PTAADPRGLALHVLLRAERSFG-DRDVGEVLVPVQDLASAAPPAG-EHRHLSYQVRSP  121

Query  374  L-GKPRGVLYLSYVFT  418
            + G+ RGVL++SY  +
Sbjct  122  MSGRKRGVLHISYSLS  137



>ref|XP_004135614.1| PREDICTED: uncharacterized protein LOC101206742 [Cucumis sativus]
 ref|XP_004170375.1| PREDICTED: uncharacterized LOC101206742 [Cucumis sativus]
 gb|KGN66070.1| hypothetical protein Csa_1G569470 [Cucumis sativus]
Length=285

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LEI I  A   K  V  + KM +YA   + G   N+ + +T VD+  G  P W    +F 
Sbjct  6    LEIRIIKAHDLKD-VNLITKMDVYAVVSISGDHLNNQKQKTTVDKDAGPNPSWDFPMTFT  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDV-------  352
              ++ V+++ + L  ++   +++G D+ +G  YV IK+ FD  V +     D        
Sbjct  65   VDDAAVQDNRLTLKIKLLSDRSLG-DREIGVVYVQIKELFDSIVHREGGVDDAGNEVKFG  123

Query  353  ALGISSKLGKPRGVLYLSYVF-TAYNFLNFPRL  448
            +  +    GK +G L L+Y F   +N  + P L
Sbjct  124  SFSVRLSNGKAKGTLDLAYKFGEKHNIESLPPL  156



>ref|XP_006344643.1| PREDICTED: uncharacterized protein LOC102596739 [Solanum tuberosum]
Length=276

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 66/134 (49%), Gaps = 5/134 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + SA+  K  V    KM +Y   ++      +++ +T VD+  G+ P W     F 
Sbjct  6    LDIKVISADGIKN-VNTFSKMDVYTEVYISSYASKASKQKTFVDKNSGTNPKWNHSMKFT  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ES +  S + L+F +K  + +G DK +G   VPI   F+   S G   + V   + ++
Sbjct  65   LDESSLTKSGIYLIFRLKSDRTLG-DKDIGEVSVPIHDLFN---SNGTVERLVEYPVITE  120

Query  374  LGKPRGVLYLSYVF  415
             GKP+G L  SY F
Sbjct  121  SGKPKGTLKFSYKF  134



>gb|KGN60948.1| hypothetical protein Csa_2G030090 [Cucumis sativus]
Length=284

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL++ IK A   K  V    KM +YA   + G  R  ++ +T V +  GS P W     F
Sbjct  5    TLDVNIKRANGLKN-VNLFSKMDVYAVVSISGDPRGKSKQKTPVAKEGGSDPYWNYTMKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VALG  361
               E+ ++++ + L  +    +++G DK +G   VPIK+  D+  ++G + +    V   
Sbjct  64   TIDEAALQSNRLNLKIKFVSDRSLG-DKKIGKVIVPIKRLLDESANKGDEGKSERTVNFS  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            + +  GK +G + LSY F
Sbjct  123  VRTMSGKEKGNVELSYKF  140



>ref|XP_004144785.1| PREDICTED: uncharacterized protein LOC101212570 [Cucumis sativus]
Length=284

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL++ IK A   K  V    KM +YA   + G  R  ++ +T V +  GS P W     F
Sbjct  5    TLDVNIKRANGLKN-VNLFSKMDVYAVVSISGDPRGKSKQKTPVAKEGGSDPYWNYTMKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VALG  361
               E+ ++++ + L  +    +++G DK +G   VPIK+  D+  ++G + +    V   
Sbjct  64   TIDEAALQSNRLNLKIKFVSDRSLG-DKKIGKVIVPIKRLLDESANKGDEGKSERTVNFS  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            + +  GK +G + LSY F
Sbjct  123  VRTMSGKEKGNVELSYKF  140



>gb|KDO36355.1| hypothetical protein CISIN_1g021949mg [Citrus sinensis]
Length=305

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 66/140 (47%), Gaps = 7/140 (5%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR-NSAECRTHVDEYRGSRPIWWILASF  190
            L++ + SA+  K  V  + KM +YA   + G       + ++HVD   GS P W     F
Sbjct  7    LDLNLISAKHLKD-VHLISKMDVYAVVSISGDHTIKKQKVKSHVDRSGGSNPTWNFPIKF  65

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFD----QCVSQGFQYQDVAL  358
              ++S  + + + L F++K    +G DK VG   VPIK+  D             + V  
Sbjct  66   TFNQSLAQQNRLTLDFKIKSDGLLG-DKTVGEVIVPIKELLDSSSSSSSGDAKSMKFVTY  124

Query  359  GISSKLGKPRGVLYLSYVFT  418
             + S  GKP+G L+ SY F+
Sbjct  125  QVRSSSGKPKGELHFSYKFS  144



>ref|XP_004170656.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223680 
[Cucumis sativus]
Length=284

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL++ IK A   K  V    KM +YA   + G  R  ++ +T V +  GS P W     F
Sbjct  5    TLDVNIKRANGLKN-VNLFSKMDVYAVVSISGDPRGKSKQKTPVAKEGGSDPYWNYTMKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VALG  361
               E+ ++++ + L  +    +++G DK +G   VPIK+  D+  ++G + +    V   
Sbjct  64   TIDEAALQSNRLNLKIKFVSDRSLG-DKKIGKVIVPIKRLLDESANKGDEGKSERTVNFS  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            + +  GK +G + LSY F
Sbjct  123  VRTMSGKXKGNVELSYKF  140



>ref|XP_006489264.1| PREDICTED: uncharacterized protein LOC102618659 [Citrus sinensis]
Length=482

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 67/140 (48%), Gaps = 6/140 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR-NSAECRTHVDEYRGSRPIWWILAS  187
             L++ + SA+  K  V  + KM++YA   + G       + +THVD   GS P W     
Sbjct  173  ALDLNVISAKHLKD-VHFISKMEVYAVVSISGDHTIKKQKVKTHVDRSGGSNPTWNFPIK  231

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VAL  358
            F  +ES  + + + L F++K    +G DK VG   +PIK+  D   S     +    V  
Sbjct  232  FTFNESLAQQNRLTLDFKIKSDGLLG-DKTVGEVIIPIKELLDSSSSSSGDAKSMKFVTY  290

Query  359  GISSKLGKPRGVLYLSYVFT  418
             + S   KP+G L+ SY F+
Sbjct  291  QVCSSSEKPKGELHFSYKFS  310



>gb|EMT21195.1| hypothetical protein F775_15531 [Aegilops tauschii]
Length=262

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 69/136 (51%), Gaps = 5/136 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  KK V    KM++YA   + GGD  +   RTH D + G  P+W     F 
Sbjct  6    LEVTLISAKDLKK-VTLFSKMRVYAVVSISGGDPRTPTHRTHSDRHGGRNPMWHAPLRFP  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
               +      + L   ++ +++ G D+ VG   VP++         G +++ ++  + S 
Sbjct  65   I-PTAADPRGLALHVLLRAERSFG-DRDVGEVVVPVQDLVAVAPPAG-EHRHLSYQVRSP  121

Query  374  L-GKPRGVLYLSYVFT  418
            + G+ RGVL++SY  +
Sbjct  122  MSGRKRGVLHISYSLS  137



>ref|NP_001238642.1| cold-regulated protein [Glycine max]
 gb|ACJ39219.1| cold-regulated protein [Glycine max]
Length=290

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 3/133 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA+  K  V    KM +YA   L G   +     THV +  GS P W     F
Sbjct  7    TLELNIISAKDIKN-VNLFSKMDVYAVVTLSGDPLHPQGATTHVHKDAGSNPTWNYPVKF  65

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +ES  + + + L  ++   + +G D  +GT +VP+++  D     G  ++ V+  +  
Sbjct  66   SVNESLAKENRLSLEIKLVSDRTLG-DTVIGTVHVPLRELMDNPGDDG-SFRQVSYQVMK  123

Query  371  KLGKPRGVLYLSY  409
            + GK +G L  SY
Sbjct  124  QSGKSKGSLNFSY  136



>ref|XP_011036850.1| PREDICTED: uncharacterized protein LOC105134212 [Populus euphratica]
Length=303

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 77/161 (48%), Gaps = 17/161 (11%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            +LEIT+ SA+  K  V   GKM +Y    L G D NS +  +THV +  G  P+W     
Sbjct  5    SLEITVISAKDLKD-VNLFGKMDVYCVVSLKGDDYNSKQKQKTHVHKDSGPNPVWNFPLK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   +   + + + L F +K ++ +G DK VG  +VP+ +       +G     ++  +S
Sbjct  64   FTIDDVAAQQNRLKLKFMLKAERMLG-DKDVGVVFVPVNELLGAKDGKG----SLSYSVS  118

Query  368  SKLGKPRGVLYLSYVFTAYNFL-NFPRLYVPSAPPMFRALD  487
            +  G+ +G L         NFL  F   +  +AP M + +D
Sbjct  119  TPRGRMKGTL---------NFLFKFGEKFNVTAPAMAKKMD  150



>ref|XP_002512414.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49866.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 7/136 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
             LEIT+ SA+  K  V    KM +YA   + G   NS +  +T VD+  G+ P W     
Sbjct  5    NLEITLISAKDIKD-VNMFSKMDVYAEVSIKGDHFNSKQKQKTPVDKDCGTNPTWNHSMK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F  HE+  + + + +  ++   ++ G DK +G  +VPIK+  D          +V+ G+ 
Sbjct  64   FNIHEASAQENRLTVQIKLISDRSFG-DKEIGEVHVPIKELIDHKAGDA----NVSYGVR  118

Query  368  SKLGKPRGVLYLSYVF  415
            +  GK +G L  S+ F
Sbjct  119  TPSGKAKGSLNFSFKF  134



>ref|XP_010067355.1| PREDICTED: uncharacterized protein LOC104454253 [Eucalyptus grandis]
Length=222

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +LE+T+ SA+     V  + KM  Y    L G  +     RTHV +  G+ P W  L +F
Sbjct  5    SLEVTVMSAKDLPN-VNVIHKMDPYVIVSLSGNHKQ----RTHVHKNGGTSPRWVKLLTF  59

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQG-FQYQDVALGIS  367
               E+  R   ++L+FE+  +K  G DK VG   VPI +  ++   QG  + + ++  +S
Sbjct  60   PVDEA--RADLLILMFEIMTEKTYGGDKEVGKVEVPIAELLEK---QGDGKPKQISYSVS  114

Query  368  SKLGKPRGVLYLSYVF  415
               GK +GVL  +Y F
Sbjct  115  LPSGKTQGVLEFNYKF  130



>ref|XP_007224302.1| hypothetical protein PRUPE_ppa020127mg [Prunus persica]
 gb|EMJ25501.1| hypothetical protein PRUPE_ppa020127mg [Prunus persica]
Length=292

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (48%), Gaps = 14/163 (9%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TLE+ + SA+  K  V  + KM +YA   L G D +  +  +T V +  G+ P W     
Sbjct  5    TLELELISAKDLKD-VNFISKMDVYAVVSLQGDDSHGKQKTKTKVAKDCGTHPTWNFPMK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VAL  358
            F     E+  + + L F++ C +++G DK +G   VP+K+ FD   +          VA 
Sbjct  64   FTL--DELLLNRLSLEFKLVCDRSLG-DKDIGQVVVPVKELFDSVAAAAADPNSMKFVAY  120

Query  359  GISSKLGKPRGVLYLSYVF----TAYNFLNFPRLY--VPSAPP  469
             +    GKP+G L+ SY F    TA      P+ Y  V +APP
Sbjct  121  QVRKPSGKPKGELHFSYKFGDKVTAPVTAAPPKGYESVTAAPP  163



>ref|XP_008223177.1| PREDICTED: U1 small nuclear ribonucleoprotein C-like [Prunus 
mume]
Length=282

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 8/139 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TLE+ + SA+  K  V  V KM +YA   L G D +  +  +T V +  G+ P W     
Sbjct  5    TLELELISAKDLKD-VNFVSKMDVYAVVSLQGDDSHGKQKTKTKVAKDCGTHPTWNFPMK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VAL  358
            F     E+  + + L F++ C +++G DK +G   VP+K+ FD   +          VA 
Sbjct  64   FTL--DELLLNRLSLEFKLVCDRSLG-DKDIGQVVVPVKELFDSVAAAAADPNSMKFVAY  120

Query  359  GISSKLGKPRGVLYLSYVF  415
             +    GKP+G L+ SY F
Sbjct  121  QVRKPSGKPKGELHFSYRF  139



>gb|EAY96559.1| hypothetical protein OsI_18464 [Oryza sativa Indica Group]
Length=276

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 4/136 (3%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  KK V    KM++YA A + GGD      RTH D   G  P+W     F 
Sbjct  6    LEVTLVSAKNLKK-VTMFSKMRVYAVASISGGDPRVPTHRTHADREGGRSPMWHAPLRFP  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++      + L   ++ ++  G D  VG  +VP+K        +G +++ ++  +   
Sbjct  65   IPDAGADMRAIALHVLLRAERVFG-DSDVGEVFVPVKDLV-AAAPEGGEHRHLSYHVRRP  122

Query  374  L-GKPRGVLYLSYVFT  418
            + G+  GVL++SY  T
Sbjct  123  VSGRKCGVLHISYQIT  138



>ref|NP_001054654.1| Os05g0149100 [Oryza sativa Japonica Group]
 gb|AAU44028.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16568.1| Os05g0149100 [Oryza sativa Japonica Group]
 dbj|BAG98216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 4/136 (3%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  KK V    KM++YA A + GGD      RTH D   G  P+W     F 
Sbjct  6    LEVTLVSAKNLKK-VTMFSKMRVYAVASISGGDPRVPTHRTHADREGGRSPMWHAPLRFP  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++      + L   ++ ++  G D  VG  +VP+K        +G +++ ++  +   
Sbjct  65   IPDAGADMRAIALHVLLRAERVFG-DSDVGEVFVPVKDLV-AAAPEGGEHRHLSYHVRRP  122

Query  374  L-GKPRGVLYLSYVFT  418
            + G+  GVL++SY  T
Sbjct  123  VSGRKCGVLHISYQIT  138



>ref|XP_010024687.1| PREDICTED: formin-F-like [Eucalyptus grandis]
 gb|KCW61128.1| hypothetical protein EUGRSUZ_H03902 [Eucalyptus grandis]
Length=296

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (44%), Gaps = 8/142 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
             L++T+ SA   K  V  + KM +Y    L G  R   + ++  +   G  P+W      
Sbjct  5    NLDLTVISARDLKD-VNLISKMDVYVVVSLEGDHRGPQKSKSPANRDGGRNPVWNFPVKL  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCV------SQGFQYQDV  352
               E   + + + L F+++C + +G DK VG   VP+K+  +             Q   V
Sbjct  64   YVDEPSAQQNRLTLRFKLRCDRALG-DKDVGEVVVPVKELLNSPAPAHADGKATSQPPTV  122

Query  353  ALGISSKLGKPRGVLYLSYVFT  418
               +    GKP+G L+ SY F+
Sbjct  123  TYQVRKPSGKPKGELHFSYKFS  144



>ref|XP_008454313.1| PREDICTED: protein enabled homolog [Cucumis melo]
Length=282

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 4/137 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TL++ IK A   K  V    KM +YA   + G  R  ++ +T V +  GS P W     F
Sbjct  5    TLDVNIKRANGLKN-VNLFSKMDVYAVVSISGDPRGKSKQKTPVAKEGGSDPHWNYPMKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCV--SQGFQYQDVALGI  364
               E+ ++N+ + L  +    ++ G DK +G   VPIK+  D+     +G   + V   +
Sbjct  64   TVDEAALQNNRLNLKIKFVSDRSFG-DKKIGKVIVPIKRLLDESAKGDEGKSERTVNFSV  122

Query  365  SSKLGKPRGVLYLSYVF  415
             +  GK +G +  SY F
Sbjct  123  RTMSGKEKGNVEFSYKF  139



>ref|XP_008390713.1| PREDICTED: C2 domain-containing protein At1g63220 [Malus domestica]
Length=238

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 67/139 (48%), Gaps = 5/139 (4%)
 Frame = +2

Query  8    LTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-RNSAECRTHVDEYRGSRPIWW-IL  181
            +TLE+ + SA+  K  V    KM +YA   ++ GD +   + ++ V +  G+ P W    
Sbjct  4    MTLEVELISAKDLKD-VNFFTKMSVYAVVSVLDGDSQEQQKTKSFVSQNCGTHPTWNNFH  62

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   E   + S + LVF++ CK+ +G DK +G    PIK+ FD   +       VA  
Sbjct  63   MDFTVDECLAQQSRLALVFKLICKRRLG-DKYIGQVVAPIKELFDTMANPNSTMTFVAYH  121

Query  362  -ISSKLGKPRGVLYLSYVF  415
             I+     P+G L  SY F
Sbjct  122  VITXPSSNPKGELRFSYKF  140



>ref|XP_006389230.1| shock protein SRC2 [Populus trichocarpa]
 gb|ERP48144.1| shock protein SRC2 [Populus trichocarpa]
Length=300

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 69/154 (45%), Gaps = 6/154 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTH---VDEYRGSRPIWWIL  181
            TLEI + SA   K  V  + KM +YA   + G D      +     VD   G  P W   
Sbjct  5    TLEINVISARGLKD-VNYISKMDVYAVVSISGDDSKQKPKQKTKTPVDRAGGKNPTWNFP  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
              F   ++ +  + + LV  +KC++ +G DK VG   VP+K+  D     G   + V+  
Sbjct  64   IKFTIPQTPLAENRLNLVCNLKCERALG-DKDVGEVNVPVKELLDSA-GDGKSMKFVSYQ  121

Query  362  ISSKLGKPRGVLYLSYVFTAYNFLNFPRLYVPSA  463
            +    GKP+G +  S+ F+    +  P +   +A
Sbjct  122  VRKPSGKPKGEVSFSFKFSGIEKVVVPEVSTAAA  155



>ref|XP_004963414.1| PREDICTED: uncharacterized protein LOC101762556 [Setaria italica]
Length=279

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 68/136 (50%), Gaps = 5/136 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  K+  L   KM++YA A + GGD      RT+ D   G  P+W     F 
Sbjct  6    LEVTLISAKDLKRVTLFT-KMRVYAVASISGGDPRLPTHRTYADREGGRNPMWHAPLRF-  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
            T         + L   ++ ++  G D+ VG  +VP++        +G + + ++  + S 
Sbjct  64   TIPPAADPRGLALHVLLRAERAFG-DRDVGEVFVPVRDLA-AAAPEGSEQRHLSYQVRSP  121

Query  374  L-GKPRGVLYLSYVFT  418
            + G+ RGVL++SY  T
Sbjct  122  VSGRKRGVLHISYKLT  137



>gb|KCW65470.1| hypothetical protein EUGRSUZ_G02880 [Eucalyptus grandis]
Length=305

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +LE+T+ SA+     V  + KM  Y    L G  +     RTHV +  G+ P W  L +F
Sbjct  88   SLEVTVMSAKDLPN-VNVIHKMDPYVIVSLSGNHKQ----RTHVHKNGGTSPRWVKLLTF  142

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQG-FQYQDVALGIS  367
               E+  R   ++L+FE+  +K  G DK VG   VPI +  ++   QG  + + ++  +S
Sbjct  143  PVDEA--RADLLILMFEIMTEKTYGGDKEVGKVEVPIAELLEK---QGDGKPKQISYSVS  197

Query  368  SKLGKPRGVLYLSYVF  415
               GK +GVL  +Y F
Sbjct  198  LPSGKTQGVLEFNYKF  213



>ref|XP_010046182.1| PREDICTED: uncharacterized protein LOC104435055 [Eucalyptus grandis]
Length=292

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 5/102 (5%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA+  K  +  + +M  Y +  L  G     E  THV E  G+ P W  L +F 
Sbjct  112  LEVTVMSAKDLKD-INHLHRMDPYVSVSLTAG----GEQYTHVHENGGTSPRWEDLVTFI  166

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQ  319
              E+  R   + L F++  KK +G DK VGT  +P+K+  +Q
Sbjct  167  VDEATARAGLLSLNFKIMTKKTIGDDKEVGTVELPVKELLEQ  208



>ref|XP_010104923.1| hypothetical protein L484_006665 [Morus notabilis]
 gb|EXC02371.1| hypothetical protein L484_006665 [Morus notabilis]
Length=224

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 3/134 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+IT+ SA   K  V  + KM +YA   + G   + ++ +THVD+  G  P W     F 
Sbjct  6    LDITLISATDLKD-VNFLSKMDVYAVVSISGDSFSKSKQKTHVDKDSGPNPRWNYTMKFT  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  + + + L  ++   ++ G DK +G  +VPIK+  D    +  +   V   +   
Sbjct  65   VPDAAAKQNQLTLKMKLVSDRSFG-DKEIGEVHVPIKELLDNYGDEKSENL-VTYNVRLP  122

Query  374  LGKPRGVLYLSYVF  415
             GK +G L  SY F
Sbjct  123  SGKSKGTLSFSYKF  136



>ref|XP_006382496.1| hypothetical protein POPTR_0005s02680g [Populus trichocarpa]
 gb|ERP60293.1| hypothetical protein POPTR_0005s02680g [Populus trichocarpa]
Length=448

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 77/161 (48%), Gaps = 17/161 (11%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            +LEIT+ SA+  K   L  GKM +Y    L G D NS +  +THV +  G  P+W     
Sbjct  5    SLEITVISAKDLKDANL-FGKMDVYCVVSLKGDDYNSKQKQKTHVHKDSGPNPVWNFPLK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   +   + + + L F +K ++ +G DK VG  +VP+ +       +G     ++  ++
Sbjct  64   FTIDDVAAQQNRLKLKFMLKAERMLG-DKDVGVVFVPVNELLGAKDGKG----SLSYSVT  118

Query  368  SKLGKPRGVLYLSYVFTAYNFL-NFPRLYVPSAPPMFRALD  487
            +  G+ +G L         NFL  F   +  +AP M + +D
Sbjct  119  APRGRMKGTL---------NFLFKFGEKFNVTAPAMAKKMD  150



>ref|XP_010103360.1| hypothetical protein L484_002544 [Morus notabilis]
 gb|EXB95529.1| hypothetical protein L484_002544 [Morus notabilis]
Length=224

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 3/134 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+IT+ SA   K  V  + KM +YA   + G   + ++ +THVD+  G  P W     F 
Sbjct  6    LDITLISATDLKD-VNFLSKMDVYAVVSISGDSFSKSKQKTHVDKDSGPNPRWNYTIKFT  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  + + + L  ++   ++ G DK +G  +VPIK+  D    +  +   V   +   
Sbjct  65   VPDAAAKQNQLTLKIKLVSDRSFG-DKEIGEVHVPIKELLDNYGDEKSENL-VTYNVRLP  122

Query  374  LGKPRGVLYLSYVF  415
             GK +G L  SY F
Sbjct  123  SGKSKGTLSFSYKF  136



>ref|XP_010024685.1| PREDICTED: uncharacterized protein LOC104415126 [Eucalyptus grandis]
Length=144

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (42%), Gaps = 11/142 (8%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
             L++ + SA   K  V  + KM +Y    L G  R   + ++  +   G  P+W      
Sbjct  5    NLDLIVISARDLKD-VNLISKMDVYVVISLEGDHRGPQKSKSPANRDGGRNPVWNFPVKL  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVS---------QGFQY  343
               E   + + + L F+++C + +G DK VG   VP+K+  D                Q 
Sbjct  64   YVDEPSTQQNRLTLRFKLRCDRALG-DKDVGEVVVPVKELLDSPAPAHADGKASWATSQP  122

Query  344  QDVALGISSKLGKPRGVLYLSY  409
              V   +    GKP+G L+ SY
Sbjct  123  PTVTYQVRKPSGKPKGELHFSY  144



>gb|EYU23908.1| hypothetical protein MIMGU_mgv1a025191mg, partial [Erythranthe 
guttata]
Length=123

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 4/117 (3%)
 Frame = +2

Query  17   EITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFRT  196
            EITI SAE  +  V  +GKM+++A   +  G     E RT  D +    P W     +  
Sbjct  7    EITIISAENLED-VRLIGKMEVHARVSI--GGSPEREKRTPTDTHGKRNPAWNYTMEYTI  63

Query  197  HESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
              S + N N +LV ++ C +N+G D+ VG  +V +K+ FD     G   ++V + ++
Sbjct  64   MASVLDNYNSMLVVKLYCSRNLG-DRYVGEVHVSMKRLFDDVAGGGRSGREVTIPVT  119



>gb|KEH37271.1| C2 domain protein [Medicago truncatula]
Length=323

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA+  K  V    KM +YA   + G   N     TH     G+ P W     F
Sbjct  7    TLELNIISAKDLKN-VNLFSKMDVYAVVSISGDPLNPQTATTHRHRDGGTSPTWNFPVKF  65

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              ++S    + + L  ++   + V  D  +G  ++P+K+  D     G  ++ V   + +
Sbjct  66   TINDSLANQNRLSLEVKLISDRTVAGDTLIGKVHIPLKELLDNP--SGDSFRQVNYQVRT  123

Query  371  KLGKPRGVLYLSYVF  415
              GK +G L LSY F
Sbjct  124  SSGKAKGNLNLSYKF  138



>gb|EPS60709.1| hypothetical protein M569_14094 [Genlisea aurea]
Length=247

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 10/141 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
             L+IT++ A+   K  L + KM++YA   +  G  N+ +  RT  D      P W     
Sbjct  5    ALDITVQHAKDLNKVNLLM-KMEVYAVVSVFNGATNTKQRVRTPPDRDGDDNPTWDFPIK  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD----VA  355
            F   E+ ++ + + LVF + C++ +G D+ VG  + PIK+      +QG    D    V+
Sbjct  64   FAVDEAALQMNALTLVFRLICRRALG-DRYVGEVHAPIKELLG---AQGKSSADGRVFVS  119

Query  356  LGISSKLGKPRGVLYLSYVFT  418
              +    GKP+G +   Y F+
Sbjct  120  YQVRKADGKPKGQISFCYRFS  140



>gb|ABO82573.1| unknown [Helianthus petiolaris]
Length=230

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V E  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHEDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_010528895.1| PREDICTED: uncharacterized protein LOC104805887 [Tarenaya hassleriana]
Length=353

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 70/151 (46%), Gaps = 9/151 (6%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L++TI SA+  K   L +GK  +YA   + G  R   + +T VD+  G++P W       
Sbjct  63   LDLTIISAKDLKDIQL-IGKQDVYAVVSINGDART--KQKTPVDKDCGTKPKWKHHVKLT  119

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ++  R + + LVF++   + +  DK +G   VP+++  +     G   + +   +   
Sbjct  120  VDDAAARENRLNLVFQIVAYRPIAGDKIIGEVTVPVRELLEYNSKSGDGEKKLTYAVRLP  179

Query  374  LGKPRGVLYLSYVFTAYNFLNFPRLYVPSAP  466
             GK +G L  SY F    F      YVP+ P
Sbjct  180  SGKTKGSLKFSYKF-GEKF-----TYVPNGP  204



>ref|XP_003594901.1| Cold-regulated protein [Medicago truncatula]
 gb|AES65152.1| cold-regulated protein [Medicago truncatula]
Length=153

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 59/135 (44%), Gaps = 3/135 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA+  K   L   +M +YA   ++G   N     TH+  + G  P W I   F
Sbjct  7    TLELDIISAKDLKDVNL-FSQMSVYAIVSILGDPLNPQITTTHIHRHAGRNPTWNIPVKF  65

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +ES    + + L  ++   +   P   +G   +P+K   D   + GFQ         S
Sbjct  66   AVNESLAYYNRLSLEVKLISYRKFLPCSTIGKVRIPLKGLLDNPANAGFQLSYQVRKKRS  125

Query  371  KLGKPRGVLYLSYVF  415
            +  K +G L LSY F
Sbjct  126  R--KSKGTLNLSYKF  138



>ref|XP_008223176.1| PREDICTED: uncharacterized protein LOC103322998 [Prunus mume]
Length=214

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 75/161 (47%), Gaps = 18/161 (11%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-RNSAECRTHVDEYRGSRPIWWILA-  184
            T+++ + SA+  K  V    KM +YA   ++G D R+  + +T      G+ P W     
Sbjct  5    TVQLELISAKDLKDDVNFFTKMSVYAVVSVLGCDHRSQQKTKTLAVRNCGTHPKWNNFPM  64

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFD------QCVSQGFQYQ  346
            +F   E   + + + L+F + CK+ +  DK +G    PIK+ FD      +C      YQ
Sbjct  65   NFTIDEYLAQQNRLALLFRLVCKRRLLGDKDIGQVVSPIKELFDAMADPSKCTMTFAAYQ  124

Query  347  DVALGISSKLGKPRGVLYLSYVFTAYNFLNFPRLYVPSAPP  469
             V        GKP+G L+ SY F+    ++      P+APP
Sbjct  125  VV----RKPSGKPKGELHFSYKFSDKVTVS------PAAPP  155



>gb|EPS59428.1| hypothetical protein M569_15381 [Genlisea aurea]
Length=279

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 10/136 (7%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + SAE  K  V  +GKM LYA   L G     +  +++VD+  G  P W     F 
Sbjct  8    LKINLISAEGLKD-VKLIGKMDLYAEVSLAG--YPQSNKKSYVDKNSGPNPKWNFKTEFV  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD--VALGIS  367
              E  +    + L+ ++  +     DK VG+  VP+ + F      G  ++D  V   + 
Sbjct  65   VDEPYLTKPGLTLLVQIMDEGTFN-DKVVGSVSVPVHELF----RGGDSHEDRVVEYQVH  119

Query  368  SKLGKPRGVLYLSYVF  415
            ++ GKP+G L  SY F
Sbjct  120  TQSGKPKGTLKFSYRF  135



>ref|NP_001236659.1| src2 protein [Glycine max]
 dbj|BAA19769.1| SRC2 [Glycine max]
Length=290

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 63/135 (47%), Gaps = 3/135 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA+  K  V    KM +YA   L G   +     THV +  GS P W     F
Sbjct  7    TLELNIISAKDIKN-VNLFSKMDVYAAVSLSGDPLHPQGATTHVHKDAGSNPTWNYPVKF  65

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +ES  + + + L  ++   + +G D  +GT +VP+++  D        ++ V+  +  
Sbjct  66   SVNESLAKENRLSLEIKLISDRTLG-DTVIGTVHVPLRELLDNPGDDS-SFRQVSYQVMK  123

Query  371  KLGKPRGVLYLSYVF  415
            +  K +G L  SY F
Sbjct  124  QSRKSKGSLNFSYKF  138



>gb|ABO82521.1| unknown [Helianthus annuus]
Length=195

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82553.1| unknown [Helianthus anomalus]
Length=229

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82566.1| unknown [Helianthus petiolaris]
Length=231

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK RG L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQRGSLNFSYKF  107



>gb|EYU23910.1| hypothetical protein MIMGU_mgv1a015398mg [Erythranthe guttata]
Length=159

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (49%), Gaps = 7/136 (5%)
 Frame = +2

Query  17   EITIKSAEVFKKY-VLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            EIT+ SA   +   +LC  KM+++A    +GG     E RT  D++    P W     + 
Sbjct  7    EITLISANNLENVRMLC--KMKVHARVS-IGGSSPETEKRTPTDKHGEVNPAWNFTMRYT  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E+ + N N +LV ++ CK+ +G D+ VG  + P+K+ F+   + G       L +  +
Sbjct  64   ISETMLENYNSMLVVKLYCKRKMG-DRYVGEIHTPMKELFEYAKNGGAGTNAAVLTLPVQ  122

Query  374  LG--KPRGVLYLSYVF  415
             G    +G L  SY F
Sbjct  123  KGCVNSQGALRFSYRF  138



>ref|XP_007138900.1| hypothetical protein PHAVU_009G247100g [Phaseolus vulgaris]
 gb|ESW10894.1| hypothetical protein PHAVU_009G247100g [Phaseolus vulgaris]
Length=305

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA+  K  V    KM +YA   L G   +     T VD+  GS P W     F
Sbjct  5    TLELNIVSAKDIKN-VNLFSKMDVYAVVSLTGDPFHLQSATTQVDKDSGSNPKWNFPVKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
              +E+  + + + L  ++   + +G D  +GT +VP+++  D         ++V+  +  
Sbjct  64   SVNEALAKENRLTLEIKLFSDRTLG-DTLIGTVHVPLRELVDNPGDDNGS-RNVSYKVLK  121

Query  371  KLGKPRGVLYLSYVFT  418
              GK +G L  SY F 
Sbjct  122  SSGKSKGSLNFSYKFA  137



>gb|ABO82557.1| unknown [Helianthus anomalus]
Length=229

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTIDEAARLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_009138716.1| PREDICTED: uncharacterized protein LOC103862775 [Brassica rapa]
Length=272

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 66/142 (46%), Gaps = 9/142 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR--NSAECRTHVDEYRGSRPIWWI-L  181
            +LEI + SA+  +K    V KM ++    L G  +  +  E RT V    G+ P W   L
Sbjct  6    SLEINVTSAKGLEK----VSKMDVFVAVKLSGDPKCSDHREQRTQVARDSGTSPRWVDGL  61

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGP--DKCVGTTYVPIKQFFDQCVSQGFQYQDVA  355
              F   ++    + +VL F++KC++  G   DK +G  +VP+K+  D         + V 
Sbjct  62   MKFTIDQTLAEANRLVLTFKIKCEQRGGGGGDKDIGEVHVPVKELLDHLGKDKAGQRYVT  121

Query  356  LGISSKLGKPRGVLYLSYVFTA  421
              I    GKP G +  +Y FT 
Sbjct  122  YKIKKTNGKPGGDISFTYSFTG  143



>gb|ABO82532.1| unknown [Helianthus annuus]
Length=230

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82534.1| unknown [Helianthus annuus]
Length=230

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_004296826.1| PREDICTED: uncharacterized protein LOC101304564 [Fragaria vesca 
subsp. vesca]
Length=291

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 69/136 (51%), Gaps = 5/136 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILAS  187
            TLE+ + SA+  K  V  + KM +YA   L G   N  +  +T +    G+ P +     
Sbjct  5    TLELELVSAKDLKD-VNLISKMDVYAVVSLDGDAYNGKQKTKTKLVPNCGTNPTFNFPMR  63

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGIS  367
            F   +S  + + + L  ++ C++++G DK +G  +VP+K+ FD    +  ++  ++  + 
Sbjct  64   FTLDDSLTQQNRLSLEVKLVCERSLG-DKDIGAVHVPVKELFDSADPKNMKF--ISYQVR  120

Query  368  SKLGKPRGVLYLSYVF  415
               G+P+G L  SY F
Sbjct  121  RPSGRPKGELSFSYKF  136



>emb|CDX89149.1| BnaA04g00370D [Brassica napus]
Length=272

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 66/142 (46%), Gaps = 9/142 (6%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR--NSAECRTHVDEYRGSRPIWWI-L  181
            +LEI + SA+  +K    V KM ++    L G  +  +  E RT V    G+ P W   L
Sbjct  6    SLEINVTSAKGLEK----VSKMDVFVAVKLSGDPKCSDHREQRTQVARDSGTSPRWVDGL  61

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGP--DKCVGTTYVPIKQFFDQCVSQGFQYQDVA  355
              F   ++    + +VL F++KC++  G   DK +G  +VP+K+  D         + V 
Sbjct  62   MKFTIDQTLAEANRLVLTFKIKCEQRGGGGGDKDIGEVHVPVKELLDHLGKDKAGQRYVT  121

Query  356  LGISSKLGKPRGVLYLSYVFTA  421
              I    GKP G +  +Y FT 
Sbjct  122  YKIKKTNGKPGGDISFTYSFTG  143



>gb|ABO82547.1| unknown [Helianthus anomalus]
Length=230

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|AEJ08746.1| RSI4 [Solanum tuberosum]
Length=252

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 56/114 (49%), Gaps = 4/114 (4%)
 Frame = +2

Query  74   MQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCK  253
            M +Y   ++      +++ +T VD+  G+ P W     F   ES +  S + LVF +K  
Sbjct  1    MDVYTEVYISSYASKASKQKTFVDKNSGTNPKWNHSMRFTLDESSLTKSGIYLVFRLKSD  60

Query  254  KNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            + +G DK +G   VPI   F+   S G   + V   + ++ GKP+G L  SY F
Sbjct  61   RTLG-DKDIGEVSVPIHDLFN---SNGTMERFVEYPVITESGKPKGTLKFSYKF  110



>gb|ABO82548.1| unknown [Helianthus anomalus]
Length=230

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_009589677.1| PREDICTED: protein cappuccino-like [Nicotiana tomentosiformis]
Length=293

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 3/134 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + +A+  K  V    KM +Y     +    N+ + +T V +  G+ P W     F 
Sbjct  6    LDIKVIAADGIKN-VNTFSKMDVYVEVS-ISYPSNTNKQKTFVHKNSGTNPKWNHSMKFT  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E+ +    + L+F +K ++ +G D  +G   VPI   F+Q  S G   + V   + ++
Sbjct  64   LVETSLTKPGLYLIFRLKSERTLG-DTKIGEVSVPIHDLFNQSTSNGTAEKFVEYPVITE  122

Query  374  LGKPRGVLYLSYVF  415
             GKP+G L  SY F
Sbjct  123  SGKPKGTLKFSYKF  136



>gb|ABO82555.1| unknown [Helianthus anomalus]
Length=230

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSDKQVSYQVRTPSGKQKGSLTFSYKF  107



>gb|ABO82530.1| unknown [Helianthus annuus]
Length=230

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82575.1| unknown [Helianthus petiolaris]
Length=231

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D    +G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKEGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82574.1| unknown [Helianthus petiolaris]
Length=231

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D    +G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKEGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82558.1| unknown [Helianthus anomalus]
Length=232

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D   + G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSNDGASEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82544.1| unknown [Helianthus anomalus]
Length=230

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLTFSYKF  107



>gb|EYU23914.1| hypothetical protein MIMGU_mgv1a014694mg [Erythranthe guttata]
Length=181

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 75/156 (48%), Gaps = 24/156 (15%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            T ++T+ SA   K  V  +GK +++A   + G     AE RT  D +  + P W    ++
Sbjct  5    TFDLTVSSATDVKD-VRLLGKTEVHARISIAGSP--DAERRTPTDTHGKTNPAWNFTTNY  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCV---------SQGFQY  343
               ES + NSN VLV ++ C +++G D+ +G   + +K+ F++           S+ F+ 
Sbjct  62   TVFESMLMNSNTVLVVKLYCTRSMG-DRYIGEVNMTLKELFERAEPDKVAAKKGSKEFEL  120

Query  344  QD---VALGISSKLGKP--------RGVLYLSYVFT  418
             +   +  G S+ L  P        +G L +SY F+
Sbjct  121  HEGEAINRGRSAMLALPLQKGSVKSQGTLIISYSFS  156



>ref|XP_010652026.1| PREDICTED: uncharacterized protein LOC104879761 [Vitis vinifera]
Length=273

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 3/104 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +LEIT+ SA   KK V  + KM +Y  A  V GD  S + +T V +  GS P W     F
Sbjct  4    SLEITLVSANGIKK-VKHISKMDVYVVA-TVSGDPQSLQ-KTPVHKDGGSNPTWNFTMKF  60

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC  322
               ES  +  +++L+F+++C ++V  DK +G   V +K+  +  
Sbjct  61   TIDESLAQLDHLMLIFQLRCCRHVRADKDIGEANVSVKELLNHA  104



>ref|XP_009384169.1| PREDICTED: basic proline-rich protein-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 64/135 (47%), Gaps = 5/135 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            T+E+T+ SA      V    KM +YA   + G  R+S   RT  D+  G  P W +   F
Sbjct  6    TMEVTMISANDLND-VNIFSKMDVYAVVSIAGEPRSSQ--RTPTDKNCGKNPSWNVTLRF  62

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
                     + +VL   ++ ++ +G D+ VG  +VP+K+      S   Q+    +   S
Sbjct  63   SVPADPDAAARLVLHVLLRSERALG-DRDVGEVHVPVKELQPPSSSSAPQFVSYQVRKPS  121

Query  371  KLGKPRGVLYLSYVF  415
              GKP+GVL LS+ F
Sbjct  122  S-GKPKGVLNLSFRF  135



>ref|XP_010684409.1| PREDICTED: splicing factor 3B subunit 4-like [Beta vulgaris subsp. 
vulgaris]
Length=350

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 66/146 (45%), Gaps = 11/146 (8%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+T+ SA+  K  V  +GKM +Y   HL    +N  +   H D   G+ P W  +  F
Sbjct  5    TLELTLISAKDLKN-VNLIGKMDVYVVVHLSDDPKNKQKTPVHQD--GGTNPSWNYVMRF  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFF----DQCVSQGFQYQDVAL  358
               ++        +V  +K +  +G DK +G   +P+K+      D    Q   YQ    
Sbjct  62   TVDDAVAAKPGKYVVLTLKHETTLGADKDLGEVLLPLKELLEGVKDPSSPQFVTYQ--VK  119

Query  359  GISSKLGKPRGVLYLSYVFTAYNFLN  436
             +SS  GK +G + LSY F     +N
Sbjct  120  RVSS--GKAQGEIKLSYKFIDMGHIN  143



>gb|ABO82522.1| unknown [Helianthus annuus]
Length=195

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_008354349.1| PREDICTED: protein diaphanous homolog 1-like [Malus domestica]
Length=325

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 5/138 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHL-VGGDRNSAECRTHVDEYRG--SRPIWWIL  181
            TLE+ + SA+  K   L + KM +YA   L V  D    + +T     RG  + P W   
Sbjct  5    TLELELISAKDIKDVRLIL-KMDVYAVVSLQVDDDSRGKQQKTMTKVARGCGTHPTWNFH  63

Query  182  ASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALG  361
             +F   E   + + + +VF++ C+ + G DK +G   VP+K+ FD   +     + V   
Sbjct  64   VNFVLDEYLTQQNRLFIVFKLVCQHSHG-DKDIGQVVVPVKELFDSVKADAASMKFVTYQ  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            +    GKP+G L  S  F
Sbjct  123  VRKPSGKPKGELNFSSKF  140



>gb|KCW65300.1| hypothetical protein EUGRSUZ_G02756, partial [Eucalyptus grandis]
Length=137

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 65/135 (48%), Gaps = 9/135 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +LE+T+ SA+     V  + KM  Y    L G  +     RTHV +  G+ P W  L +F
Sbjct  5    SLEVTVMSAKDLHN-VNFIHKMDPYVIVSLSGNHKQ----RTHVHKNGGTSPRWVKLLAF  59

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               E+      ++L+FE+  +K  G DK VG   VPI +  ++      + + ++  +S 
Sbjct  60   PVDEACA--DLLILMFEIMTEKTYGGDKEVGRVEVPIAELLEK--RGDGKPKQISYSVSL  115

Query  371  KLGKPRGVLYLSYVF  415
              GK +GVL   Y F
Sbjct  116  PSGKTQGVLEFKYKF  130



>gb|ABO82568.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82551.1| unknown [Helianthus anomalus]
Length=232

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGASEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_007208693.1| hypothetical protein PRUPE_ppa1027138mg [Prunus persica]
 gb|EMJ09892.1| hypothetical protein PRUPE_ppa1027138mg [Prunus persica]
Length=200

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 7/138 (5%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILA-SF  190
            LEITI SA   K  V    KM +YA A  V GD  + + +T V +  G+ P W   +  F
Sbjct  6    LEITIVSASDLKD-VNMFSKMDVYA-AVSVSGDPGNKKQKTPVAKDGGTNPKWNNYSIKF  63

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD---VALG  361
               ++ + ++ + L  E+  ++++G D  +G+  +P+K+ FD      +Q +    V   
Sbjct  64   TLDDAALLDNRLTLNIELVSERSLG-DTKIGSVQIPLKELFDSLGGGDYQKKQIKYVGYS  122

Query  362  ISSKLGKPRGVLYLSYVF  415
            + +  GKP+G +   Y F
Sbjct  123  VQTSSGKPKGSINFGYKF  140



>gb|ABO82543.1| unknown [Helianthus anomalus]
Length=230

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGKSEKQVSYQVRTPSGKQKGSLTFSYKF  107



>gb|ABO82524.1| unknown [Helianthus annuus]
Length=230

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82541.1| unknown [Helianthus anomalus]
 gb|ABO82546.1| unknown [Helianthus anomalus]
 gb|ABO82550.1| unknown [Helianthus anomalus]
Length=231

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82559.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82540.1| unknown [Helianthus anomalus]
Length=233

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGASEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_002319528.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE95451.1| C2 domain-containing family protein [Populus trichocarpa]
Length=289

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 65/135 (48%), Gaps = 6/135 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILASF  190
            LEIT+ S +  K  V   GKM LY    + G    S +  +THV +  G  P+W     F
Sbjct  6    LEITVASGKDLKD-VNVFGKMDLYCVVSIKGDPHKSKQKQKTHVHKDCGPNPLWNFPMKF  64

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               E+  + + + + F++  ++ +G DK VG   VP+K+  D    +G     ++  + +
Sbjct  65   NIDEAAAQQNRLQIKFKLLAERMMG-DKEVGVVSVPVKELLDSKDGKGGL---MSYAVKT  120

Query  371  KLGKPRGVLYLSYVF  415
              GK +G L  S+ F
Sbjct  121  PSGKMKGTLSFSFNF  135



>gb|ABO82535.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82528.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82525.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82538.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_009798433.1| PREDICTED: adhesive plaque matrix protein-like [Nicotiana sylvestris]
Length=289

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 64/134 (48%), Gaps = 3/134 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + +A+  K  V    KM +Y    +    + + + +T V +  G+ P W     F 
Sbjct  6    LDIKVIAADGIKN-VNTFSKMDVYVEVSISYPSQTNKQ-KTFVHKNSGTNPKWNHSMKFT  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E+ +    + L+F +K ++ +G D  +G   VPI   F+Q  S G   + V   + ++
Sbjct  64   LDETSLTKPGLYLIFRLKSERTLG-DTKIGEVSVPIHDLFNQSTSNGTAERFVEYPVITE  122

Query  374  LGKPRGVLYLSYVF  415
             GKP+G L  SY F
Sbjct  123  SGKPKGTLKFSYKF  136



>gb|EYU22926.1| hypothetical protein MIMGU_mgv1a015358mg [Erythranthe guttata]
Length=160

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 2/107 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
             EIT+ SA   +K +  + KM++YAT   +GG     E RT  D    S P W     + 
Sbjct  6    FEITLISANNLEK-IRRICKMKVYATVS-IGGGPPENEKRTPTDRNGESNPAWNFTVKYS  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQG  334
             +ES V++ N +LV ++ C++ +  D  +G  +  +K+ FD   S G
Sbjct  64   INESMVQHLNTMLVVKLFCRRLLRCDTYIGEVHTSLKELFDYAESSG  110



>gb|ABO82549.1| unknown [Helianthus anomalus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82562.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82564.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82536.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GIAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82519.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82561.1| unknown [Helianthus petiolaris]
 gb|ABO82570.1| unknown [Helianthus petiolaris]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82560.1| unknown [Helianthus petiolaris]
 gb|ABO82563.1| unknown [Helianthus petiolaris]
 gb|ABO82565.1| unknown [Helianthus petiolaris]
 gb|ABO82569.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82523.1| unknown [Helianthus annuus]
Length=231

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82520.1| unknown [Helianthus annuus]
 gb|ABO82526.1| unknown [Helianthus annuus]
 gb|ABO82527.1| unknown [Helianthus annuus]
 gb|ABO82529.1| unknown [Helianthus annuus]
 gb|ABO82533.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82531.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82537.1| unknown [Helianthus annuus]
 gb|ABO82539.1| unknown [Helianthus annuus]
Length=230

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82567.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82571.1| unknown [Helianthus petiolaris]
 gb|ABO82572.1| unknown [Helianthus petiolaris]
Length=231

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_006489104.1| PREDICTED: uncharacterized protein LOC102622800 isoform X2 [Citrus 
sinensis]
Length=182

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 52/103 (50%), Gaps = 3/103 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDR-NSAECRTHVDEYRGSRPIWWILAS  187
            TL++ + SA+  K  V  + KM +YA   + G       + +THVD   GS P W     
Sbjct  6    TLDLNVISAKHLKD-VHFISKMDVYAVVSISGDHTIKKQKVKTHVDRSGGSNPTWNFPIK  64

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFD  316
            F  +ES  + + + L F++K    +G DK VG   VPIK+  D
Sbjct  65   FTFNESLAQQNRLTLDFKIKSDGLLG-DKTVGEVIVPIKELLD  106



>gb|ABO82542.1| unknown [Helianthus anomalus]
Length=231

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSDKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82556.1| unknown [Helianthus anomalus]
Length=230

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSDKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|ABO82552.1| unknown [Helianthus anomalus]
Length=229

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (46%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGGSDPSWNFPMKFAVDEAAGLQNRLTLVVEIKHDGAFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L   Y F
Sbjct  63   GLAHVPIKELLDGLSKDGTSDKQVSYQVRTPSGKQKGSLTFPYKF  107



>ref|XP_010445373.1| PREDICTED: uncharacterized protein LOC104728029 [Camelina sativa]
Length=286

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 67/143 (47%), Gaps = 9/143 (6%)
 Frame = +2

Query  8    LTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGD-RNSAECRTHVDEYRGSRPIWWILA  184
            LTLE+ I+SA      V  + KM +Y    L G + R   + +T+VD  RGS P+W+   
Sbjct  4    LTLELNIRSASNLVN-VNLITKMNVYVNITLHGENARKKQKAKTNVDRSRGSNPVWYHPV  62

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC---VSQGFQYQDVA  355
             F  +E  V +  + LV  +  +  +G +K +G   +P+ +  +      +     Q++ 
Sbjct  63   KFSVNERLVYDDRLTLVMRLISRGYLG-NKDIGRVTIPLLELLNSVKPPTNDAGNSQEMK  121

Query  356  LGI---SSKLGKPRGVLYLSYVF  415
            L I    +  GK  G L  SY F
Sbjct  122  LMIYQVRTPSGKRSGTLTFSYRF  144



>ref|XP_011023669.1| PREDICTED: WW domain-binding protein 2-like [Populus euphratica]
Length=289

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 6/135 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAE-CRTHVDEYRGSRPIWWILASF  190
            LEIT+ S +  K  V   GKM +Y    + G    S +  +THV +  G  P+W     F
Sbjct  6    LEITVASGKDLKD-VNVFGKMDVYCVVSIKGDPHKSKQKQKTHVHKDCGPNPLWNFPMKF  64

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               E+  + + + + F++  ++ +G DK VG   VP+K+  D    +G     ++  + +
Sbjct  65   NIDEAAAQQNRLQIKFKLLAERMMG-DKEVGVVSVPVKELLDSKDGKGGL---MSYAVKT  120

Query  371  KLGKPRGVLYLSYVF  415
              GK +G L  S+ F
Sbjct  121  PSGKMKGTLSFSFNF  135



>gb|ABO82554.1| unknown [Helianthus anomalus]
Length=231

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (46%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  NS + +T V +   S P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANSQKLKTPVHKDGDSDPSWNFPMKFTVDEAAGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D     G   + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDGTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>ref|XP_002299823.2| hypothetical protein POPTR_0001s25640g, partial [Populus trichocarpa]
 gb|EEE84628.2| hypothetical protein POPTR_0001s25640g, partial [Populus trichocarpa]
Length=293

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (47%), Gaps = 9/129 (7%)
 Frame = +2

Query  5    PLTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILA  184
            PL LEITI SA+  K      G ++ YAT +L   D   A   TH D+   +RP+W    
Sbjct  6    PLHLEITIISAKHLKNVNWRNGDLKPYATFYLDNSDHRLA---THADDSLSTRPVW----  58

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI  364
            + R     +R+ +V+ +     K +  P   VGT   P+ Q  D   +  +  +   L +
Sbjct  59   NERFTIPMIRHDSVLTLDVFHSKPSETPKPLVGTGKFPLSQLLDSDETTSYSLR--TLEL  116

Query  365  SSKLGKPRG  391
            S   G+P+G
Sbjct  117  SRPSGRPQG  125



>gb|EYU23912.1| hypothetical protein MIMGU_mgv1a014817mg [Erythranthe guttata]
Length=177

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LEIT+ SA+  +   +  GK  ++A   + G    + E RT  D +    P W    S+ 
Sbjct  6    LEITVVSAKDLEDVRVFFGKTAVHARVSISGKAATATERRTPTDRHGNKNPAWNFTTSYT  65

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC  322
              E+ V+ S+ +LV ++ C  N G D  +G  ++ +++ F+  
Sbjct  66   VTEAMVQGSSRMLVVKLYCDSNAG-DIYIGEVHISLRELFESA  107



>ref|XP_010674816.1| PREDICTED: uncharacterized protein LOC104890897 [Beta vulgaris 
subsp. vulgaris]
Length=305

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 58/122 (48%), Gaps = 4/122 (3%)
 Frame = +2

Query  50   KYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVV  229
            K V     M +Y     V GD  S + RT VD+  G+ P W     F   ES  R + + 
Sbjct  17   KDVNVFSTMDVYVVGS-VSGDPRSMQ-RTAVDKDGGTNPKWNHDMKFTFDESAARLNRLG  74

Query  230  LVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSY  409
            LVF++   + +G DK +G  YVP+K+ FD       Q + V   + +  GK +G +  S+
Sbjct  75   LVFQIMSDRTLG-DKEIGRVYVPLKELFD-ATDPIDQERHVVYQVQTPTGKFKGEMEFSF  132

Query  410  VF  415
             F
Sbjct  133  KF  134



>emb|CDY72474.1| BnaCnng77840D [Brassica napus]
Length=209

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 5/140 (4%)
 Frame = +2

Query  8    LTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILAS  187
            LTLE+ I SA   + YV  + KM +YA   L+G D+   + +T VD + GS P W     
Sbjct  4    LTLELNINSASDLE-YVNHITKMNVYAVVTLLG-DKKIQKVKTAVDRHGGSNPNWNHAVK  61

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC--VSQGFQYQDVALG  361
            F  +E   R   + LV  +   + +G DK +G   +P+          S G   + V   
Sbjct  62   FAVNERLAREGRLTLVVGLFSGRVLG-DKDIGKVEIPLVYLLPSTNGNSNGHGMKFVTYQ  120

Query  362  ISSKLGKPRGVLYLSYVFTA  421
            + +   + +G L  SY F  
Sbjct  121  VRTPSERMKGSLTFSYRFNG  140



>ref|XP_009136710.1| PREDICTED: uncharacterized protein LOC103860797 [Brassica rapa]
 emb|CDX90571.1| BnaA03g42100D [Brassica napus]
Length=209

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 67/149 (45%), Gaps = 9/149 (6%)
 Frame = +2

Query  8    LTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILAS  187
            LTLE+ I SA   + YV  + KM +YA   L+G D+   + +T VD + GS P W     
Sbjct  4    LTLELNINSASDLE-YVNHITKMNVYAVVTLLG-DKKIQKVKTAVDRHGGSNPNWNHAFK  61

Query  188  FRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFF----DQCVSQGFQYQDVA  355
            F  +E   R   + LV  +   + +G DK +G   +P+        D     G ++  V 
Sbjct  62   FSVNERLAREGRLTLVVGLFSGRVLG-DKDIGKVEIPLVYLLPSTNDNSNGHGMKF--VT  118

Query  356  LGISSKLGKPRGVLYLSYVFTAYNFLNFP  442
              + +   + +G L  SY F   + +  P
Sbjct  119  YQVRTPSERMKGSLTFSYRFNGTDVIYGP  147



>ref|XP_011035190.1| PREDICTED: uncharacterized protein LOC105133073 isoform X1 [Populus 
euphratica]
 ref|XP_011035191.1| PREDICTED: uncharacterized protein LOC105133073 isoform X2 [Populus 
euphratica]
Length=360

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (46%), Gaps = 9/129 (7%)
 Frame = +2

Query  5    PLTLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILA  184
            PL LEITI SA+  K      G ++ YAT +L   D   A   TH D+   +RP+W    
Sbjct  67   PLHLEITIISAKHLKNVNWRNGDLKPYATFYLDNSDNRLA---THADDSLSTRPVW----  119

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI  364
            + R     +R+ +V+ +     K +  P   VGT   P+ Q  D    +   Y    L +
Sbjct  120  NERFTIPIIRHDSVLTLDVFHSKPSETPKPLVGTVKFPLSQLLDS--DETTSYSVRTLEL  177

Query  365  SSKLGKPRG  391
            S   G+P+G
Sbjct  178  SRPSGRPQG  186



>gb|ABE98329.1| SRC2-like protein [Nicotiana benthamiana]
Length=294

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 64/134 (48%), Gaps = 3/134 (2%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L+I + +A+  K  V    KM +Y    +   +  + + +T V +  G+ P W     F 
Sbjct  6    LDIKVIAADGIKN-VNTFSKMDVYVEVSISYPNHTNKQ-KTFVHKNSGTNPKWNHSMKFT  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E+ +    + L+F +K ++ +G D  +G   VPI   F+Q  S G   + V   + ++
Sbjct  64   LEETSLTRPGLYLIFRLKSERTLG-DTKIGEVSVPIHDLFNQSTSNGTVERFVEYPVITE  122

Query  374  LGKPRGVLYLSYVF  415
             GKP+G L  S+ F
Sbjct  123  SGKPKGTLKFSHKF  136



>emb|CDP15793.1| unnamed protein product [Coffea canephora]
Length=183

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (49%), Gaps = 8/135 (6%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
             E+T+ SA V    V  +G+M++YA   L+ G  NS E  T VD  R + P W     + 
Sbjct  6    FEVTLISA-VNLPNVRELGQMKVYAKV-LIKGYSNS-EWITSVDRERETNPYWNCRIKYT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQ-GFQYQDVALGISS  370
              E  V    V+LV ++ C++++ PDK VG   + +K+ FD    Q   +Y      +  
Sbjct  63   LPEKAVEKDGVLLVIKLYCERSLLPDKYVGEVNLSLKKLFDYGFPQEKLEYYVNRNDVDG  122

Query  371  KLGKPRGVLYLSYVF  415
            K GK    L LSY F
Sbjct  123  KFGK----LKLSYDF  133



>ref|XP_003594708.1| hypothetical protein MTR_2g033730 [Medicago truncatula]
Length=390

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 57/133 (43%), Gaps = 5/133 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLEI + SA+  K       K++++A   + G   N     T  D Y    P W     F
Sbjct  10   TLEIKMISAKDVKDVTPFFQKLKVFAYVSIKGDPLNPQTEVTDADGYNKRNPEWNSSLKF  69

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ES      + L   +  K N  P+K +GT  +P+K+ FD        YQ     I+S
Sbjct  70   TFKESLANQDRLFLKIHLGAKLNF-PNKLIGTVNIPLKELFDNPAGHQLSYQ--VRKINS  126

Query  371  KLGKPRGVLYLSY  409
            +  K RG L LSY
Sbjct  127  E--KSRGTLNLSY  137



>gb|AES64959.2| SRC2-like protein, putative [Medicago truncatula]
Length=369

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 57/133 (43%), Gaps = 5/133 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLEI + SA+  K       K++++A   + G   N     T  D Y    P W     F
Sbjct  10   TLEIKMISAKDVKDVTPFFQKLKVFAYVSIKGDPLNPQTEVTDADGYNKRNPEWNSSLKF  69

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ES      + L   +  K N  P+K +GT  +P+K+ FD        YQ     I+S
Sbjct  70   TFKESLANQDRLFLKIHLGAKLNF-PNKLIGTVNIPLKELFDNPAGHQLSYQ--VRKINS  126

Query  371  KLGKPRGVLYLSY  409
            +  K RG L LSY
Sbjct  127  E--KSRGTLNLSY  137



>emb|CDP15795.1| unnamed protein product [Coffea canephora]
Length=173

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 5/118 (4%)
 Frame = +2

Query  65   VGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEV  244
            +GKM++YA    V G  NS    T VD  R + P W     +   E  V+   V+LV E+
Sbjct  22   LGKMKVYAQVS-VKGHSNSVWV-TPVDRERETNPYWNCKIKYTLPEIAVQKDGVILVIEL  79

Query  245  KCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVFT  418
             C++++ PDK VG   + +K+ FD   SQ     DV    +  +    G L LSY F 
Sbjct  80   YCERSLLPDKYVGEVNLSLKKLFDCGFSQENLEYDVDRNDADGI---FGKLKLSYDFA  134



>gb|ABN09103.1| C2 [Medicago truncatula]
Length=361

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 57/133 (43%), Gaps = 5/133 (4%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLEI + SA+  K       K++++A   + G   N     T  D Y    P W     F
Sbjct  10   TLEIKMISAKDVKDVTPFFQKLKVFAYVSIKGDPLNPQTEVTDADGYNKRNPEWNSSLKF  69

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               ES      + L   +  K N  P+K +GT  +P+K+ FD        YQ     I+S
Sbjct  70   TFKESLANQDRLFLKIHLGAKLNF-PNKLIGTVNIPLKELFDNPAGHQLSYQ--VRKINS  126

Query  371  KLGKPRGVLYLSY  409
            +  K RG L LSY
Sbjct  127  E--KSRGTLNLSY  137



>gb|KCW65474.1| hypothetical protein EUGRSUZ_G02885 [Eucalyptus grandis]
Length=225

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 65/136 (48%), Gaps = 7/136 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            +L++T  SA+      L   KM  Y T  L G  + S    T V +  G+ P W  L +F
Sbjct  5    SLQVTGMSAKDLHNVHL-THKMHPYVTVSLSGNHKKS----TDVHKDGGTSPSWVDLLTF  59

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
               E+      + LVFE+  KK+ G +K VG   VPI +  ++      +    ++ + S
Sbjct  60   PVDEA--CTDLLTLVFEIMSKKSRGGEKEVGRVKVPIAELLEKQGDGRAKQMSCSVSLPS  117

Query  371  KLGKPRGVLYLSYVFT  418
             +GK +GVL  +Y F+
Sbjct  118  GVGKTQGVLEFTYKFS  133



>gb|EYU23913.1| hypothetical protein MIMGU_mgv1a024879mg, partial [Erythranthe 
guttata]
Length=155

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 61/131 (47%), Gaps = 4/131 (3%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LEIT+ SA   +   +  GK  ++A   + G  +   E RT  D +    P W    ++ 
Sbjct  6    LEITVVSANNLEDVRVFFGKTAVHARVSING--KPETERRTPTDTHGNQNPSWEFTTTYI  63

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI-SS  370
              E+ +++ N +LV ++ C +N G D+ +G  Y+ + + FD     G   +   L + S 
Sbjct  64   IMETMLQSCNAMLVVKLYCDRNAG-DRYIGEVYISLMELFDCAKYNGDDEKSSNLQVESD  122

Query  371  KLGKPRGVLYL  403
              G+   V+ L
Sbjct  123  SCGRRSAVMTL  133



>ref|XP_010666732.1| PREDICTED: uncharacterized protein LOC104883866 [Beta vulgaris 
subsp. vulgaris]
Length=253

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 66/146 (45%), Gaps = 17/146 (12%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNS-------AECRTHVDEYRGSRPI  169
            TL +TI SA   K+ V    KM +Y    ++    N         + RT +D+     P 
Sbjct  5    TLNLTILSANDIKQ-VNFFSKMDVYVVVSMIDSADNHNLRSNSIQKQRTPIDKKGDKNPT  63

Query  170  WWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQD  349
            W    SF  ++   R + + ++FE+   ++   DK +G   VP+    +     G+  Q 
Sbjct  64   WNYTISFTINDVVARQNRLYILFEIFSSRSFPGDKLIGKVQVPVYDLLN-----GYGDQK  118

Query  350  VALGISSKL----GKPRGVLYLSYVF  415
             A+ +S ++    GKP+GV  +SY F
Sbjct  119  DAILVSYQVRKRSGKPKGVFNVSYKF  144



>ref|XP_008801062.1| PREDICTED: wiskott-Aldrich syndrome protein family member 2-like 
[Phoenix dactylifera]
Length=374

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 9/134 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+T+ SA+  K  V    KM++YA   L G  R+    RT  D   G  P W   ++F
Sbjct  5    TLEVTLISAKDLKD-VNLFSKMEVYAVVSLSGDTRS--RQRTPTDREGGRNPAWN--STF  59

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
            R +         VL   ++ ++ +G D+ VG  ++P+ +  D     G ++  V+  +  
Sbjct  60   RFNVPADGYGRQVLHILIRGERALG-DRDVGEVHIPLSELLDAAPGDGPKF--VSYQVRK  116

Query  371  -KLGKPRGVLYLSY  409
               GKP+GVL LSY
Sbjct  117  CTSGKPKGVLNLSY  130



>ref|XP_011087410.1| PREDICTED: uncharacterized protein LOC105168911 [Sesamum indicum]
Length=345

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 61/136 (45%), Gaps = 10/136 (7%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            L IT+ S E  K  V    KM +Y    + G     ++  T VD+  G+ P W     F 
Sbjct  69   LNITVISCEDLKD-VKVFSKMDVYTEVSIAG--YPLSKKTTFVDKNSGTNPKWNHRMEFM  125

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFF--DQCVSQGFQYQDVALGIS  367
              E  +    + L+FE+K +      K +G+  VPI + +  D    +  +YQ     + 
Sbjct  126  VDEPYLTKPGLSLLFEIKAESTFSGYKDIGSVTVPIYELYQPDATEDKVVEYQ-----VH  180

Query  368  SKLGKPRGVLYLSYVF  415
            ++ GKP+G L  SY F
Sbjct  181  TRSGKPKGTLKFSYRF  196



>gb|ABO82545.1| unknown [Helianthus anomalus]
Length=229

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (46%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  VGGDRNSAECRTHVDEYRGSRPIWWILASFRTHESEVRNSNVVLVFEVKCKKNVGPDKCV  280
            + G  N+ + +T V +  GS P W     F   E+    + + LV E+K     G DK V
Sbjct  4    ISGAANTQKLKTPVHKDGGSDPSWNFPMKFTVDEATGLQNRLTLVVEIKHDGTFG-DKDV  62

Query  281  GTTYVPIKQFFDQCVSQGFQYQDVALGISSKLGKPRGVLYLSYVF  415
            G  +VPIK+  D         + V+  + +  GK +G L  SY F
Sbjct  63   GLAHVPIKELLDGLSKDWTSEKQVSYQVRTPSGKQKGSLNFSYKF  107



>gb|EYU23907.1| hypothetical protein MIMGU_mgv1a024503mg, partial [Erythranthe 
guttata]
Length=148

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 4/104 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LEIT+ SA      V  +G+M++YA   + G  + S   R+ VD    + P W     + 
Sbjct  6    LEITLVSANSLPD-VRSLGQMKVYAKVSIKGESKTSK--RSPVDFEGETNPRWNFRTEYT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCV  325
              ES V+  +V +   + CK+ +G ++ +G   +PIK  FD+ +
Sbjct  63   ISESAVQQPDVKISIRLYCKRTLG-NRFIGDVSIPIKSLFDKGI  105



>ref|XP_006289418.1| hypothetical protein CARUB_v10002917mg [Capsella rubella]
 gb|EOA22316.1| hypothetical protein CARUB_v10002917mg [Capsella rubella]
Length=153

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (48%), Gaps = 7/111 (6%)
 Frame = +2

Query  14   LEITIKSAE--VFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWI-LA  184
            +EIT  SAE  V+KK  +       + TA    G       RT VDE  G+ P+W   L 
Sbjct  5    IEITGISAEDLVYKKRRVKKNAYVAFDTA----GKYMKQPMRTSVDEISGNYPMWEDKLE  60

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGF  337
            +  +   E   +  V+  +V C+ + G D CVGT  VP+K F  +   +GF
Sbjct  61   TEFSPGKEAVTATSVMYVQVLCRSSAGEDHCVGTARVPVKDFTGEYAPEGF  111



>ref|XP_008800861.1| PREDICTED: formin-like protein 18 [Phoenix dactylifera]
Length=341

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 68/140 (49%), Gaps = 17/140 (12%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+T+ SA   K  V    KM+++A   + G DR S + RT  D+Y G+ P W     F 
Sbjct  6    LEVTLISANDLKD-VNFFSKMRVFAILSIAG-DRRSRQ-RTASDKYGGTSPSWNTTLRFA  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS-  370
               +      +V+   ++ ++  G D+ VG  ++P+K+  +   S G    D ++   S 
Sbjct  63   VPAAA---EGLVIHVLLRSERAFG-DRDVGEVFIPLKELLNGVASAG----DSSVHFVSY  114

Query  371  -----KLGKPRGVLYLSYVF  415
                   GKP+GVL LSY F
Sbjct  115  QVRKPSSGKPKGVLNLSYKF  134



>ref|XP_010921798.1| PREDICTED: ingression protein fic1-like [Elaeis guineensis]
Length=336

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 64/134 (48%), Gaps = 9/134 (7%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+T+ S++  K  V    KM++YA   L G  R+  + RT  D   G  P W     F
Sbjct  5    TLEVTLISSKDLKD-VSLFSKMEVYAVVSLSGDPRS--KQRTSTDREGGKNPAWNSTLRF  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
                 +      VL   ++ ++ +G D+ VG  ++P+ +  D     G ++  V+  +  
Sbjct  62   NVPADDY--GRQVLHILLRAERALG-DRDVGEVHIPLSELLDAAPGNGPKF--VSYQVRK  116

Query  371  -KLGKPRGVLYLSY  409
               GKP+GVL LSY
Sbjct  117  CTSGKPKGVLNLSY  130



>gb|EYU23915.1| hypothetical protein MIMGU_mgv1a014535mg [Erythranthe guttata]
Length=186

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
             +ITI +A   +  V   GK + +A  ++VG      E RT  D +    P W    S+ 
Sbjct  9    FDITISAAYNVED-VRLFGKTEAHARIYIVG--LTEPERRTPTDTHGKKNPAWNFTTSYT  65

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              ES ++N N VLV +V C + +G D  +G   + +K+ FD C         VA G SSK
Sbjct  66   IFESMLKNCNTVLVVKVYCTRAMG-DIYIGQVDISLKELFD-CAGP----VHVATGKSSK  119

Query  374  LGKPR  388
            L   R
Sbjct  120  LDDER  124



>ref|XP_006282258.1| hypothetical protein CARUB_v10028535mg [Capsella rubella]
 gb|EOA15156.1| hypothetical protein CARUB_v10028535mg [Capsella rubella]
Length=153

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (48%), Gaps = 7/111 (6%)
 Frame = +2

Query  14   LEITIKSAE--VFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWI-LA  184
            +EIT  SAE  V+KK  +       + TA    G       RT VDE  G+ P+W   L 
Sbjct  5    IEITGISAEDLVYKKRRVKKNAYGAFDTA----GKYMKQPMRTSVDEISGNYPMWEDKLE  60

Query  185  SFRTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGF  337
            +  +   E   +  V+  +V C+ + G D CVGT  VP+K F  +   +GF
Sbjct  61   TEFSPGKEAVTATSVMYVQVLCRSSAGEDHCVGTARVPVKDFTGEYALEGF  111



>emb|CDX74290.1| BnaA03g27570D [Brassica napus]
Length=199

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 63/146 (43%), Gaps = 5/146 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA   +  V  + KM +YA   L  GD+   + +T VD Y GS P W     F
Sbjct  5    TLELNINSASDLEN-VNHITKMNVYAVITL-SGDKKIQKAKTGVDRYGGSNPNWNHAVKF  62

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC--VSQGFQYQDVALGI  364
              +E   R   + LV  +   + +G +K +G   VP+            G + + V   +
Sbjct  63   SVNERLAREGRLTLVVGLFSSRLLG-NKDIGEVEVPLGYLLPSTNGNGNGHEMKFVTYQV  121

Query  365  SSKLGKPRGVLYLSYVFTAYNFLNFP  442
             +   K +G L  SY F     ++ P
Sbjct  122  RTPSEKMKGSLTFSYRFGGTPIISGP  147



>ref|XP_011075026.1| PREDICTED: uncharacterized protein LOC105159610 [Sesamum indicum]
Length=156

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 62/134 (46%), Gaps = 5/134 (4%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
             EIT+ SA   +  V  + KM+++A   + GG  N  E RT  D++  + P W     + 
Sbjct  6    FEITLISANNLED-VRKICKMKVHARVSIGGGGEN--EQRTPTDKHGETNPAWNFTMRYT  62

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISSK  373
              E  ++  N +LV ++ CK+ +G D+ +G  +  +K+ FD C         +   +   
Sbjct  63   VSEPMLQAYNTMLVIKLYCKRKLG-DRYIGEVHTSMKELFD-CARPTGGSAVLTFPVQKG  120

Query  374  LGKPRGVLYLSYVF  415
                +G L  SY F
Sbjct  121  CVNSQGALRFSYRF  134



>ref|XP_010259736.1| PREDICTED: uncharacterized protein LOC104599071 [Nelumbo nucifera]
Length=222

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (46%), Gaps = 21/146 (14%)
 Frame = +2

Query  14   LEITIKSAE-------VFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIW  172
            LEIT+ SA        VFK +      M++YA    V  D N  + RT VD+  G+ P W
Sbjct  5    LEITVISARDLRNVRRVFKSH------MRVYAVVS-VSSDPNKIQ-RTPVDQKGGTNPNW  56

Query  173  WILASFRTHESEV---RNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQ-  340
                +F   E ++   RN  ++L F++ C +  G DK +G  +VPI    +     G   
Sbjct  57   NCTMNFSLGECDLSVHRNKPILLSFKLCCNRTRG-DKLLGEVFVPIIDLLNNAPPTGNST  115

Query  341  -YQDVALGISSKLGKPRGVLYLSYVF  415
              + ++  +   LG   G+L  SY F
Sbjct  116  PTRTISCQVRDLLGNLHGILNFSYKF  141



>emb|CDX91956.1| BnaC03g32580D [Brassica napus]
Length=198

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 63/146 (43%), Gaps = 5/146 (3%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ I SA   +  V  + KM +YA   L+G D+   + +T VD Y GS P W     F
Sbjct  5    TLELNINSASDLEN-VNYITKMNVYAVITLLG-DKKIQKAKTGVDHYGGSSPNWNHAVKF  62

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQC--VSQGFQYQDVALGI  364
              +E   R   + LV  +   + +G  K +G   VP             G + + V   +
Sbjct  63   SVNERLAREGRLTLVVGLFSSRLLG-SKDIGEVEVPFGYLLPSTNGNGNGHEMKFVTYQV  121

Query  365  SSKLGKPRGVLYLSYVFTAYNFLNFP  442
             +   K +G L  SY F+    ++ P
Sbjct  122  RTPSEKMKGSLTFSYRFSDTTVISGP  147



>ref|XP_004968753.1| PREDICTED: formin-like protein 18-like [Setaria italica]
Length=299

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 58/136 (43%), Gaps = 4/136 (3%)
 Frame = +2

Query  14   LEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASFR  193
            LE+ + SA   KK V    ++++YA A + GGD       T  D   G  P W   A F 
Sbjct  6    LEVNLISANDLKK-VTLFSRLRVYAIASISGGDPRIPTHSTLADYVNGCNPAWNTTAHFP  64

Query  194  THESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGI-SS  370
              E+      + L   ++ K+    D+ VG  YVP+         +G   + V+  +   
Sbjct  65   IPEA-ADTRGLALHVRLRAKRAYFGDRDVGEVYVPVDDLL-AGADKGGDPRPVSYQVRRP  122

Query  371  KLGKPRGVLYLSYVFT  418
              G+  GVLY  Y FT
Sbjct  123  HSGRAHGVLYFCYKFT  138



>ref|XP_008789935.1| PREDICTED: small nuclear ribonucleoprotein-associated protein 
B'-like [Phoenix dactylifera]
Length=289

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 60/133 (45%), Gaps = 7/133 (5%)
 Frame = +2

Query  11   TLEITIKSAEVFKKYVLCVGKMQLYATAHLVGGDRNSAECRTHVDEYRGSRPIWWILASF  190
            TLE+ + SA+  K+ V    KM++YA   L G  R  +  RT  D   G  P W     F
Sbjct  5    TLEVNLISAKDLKQ-VNLFSKMEVYAVVSLSGDPR--SRQRTPPDREGGRNPAWNSTVRF  61

Query  191  RTHESEVRNSNVVLVFEVKCKKNVGPDKCVGTTYVPIKQFFDQCVSQGFQYQDVALGISS  370
                        VL   ++ ++ +G D+ VG   +P+ +  D     G ++    +   +
Sbjct  62   NVPADNYERQ--VLHILLRAERALG-DRDVGEVRIPLSELLDAAAGNGPKFVSYQVRKCT  118

Query  371  KLGKPRGVLYLSY  409
              GKP+GVL LSY
Sbjct  119  S-GKPKGVLNLSY  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1198105707698