BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85416_g1_i1 len=1220 path=[1198:0-1219]

Length=1220
                                                                      Score     E

dbj|BAO57275.1|  xyloglucan endotransglucosylase/hydrolase              600   0.0      
ref|XP_009609044.1|  PREDICTED: probable xyloglucan endotransgluc...    456   5e-157   
ref|XP_006360667.1|  PREDICTED: probable xyloglucan endotransgluc...    454   4e-156   
ref|XP_009796455.1|  PREDICTED: xyloglucan endotransglucosylase/h...    452   4e-155   
ref|XP_009760620.1|  PREDICTED: probable xyloglucan endotransgluc...    447   2e-153   
gb|ABD98046.1|  xyloglucan endotransglycosylase                         441   5e-151   Striga asiatica [witchweed]
gb|EYU25733.1|  hypothetical protein MIMGU_mgv1a011641mg                437   2e-149   
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...    437   3e-149   
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...    437   3e-149   
ref|XP_004240131.2|  PREDICTED: probable xyloglucan endotransgluc...    434   3e-148   
ref|XP_007015526.1|  Xyloglucan endotransglycosylase 6                  433   9e-148   
gb|ACD03220.1|  xyloglucan endotransglucosylase/hydrolase 10            427   1e-145   Actinidia deliciosa [Chinese gooseberry]
gb|KHN22640.1|  Putative xyloglucan endotransglucosylase/hydrolas...    424   4e-144   
emb|CDP16009.1|  unnamed protein product                                423   6e-144   
ref|NP_001242489.1|  uncharacterized protein LOC100807063 precursor     422   2e-143   
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...    421   4e-143   
gb|KDP42857.1|  hypothetical protein JCGZ_23799                         420   5e-143   
ref|XP_010687463.1|  PREDICTED: probable xyloglucan endotransgluc...    421   8e-143   
ref|XP_007154667.1|  hypothetical protein PHAVU_003G137600g             420   8e-143   
ref|XP_008223830.1|  PREDICTED: probable xyloglucan endotransgluc...    419   2e-142   
ref|XP_007222107.1|  hypothetical protein PRUPE_ppa009610mg             419   2e-142   
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               419   4e-142   
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             419   4e-142   
ref|XP_011020098.1|  PREDICTED: probable xyloglucan endotransgluc...    418   5e-142   
ref|XP_004299791.1|  PREDICTED: probable xyloglucan endotransgluc...    418   6e-142   
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         418   6e-142   
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase               417   9e-142   
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               417   2e-141   
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase               417   2e-141   
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase               417   2e-141   
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               417   2e-141   
ref|XP_007014173.1|  Xyloglucan endotransglycosylase 6                  417   3e-141   
ref|XP_006359066.1|  PREDICTED: xyloglucan endotransglucosylase/h...    416   4e-141   
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase               416   4e-141   
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               416   4e-141   
ref|XP_003610008.1|  Xyloglucan endotransglucosylase/hydrolase          416   4e-141   
ref|XP_009401564.1|  PREDICTED: probable xyloglucan endotransgluc...    416   4e-141   
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase               416   5e-141   
ref|NP_001234342.1|  xyloglucan endotransglycosylase LeXET2 precu...    415   6e-141   
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...    415   8e-141   
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2          415   8e-141   Asparagus officinalis
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase               414   1e-140   
ref|XP_004146309.1|  PREDICTED: xyloglucan endotransglucosylase/h...    414   2e-140   
ref|XP_010241684.1|  PREDICTED: probable xyloglucan endotransgluc...    414   3e-140   
ref|XP_004161045.1|  PREDICTED: xyloglucan endotransglucosylase/h...    413   6e-140   
ref|XP_002526228.1|  Xyloglucan endotransglucosylase/hydrolase pr...    412   9e-140   Ricinus communis
gb|KDP36435.1|  hypothetical protein JCGZ_08704                         412   1e-139   
ref|XP_007035759.1|  Xyloglucan endotransglucosylase/hydrolase fa...    412   2e-139   
gb|KHN22712.1|  Putative xyloglucan endotransglucosylase/hydrolas...    412   2e-139   
ref|XP_011018193.1|  PREDICTED: probable xyloglucan endotransgluc...    411   3e-139   
gb|EYU20918.1|  hypothetical protein MIMGU_mgv1a011123mg                411   4e-139   
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    411   5e-139   
gb|KHG10045.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    410   5e-139   
ref|XP_003549490.2|  PREDICTED: probable xyloglucan endotransgluc...    411   5e-139   
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    410   7e-139   
gb|AAF80590.1|AF223419_1  xyloglucan endotransglycosylase XET1          410   8e-139   Asparagus officinalis
emb|CDP02962.1|  unnamed protein product                                410   9e-139   
gb|ABL10090.1|  xyloglucan endotransglycosylase                         409   1e-138   Musa acuminata [banana]
ref|XP_002526229.1|  conserved hypothetical protein                     409   1e-138   Ricinus communis
ref|XP_003542166.1|  PREDICTED: xyloglucan endotransglucosylase/h...    409   2e-138   
ref|XP_011043998.1|  PREDICTED: probable xyloglucan endotransgluc...    409   2e-138   
gb|KHG21666.1|  putative xyloglucan endotransglucosylase/hydrolas...    409   2e-138   
ref|XP_002270299.1|  PREDICTED: probable xyloglucan endotransgluc...    409   2e-138   Vitis vinifera
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    409   3e-138   
ref|XP_010039803.1|  PREDICTED: probable xyloglucan endotransgluc...    409   3e-138   
ref|NP_001284442.1|  xyloglucan endotransglucosylase/hydrolase pr...    409   3e-138   
ref|XP_011023833.1|  PREDICTED: probable xyloglucan endotransgluc...    410   3e-138   
ref|XP_002274601.1|  PREDICTED: probable xyloglucan endotransgluc...    409   4e-138   Vitis vinifera
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    407   6e-138   
ref|XP_011043999.1|  PREDICTED: probable xyloglucan endotransgluc...    408   6e-138   
ref|XP_007014165.1|  Xyloglucan endotransglucosylase/hydrolase fa...    408   7e-138   
gb|KHG09882.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    407   8e-138   
ref|XP_008223658.1|  PREDICTED: probable xyloglucan endotransgluc...    407   8e-138   
ref|XP_007223211.1|  hypothetical protein PRUPE_ppa009346mg             408   9e-138   
ref|XP_011044000.1|  PREDICTED: probable xyloglucan endotransgluc...    407   9e-138   
emb|CAN80250.1|  hypothetical protein VITISV_036640                     407   1e-137   Vitis vinifera
ref|XP_010047002.1|  PREDICTED: probable xyloglucan endotransgluc...    407   1e-137   
ref|XP_002324480.1|  xyloglucan endo-1 family protein                   407   1e-137   Populus trichocarpa [western balsam poplar]
ref|XP_002308092.2|  xyloglucan endo-1 family protein                   407   1e-137   Populus trichocarpa [western balsam poplar]
ref|XP_004488032.1|  PREDICTED: probable xyloglucan endotransgluc...    407   1e-137   
ref|XP_010927060.1|  PREDICTED: brassinosteroid-regulated protein...    407   2e-137   
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor     407   2e-137   
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    406   2e-137   
ref|XP_007154784.1|  hypothetical protein PHAVU_003G147700g             406   2e-137   
ref|XP_010046992.1|  PREDICTED: probable xyloglucan endotransgluc...    407   2e-137   
ref|XP_002324481.2|  xyloglucan endo-1 family protein                   406   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    406   3e-137   
ref|XP_010259807.1|  PREDICTED: probable xyloglucan endotransgluc...    407   3e-137   
ref|XP_002318936.2|  putative xyloglucan endotransglycosylase fam...    407   3e-137   Populus trichocarpa [western balsam poplar]
ref|XP_002274404.1|  PREDICTED: brassinosteroid-regulated protein...    406   4e-137   Vitis vinifera
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...    405   5e-137   
ref|XP_007014172.1|  Xyloglucan endotransglucosylase/hydrolase fa...    405   6e-137   
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    405   7e-137   
gb|KHG04746.1|  putative xyloglucan endotransglucosylase/hydrolas...    405   9e-137   
ref|XP_002273742.2|  PREDICTED: probable xyloglucan endotransgluc...    405   9e-137   Vitis vinifera
gb|AFK47685.1|  unknown                                                 404   1e-136   
ref|XP_011094075.1|  PREDICTED: probable xyloglucan endotransgluc...    405   1e-136   
ref|XP_010259803.1|  PREDICTED: probable xyloglucan endotransgluc...    405   1e-136   
ref|XP_002270416.1|  PREDICTED: probable xyloglucan endotransgluc...    405   1e-136   Vitis vinifera
ref|XP_010046996.1|  PREDICTED: probable xyloglucan endotransgluc...    405   1e-136   
ref|XP_003625289.1|  Xyloglucan endotransglucosylase/hydrolase          404   2e-136   
gb|ABM91066.1|  xyloglucan endotransglycosylase/hydrolase precurs...    404   2e-136   Populus tremula [European aspen]
ref|XP_010656826.1|  PREDICTED: probable xyloglucan endotransgluc...    404   3e-136   
ref|XP_010048560.1|  PREDICTED: probable xyloglucan endotransgluc...    404   3e-136   
ref|XP_011069896.1|  PREDICTED: probable xyloglucan endotransgluc...    404   4e-136   
ref|XP_003610142.1|  Xyloglucan endotransglucosylase/hydrolase          403   4e-136   
ref|XP_010259808.1|  PREDICTED: xyloglucan endotransglucosylase/h...    404   4e-136   
ref|XP_010259798.1|  PREDICTED: probable xyloglucan endotransgluc...    404   5e-136   
ref|XP_010046998.1|  PREDICTED: probable xyloglucan endotransgluc...    403   5e-136   
ref|XP_007138740.1|  hypothetical protein PHAVU_009G233200g             402   5e-136   
ref|XP_002274827.1|  PREDICTED: probable xyloglucan endotransgluc...    403   8e-136   Vitis vinifera
gb|KCW78732.1|  hypothetical protein EUGRSUZ_C00176                     408   8e-136   
ref|XP_002274858.1|  PREDICTED: xyloglucan endotransglucosylase/h...    403   8e-136   Vitis vinifera
gb|KCW78734.1|  hypothetical protein EUGRSUZ_C00178                     404   9e-136   
ref|XP_007014171.1|  Xyloglucan endotransglucosylase/hydrolase fa...    402   9e-136   
gb|ACD03219.1|  xyloglucan endotransglucosylase/hydrolase 9             402   1e-135   Actinidia hemsleyana
ref|XP_003595145.1|  Xyloglucan endotransglucosylase/hydrolase          402   1e-135   
ref|XP_003549488.1|  PREDICTED: probable xyloglucan endotransgluc...    402   1e-135   
ref|XP_010103016.1|  putative xyloglucan endotransglucosylase/hyd...    402   2e-135   
ref|XP_003542156.1|  PREDICTED: probable xyloglucan endotransgluc...    402   2e-135   
emb|CAN74784.1|  hypothetical protein VITISV_032594                     402   2e-135   Vitis vinifera
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...    401   2e-135   
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    402   2e-135   
ref|XP_004507927.1|  PREDICTED: probable xyloglucan endotransgluc...    401   2e-135   
ref|XP_009394877.1|  PREDICTED: probable xyloglucan endotransgluc...    401   2e-135   
ref|XP_010046993.1|  PREDICTED: probable xyloglucan endotransgluc...    401   3e-135   
ref|NP_001237075.1|  syringolide-induced protein 19-1-5 precursor       401   3e-135   
ref|XP_010259797.1|  PREDICTED: xyloglucan endotransglucosylase/h...    401   3e-135   
ref|XP_009390493.1|  PREDICTED: probable xyloglucan endotransgluc...    400   3e-135   
ref|XP_010046997.1|  PREDICTED: probable xyloglucan endotransgluc...    401   4e-135   
gb|KHN17579.1|  Putative xyloglucan endotransglucosylase/hydrolas...    401   4e-135   
ref|XP_004507835.1|  PREDICTED: probable xyloglucan endotransgluc...    401   5e-135   
ref|XP_007014183.1|  Xyloglucan endotransglycosylase 6                  401   5e-135   
ref|XP_002532673.1|  Xyloglucan endotransglucosylase/hydrolase pr...    399   5e-135   Ricinus communis
gb|ACD03232.1|  xyloglucan endotransglucosylase/hydrolase 8             400   6e-135   Malus domestica [apple tree]
ref|XP_009417487.1|  PREDICTED: probable xyloglucan endotransgluc...    400   6e-135   
ref|XP_004507837.1|  PREDICTED: probable xyloglucan endotransgluc...    400   7e-135   
ref|XP_010670334.1|  PREDICTED: probable xyloglucan endotransgluc...    399   1e-134   
ref|XP_008796499.1|  PREDICTED: xyloglucan endotransglucosylase/h...    399   1e-134   
ref|XP_010667998.1|  PREDICTED: probable xyloglucan endotransgluc...    399   1e-134   
gb|KDO46534.1|  hypothetical protein CISIN_1g023431mg                   399   2e-134   
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    399   2e-134   
emb|CAN80252.1|  hypothetical protein VITISV_036642                     399   2e-134   Vitis vinifera
ref|XP_007154781.1|  hypothetical protein PHAVU_003G147400g             398   4e-134   
dbj|BAE06063.1|  xyloglucan endotransglucosylase/hydrolase              399   5e-134   Sagittaria pygmaea
ref|XP_003610153.1|  Xyloglucan endotransglucosylase/hydrolase          398   6e-134   
ref|NP_001276139.1|  uncharacterized protein LOC102661404 precursor     398   6e-134   
ref|XP_006453413.1|  hypothetical protein CICLE_v10008951mg             399   8e-134   
gb|KHN24614.1|  Brassinosteroid-regulated protein BRU1                  398   9e-134   
ref|XP_009798276.1|  PREDICTED: xyloglucan endotransglucosylase/h...    397   1e-133   
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    397   1e-133   
ref|XP_002274552.1|  PREDICTED: probable xyloglucan endotransgluc...    397   1e-133   Vitis vinifera
ref|XP_006474159.1|  PREDICTED: xyloglucan endotransglucosylase/h...    397   2e-133   
dbj|BAJ10423.1|  xyloglucan endotransglucosylase/hydrolase              396   2e-133   
ref|XP_004293370.1|  PREDICTED: probable xyloglucan endotransgluc...    397   2e-133   
ref|XP_004293368.1|  PREDICTED: probable xyloglucan endotransgluc...    396   2e-133   
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    396   3e-133   
ref|XP_002270182.2|  PREDICTED: probable xyloglucan endotransgluc...    399   3e-133   Vitis vinifera
ref|NP_001267579.1|  probable xyloglucan endotransglucosylase/hyd...    396   3e-133   
ref|XP_010103020.1|  Xyloglucan endotransglucosylase/hydrolase pr...    396   3e-133   
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...    396   3e-133   
gb|KDP36436.1|  hypothetical protein JCGZ_08705                         396   3e-133   
ref|XP_010259800.1|  PREDICTED: probable xyloglucan endotransgluc...    397   3e-133   
ref|XP_003533750.1|  PREDICTED: brassinosteroid-regulated protein...    395   4e-133   
ref|NP_194311.1|  probable xyloglucan endotransglucosylase/hydrol...    395   4e-133   Arabidopsis thaliana [mouse-ear cress]
gb|AII99392.1|  xyloglucan endotransglucosylase/hydrolase2              395   4e-133   
ref|XP_010103019.1|  putative xyloglucan endotransglucosylase/hyd...    395   4e-133   
gb|AII99393.1|  xyloglucan endotransglucosylase/hydrolase2              395   4e-133   
ref|XP_011070177.1|  PREDICTED: xyloglucan endotransglucosylase/h...    396   5e-133   
ref|XP_006600497.1|  PREDICTED: probable xyloglucan endotransgluc...    395   5e-133   
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...    397   5e-133   
ref|XP_009409758.1|  PREDICTED: probable xyloglucan endotransgluc...    395   6e-133   
gb|ADV41673.1|  endo-xyloglucan transferase                             395   6e-133   
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    395   7e-133   
ref|XP_010929299.1|  PREDICTED: xyloglucan endotransglucosylase/h...    395   7e-133   
ref|XP_010668001.1|  PREDICTED: probable xyloglucan endotransgluc...    395   8e-133   
gb|AHB60658.1|  xyloglucan endotransglucosylase/hydrolase               395   9e-133   
gb|AAL32550.1|  xyloglucan endo-1, 4-beta-D-glucanase (XTR-6)           395   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235156.1|  PREDICTED: probable xyloglucan endotransgluc...    395   1e-132   
ref|XP_006453420.1|  hypothetical protein CICLE_v10008778mg             397   1e-132   
emb|CAN80251.1|  hypothetical protein VITISV_036641                     394   1e-132   Vitis vinifera
ref|XP_008223656.1|  PREDICTED: xyloglucan endotransglucosylase/h...    394   1e-132   
ref|XP_009121735.1|  PREDICTED: probable xyloglucan endotransgluc...    394   1e-132   
gb|AFK33537.1|  unknown                                                 394   1e-132   
ref|XP_002869654.1|  hypothetical protein ARALYDRAFT_354208             394   2e-132   
ref|XP_008799440.1|  PREDICTED: probable xyloglucan endotransgluc...    394   2e-132   
gb|ACU23404.1|  unknown                                                 394   2e-132   Glycine max [soybeans]
ref|XP_006358261.1|  PREDICTED: probable xyloglucan endotransgluc...    393   3e-132   
ref|XP_006845719.1|  hypothetical protein AMTR_s00019p00242980          393   3e-132   
ref|NP_001234472.1|  xyloglucan endotransglucosylase-hydrolase XT...    393   3e-132   
emb|CAA10231.1|  xyloglucan endotransglycosylase 1                      394   4e-132   Fagus sylvatica
ref|XP_006474154.1|  PREDICTED: probable xyloglucan endotransgluc...    393   4e-132   
ref|XP_007014176.1|  Xyloglucan endotransglycosylase 6                  393   4e-132   
ref|XP_010259802.1|  PREDICTED: probable xyloglucan endotransgluc...    394   4e-132   
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...    393   5e-132   
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    393   5e-132   
ref|XP_010677922.1|  PREDICTED: probable xyloglucan endotransgluc...    393   5e-132   
ref|XP_006474155.1|  PREDICTED: probable xyloglucan endotransgluc...    393   5e-132   
gb|KHG05436.1|  putative xyloglucan endotransglucosylase/hydrolas...    393   6e-132   
ref|XP_009344503.1|  PREDICTED: probable xyloglucan endotransgluc...    392   7e-132   
ref|XP_007224386.1|  hypothetical protein PRUPE_ppa021675mg             393   7e-132   
ref|XP_010677921.1|  PREDICTED: probable xyloglucan endotransgluc...    392   1e-131   
gb|ABM91073.1|  xyloglucan endotransglycosylase/hydrolase precurs...    392   1e-131   Populus tremula x Populus tremuloides
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    392   1e-131   
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...    391   1e-131   
ref|XP_010676725.1|  PREDICTED: probable xyloglucan endotransgluc...    391   1e-131   
ref|XP_011043991.1|  PREDICTED: xyloglucan endotransglucosylase/h...    392   2e-131   
ref|XP_007226935.1|  hypothetical protein PRUPE_ppa015713mg             391   2e-131   
ref|XP_009793860.1|  PREDICTED: probable xyloglucan endotransgluc...    391   2e-131   
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...    391   2e-131   
ref|XP_007014179.1|  Xyloglucan endotransglycosylase 6 isoform 1        391   2e-131   
ref|XP_010656825.1|  PREDICTED: probable xyloglucan endotransgluc...    391   2e-131   
gb|AGT29355.1|  xyloglucan endotransglucosylase/hydrolase 5             391   2e-131   
ref|XP_006413268.1|  hypothetical protein EUTSA_v10025720mg             392   3e-131   
gb|AFK47205.1|  unknown                                                 391   3e-131   
ref|XP_009341028.1|  PREDICTED: probable xyloglucan endotransgluc...    391   3e-131   
ref|XP_004235158.1|  PREDICTED: probable xyloglucan endotransgluc...    391   3e-131   
ref|XP_002325067.2|  hypothetical protein POPTR_0018s10290g             391   4e-131   Populus trichocarpa [western balsam poplar]
dbj|BAH36875.1|  xyloglucan endotransglucosylase/hydrolase              390   4e-131   Rosa hybrid cultivar
gb|KDO46535.1|  hypothetical protein CISIN_1g023581mg                   390   4e-131   
ref|XP_011069899.1|  PREDICTED: probable xyloglucan endotransgluc...    390   4e-131   
gb|ACK36945.1|  xyloglucan endotransglycosylase                         390   4e-131   Annona cherimola [cherimoya]
ref|XP_003610141.1|  Xyloglucan endotransglucosylase/hydrolase          390   5e-131   
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    390   5e-131   
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg             390   6e-131   
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    390   6e-131   
ref|XP_010047000.1|  PREDICTED: probable xyloglucan endotransgluc...    390   7e-131   
ref|XP_006358262.1|  PREDICTED: probable xyloglucan endotransgluc...    390   7e-131   
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    390   7e-131   
ref|XP_004235157.1|  PREDICTED: probable xyloglucan endotransgluc...    390   8e-131   
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...    390   8e-131   
ref|XP_010927059.1|  PREDICTED: probable xyloglucan endotransgluc...    389   9e-131   
ref|XP_006280918.1|  hypothetical protein CARUB_v10026914mg             389   1e-130   
ref|XP_009759293.1|  PREDICTED: xyloglucan endotransglucosylase/h...    389   1e-130   
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             389   1e-130   
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             389   1e-130   
ref|XP_006858036.1|  hypothetical protein AMTR_s00062p00016540          389   1e-130   
ref|XP_006425209.1|  hypothetical protein CICLE_v10010858mg             389   1e-130   
ref|XP_006358260.1|  PREDICTED: probable xyloglucan endotransgluc...    389   1e-130   
ref|XP_010536006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    389   2e-130   
ref|XP_010433588.1|  PREDICTED: probable xyloglucan endotransgluc...    389   2e-130   
ref|XP_010259801.1|  PREDICTED: probable xyloglucan endotransgluc...    389   2e-130   
ref|XP_002302146.2|  xyloglucan endo-1 family protein                   388   4e-130   Populus trichocarpa [western balsam poplar]
ref|XP_009341025.1|  PREDICTED: xyloglucan endotransglucosylase/h...    388   4e-130   
ref|XP_002274154.2|  PREDICTED: probable xyloglucan endotransgluc...    389   4e-130   Vitis vinifera
ref|XP_008223719.1|  PREDICTED: xyloglucan endotransglucosylase/h...    388   5e-130   
ref|XP_006284247.1|  hypothetical protein CARUB_v10005412mg             388   5e-130   
ref|XP_010525737.1|  PREDICTED: xyloglucan endotransglucosylase/h...    387   5e-130   
gb|AES92349.2|  xyloglucan endotransglucosylase/hydrolase family ...    387   6e-130   
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    388   6e-130   
gb|AFK40376.1|  unknown                                                 388   6e-130   
ref|XP_010670335.1|  PREDICTED: probable xyloglucan endotransgluc...    387   6e-130   
ref|XP_010103015.1|  putative xyloglucan endotransglucosylase/hyd...    387   1e-129   
ref|XP_006597811.1|  PREDICTED: brassinosteroid-regulated protein...    388   1e-129   
ref|XP_010929300.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
emb|CDP02959.1|  unnamed protein product                                386   1e-129   
ref|XP_010448365.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
ref|XP_003542150.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
ref|XP_010259804.1|  PREDICTED: xyloglucan endotransglucosylase/h...    387   1e-129   
ref|XP_011038986.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
ref|XP_010913701.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931             386   2e-129   
ref|XP_009614968.1|  PREDICTED: xyloglucan endotransglucosylase/h...    386   2e-129   
ref|XP_010525736.1|  PREDICTED: xyloglucan endotransglucosylase/h...    386   3e-129   
ref|XP_007224654.1|  hypothetical protein PRUPE_ppa026319mg             386   3e-129   
ref|XP_004293369.1|  PREDICTED: probable xyloglucan endotransgluc...    387   3e-129   
ref|XP_009344504.1|  PREDICTED: xyloglucan endotransglucosylase/h...    386   4e-129   
ref|XP_009139558.1|  PREDICTED: probable xyloglucan endotransgluc...    385   4e-129   
ref|XP_010443442.1|  PREDICTED: xyloglucan endotransglucosylase/h...    385   4e-129   
ref|XP_004309952.1|  PREDICTED: xyloglucan endotransglucosylase/h...    385   5e-129   
ref|XP_007223160.1|  hypothetical protein PRUPE_ppa009417mg             385   5e-129   
ref|XP_002520388.1|  Brassinosteroid-regulated protein BRU1 precu...    385   5e-129   Ricinus communis
gb|KHN17581.1|  Putative xyloglucan endotransglucosylase/hydrolas...    385   6e-129   
ref|XP_006358258.1|  PREDICTED: probable xyloglucan endotransgluc...    385   7e-129   
gb|AEX07596.1|  xyloglucosyl transferase 1                              385   7e-129   
ref|XP_008801542.1|  PREDICTED: probable xyloglucan endotransgluc...    385   7e-129   
ref|XP_010103021.1|  putative xyloglucan endotransglucosylase/hyd...    385   7e-129   
gb|AEX07595.1|  xyloglucosyl transferase 2                              384   7e-129   
ref|XP_009356634.1|  PREDICTED: brassinosteroid-regulated protein...    385   8e-129   
ref|XP_006412727.1|  hypothetical protein EUTSA_v10025941mg             384   8e-129   
gb|ACJ85154.1|  unknown                                                 384   9e-129   
gb|ACU23432.1|  unknown                                                 385   1e-128   
ref|NP_001241948.1|  uncharacterized protein LOC100800017 precursor     385   1e-128   
ref|XP_006358259.1|  PREDICTED: probable xyloglucan endotransgluc...    384   1e-128   
ref|XP_009798277.1|  PREDICTED: probable xyloglucan endotransgluc...    384   1e-128   
ref|XP_010452475.1|  PREDICTED: xyloglucan endotransglucosylase/h...    384   1e-128   
ref|XP_004309954.1|  PREDICTED: probable xyloglucan endotransgluc...    384   1e-128   
gb|KFK27295.1|  hypothetical protein AALP_AA8G363900                    384   1e-128   
gb|KDP42856.1|  hypothetical protein JCGZ_23798                         384   2e-128   
gb|KFK27294.1|  hypothetical protein AALP_AA8G363800                    384   2e-128   
ref|XP_007154782.1|  hypothetical protein PHAVU_003G147500g             384   2e-128   
ref|XP_002321087.1|  brassinosteroid-regulated family protein           383   3e-128   
ref|XP_011016785.1|  PREDICTED: probable xyloglucan endotransgluc...    384   3e-128   
ref|NP_001281066.1|  brassinosteroid-regulated protein BRU1-like ...    384   3e-128   
ref|XP_011016106.1|  PREDICTED: brassinosteroid-regulated protein...    383   3e-128   
ref|NP_200564.1|  xyloglucan endotransglucosylase/hydrolase prote...    383   3e-128   
ref|XP_009413334.1|  PREDICTED: xyloglucan endotransglucosylase/h...    382   5e-128   
ref|XP_004507838.1|  PREDICTED: probable xyloglucan endotransgluc...    383   5e-128   
ref|XP_004161054.1|  PREDICTED: probable xyloglucan endotransgluc...    383   6e-128   
gb|EYU20916.1|  hypothetical protein MIMGU_mgv1a011962mg                382   6e-128   
emb|CAD88260.1|  putative xyloglucan endotransglycosylase               383   6e-128   
ref|XP_006366191.1|  PREDICTED: probable xyloglucan endotransgluc...    382   6e-128   
ref|XP_011026280.1|  PREDICTED: probable xyloglucan endotransgluc...    383   7e-128   
ref|XP_006474160.1|  PREDICTED: xyloglucan endotransglucosylase/h...    382   7e-128   
ref|XP_010023598.1|  PREDICTED: brassinosteroid-regulated protein...    382   8e-128   
ref|XP_010042670.1|  PREDICTED: brassinosteroid-regulated protein...    382   8e-128   
ref|XP_010243150.1|  PREDICTED: brassinosteroid-regulated protein...    382   8e-128   
gb|AEQ37175.1|  xyloglucan endotransglucosylase/hydrolase               382   8e-128   
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         382   9e-128   
ref|XP_009356637.1|  PREDICTED: brassinosteroid-regulated protein...    382   9e-128   
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    382   9e-128   
emb|CDP02963.1|  unnamed protein product                                382   9e-128   
ref|XP_004146358.1|  PREDICTED: probable xyloglucan endotransgluc...    382   1e-127   
ref|XP_010053241.1|  PREDICTED: brassinosteroid-regulated protein...    382   1e-127   
gb|ABM91071.1|  xyloglucan endotransglycosylase/hydrolase precurs...    381   2e-127   
emb|CDX94413.1|  BnaC01g17710D                                          381   2e-127   
ref|XP_002306736.2|  xyloglucan endo-1 family protein                   382   2e-127   
ref|XP_002325068.2|  hypothetical protein POPTR_0018s10300g             382   2e-127   
ref|XP_008223715.1|  PREDICTED: probable xyloglucan endotransgluc...    381   2e-127   
ref|XP_011079307.1|  PREDICTED: probable xyloglucan endotransgluc...    382   2e-127   
gb|KFK27296.1|  hypothetical protein AALP_AA8G364000                    381   2e-127   
ref|XP_010246961.1|  PREDICTED: brassinosteroid-regulated protein...    381   2e-127   
ref|XP_002268708.1|  PREDICTED: brassinosteroid-regulated protein...    381   2e-127   
ref|XP_009137907.1|  PREDICTED: xyloglucan endotransglucosylase/h...    380   2e-127   
gb|ABP04059.1|  xyloglucan endo-transglucosylase/hydrolase 1            381   2e-127   
ref|XP_011044804.1|  PREDICTED: brassinosteroid-regulated protein...    381   3e-127   
ref|XP_004149095.1|  PREDICTED: probable xyloglucan endotransgluc...    380   3e-127   
ref|XP_008223655.1|  PREDICTED: xyloglucan endotransglucosylase/h...    381   3e-127   
ref|XP_011006106.1|  PREDICTED: brassinosteroid-regulated protein...    380   4e-127   
ref|XP_009626663.1|  PREDICTED: probable xyloglucan endotransgluc...    380   4e-127   
ref|XP_006656426.1|  PREDICTED: probable xyloglucan endotransgluc...    380   4e-127   
ref|XP_006858039.1|  hypothetical protein AMTR_s00062p00020460          380   4e-127   
ref|XP_010046991.1|  PREDICTED: probable xyloglucan endotransgluc...    380   5e-127   
ref|XP_007215791.1|  hypothetical protein PRUPE_ppa009863mg             379   5e-127   
ref|XP_008781813.1|  PREDICTED: probable xyloglucan endotransgluc...    380   6e-127   
dbj|BAD93484.1|  pollen major allergen No.121 isoform 1                 379   7e-127   
ref|XP_008229404.1|  PREDICTED: brassinosteroid-regulated protein...    379   8e-127   
ref|XP_004163176.1|  PREDICTED: probable xyloglucan endotransgluc...    379   8e-127   
ref|XP_010046990.1|  PREDICTED: probable xyloglucan endotransgluc...    380   9e-127   
ref|XP_002526224.1|  Xyloglucan endotransglucosylase/hydrolase pr...    380   9e-127   
emb|CDX68640.1|  BnaC01g08130D                                          379   9e-127   
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase              379   9e-127   
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...    380   9e-127   
ref|XP_004507836.1|  PREDICTED: probable xyloglucan endotransgluc...    380   1e-126   
ref|XP_004242686.1|  PREDICTED: xyloglucan endotransglucosylase/h...    379   1e-126   
ref|XP_008341405.1|  PREDICTED: brassinosteroid-regulated protein...    379   1e-126   
ref|XP_008799496.1|  PREDICTED: probable xyloglucan endotransgluc...    380   1e-126   
ref|XP_008229403.1|  PREDICTED: brassinosteroid-regulated protein...    379   1e-126   
gb|KDP35747.1|  hypothetical protein JCGZ_10519                         378   1e-126   
emb|CDY25904.1|  BnaC09g32760D                                          379   2e-126   
ref|XP_009356635.1|  PREDICTED: probable xyloglucan endotransgluc...    378   2e-126   
ref|XP_009417169.1|  PREDICTED: probable xyloglucan endotransgluc...    379   2e-126   
ref|XP_008453623.1|  PREDICTED: xyloglucan endotransglucosylase/h...    379   2e-126   
gb|AGT29357.1|  xyloglucan endotransglucosylase/hydrolase 7             378   2e-126   
ref|XP_009127941.1|  PREDICTED: xyloglucan endotransglucosylase/h...    378   3e-126   
ref|XP_011044805.1|  PREDICTED: brassinosteroid-regulated protein...    380   4e-126   
gb|ABE11608.1|  xyloglucan endo-transglycosylase precursor              377   4e-126   
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase              378   4e-126   
ref|XP_009380745.1|  PREDICTED: probable xyloglucan endotransgluc...    377   4e-126   
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16       378   5e-126   
ref|XP_008229401.1|  PREDICTED: brassinosteroid-regulated protein...    377   5e-126   
ref|XP_006387415.1|  xyloglucan endo-1 family protein                   377   5e-126   
ref|XP_004966138.1|  PREDICTED: probable xyloglucan endotransgluc...    378   5e-126   
ref|XP_002520387.1|  Brassinosteroid-regulated protein BRU1 precu...    377   6e-126   
ref|XP_002307040.2|  xyloglucan endo-1 family protein                   377   6e-126   
ref|XP_009356633.1|  PREDICTED: brassinosteroid-regulated protein...    377   6e-126   
ref|XP_007154780.1|  hypothetical protein PHAVU_003G147300g             377   6e-126   
ref|XP_009120269.1|  PREDICTED: probable xyloglucan endotransgluc...    377   7e-126   
ref|XP_011079309.1|  PREDICTED: xyloglucan endotransglucosylase/h...    377   8e-126   
gb|KCW89704.1|  hypothetical protein EUGRSUZ_A01966                     377   8e-126   
emb|CDY67778.1|  BnaA10g29060D                                          377   8e-126   
ref|XP_006279674.1|  hypothetical protein CARUB_v10026912mg             377   9e-126   
gb|EPS66054.1|  hypothetical protein M569_08724                         376   1e-125   
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3             377   1e-125   
ref|NP_568859.2|  probable xyloglucan endotransglucosylase/hydrol...    377   1e-125   
ref|XP_008346306.1|  PREDICTED: xyloglucan endotransglucosylase/h...    376   1e-125   
gb|KHF98181.1|  putative xyloglucan endotransglucosylase/hydrolas...    377   1e-125   
ref|XP_006474631.1|  PREDICTED: xyloglucan endotransglucosylase/h...    376   1e-125   
gb|KDP33066.1|  hypothetical protein JCGZ_13603                         376   1e-125   
gb|EMT07366.1|  Putative xyloglucan endotransglucosylase/hydrolas...    377   1e-125   
ref|XP_009406667.1|  PREDICTED: probable xyloglucan endotransgluc...    376   1e-125   
ref|XP_006358761.1|  PREDICTED: brassinosteroid-regulated protein...    376   1e-125   
ref|XP_009356638.1|  PREDICTED: brassinosteroid-regulated protein...    377   2e-125   
ref|XP_009611406.1|  PREDICTED: probable xyloglucan endotransgluc...    376   2e-125   
gb|AAB18364.1|  xyloglucan endotransglycosylase-related protein         376   2e-125   
ref|XP_011026281.1|  PREDICTED: brassinosteroid-regulated protein...    376   2e-125   
gb|EMT12047.1|  Putative xyloglucan endotransglucosylase/hydrolas...    376   3e-125   
emb|CDX72228.1|  BnaC07g42500D                                          375   3e-125   
ref|XP_004165696.1|  PREDICTED: xyloglucan endotransglucosylase/h...    376   3e-125   
ref|XP_004247897.1|  PREDICTED: brassinosteroid-regulated protein...    375   3e-125   
ref|XP_004146306.1|  PREDICTED: xyloglucan endotransglucosylase/h...    375   3e-125   
ref|XP_006474628.1|  PREDICTED: probable xyloglucan endotransgluc...    378   3e-125   
ref|XP_007034180.1|  Xyloglucan endotransglucosylase/hydrolase 16       375   3e-125   
ref|NP_001058459.1|  Os06g0697000                                       375   4e-125   
ref|XP_007048840.1|  Xyloglucan endotransglucosylase/hydrolase 15       375   4e-125   
ref|XP_006474158.1|  PREDICTED: xyloglucan endotransglucosylase/h...    375   4e-125   
ref|XP_010545428.1|  PREDICTED: xyloglucan endotransglucosylase/h...    375   5e-125   
ref|XP_004303859.1|  PREDICTED: probable xyloglucan endotransgluc...    375   5e-125   
gb|ABK30789.1|  xyloglucan endotransglycosylase 3                       374   5e-125   
gb|KDP36428.1|  hypothetical protein JCGZ_08697                         374   7e-125   
gb|KDP36433.1|  hypothetical protein JCGZ_08702                         375   7e-125   
ref|XP_004303861.1|  PREDICTED: probable xyloglucan endotransgluc...    375   8e-125   
ref|NP_194756.1|  xyloglucan endotransglucosylase/hydrolase prote...    374   1e-124   
emb|CDP02961.1|  unnamed protein product                                378   1e-124   
ref|XP_008348360.1|  PREDICTED: brassinosteroid-regulated protein...    374   2e-124   
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...    374   2e-124   
ref|XP_007014184.1|  Xyloglucan endotransglycosylase 6                  375   2e-124   
ref|XP_011007580.1|  PREDICTED: probable xyloglucan endotransgluc...    374   2e-124   
gb|EAZ02222.1|  hypothetical protein OsI_24317                          374   2e-124   
ref|XP_008452257.1|  PREDICTED: probable xyloglucan endotransgluc...    374   2e-124   
ref|XP_009377621.1|  PREDICTED: brassinosteroid-regulated protein...    374   2e-124   
ref|NP_001058457.1|  Os06g0696600                                       374   2e-124   
ref|XP_010676747.1|  PREDICTED: probable xyloglucan endotransgluc...    373   2e-124   
ref|XP_010526338.1|  PREDICTED: probable xyloglucan endotransgluc...    374   2e-124   
ref|XP_002301752.1|  brassinosteroid-regulated family protein           374   2e-124   
gb|AAQ82628.1|  xyloglucan endotransglucosylase                         373   2e-124   
ref|XP_011043995.1|  PREDICTED: xyloglucan endotransglucosylase/h...    374   2e-124   
gb|AAM63080.1|  xyloglucan endo-1,4-beta-D-glucanase precursor          372   3e-124   
gb|KFK29589.1|  hypothetical protein AALP_AA7G154000                    372   3e-124   
ref|XP_002867358.1|  meristem-5                                         372   3e-124   
ref|XP_006349901.1|  PREDICTED: brassinosteroid-regulated protein...    372   4e-124   
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg             372   6e-124   
ref|XP_006657289.1|  PREDICTED: probable xyloglucan endotransgluc...    372   7e-124   
ref|XP_002866212.1|  hypothetical protein ARALYDRAFT_495853             372   8e-124   
ref|XP_002267890.2|  PREDICTED: brassinosteroid-regulated protein...    372   9e-124   
emb|CDY39193.1|  BnaA03g50050D                                          371   1e-123   
ref|XP_010439278.1|  PREDICTED: xyloglucan endotransglucosylase/h...    371   1e-123   
ref|XP_002267838.1|  PREDICTED: brassinosteroid-regulated protein...    371   1e-123   
ref|XP_006845721.1|  hypothetical protein AMTR_s00019p00243410          372   1e-123   
ref|XP_009765042.1|  PREDICTED: brassinosteroid-regulated protein...    371   1e-123   
ref|XP_011007582.1|  PREDICTED: probable xyloglucan endotransgluc...    372   1e-123   
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    372   1e-123   
ref|XP_009628113.1|  PREDICTED: brassinosteroid-regulated protein...    371   1e-123   
gb|EYU42434.1|  hypothetical protein MIMGU_mgv1a023025mg                372   2e-123   
ref|NP_199618.1|  xyloglucan endotransglucosylase/hydrolase prote...    371   2e-123   
ref|XP_010442224.1|  PREDICTED: xyloglucan endotransglucosylase/h...    371   2e-123   
ref|XP_010482054.1|  PREDICTED: xyloglucan endotransglucosylase/h...    371   2e-123   
ref|XP_009108100.1|  PREDICTED: probable xyloglucan endotransgluc...    371   2e-123   
ref|XP_010690581.1|  PREDICTED: probable xyloglucan endotransgluc...    370   2e-123   
emb|CDY27126.1|  BnaA08g07640D                                          371   3e-123   
ref|XP_003560505.2|  PREDICTED: xyloglucan endotransglucosylase/h...    370   3e-123   
ref|XP_011024784.1|  PREDICTED: brassinosteroid-regulated protein...    370   3e-123   
ref|XP_009126833.1|  PREDICTED: probable xyloglucan endotransgluc...    370   4e-123   
ref|XP_010450105.1|  PREDICTED: probable xyloglucan endotransgluc...    370   4e-123   
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             370   4e-123   
ref|XP_010446167.1|  PREDICTED: probable xyloglucan endotransgluc...    370   5e-123   
ref|XP_010435185.1|  PREDICTED: probable xyloglucan endotransgluc...    370   5e-123   
ref|XP_006453415.1|  hypothetical protein CICLE_v10010412mg             369   5e-123   
ref|XP_004303862.1|  PREDICTED: probable xyloglucan endotransgluc...    370   6e-123   
ref|XP_009373581.1|  PREDICTED: brassinosteroid-regulated protein...    369   6e-123   
ref|XP_008229405.1|  PREDICTED: brassinosteroid-regulated protein...    370   7e-123   
ref|XP_011018195.1|  PREDICTED: probable xyloglucan endotransgluc...    368   8e-123   
ref|XP_002262761.1|  PREDICTED: brassinosteroid-regulated protein...    369   8e-123   
ref|XP_007217342.1|  hypothetical protein PRUPE_ppa020825mg             368   9e-123   
ref|XP_006381821.1|  xyloglucan endo-1 family protein                   369   9e-123   
dbj|BAO57276.1|  xyloglucan endotransglucosylase/hydrolase              369   1e-122   
ref|NP_001280908.1|  brassinosteroid-regulated protein BRU1-like ...    369   1e-122   
ref|XP_010527137.1|  PREDICTED: probable xyloglucan endotransgluc...    368   1e-122   
gb|KDO38356.1|  hypothetical protein CISIN_1g047166mg                   367   1e-122   
gb|KDP36427.1|  hypothetical protein JCGZ_08696                         369   1e-122   
ref|XP_011043994.1|  PREDICTED: xyloglucan endotransglucosylase/h...    369   2e-122   
ref|XP_006453409.1|  hypothetical protein CICLE_v10009172mg             368   2e-122   
ref|XP_004298224.1|  PREDICTED: brassinosteroid-regulated protein...    372   2e-122   
ref|XP_004252976.1|  PREDICTED: brassinosteroid-regulated protein...    367   2e-122   
gb|AFR46576.1|  xyloglucan endotransglucosylase/hydrolase 7             367   3e-122   
gb|ADM18305.1|  xyloglucantransglusylase/hydrolase 1                    368   3e-122   
ref|XP_002868312.1|  hypothetical protein ARALYDRAFT_493497             368   3e-122   
ref|XP_008246199.1|  PREDICTED: probable xyloglucan endotransgluc...    365   3e-122   
ref|XP_010532726.1|  PREDICTED: probable xyloglucan endotransgluc...    368   3e-122   
ref|XP_008229402.1|  PREDICTED: brassinosteroid-regulated protein...    367   4e-122   
gb|KDO37094.1|  hypothetical protein CISIN_1g036092mg                   368   4e-122   
ref|XP_003524918.1|  PREDICTED: brassinosteroid-regulated protein...    367   4e-122   
ref|XP_007215773.1|  hypothetical protein PRUPE_ppa009608mg             367   4e-122   
ref|XP_004293654.1|  PREDICTED: probable xyloglucan endotransgluc...    368   5e-122   
gb|EMS61565.1|  putative xyloglucan endotransglucosylase/hydrolas...    367   5e-122   
ref|XP_002438936.1|  hypothetical protein SORBIDRAFT_10g028580          368   6e-122   
ref|XP_006414798.1|  hypothetical protein EUTSA_v10025705mg             369   7e-122   
ref|XP_002863854.1|  ATXTH20                                            367   7e-122   
ref|XP_008229400.1|  PREDICTED: brassinosteroid-regulated protein...    367   8e-122   
gb|AFR46580.2|  xyloglucan endotransglucosylase/hydrolase 12            367   8e-122   
emb|CDY66832.1|  BnaAnng23050D                                          366   8e-122   
ref|XP_008380453.1|  PREDICTED: brassinosteroid-regulated protein...    366   9e-122   
ref|XP_002302145.2|  hypothetical protein POPTR_0002s06120g             370   1e-121   
ref|NP_001130486.1|  xyloglucan endotransglucosylase/hydrolase pr...    367   1e-121   
ref|NP_566738.1|  xyloglucan endotransglucosylase/hydrolase prote...    366   2e-121   
ref|XP_002437518.1|  hypothetical protein SORBIDRAFT_10g028550          366   2e-121   
ref|XP_009377610.1|  PREDICTED: brassinosteroid-regulated protein...    366   2e-121   
gb|ABM91075.1|  xyloglucan endotransglycosylase/hydrolase precurs...    366   2e-121   
ref|XP_004303860.1|  PREDICTED: probable xyloglucan endotransgluc...    366   2e-121   
emb|CDY03539.1|  BnaC03g67980D                                          367   2e-121   
emb|CCW72555.1|  xyloglucan endotransglycosylase 6.3                    365   3e-121   
emb|CAN83588.1|  hypothetical protein VITISV_004806                     365   3e-121   
ref|XP_003610154.1|  Xyloglucan endotransglucosylase/hydrolase          365   3e-121   
ref|XP_006453419.1|  hypothetical protein CICLE_v10010722mg             366   4e-121   
gb|AFK33604.1|  unknown                                                 365   4e-121   
gb|ACU23820.1|  unknown                                                 365   4e-121   
dbj|BAJ89557.1|  predicted protein                                      365   4e-121   
ref|XP_010536921.1|  PREDICTED: probable xyloglucan endotransgluc...    365   4e-121   
dbj|BAJ99431.1|  predicted protein                                      365   4e-121   
gb|KFK24577.1|  hypothetical protein AALP_AAs45078U000600               365   5e-121   



>dbj|BAO57275.1| xyloglucan endotransglucosylase/hydrolase [Ipomoea nil]
Length=294

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/294 (99%), Positives = 292/294 (99%), Gaps = 1/294 (0%)
 Frame = -3

Query  1146  MASLEATHRGGGG-VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLS  970
             MASLEATHRGGGG VAAFILLLTTLSAAGIAAGNF NEIGFNWGQDHGKILENGQLLTLS
Sbjct  1     MASLEATHRGGGGGVAAFILLLTTLSAAGIAAGNFNNEIGFNWGQDHGKILENGQLLTLS  60

Query  969   LDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSG  790
             LDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSG
Sbjct  61    LDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSG  120

Query  789   DPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEA  610
             DPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEA
Sbjct  121   DPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEA  180

Query  609   SGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTS  430
             SGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTS
Sbjct  181   SGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTS  240

Query  429   SCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             SCT+NPSANPWLSQSLDISGQQRI+WVQKNYMIYNYCTDAKRFPQGFPPECSLN
Sbjct  241   SCTQNPSANPWLSQSLDISGQQRIQWVQKNYMIYNYCTDAKRFPQGFPPECSLN  294



>ref|XP_009609044.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nicotiana tomentosiformis]
Length=279

 Score =   456 bits (1173),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 218/280 (78%), Positives = 247/280 (88%), Gaps = 2/280 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             + +F+ L+  L  A   AGNF  +    WG    KILENGQLLTLSLD+ SGSGFRS NQ
Sbjct  2     MKSFLFLMIFLVVA--LAGNFNKDFDITWGDGRAKILENGQLLTLSLDKTSGSGFRSKNQ  59

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKID+KIKLVPGNSAGTVTTYYLSS+GS+HDEIDFEFLGNLSGDPY+LHTNVFTQGK
Sbjct  60    YLFGKIDLKIKLVPGNSAGTVTTYYLSSIGSSHDEIDFEFLGNLSGDPYILHTNVFTQGK  119

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPTKDFHTY+ILWNPQSIIFSVDGTPIRQFKN+EASGIP+PK+QPMW+Y
Sbjct  120   GNREQQFYLWFDPTKDFHTYTILWNPQSIIFSVDGTPIRQFKNLEASGIPYPKNQPMWIY  179

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWS+APFIASYRNY+AQACV+ S+SS+S  + + + N WLS+
Sbjct  180   SSLWNADDWATRGGLVKTDWSKAPFIASYRNYNAQACVWSSSSSSSCTSNSSTGNSWLSE  239

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             SLD +GQ RIKWVQ NYMIYNYCTD KRFPQGFPPECSLN
Sbjct  240   SLDSTGQSRIKWVQSNYMIYNYCTDTKRFPQGFPPECSLN  279



>ref|XP_006360667.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Solanum tuberosum]
Length=282

 Score =   454 bits (1168),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 211/263 (80%), Positives = 236/263 (90%), Gaps = 1/263 (0%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF  +    WG    KILENGQL+TLSLD+ASGSGFRS NQY++GKID+KIKLVPGNS
Sbjct  21    AGNFNQDFDITWGDGRAKILENGQLMTLSLDKASGSGFRSKNQYLFGKIDLKIKLVPGNS  80

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYLSS+GS+HDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKDF
Sbjct  81    AGTVTTYYLSSIGSSHDEIDFEFLGNLSGDPYILHTNVFTQGKGDREQQFYLWFDPTKDF  140

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQSIIFSVDGTPIRQFKNME+SGIP+PK QPMW+YSSLW+A+DWATRGGLVK
Sbjct  141   HTYSILWNPQSIIFSVDGTPIRQFKNMESSGIPYPKSQPMWIYSSLWNADDWATRGGLVK  200

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
             TDW++APFIASY N++AQACV+ S S+ SSC  + + N WLS++LDI+GQ RIKWVQ NY
Sbjct  201   TDWTKAPFIASYTNFNAQACVWSSTSTASSC-NSTTQNSWLSENLDITGQSRIKWVQNNY  259

Query  336   MIYNYCTDAKRFPQGFPPECSLN  268
             MIYNYC D KRFPQGFP ECSLN
Sbjct  260   MIYNYCNDIKRFPQGFPRECSLN  282



>ref|XP_009796455.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Nicotiana sylvestris]
Length=288

 Score =   452 bits (1162),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 218/281 (78%), Positives = 243/281 (86%), Gaps = 2/281 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             + +F+ L   L      AG+F  E    WG    KILENGQLLTLSLD+ SGSGFRS  Q
Sbjct  9     IISFLFLSFLLVVMAALAGDFNQEFDVTWGDGRVKILENGQLLTLSLDKTSGSGFRSKRQ  68

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             YM+GKIDMKIKLVPGNSAGTVTTYYLSSLG THDEIDFEFLGNLSGDPY+LHTNVFTQGK
Sbjct  69    YMFGKIDMKIKLVPGNSAGTVTTYYLSSLGPTHDEIDFEFLGNLSGDPYILHTNVFTQGK  128

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS-GIPFPKDQPMWM  571
             G REQQFYLWFDPTKDFHTYSILWNP+SIIFSVDGTPIRQFKN+E S GIP+PK+QPMW+
Sbjct  129   GDREQQFYLWFDPTKDFHTYSILWNPRSIIFSVDGTPIRQFKNLETSMGIPYPKNQPMWI  188

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSLWDAEDWATRGGLVKTDWSQAPF+ASYRN++AQACV+ S S++S  ++N +AN W++
Sbjct  189   YSSLWDAEDWATRGGLVKTDWSQAPFVASYRNFNAQACVWSSGSTSSC-SRNSTANSWIT  247

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             +SLD SGQ RIKWVQKNYM+YNYCTD KRFPQGFP ECSLN
Sbjct  248   ESLDNSGQARIKWVQKNYMVYNYCTDIKRFPQGFPLECSLN  288



>ref|XP_009760620.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nicotiana sylvestris]
Length=279

 Score =   447 bits (1150),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 217/280 (78%), Positives = 242/280 (86%), Gaps = 2/280 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             + +F+  +  L  A   AGNF       WG    KILENGQLLTLSLD+ SGSGFRS NQ
Sbjct  2     MKSFLFQMMFLVVA--FAGNFNQNFDITWGDGRAKILENGQLLTLSLDKTSGSGFRSKNQ  59

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKID+KIKLVPGNSAGTVTTYYLSS+GS+HDEIDFEFLGNLSGDPY+LHTNVFTQGK
Sbjct  60    YLFGKIDLKIKLVPGNSAGTVTTYYLSSIGSSHDEIDFEFLGNLSGDPYILHTNVFTQGK  119

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPTK FHTYSILWNPQSIIFSVDGTPIRQFKN+EASGIP+PK+QPMW+Y
Sbjct  120   GNREQQFYLWFDPTKYFHTYSILWNPQSIIFSVDGTPIRQFKNLEASGIPYPKNQPMWIY  179

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWS+APFIASYRNY+AQACV+ S SS+S    N + N WLS+
Sbjct  180   SSLWNADDWATRGGLVKTDWSKAPFIASYRNYNAQACVWSSTSSSSCSPNNSTENSWLSE  239

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             SLD +GQ +IKWVQ NYMIYNYCTD KRFPQGFPPECSLN
Sbjct  240   SLDNTGQSKIKWVQNNYMIYNYCTDTKRFPQGFPPECSLN  279



>gb|ABD98046.1| xyloglucan endotransglycosylase [Striga asiatica]
Length=277

 Score =   441 bits (1134),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/280 (75%), Positives = 234/280 (84%), Gaps = 5/280 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAG-NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             +  +I+LL  +S A  A G NF  +    WG    KIL NG+LLTLSLD+ SGSGFRS  
Sbjct  1     MKKYIVLLALISFAATATGSNFNQDFDITWGDGRAKILNNGKLLTLSLDKTSGSGFRSKK  60

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             QYM+GKID++IKLVPGNSAGTVTTYYLSSLG  HDEIDFEFLGNLSG PY LHTNVF QG
Sbjct  61    QYMFGKIDLQIKLVPGNSAGTVTTYYLSSLGPNHDEIDFEFLGNLSGQPYTLHTNVFAQG  120

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KGGREQQF LWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKN+E+ G+P+PK QPMW+
Sbjct  121   KGGREQQFRLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNLESKGVPYPKSQPMWV  180

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSLW+A+DWATRGGLVKTDWSQAPF ASY N++A AC    + +TSSC++N SAN W S
Sbjct  181   YSSLWNADDWATRGGLVKTDWSQAPFTASYTNFNALAC----SGATSSCSQNSSANSWFS  236

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             QSLD SGQQRIKWVQKNYM YNYCTD KR+PQGFP ECS+
Sbjct  237   QSLDFSGQQRIKWVQKNYMTYNYCTDTKRYPQGFPIECSI  276



>gb|EYU25733.1| hypothetical protein MIMGU_mgv1a011641mg [Erythranthe guttata]
Length=275

 Score =   437 bits (1123),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 232/278 (83%), Gaps = 7/278 (3%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +   + +L +  AA I  GNF  +    WG+   KIL+NG+LLTLSLD+ASGSGFRS NQ
Sbjct  3     IHVLLSVLLSFVAAAIC-GNFNQDFDITWGEGRAKILDNGKLLTLSLDKASGSGFRSKNQ  61

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM+IKLVPGNSAGTVTTYYLSSLG  HDEIDFEFLGNLSGDPY+LHTNVF  GK
Sbjct  62    YLFGKIDMQIKLVPGNSAGTVTTYYLSSLGQNHDEIDFEFLGNLSGDPYILHTNVFALGK  121

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKN E+ G+ +PK QPMW++
Sbjct  122   GNREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNQESKGVSYPKSQPMWIF  181

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDW++APF ASY N++A AC  G      SC+K  S N W SQ
Sbjct  182   SSLWNADDWATRGGLVKTDWTKAPFTASYANFNALACTAG------SCSKKSSVNSWFSQ  235

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             SLDI+GQ+RIKWVQKNYMIYNYCTD+KRFPQGFP ECS
Sbjct  236   SLDITGQERIKWVQKNYMIYNYCTDSKRFPQGFPTECS  273



>ref|NP_001289204.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Pyrus x bretschneideri]
 gb|AGR44475.1| xyloglucan endotransglycosylase 2 [Pyrus x bretschneideri]
Length=282

 Score =   437 bits (1123),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/263 (77%), Positives = 233/263 (89%), Gaps = 3/263 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  +    WG    KIL+NGQ LTLSLD+ SGSGFRS NQY++GKIDM+IKLVPGN
Sbjct  20    SAGNFNQDFDITWGDGRAKILDNGQSLTLSLDKTSGSGFRSKNQYLFGKIDMQIKLVPGN  79

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSSLGSTHDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKD
Sbjct  80    SAGTVTAYYLSSLGSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKD  139

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ+IIFSVDGTPIR+FKN+E+ G+ FPKDQ MW+YSSLW+A+DWATRGGLV
Sbjct  140   FHTYSILWNPQTIIFSVDGTPIREFKNLESKGVSFPKDQGMWIYSSLWNADDWATRGGLV  199

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSC-TKNPSANPWLSQSLDISGQQRIKWVQK  343
             KTDWS+APF ASYRN++AQAC +  +S TS C +++P+ + WL+QSLD +GQ+R+KWVQK
Sbjct  200   KTDWSKAPFTASYRNFNAQACTW--SSGTSRCPSESPNESSWLTQSLDSTGQERMKWVQK  257

Query  342   NYMIYNYCTDAKRFPQGFPPECS  274
             NYMIYNYC D KRFPQGFPPECS
Sbjct  258   NYMIYNYCRDTKRFPQGFPPECS  280



>ref|NP_001281042.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Malus domestica]
 gb|AAN07898.1| xyloglucan endotransglycosylase [Malus domestica]
 gb|ACD03226.1| xyloglucan endotransglucosylase/hydrolase 2 [Malus domestica]
Length=282

 Score =   437 bits (1123),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/263 (77%), Positives = 233/263 (89%), Gaps = 3/263 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  +    WG    KIL+NGQ LTLSLD+ SGSGF+S NQY++GKIDM+IKLVPGN
Sbjct  20    SAGNFNQDFDITWGDGRAKILDNGQSLTLSLDKTSGSGFQSKNQYLFGKIDMQIKLVPGN  79

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSSLGSTHDEIDFEFLGNLSGDPY+LHTN+FTQGKG REQQFYLWFDPTKD
Sbjct  80    SAGTVTAYYLSSLGSTHDEIDFEFLGNLSGDPYILHTNIFTQGKGNREQQFYLWFDPTKD  139

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ+IIFSVDGTPIR+FKN+E+ G+ FPKDQ MW+YSSLW+A+DWATRGGLV
Sbjct  140   FHTYSILWNPQTIIFSVDGTPIREFKNLESKGVSFPKDQGMWIYSSLWNADDWATRGGLV  199

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSC-TKNPSANPWLSQSLDISGQQRIKWVQK  343
             KTDWS+APF ASYRN++AQAC +  +S TS C +K+P+ + WL+QSLD +GQ+RIKWVQK
Sbjct  200   KTDWSKAPFTASYRNFNAQACTW--SSGTSRCPSKSPNESSWLTQSLDSTGQERIKWVQK  257

Query  342   NYMIYNYCTDAKRFPQGFPPECS  274
             NYMIYNYC D KRFPQGFPPECS
Sbjct  258   NYMIYNYCRDTKRFPQGFPPECS  280



>ref|XP_004240131.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Solanum lycopersicum]
Length=288

 Score =   434 bits (1117),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 207/263 (79%), Positives = 235/263 (89%), Gaps = 1/263 (0%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF  +    WG D  KILENGQL+TLSLD+ SGSGFRS NQY++GKID+KIKLVPGNS
Sbjct  27    AGNFNQDFDITWGDDRAKILENGQLMTLSLDKVSGSGFRSKNQYLFGKIDLKIKLVPGNS  86

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYLSS+GS+HDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKDF
Sbjct  87    AGTVTTYYLSSIGSSHDEIDFEFLGNLSGDPYILHTNVFTQGKGDREQQFYLWFDPTKDF  146

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQSIIFSVDGTPIRQFKN+E+SGIP+PK QPMW+YSSLW+A+DWATRGGLVK
Sbjct  147   HTYSILWNPQSIIFSVDGTPIRQFKNLESSGIPYPKSQPMWIYSSLWNADDWATRGGLVK  206

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
              DW++APFIASY N++AQACV+ S S++SSC    + + WLS++LDI+G+ RIKWVQ NY
Sbjct  207   IDWTKAPFIASYTNFNAQACVWSSTSTSSSCNST-TQDSWLSENLDITGKSRIKWVQNNY  265

Query  336   MIYNYCTDAKRFPQGFPPECSLN  268
             MIYNYC D KRFPQGFP ECSLN
Sbjct  266   MIYNYCNDIKRFPQGFPLECSLN  288



>ref|XP_007015526.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY33145.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=285

 Score =   433 bits (1113),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 214/278 (77%), Positives = 240/278 (86%), Gaps = 8/278 (3%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
               F LL++ L      AGNF  +    WG    KIL NGQLLTLSLD+ SGSGF+S  QY
Sbjct  15    VVFTLLVSAL------AGNFNQDFDITWGDGRAKILGNGQLLTLSLDKTSGSGFKSKKQY  68

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLVPGNSAGTVT YYLSSLGSTHDEIDFEFLGNLSGDPY+LHTNVFTQGKG
Sbjct  69    LFGKIDMQLKLVPGNSAGTVTAYYLSSLGSTHDEIDFEFLGNLSGDPYILHTNVFTQGKG  128

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPTKDFHTYSILWNP+SIIF VDGTPIR+FKN+E++GIPFPK QPMW+YS
Sbjct  129   NREQQFYLWFDPTKDFHTYSILWNPRSIIFYVDGTPIREFKNLESNGIPFPKSQPMWIYS  188

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLWDAE+WATRGGLVKTDWSQAPF ASY+N++AQAC++  AS++SSC+ N S N WL+QS
Sbjct  189   SLWDAEEWATRGGLVKTDWSQAPFTASYQNFNAQACIW--ASNSSSCSANSSKNSWLTQS  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD SGQ RIKWVQKNYMIYNYCTDAKRF QGFPPECSL
Sbjct  247   LDSSGQARIKWVQKNYMIYNYCTDAKRFQQGFPPECSL  284



>gb|ACD03220.1| xyloglucan endotransglucosylase/hydrolase 10 [Actinidia deliciosa]
Length=283

 Score =   427 bits (1099),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 211/275 (77%), Positives = 240/275 (87%), Gaps = 1/275 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +L+   LS   +A AG+F  +    WG    KIL  G+LLTLSLD+ASGSGF+S NQY++
Sbjct  7     VLVSLILSFTAVASAGSFYQDFDIKWGDGRAKILGEGKLLTLSLDKASGSGFQSQNQYLF  66

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM+IKLVPGNSAGTVT+YYLSSLGSTHDEIDFEFLGNLSGDPY LHTNVFTQGKG R
Sbjct  67    GKIDMQIKLVPGNSAGTVTSYYLSSLGSTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNR  126

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPTKDFHTYSILWNP+SIIFSVDGTPIRQFKNM++ GIPFPKDQPMW+YSSL
Sbjct  127   EQQFHLWFDPTKDFHTYSILWNPRSIIFSVDGTPIRQFKNMQSDGIPFPKDQPMWIYSSL  186

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN++AQAC + S+SS+SSC+ NP+ N WLS+SLD
Sbjct  187   WNADDWATRGGLVKTDWSQAPFTASYRNFNAQACTWSSSSSSSSCSNNPTNNSWLSESLD  246

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              +GQ+RIKW QKNYMIYNYCTD KRFP G P ECS
Sbjct  247   STGQERIKWAQKNYMIYNYCTDLKRFPLGLPSECS  281



>gb|KHN22640.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=283

 Score =   424 bits (1089),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 231/277 (83%), Gaps = 1/277 (0%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ LL T      +AGNF  +    WG    KIL +G+LLTLSLD+ SGSGFRS N+Y++
Sbjct  6     FLALLITTFVVAASAGNFNQDFEITWGDGRAKILNSGELLTLSLDKTSGSGFRSRNEYLF  65

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSSLG THDEIDFEFLGNLSGDPY+LHTNVFTQGKG R
Sbjct  66    GKIDMQLKLVPGNSAGTVTAYYLSSLGDTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNR  125

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPT+DFHTYSILWNPQSIIFSVDGTPIR+FKN+E+ G+ FPK+QPM +YSSL
Sbjct  126   EQQFYLWFDPTQDFHTYSILWNPQSIIFSVDGTPIREFKNLESKGVSFPKNQPMRIYSSL  185

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDWSQAPF ASYR ++AQACV+  S+ S+ S     S   WL QSL
Sbjct  186   WNADDWATRGGLVKTDWSQAPFTASYRKFNAQACVWTSSSGSSCSSNNPSSNQAWLKQSL  245

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             D +GQ RI+WVQKNYMIYNYCTD KRFPQG PPEC++
Sbjct  246   DSTGQARIQWVQKNYMIYNYCTDTKRFPQGLPPECTI  282



>emb|CDP16009.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   423 bits (1088),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 203/263 (77%), Positives = 234/263 (89%), Gaps = 1/263 (0%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF  +    +G    +IL+NG+LLTLSLD+ SGSGFRS NQY++GKID+++KLVPGNS
Sbjct  21    AGNFYQDFDITFGDGRAQILQNGKLLTLSLDKTSGSGFRSKNQYLFGKIDIQMKLVPGNS  80

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYLSS+GS HDEIDFEFLGNLSG+PY+LHTNV+TQGKGGREQQFYLWFDPTK F
Sbjct  81    AGTVTTYYLSSIGSNHDEIDFEFLGNLSGEPYILHTNVYTQGKGGREQQFYLWFDPTKGF  140

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             H+Y+ILWNPQSIIFSVDGTPIRQFKN+E++GIP+PKDQPMWMYSSLWDAEDWATRGGLVK
Sbjct  141   HSYTILWNPQSIIFSVDGTPIRQFKNLESNGIPYPKDQPMWMYSSLWDAEDWATRGGLVK  200

Query  516   TDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             TDWSQAPFIASY+NY+AQAC++   +S++S    N SAN WL++SLD SG +RI WVQKN
Sbjct  201   TDWSQAPFIASYQNYNAQACIWSSGSSTSSCSKSNSSANSWLTESLDSSGLERINWVQKN  260

Query  339   YMIYNYCTDAKRFPQGFPPECSL  271
             YMIYNYCTD  RFPQGFP ECSL
Sbjct  261   YMIYNYCTDKSRFPQGFPHECSL  283



>ref|NP_001242489.1| uncharacterized protein LOC100807063 precursor [Glycine max]
 gb|ACU20296.1| unknown [Glycine max]
Length=283

 Score =   422 bits (1084),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 230/277 (83%), Gaps = 1/277 (0%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ LL T      +AGNF  +    WG    KIL +G+LLTLSLD+ SGSGFRS N+Y++
Sbjct  6     FLALLITTFVVAASAGNFNQDFEITWGDGRAKILNSGELLTLSLDKTSGSGFRSRNEYLF  65

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSSLG THDEIDFEFLGNLSGDPY+LHTNVFTQGKG R
Sbjct  66    GKIDMQLKLVPGNSAGTVTAYYLSSLGDTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNR  125

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPT+DFHTYSILWNPQSIIFSVDGTPIR+FKN+E+ G  FPK+QPM +YSSL
Sbjct  126   EQQFYLWFDPTQDFHTYSILWNPQSIIFSVDGTPIREFKNLESKGASFPKNQPMRIYSSL  185

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDWSQAPF ASYR ++AQACV+  S+ S+ S     S   WL QSL
Sbjct  186   WNADDWATRGGLVKTDWSQAPFTASYRKFNAQACVWTSSSGSSCSSNNPSSNQAWLKQSL  245

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             D +GQ RI+WVQKNYMIYNYCTD KRFPQG PPEC++
Sbjct  246   DSTGQARIQWVQKNYMIYNYCTDTKRFPQGLPPECTI  282



>gb|KHF98175.1| putative xyloglucan endotransglucosylase/hydrolase 23 -like protein 
[Gossypium arboreum]
Length=290

 Score =   421 bits (1083),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 197/282 (70%), Positives = 235/282 (83%), Gaps = 6/282 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIA--AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             F LL+  L A  +A  A NF N+    WG   GKI+ NG++LTLSLD+ASGSGF+S N+Y
Sbjct  8     FTLLVPLLVACLMASSASNFHNDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQSKNEY  67

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG
Sbjct  68    LFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKG  127

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G+PFPK+QPM +YS
Sbjct  128   NREQQFYLWFDPTVDFHTYSILWNPQRIIFSVDGTPIREFKNMESFGVPFPKNQPMRIYS  187

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA----NPW  397
             SLW+A+DWATRGGLVKTDW++APF ASYRN++A ACV+ + +S+     +PS+    + W
Sbjct  188   SLWNADDWATRGGLVKTDWTRAPFTASYRNFNADACVWSNGASSCKSNASPSSASTNSAW  247

Query  396   LSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              SQ +D + QQR+KWVQKNYMIYNYC DAKRFPQG PPEC++
Sbjct  248   FSQEMDSAKQQRLKWVQKNYMIYNYCNDAKRFPQGLPPECNM  289



>gb|KDP42857.1| hypothetical protein JCGZ_23799 [Jatropha curcas]
Length=268

 Score =   420 bits (1080),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 200/267 (75%), Positives = 229/267 (86%), Gaps = 1/267 (0%)
 Frame = -3

Query  1071  AAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKL  892
              A  AA +F       WG    KIL NGQLLTLSLD+ SGSGF+S  QY++GKIDM++KL
Sbjct  2     VAASAANDFNQNFDITWGDGRAKILNNGQLLTLSLDKTSGSGFKSKKQYLFGKIDMQLKL  61

Query  891   VPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFD  712
             VPGNSAGTVT YYLSS+GS HDEIDFEFLGNLSG+PY+LHTNVFTQGKG REQQFYLWFD
Sbjct  62    VPGNSAGTVTAYYLSSVGSAHDEIDFEFLGNLSGEPYILHTNVFTQGKGNREQQFYLWFD  121

Query  711   PTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATR  532
             PTKDFHTYS+LWNPQSIIFSVDGTPIR+FKN+E++GI FPK QPMW+YSSLW+A+DWATR
Sbjct  122   PTKDFHTYSVLWNPQSIIFSVDGTPIREFKNLESNGIQFPKSQPMWIYSSLWNADDWATR  181

Query  531   GGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKW  352
             GGLVKTDW+QAPF ASYRN++AQAC++ S SS+ S + + S N WL+QSLD +GQ+RIKW
Sbjct  182   GGLVKTDWTQAPFTASYRNFNAQACIWASGSSSCSSSNS-SKNSWLTQSLDTTGQERIKW  240

Query  351   VQKNYMIYNYCTDAKRFPQGFPPECSL  271
             VQKNYMIYNYCTD KRFPQG P ECS 
Sbjct  241   VQKNYMIYNYCTDTKRFPQGLPKECSF  267



>ref|XP_010687463.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   421 bits (1081),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 205/280 (73%), Positives = 235/280 (84%), Gaps = 4/280 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             VA  + LL        +  NF  +    WG    KIL NGQLLTLSLD+ SGSGFRS N+
Sbjct  11    VAFVVALLMLGFGLEGSDANFNKDFDITWGDGRAKILNNGQLLTLSLDKTSGSGFRSQNR  70

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             YMYGKIDM+IKLVP NSAGTVTTYYLSSLG+ HDEIDFEFLGNLSGDPY+LHTNVF QGK
Sbjct  71    YMYGKIDMQIKLVPDNSAGTVTTYYLSSLGANHDEIDFEFLGNLSGDPYILHTNVFAQGK  130

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPTKD+HTYSILWNP +IIF VDGTPIR+FKN+E+ G+ +PK QPMW+Y
Sbjct  131   GNREQQFYLWFDPTKDYHTYSILWNPLNIIFYVDGTPIREFKNLESKGMSYPKSQPMWVY  190

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLWDAEDWATRGG+VKTDW+QAPFIASYRNY+AQAC +  +SS+SSC    S++ WL+Q
Sbjct  191   SSLWDAEDWATRGGIVKTDWTQAPFIASYRNYNAQACTWSPSSSSSSC----SSSSWLNQ  246

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             +LD S Q+RI+WVQKNYMIYNYC+D+KRFPQGFPPECSLN
Sbjct  247   ALDTSEQRRIEWVQKNYMIYNYCSDSKRFPQGFPPECSLN  286



>ref|XP_007154667.1| hypothetical protein PHAVU_003G137600g [Phaseolus vulgaris]
 gb|ESW26661.1| hypothetical protein PHAVU_003G137600g [Phaseolus vulgaris]
Length=283

 Score =   420 bits (1080),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 231/277 (83%), Gaps = 1/277 (0%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ LL       ++AGN   +    WG    KIL NG+LLTLSLD+ASGSGFRS N+Y++
Sbjct  6     FLALLFVSYVIAVSAGNLNQDFEITWGDGRAKILNNGELLTLSLDKASGSGFRSRNEYLF  65

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSSLG+ HDEIDFEFLGNLSGDPY+LHTN+FTQGKG R
Sbjct  66    GKIDMQLKLVPGNSAGTVTAYYLSSLGNVHDEIDFEFLGNLSGDPYILHTNIFTQGKGNR  125

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIR+FKN+E+ G+ FPK+Q M +YSSL
Sbjct  126   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESKGVSFPKNQAMRIYSSL  185

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYG-SASSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDWSQAPF ASYRN++AQACV+  S+ S+ S     S   W+ QS+
Sbjct  186   WNADDWATRGGLVKTDWSQAPFTASYRNFNAQACVWTPSSGSSCSSNNPSSNQSWMKQSM  245

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             D +GQ RI+WVQKNYMIYNYCTD KRFPQG PPEC++
Sbjct  246   DATGQARIQWVQKNYMIYNYCTDTKRFPQGLPPECTI  282



>ref|XP_008223830.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
Length=285

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/278 (75%), Positives = 236/278 (85%), Gaps = 1/278 (0%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
               +LL T  +   +A AGN   +    WG    +IL+NGQLLTLSLD+ SGSGFRS NQY
Sbjct  7     VLVLLQTLFNILVVASAGNLNQDFDLTWGDGRAQILDNGQLLTLSLDKTSGSGFRSKNQY  66

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAGTVT YYLSSLGSTHDEIDFEFLGNLSGDPY+LHTNVFTQGKG
Sbjct  67    LFGKIDMQIKLVPGNSAGTVTAYYLSSLGSTHDEIDFEFLGNLSGDPYILHTNVFTQGKG  126

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKN+E+ GIPFPK+Q M +YS
Sbjct  127   NREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNLESKGIPFPKNQAMSIYS  186

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWATRGGLVK DWS+APF ASYRN++AQAC + S SS  S + + S++ WLSQS
Sbjct  187   SLWNADDWATRGGLVKADWSKAPFTASYRNFNAQACTWSSGSSHCSSSSSSSSSSWLSQS  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD +GQ+RIKWVQKNYMIYNYC D KRFPQGFP ECSL
Sbjct  247   LDATGQERIKWVQKNYMIYNYCRDTKRFPQGFPAECSL  284



>ref|XP_007222107.1| hypothetical protein PRUPE_ppa009610mg [Prunus persica]
 gb|EMJ23306.1| hypothetical protein PRUPE_ppa009610mg [Prunus persica]
Length=285

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/278 (75%), Positives = 235/278 (85%), Gaps = 1/278 (0%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
               +LL T  +   +A AGN   +    WG    +IL+NGQLLTLSLD+ SGSGFRS NQY
Sbjct  7     VLVLLQTLFNILVVASAGNLNQDFDLTWGDGRAQILDNGQLLTLSLDKTSGSGFRSKNQY  66

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAGTVT YYLSSLGSTHDEIDFEFLGNLSGDPY+LHTNVFTQGKG
Sbjct  67    LFGKIDMQIKLVPGNSAGTVTAYYLSSLGSTHDEIDFEFLGNLSGDPYILHTNVFTQGKG  126

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKN+E+ GIPFPK+Q M +YS
Sbjct  127   NREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNLESKGIPFPKNQAMSIYS  186

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWATRGGLVK DWS+APF ASYRN++AQAC + S SS  S + +  ++ WLSQS
Sbjct  187   SLWNADDWATRGGLVKADWSKAPFTASYRNFNAQACTWSSGSSRCSSSSSSGSSSWLSQS  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD +GQ+RIKWVQKNYMIYNYC D KRFPQGFP ECSL
Sbjct  247   LDATGQERIKWVQKNYMIYNYCRDTKRFPQGFPAECSL  284



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 192/264 (73%), Positives = 228/264 (86%), Gaps = 3/264 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  24    AGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGGREQQF+LWFDPT DF
Sbjct  84    AGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSSLW+A+DWATRGGL+K
Sbjct  144   HTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLDISGQQRIKWVQKN  340
             TDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ LD + QQR++WVQKN
Sbjct  204   TDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  339   YMIYNYCTDAKRFPQGFPPECSLN  268
             YMIYNYCTDAKRFPQG+PPEC+++
Sbjct  262   YMIYNYCTDAKRFPQGYPPECAIH  285



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 192/264 (73%), Positives = 228/264 (86%), Gaps = 3/264 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  24    AGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGGREQQF+LWFDPT DF
Sbjct  84    AGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSSLW+A+DWATRGGL+K
Sbjct  144   HTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLDISGQQRIKWVQKN  340
             TDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ LD + QQR++WVQKN
Sbjct  204   TDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  339   YMIYNYCTDAKRFPQGFPPECSLN  268
             YMIYNYCTDAKRFPQG+PPEC+++
Sbjct  262   YMIYNYCTDAKRFPQGYPPECAIH  285



>ref|XP_011020098.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=285

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 204/277 (74%), Positives = 236/277 (85%), Gaps = 1/277 (0%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
              F ++     A  +AAGNF  +    WG    K+L+NGQLLTLSLD+ SGSGF+S NQY+
Sbjct  9     CFTIVSFLFMAVAMAAGNFNQQFDTTWGDGRAKVLQNGQLLTLSLDKTSGSGFKSKNQYL  68

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSSLGS HDEIDFEFLGNLSGDPY+LHTNVFTQGKG 
Sbjct  69    FGKIDMQLKLVPGNSAGTVTAYYLSSLGSAHDEIDFEFLGNLSGDPYILHTNVFTQGKGN  128

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPTKDFHTYS+LWNP SI+FSVDGTPIR+FKNME+ GIP+PK QPMW+YSS
Sbjct  129   REQQFYLWFDPTKDFHTYSVLWNPLSIVFSVDGTPIREFKNMESKGIPYPKSQPMWIYSS  188

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSL  382
             LW+A+DWATRGGL+KTDWSQAPF ASYRN++AQAC++ S SS+ S + + S +  LSQSL
Sbjct  189   LWNADDWATRGGLIKTDWSQAPFTASYRNFNAQACIWASGSSSCSSSGSSSNSW-LSQSL  247

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
               +GQ RIKWVQKNYMIYNYCTDAKRFPQG PPECS+
Sbjct  248   GSTGQGRIKWVQKNYMIYNYCTDAKRFPQGPPPECSM  284



>ref|XP_004299791.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Fragaria vesca subsp. vesca]
Length=285

 Score =   418 bits (1075),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 231/278 (83%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             A ++    L AA  +AGNF  +    WG    KIL N QLLTL+LD+ SGSGF+S NQY+
Sbjct  8     ALVMFFKILVAA--SAGNFNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKSRNQYL  65

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM+IKLVPGNSAGTVT+YYLSSLGS HDEIDFEFLGNLSGDPY LHTNVFTQGKG 
Sbjct  66    FGKIDMQIKLVPGNSAGTVTSYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFTQGKGN  125

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIR+FKN+E+ GIPFPK+Q MW+YSS
Sbjct  126   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAMWIYSS  185

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQS  385
             LW+A+DWATRGGLVKTDWS+APF ASYRN++AQAC++   +SS SS     S   W +QS
Sbjct  186   LWNADDWATRGGLVKTDWSKAPFTASYRNFNAQACIWSSGSSSCSSSPSGSSKEAWFTQS  245

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD +G+ R+KWVQKNYMIY+YC D KRFPQG P EC++
Sbjct  246   LDATGKGRMKWVQKNYMIYDYCKDTKRFPQGVPLECTV  283



>gb|KDP36434.1| hypothetical protein JCGZ_08703 [Jatropha curcas]
Length=286

 Score =   418 bits (1075),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 198/282 (70%), Positives = 234/282 (83%), Gaps = 6/282 (2%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAA--GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
              + +LLLT  S+  +AA  GNF  +    WG    KIL NGQLLTL+LD+ASGSGF+S N
Sbjct  6     VSLLLLLTYFSSLILAALGGNFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRN  65

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTN+F+QG
Sbjct  66    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNLFSQG  125

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFY+WFDPT DFHTYSILWN Q IIFSVDGTPIR+FKN+E++G+PFPK QPM +
Sbjct  126   KGNREQQFYVWFDPTADFHTYSILWNSQRIIFSVDGTPIREFKNLESAGVPFPKSQPMRI  185

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN--PW  397
             YSSLW+A+DWATRGGLVKTDWSQAPF ASYRN++A ACV+ + +S  SC  N ++N   W
Sbjct  186   YSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNANACVWSNGAS--SCGTNAASNTTSW  243

Query  396   LSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LS+ LD + Q+R+KWVQKNYMIYNYCTD KRFPQG P EC L
Sbjct  244   LSEELDSTSQERLKWVQKNYMIYNYCTDIKRFPQGLPTECKL  285



>gb|AGI42451.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42453.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42462.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   417 bits (1073),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 234/279 (84%), Gaps = 8/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF LL++   AA     NF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y+
Sbjct  14    AFSLLVSLAFAA-----NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYL  68

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGG
Sbjct  69    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGG  128

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSS
Sbjct  129   REQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSS  188

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQS  385
             LW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ 
Sbjct  189   LWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEE  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             LD + QQR++WVQKNYMIYNYCTDAKRFPQG+PPEC+++
Sbjct  247   LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAIH  285



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/264 (72%), Positives = 227/264 (86%), Gaps = 3/264 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  24    AGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGGREQQF+LWFDPT DF
Sbjct  84    AGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSSLW+A+DWATRGGL+K
Sbjct  144   HTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLDISGQQRIKWVQKN  340
             TDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ LD + QQR++W QKN
Sbjct  204   TDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEELDATSQQRLQWAQKN  261

Query  339   YMIYNYCTDAKRFPQGFPPECSLN  268
             YMIYNYCTDAKRFPQG+PPEC+++
Sbjct  262   YMIYNYCTDAKRFPQGYPPECAIH  285



>gb|AGI42449.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 233/279 (84%), Gaps = 8/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF LL++   AA     NF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y+
Sbjct  14    AFSLLVSLAFAA-----NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYL  68

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGG
Sbjct  69    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGG  128

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSS
Sbjct  129   REQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSS  188

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQS  385
             LW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ 
Sbjct  189   LWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEE  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             LD + QQR++WVQKNYMIYNYCTDAKRFPQG+PPEC ++
Sbjct  247   LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECDVH  285



>gb|AGI42452.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 233/279 (84%), Gaps = 8/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF LL++   AA     NF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y+
Sbjct  14    AFSLLVSLAFAA-----NFHNDFDVTWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYL  68

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGG
Sbjct  69    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGG  128

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK Q M +YSS
Sbjct  129   REQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKSQAMRIYSS  188

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQS  385
             LW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ 
Sbjct  189   LWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEE  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             LD + QQR++WVQKNYMIYNYCTDAKRFPQG+PPEC+++
Sbjct  247   LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAIH  285



>gb|AGI42450.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/264 (72%), Positives = 227/264 (86%), Gaps = 3/264 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  24    AGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS G THDEIDFEFLGNLSGDPY LH NVF+QGKGGREQQF+LWFDPT DF
Sbjct  84    AGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHINVFSQGKGGREQQFHLWFDPTADF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSSLW+A+DWATRGGL+K
Sbjct  144   HTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLDISGQQRIKWVQKN  340
             TDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ LD + QQR++WVQKN
Sbjct  204   TDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  339   YMIYNYCTDAKRFPQGFPPECSLN  268
             YMIYNYCTDAKRFPQG+PPEC+++
Sbjct  262   YMIYNYCTDAKRFPQGYPPECAIH  285



>ref|XP_007014173.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31792.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=294

 Score =   417 bits (1071),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 237/285 (83%), Gaps = 8/285 (3%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V +F L    ++A+   AGNF  +    WG    KIL NGQLLTL+LD+ASGSGF+S N+
Sbjct  13    VKSFFLACFFMAAS---AGNFYQDFDLTWGDGRAKILNNGQLLTLALDKASGSGFQSKNE  69

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNV++QGK
Sbjct  70    YLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVYSQGK  129

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN+E++G+PFPK QPM +Y
Sbjct  130   GNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNLESNGVPFPKKQPMRIY  189

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS-----STSSCTKNPSAN  403
             SSLW+A+DWATRGGLVKTDWSQAPF ASYRN++A+ACV+ + +     S+SS +    +N
Sbjct  190   SSLWNADDWATRGGLVKTDWSQAPFTASYRNFNAKACVWTNGASSCSSSSSSSSSGSKSN  249

Query  402   PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              WLSQ LDI+GQQR+KWVQKNYMIYNYCTD KRFPQG P EC ++
Sbjct  250   AWLSQELDITGQQRLKWVQKNYMIYNYCTDTKRFPQGLPLECKMS  294



>ref|XP_006359066.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Solanum tuberosum]
Length=275

 Score =   416 bits (1068),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 198/281 (70%), Positives = 228/281 (81%), Gaps = 14/281 (5%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             + +F++L+  L       G F  E    WG    KILENGQLLTLSLDR+SGSGF+S  Q
Sbjct  8     IFSFLVLICFLVVVAFG-GTFDQEFDVTWGYGRVKILENGQLLTLSLDRSSGSGFKSKQQ  66

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             YM+ KIDMKIKLVPGNSAGT TTYYLSS+GS HDEIDFEFLGN+SG+PY LHTNV+ QGK
Sbjct  67    YMFAKIDMKIKLVPGNSAGTATTYYLSSVGSAHDEIDFEFLGNVSGEPYTLHTNVYAQGK  126

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS-GIPFPKDQPMWM  571
             G REQQFYLWFDPTKDFHTYSILWNP++IIF VDGTPIRQ+KN+EA+ GIP+PK+QPMW+
Sbjct  127   GDREQQFYLWFDPTKDFHTYSILWNPRNIIFLVDGTPIRQYKNLEATNGIPYPKNQPMWL  186

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSLW+AE+WATRGGLV+TDWS+APFIASYRN++ Q             +KNP AN WL+
Sbjct  187   YSSLWNAEEWATRGGLVRTDWSKAPFIASYRNFNVQT------------SKNPIANSWLT  234

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             QSLD  G  R+KWVQKNYMIYNYCTD KRFPQGFP EC+LN
Sbjct  235   QSLDNVGLARMKWVQKNYMIYNYCTDTKRFPQGFPHECTLN  275



>gb|AGI42460.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 195/279 (70%), Positives = 233/279 (84%), Gaps = 8/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF LL++   AA     NF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y+
Sbjct  14    AFSLLVSLAFAA-----NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYL  68

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGG
Sbjct  69    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGG  128

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPT DFHTYSILWNPQ IIFSVD  PIR+FKN E+ G+ +PK+Q M +YSS
Sbjct  129   REQQFHLWFDPTADFHTYSILWNPQRIIFSVDNAPIREFKNAESVGVAYPKNQAMRIYSS  188

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQS  385
             LW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ 
Sbjct  189   LWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEE  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             LD + QQR++WVQKNYMIYNYCTDAKRFPQG+PPEC+++
Sbjct  247   LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAIH  285



>gb|AGI42461.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 235/289 (81%), Gaps = 6/289 (2%)
 Frame = -3

Query  1131  ATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASG  952
             A+H     +  F   L   SA    AGNF N+    WG   GKIL NGQLLTL+LD+ SG
Sbjct  2     ASHLNSIPIVFFAFSLLVSSAF---AGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSG  58

Query  951   SGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLH  772
             SGF+S N+Y++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFL NLSGDPY LH
Sbjct  59    SGFQSRNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLENLSGDPYTLH  118

Query  771   TNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFP  592
             TNVF+QGKGGREQQF+LWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +P
Sbjct  119   TNVFSQGKGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYP  178

Query  591   KDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-  415
             K+Q M +YSSLW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N 
Sbjct  179   KNQAMRIYSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNA  236

Query  414   PSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             PS N WL++ LD + QQR++WVQ+NYMIYNYCTDAKRFPQG+PPEC+++
Sbjct  237   PSNNAWLNEELDATSQQRLQWVQENYMIYNYCTDAKRFPQGYPPECAIH  285



>ref|XP_003610008.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92205.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=284

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/270 (73%), Positives = 224/270 (83%), Gaps = 0/270 (0%)
 Frame = -3

Query  1080  TLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMK  901
             T      AA NF       WG   GKIL NGQLLTLSLD+ASGSGFRS N+Y++GKIDM+
Sbjct  14    TFLVEASAASNFNQYFDITWGDGRGKILNNGQLLTLSLDKASGSGFRSKNEYLFGKIDMQ  73

Query  900   IKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYL  721
             +KLVPGNSAGTVTTYYLSSLG  HDEIDFEFLGNLSGDPY++HTN++ QGKG +EQQFYL
Sbjct  74    LKLVPGNSAGTVTTYYLSSLGDAHDEIDFEFLGNLSGDPYIVHTNIYAQGKGNKEQQFYL  133

Query  720   WFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDW  541
             WFDPTKDFHTYSILWNPQSIIFSVDGTP+R+FKN+E+ GIPFPK Q M +YSSLWDA++W
Sbjct  134   WFDPTKDFHTYSILWNPQSIIFSVDGTPLREFKNLESKGIPFPKSQAMSIYSSLWDADNW  193

Query  540   ATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQR  361
             ATRGGL KTDWSQAPF ASY N++ QACV+ S+ S+ S     S + W+ QSLD +GQ R
Sbjct  194   ATRGGLAKTDWSQAPFTASYGNFNIQACVWTSSGSSCSSKNPSSNHSWMKQSLDSTGQAR  253

Query  360   IKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             I+WVQKNYMIYNYCTD KRFPQG PPECSL
Sbjct  254   IQWVQKNYMIYNYCTDTKRFPQGLPPECSL  283



>ref|XP_009401564.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 199/278 (72%), Positives = 220/278 (79%), Gaps = 1/278 (0%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             A   LL   S   IA AGNF  E    WG D  K L+NGQLLTLSLD+ASGSGF+S NQY
Sbjct  2     AMRFLLVACSLVAIASAGNFYQEFDVTWGGDRAKNLDNGQLLTLSLDKASGSGFQSKNQY  61

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVFTQGKG
Sbjct  62    LFGKIDMQIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKG  121

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              RE QF LWFDPT DFHTYSILWNP+ +IF VDGTPIR FKN+E+ GI FP  QPM +YS
Sbjct  122   NREMQFKLWFDPTDDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPNSQPMRIYS  181

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWATRGGLVKTDWS+APF ASYRN+ A  CV  SA+S  +    PS   W +Q 
Sbjct  182   SLWNADDWATRGGLVKTDWSRAPFTASYRNFKANTCVPSSATSECASNSVPSNGGWWNQE  241

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD  GQQR+KWVQKNYMIYNYC+D KRFPQG PPECS+
Sbjct  242   LDSMGQQRMKWVQKNYMIYNYCSDLKRFPQGLPPECSI  279



>gb|AGI42454.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=281

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/279 (70%), Positives = 233/279 (84%), Gaps = 8/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF LL++   AA     NF N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y+
Sbjct  10    AFSLLVSLAFAA-----NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYL  64

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGG
Sbjct  65    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGG  124

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPT DFHTYSILWNPQ  IFSVD TPIR+FKN E+ G+ +PK+Q M +YSS
Sbjct  125   REQQFHLWFDPTADFHTYSILWNPQRTIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSS  184

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQS  385
             LW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ 
Sbjct  185   LWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIW--SSGRSSCNSNAPSNNAWLNEE  242

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             LD + QQR++WVQKNYMIYNYCTDAKRFPQG+PPEC+++
Sbjct  243   LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAIH  281



>ref|NP_001234342.1| xyloglucan endotransglycosylase LeXET2 precursor [Solanum lycopersicum]
 gb|AAG00902.1|AF176776_1 xyloglucan endotransglycosylase LeXET2 [Solanum lycopersicum]
Length=275

 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 198/281 (70%), Positives = 227/281 (81%), Gaps = 14/281 (5%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +  F LL+          G F  E    WG    KILENGQLLTLSLDR+SGSGF+S  Q
Sbjct  8     IFTFFLLICFFVVVAFG-GTFDQEFDVTWGYGRVKILENGQLLTLSLDRSSGSGFKSKQQ  66

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             YM+ KIDMKIKLVPGNSAGT TTYYLSS+GS HDEIDFEFLGN+SG+PY LHTNV+ QGK
Sbjct  67    YMFAKIDMKIKLVPGNSAGTATTYYLSSVGSAHDEIDFEFLGNVSGEPYTLHTNVYAQGK  126

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS-GIPFPKDQPMWM  571
             G REQQF+LWFDPTKDFHTYSILWNP++IIF VDGTPIRQ+KN+EA+ GIP+PK+QPMW+
Sbjct  127   GDREQQFHLWFDPTKDFHTYSILWNPRNIIFLVDGTPIRQYKNLEATNGIPYPKNQPMWL  186

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSLW+AE+WATRGGLV+TDWS+APFIASYRN++AQ             +KNP+AN WL+
Sbjct  187   YSSLWNAEEWATRGGLVRTDWSKAPFIASYRNFNAQT------------SKNPTANSWLT  234

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             QSLD  G  R+KWVQKNYMIYNYCTD KRFPQGFP EC+LN
Sbjct  235   QSLDNVGLTRMKWVQKNYMIYNYCTDTKRFPQGFPHECTLN  275



>ref|NP_001267702.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87535.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87533.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65438.1| hypothetical protein Csa_1G422470 [Cucumis sativus]
Length=283

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ LL + S   I++ NF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++
Sbjct  7     FLTLLFSASLIAISSANFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSQNEYLF  66

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLV GNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  67    GKIDMQLKLVAGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  126

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSILWNP  IIFSVDGTPIR+FKN E++G+PFPKDQPM +YSSL
Sbjct  127   EQQFHLWFDPTADFHTYSILWNPNRIIFSVDGTPIREFKNWESNGVPFPKDQPMRIYSSL  186

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDW++APF ASY+N+ A+ACV+    S+ S +   S+N WLSQ +D
Sbjct  187   WNADDWATRGGLVKTDWTKAPFTASYKNFKAEACVWSGGKSSCSPSPAGSSNSWLSQEMD  246

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              + Q+R+KWVQKNYMIYNYCTD KRFPQG P EC+L
Sbjct  247   SASQERLKWVQKNYMIYNYCTDTKRFPQGLPTECNL  282



>gb|AAF80591.1|AF223420_1 xyloglucan endotransglycosylase XET2 [Asparagus officinalis]
Length=284

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 232/283 (82%), Gaps = 4/283 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             +A+ +  +  LS+ GIA AGNF ++    WG   G+I++NGQLL+LSLD+ASGSGF ST+
Sbjct  1     MASLLFAVLALSSVGIAVAGNFNDDFKITWGDGRGRIVDNGQLLSLSLDKASGSGFESTH  60

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVFTQG
Sbjct  61    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQG  120

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQF+LWFDPTKDFHTYSILWNP  IIFSVDG PIR FKNME+ G+ FPK QPM +
Sbjct  121   KGNREQQFHLWFDPTKDFHTYSILWNPSHIIFSVDGIPIRDFKNMESRGVAFPKSQPMKI  180

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASST---SSCTKNPSANP  400
             YSSLW+A+DWATRGGL+KTDW++APF ASYRN++A ACV+ + +ST           +N 
Sbjct  181   YSSLWNADDWATRGGLIKTDWTKAPFTASYRNFNANACVWSAGTSTCSSKKSPSASPSNA  240

Query  399   WLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             WL++ LD + Q+R++WVQKNYMIYNYC D KRFPQG PPECS+
Sbjct  241   WLNEELDSTRQERMRWVQKNYMIYNYCADLKRFPQGLPPECSV  283



>gb|AGI42459.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/279 (70%), Positives = 233/279 (84%), Gaps = 8/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF LL++   AA     N  N+    WG   GKIL NGQLLTL+LD+ SGSGF+S N+Y+
Sbjct  14    AFSLLVSLAFAA-----NSHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYL  68

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKGG
Sbjct  69    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGG  128

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKN E+ G+ +PK+Q M +YSS
Sbjct  129   REQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSS  188

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQS  385
             LW+A+DWATRGGL+KTDWS+APF ASYRN++A+AC++  +S  SSC  N PS N WL++ 
Sbjct  189   LWNADDWATRGGLIKTDWSKAPFTASYRNFNARACIW--SSGRSSCNSNAPSNNAWLNEE  246

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             LD + QQR++WVQKNYMIYNYCTDAKRFPQG+PPEC+++
Sbjct  247   LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAIH  285



>ref|XP_004146309.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Cucumis sativus]
 gb|KGN65439.1| Xyloglucan endotransglucosylase/hydrolase 2 [Cucumis sativus]
Length=287

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/262 (74%), Positives = 222/262 (85%), Gaps = 0/262 (0%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
              GNF N+    WG D  KIL NG LLTLSLDR SGSGF+S N Y+YGKIDM++KLVPGNS
Sbjct  24    CGNFYNDFEITWGNDRAKILNNGDLLTLSLDRGSGSGFQSKNVYLYGKIDMQLKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYL S GST DEIDFEFLGNLSGDPY LHTNV+TQGKG REQQF+LWFDPT DF
Sbjct  84    AGTVTTYYLKSQGSTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDREQQFHLWFDPTYDF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ IIFSVDGTPIR+FKN E+SG+ FPK+QPM +YSSLW+A+DWATRGGLVK
Sbjct  144   HTYSILWNPQGIIFSVDGTPIREFKNHESSGVLFPKNQPMRLYSSLWNADDWATRGGLVK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
             TDWS+APF A+YRN++A  CV+   +S+ S   N     WLS++LDI+ QQR+KWVQ+NY
Sbjct  204   TDWSKAPFTAAYRNFNANVCVWSGGASSCSSGTNVGGRGWLSENLDITRQQRMKWVQRNY  263

Query  336   MIYNYCTDAKRFPQGFPPECSL  271
             MIYNYCTDAKRFPQG+PPECSL
Sbjct  264   MIYNYCTDAKRFPQGYPPECSL  285



>ref|XP_010241684.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=283

 Score =   414 bits (1063),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 232/279 (83%), Gaps = 4/279 (1%)
 Frame = -3

Query  1101  AFILLLTTLSAAGI---AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             A ++L+ TL  + I   +AGNF  ++   WG   GKIL NGQLLTLSLD+ SGSGF+S  
Sbjct  4     ATVILMATLLGSLIVLSSAGNFYQDVDVTWGDGRGKILNNGQLLTLSLDKFSGSGFQSKK  63

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDMK+KLVPGNSAGTVTTYYLSS GSTHDEIDFEFLGNLSGDPY+LHTNVF QG
Sbjct  64    EYLFGKIDMKLKLVPGNSAGTVTTYYLSSQGSTHDEIDFEFLGNLSGDPYILHTNVFAQG  123

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPTKDFHTYSILWNP+ IIFSVDGTPIR F+NME++G+ FP  QPM +
Sbjct  124   KGNREQQFYLWFDPTKDFHTYSILWNPRQIIFSVDGTPIRVFRNMESAGVAFPNKQPMRV  183

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             Y+SLW+A+DWATRGGLVKTDWSQAPF+ASY N++A ACV+ S  S+S    +  +  W++
Sbjct  184   YASLWNADDWATRGGLVKTDWSQAPFVASYANFNANACVWSSGGSSSCSGNS-PSTAWMN  242

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             Q LD +GQ+R+ WVQKNYMIYNYCTD KRFPQG PPEC+
Sbjct  243   QDLDAAGQKRLAWVQKNYMIYNYCTDVKRFPQGLPPECT  281



>ref|XP_004161045.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Cucumis sativus]
 emb|CCH26406.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=287

 Score =   413 bits (1061),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 195/262 (74%), Positives = 223/262 (85%), Gaps = 0/262 (0%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
              GNF N+   +WG D  KIL NG LLTLSLDR SGSGF+S N Y+YGKIDM++KLVPGNS
Sbjct  24    CGNFYNDFEISWGNDRAKILNNGDLLTLSLDRGSGSGFQSKNVYLYGKIDMQLKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYL S GST DEIDFEFLGNLSGDPY LHTNV+TQGKG REQQF+LWFDPT DF
Sbjct  84    AGTVTTYYLKSQGSTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDREQQFHLWFDPTYDF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ IIFSVDGTPIR+FKN E+SG+ FPK+QPM +YSSLW+A+DWATRGGLVK
Sbjct  144   HTYSILWNPQGIIFSVDGTPIREFKNHESSGVLFPKNQPMRLYSSLWNADDWATRGGLVK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
             TDWS+APF A+YRN++A  CV+   +S+ S   N     WLS++LDI+ QQR+KWVQ+NY
Sbjct  204   TDWSKAPFTAAYRNFNANVCVWSGGASSCSSGTNVGGRGWLSENLDITRQQRMKWVQRNY  263

Query  336   MIYNYCTDAKRFPQGFPPECSL  271
             MIYNYCTDAKRFPQG+PPECSL
Sbjct  264   MIYNYCTDAKRFPQGYPPECSL  285



>ref|XP_002526228.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36169.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=284

 Score =   412 bits (1060),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 198/280 (71%), Positives = 233/280 (83%), Gaps = 9/280 (3%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LLL +L  A  +A NF N+    WG    KIL +G+LLTL+LD+ASGSGF+S N+Y++G
Sbjct  8     LLLLASLMVA--SASNFYNDFDITWGDGRAKILNDGELLTLTLDKASGSGFQSKNEYLFG  65

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+IKLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  66    KIDMQIKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  125

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKNME++G+PFP++QPM +YSSLW
Sbjct  126   QQFYLWFDPTADFHTYSILWNPQRIIFSVDETPIREFKNMESNGVPFPRNQPMRIYSSLW  185

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSC-----TKNPSANPWLS  391
             +A+DWATRGGLVKTDWSQAPF ASYRN++A ACV  S++  SSC         ++N WLS
Sbjct  186   NADDWATRGGLVKTDWSQAPFTASYRNFNANACV--SSNGASSCGTNSSPSTSTSNSWLS  243

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q LD + Q+R++WVQKNYMIYNYCTDAKRF QG P EC+L
Sbjct  244   QELDSTSQERLQWVQKNYMIYNYCTDAKRFAQGLPTECNL  283



>gb|KDP36435.1| hypothetical protein JCGZ_08704 [Jatropha curcas]
Length=286

 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/280 (69%), Positives = 232/280 (83%), Gaps = 2/280 (1%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAA--GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
              + +LLL   S+  + A  GNF  +    WG    KIL NGQLLTL+LD+ASGSGF+S N
Sbjct  6     VSLLLLLAYFSSLILVALGGNFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRN  65

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QG
Sbjct  66    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQG  125

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN+E++G+PFPK QPM +
Sbjct  126   KGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNLESAGVPFPKSQPMRI  185

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSL +A+DWATRGGLVKTDWS+APF ASYRN++A AC++ + +S+   +   S+N WLS
Sbjct  186   YSSLGNADDWATRGGLVKTDWSRAPFTASYRNFNANACIWSNGASSCKSSSPSSSNVWLS  245

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q LD + Q R++WVQ+NYMIYNYCTD KRFPQG PPECS+
Sbjct  246   QELDATSQDRLQWVQQNYMIYNYCTDTKRFPQGIPPECSM  285



>ref|XP_007035759.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY06685.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   412 bits (1059),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 230/281 (82%), Gaps = 9/281 (3%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAG--NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             LL++ +    +AA   NF  +    WG   GKI+ NG++LTLSLD+ASGSGF+S N+Y++
Sbjct  11    LLMSLVIGCPVAASASNFYQDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQSKNEYLF  70

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LH NVF+QGKG R
Sbjct  71    GKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHANVFSQGKGNR  130

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+QPM +YSS 
Sbjct  131   EQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNTESLGVPFPKNQPMRIYSSS  190

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNP-----SANPWL  394
             W+A+DWATRGGLVKTDW+QAPF ASYRN++A ACV+  ++  SSC  NP     + N W 
Sbjct  191   WNADDWATRGGLVKTDWTQAPFTASYRNFNADACVW--SNEASSCKSNPLSSASTNNAWF  248

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             SQ LD + QQR++WV KNYMIYNYCTDAKRFPQG PPEC++
Sbjct  249   SQELDSTSQQRLQWVPKNYMIYNYCTDAKRFPQGLPPECNM  289



>gb|KHN22712.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/278 (69%), Positives = 230/278 (83%), Gaps = 6/278 (2%)
 Frame = -3

Query  1095  ILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +L+ T +    IA AGNF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++
Sbjct  8     LLICTVIGYFVIASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLF  67

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G+T DEIDFEFLGNLSG+PY+LHTNVF+QGKG R
Sbjct  68    GKIDMQLKLVPGNSAGTVTAYYLSSKGATWDEIDFEFLGNLSGEPYILHTNVFSQGKGNR  127

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPT DFHTYSILWNPQ I+FSVDG+PIR+FKNME+ G+PFPK+Q M +YSSL
Sbjct  128   EQQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMRIYSSL  187

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN---PSANPWLSQ  388
             W+A+DWATRGGLVKTDW+QAPF ASYRN++A AC    +S TSSC  N    S N WLS+
Sbjct  188   WNADDWATRGGLVKTDWTQAPFTASYRNFNANACTV--SSGTSSCGSNYPSSSNNAWLSE  245

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              LD + Q+R+KW+QKNYMIYNYC+D +RFPQG PPEC+
Sbjct  246   ELDSTNQERLKWLQKNYMIYNYCSDTQRFPQGLPPECN  283



>ref|XP_011018193.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=289

 Score =   411 bits (1057),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 188/278 (68%), Positives = 230/278 (83%), Gaps = 5/278 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LL+ +L+ A  +A NF N+    WG    KIL NG+LLTL+LD+ASGSGF+S  +Y++GK
Sbjct  14    LLVASLTVA--SASNFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRKEYLFGK  71

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  72    IDMQLKLVPGNSAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  131

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +YSSLW+
Sbjct  132   QFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWN  191

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSL  382
             A+DWATRGGLVKTDW+ APF ASYRN++A+ACV  + +S+   T +P A   N W S+ L
Sbjct  192   ADDWATRGGLVKTDWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEEL  251

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWV++NYM+YNYC D  RFPQG PPECS++
Sbjct  252   DSTRQERLKWVRENYMVYNYCKDVNRFPQGLPPECSMS  289



>gb|EYU20918.1| hypothetical protein MIMGU_mgv1a011123mg [Erythranthe guttata]
Length=292

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 226/283 (80%), Gaps = 5/283 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +A+ I +L T   +  A+ NF  +    WG+   KIL NG  LTLSLD+ASGSGF+S NQ
Sbjct  10    IASLIPILMTSFVS--ASNNFYQDFDLTWGEGRSKILNNGDSLTLSLDKASGSGFQSKNQ  67

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++ KIDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY++HTNVF+QGK
Sbjct  68    YLFAKIDMQIKLVPGNSAGTVTAYYLSSQGVTHDEIDFEFLGNLSGDPYIVHTNVFSQGK  127

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNP  IIFSVDGTPIR+FKN E+ G+PFPK QPM +Y
Sbjct  128   GNREQQFYLWFDPTADFHTYSILWNPHRIIFSVDGTPIREFKNAESVGVPFPKSQPMRIY  187

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN---PW  397
             SSLW+A+DWATRGGL+KTDW+QAPF ASYRN+ A ACV+      S+C    S N    W
Sbjct  188   SSLWNADDWATRGGLIKTDWAQAPFTASYRNFEAVACVWSPFDGFSTCNTKSSPNSVDAW  247

Query  396   LSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             L++ LD + Q+R+KWVQ +YMIYNYCTDAKRFP GFPPEC++N
Sbjct  248   LNEELDSTNQERLKWVQHHYMIYNYCTDAKRFPLGFPPECAVN  290



>gb|KHN22714.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 193/275 (70%), Positives = 223/275 (81%), Gaps = 3/275 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             + LL +L     AAGNF  +    WG    KIL N  LLTLSLD+ASGSGF+S N+Y++G
Sbjct  13    VPLLVSLFIVVCAAGNFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFG  72

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  73    KIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  132

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK QPM +YSSLW
Sbjct  133   QQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLW  192

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLD  379
             +A+DWATRGG +KTDWS+APF ASYRN++A ACV+    ST  C  N PS+N WLSQ LD
Sbjct  193   NADDWATRGGRIKTDWSKAPFTASYRNFNANACVWNRGKST--CKSNSPSSNAWLSQELD  250

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              + QQR+ WVQKNYMIYNYC+D  RF QG P EC+
Sbjct  251   STAQQRLSWVQKNYMIYNYCSDKNRFAQGLPLECT  285



>gb|KHG10045.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=280

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 197/264 (75%), Positives = 224/264 (85%), Gaps = 1/264 (0%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +A NF  +I   WG   GKILENG LLTL+LD+ SGSGF+S NQY++GKIDM IKLVPGN
Sbjct  18    SAANFNQDIEVTWGDGRGKILENGNLLTLTLDKFSGSGFQSKNQYLFGKIDMNIKLVPGN  77

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVTTYYL S GST DEIDFEFLGNLSGDPY++HTNV+TQGKG +EQQFYLWFDPTKD
Sbjct  78    SAGTVTTYYLRSEGSTWDEIDFEFLGNLSGDPYIVHTNVYTQGKGDKEQQFYLWFDPTKD  137

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYS+LWNPQ IIFSVDGTPIR+FKN+E+ G+ FPK QPM +YSSLW+A+DWATRGGLV
Sbjct  138   FHTYSLLWNPQRIIFSVDGTPIREFKNLESMGVAFPKSQPMRVYSSLWNADDWATRGGLV  197

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             KTDWS+APF A+YRNY A ACV+ S  S+ S T   S N WLSQ LDI+ QQR+KWVQKN
Sbjct  198   KTDWSKAPFTAAYRNYKADACVWSSGKSSCSSTSP-SQNSWLSQELDITSQQRLKWVQKN  256

Query  339   YMIYNYCTDAKRFPQGFPPECSLN  268
             YMIYNYCTD KRFPQG P ECS++
Sbjct  257   YMIYNYCTDTKRFPQGLPKECSVH  280



>ref|XP_003549490.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Glycine max]
Length=292

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 234/292 (80%), Gaps = 5/292 (2%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             MASL +       V    +L ++++A+   AGNF  +    WG    KIL NG LLTLSL
Sbjct  1     MASLHSITFSTKTVLYVFVLASSIAAS---AGNFYQDFDVTWGDGRAKILNNGDLLTLSL  57

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGD  787
             D+ASGSGF+S N+Y++GKIDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGD
Sbjct  58    DKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSNWDEIDFEFLGNLSGD  117

Query  786   PYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS  607
             PY+LHTNVF+QGKG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ 
Sbjct  118   PYILHTNVFSQGKGSREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNMESK  177

Query  606   GIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY--GSASST  433
             G+ FPK+QPM +YSSLW+A+DWATRGGLVKTDW+QAPF ASYRN++A ACV+   S+SS+
Sbjct  178   GVAFPKEQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACVHSGSSSSSS  237

Query  432   SSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             S    + S+N W SQ LD + Q R+ WVQKNYMIYNYCTD KRFPQG PPEC
Sbjct  238   SCTANSSSSNAWFSQQLDSTSQDRLSWVQKNYMIYNYCTDTKRFPQGLPPEC  289



>gb|KHG09063.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=292

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 197/292 (67%), Positives = 233/292 (80%), Gaps = 11/292 (4%)
 Frame = -3

Query  1119  GGGGVAAFILLLTTLSAAGIAAG---NFINEIGFNWGQDHGKILENGQLLTLSLDRASGS  949
             G    + F LL+  + A  I A    NF N+    WG   GKI  NG++LTLSLD+ SGS
Sbjct  2     GYSSSSKFPLLMPLMVACLIMAASGSNFHNDFDITWGDGRGKIASNGEVLTLSLDKQSGS  61

Query  948   GFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHT  769
             GF+S N+Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHT
Sbjct  62    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHT  121

Query  768   NVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPK  589
             NVF+QGKG REQQFYLWFDPT DFHTYSILWNPQ IIFSVD TPIR+FKNME+ G+PFPK
Sbjct  122   NVFSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIFSVDDTPIREFKNMESIGVPFPK  181

Query  588   DQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-P  412
             +QPM +YSSLW+A+DWATRGGL+KTDW+QAPF ASYRN++A ACV+ + +  SSC  N P
Sbjct  182   NQPMRIYSSLWNADDWATRGGLLKTDWTQAPFTASYRNFNADACVWSNGA--SSCKSNAP  239

Query  411   SA-----NPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             S+     N W SQ +D +  QR++WVQ+NYMIYNYCTDAKRFPQG PPEC +
Sbjct  240   SSSTSTNNAWFSQEMDSAKMQRLQWVQQNYMIYNYCTDAKRFPQGLPPECKM  291



>gb|AAF80590.1|AF223419_1 xyloglucan endotransglycosylase XET1 [Asparagus officinalis]
Length=284

 Score =   410 bits (1054),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 191/273 (70%), Positives = 217/273 (79%), Gaps = 4/273 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
              L  T ++ +G+  GNF  +    WG    KIL NGQ+LTLSLD+ SGSGF+S NQY++G
Sbjct  13    FLAATFVAMSGVHGGNFYRDFDLTWGDGRAKILNNGQMLTLSLDKVSGSGFQSKNQYLFG  72

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTN+FTQGKG RE
Sbjct  73    KIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNIFTQGKGNRE  132

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPTKDFHTYSILWNPQ IIFSVDG PIR FKN+E   IPFPK QPM +YSSLW
Sbjct  133   QQFYLWFDPTKDFHTYSILWNPQHIIFSVDGIPIRDFKNLEKYRIPFPKIQPMRLYSSLW  192

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDI  376
             DA++WATRGGLVKTDWS+APF ASYRN+ AQACV  S  S          N W +Q LD+
Sbjct  193   DADNWATRGGLVKTDWSKAPFTASYRNFQAQACVLSSGRSRCGS----GGNRWFNQQLDV  248

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             +  +R++WVQKNYMIYNYCTD KRFPQG P EC
Sbjct  249   ASLKRLRWVQKNYMIYNYCTDVKRFPQGIPTEC  281



>emb|CDP02962.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   410 bits (1055),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 194/280 (69%), Positives = 228/280 (81%), Gaps = 6/280 (2%)
 Frame = -3

Query  1098  FILLLTTL---SAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             F+LL+      S+  I AGNF  +    WG    K L NG+LLTLSLD+ASGSG +S N+
Sbjct  14    FLLLIIVAFFNSSQSILAGNFDQDFAVTWGDGRAKTLNNGKLLTLSLDKASGSGVQSKNE  73

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++G+IDM++KLVPGNSAGTVTTYYLSS GST DEIDFEFLGNLSGDPY++HTNV+ QGK
Sbjct  74    YLFGRIDMQLKLVPGNSAGTVTTYYLSSPGSTRDEIDFEFLGNLSGDPYIVHTNVYAQGK  133

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G +EQQFY WFDPT DFHTYSILWNP+SI+F VDGTPIR +KN+EA GIP+PK+QPM +Y
Sbjct  134   GDKEQQFYAWFDPTADFHTYSILWNPRSILFYVDGTPIRVYKNLEARGIPYPKNQPMKVY  193

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             +SLWDAEDWATRGGLVKTDWSQ+PF AS R++ A ACV+  +S  SSC  N S  PW SQ
Sbjct  194   ASLWDAEDWATRGGLVKTDWSQSPFTASLRDFKADACVW--SSGRSSCGSN-STKPWFSQ  250

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              LD + Q R+KWVQ+NYMIYNYCTDAKRFPQGFPPEC+ N
Sbjct  251   ELDATSQARLKWVQQNYMIYNYCTDAKRFPQGFPPECTAN  290



>gb|ABL10090.1| xyloglucan endotransglycosylase [Musa acuminata]
Length=280

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/278 (71%), Positives = 219/278 (79%), Gaps = 1/278 (0%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             A   LL   S   IA AGNF  E    WG D  K L+NGQLLTLSLD+ASGSGF+S NQY
Sbjct  2     AMRFLLVACSLVAIASAGNFYQEFDVTWGGDRAKNLDNGQLLTLSLDKASGSGFQSKNQY  61

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGN SGDPY LHTNVFTQGKG
Sbjct  62    LFGKIDMQIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNPSGDPYTLHTNVFTQGKG  121

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              RE QF LWFDPT+DFHTYSILWNP+ +IF VDGTPIR FKN+E+ GI FP  QPM +YS
Sbjct  122   NREMQFKLWFDPTEDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPNSQPMRIYS  181

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWATRGGLVKTDWS+APF ASYRN+ A  CV  SA++  +    PS   W +Q 
Sbjct  182   SLWNADDWATRGGLVKTDWSKAPFTASYRNFKADTCVPSSATTECASNSVPSNGGWWNQE  241

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD  GQQR+KWVQKNYMIYNYC+D KRF QG PPECS+
Sbjct  242   LDSMGQQRMKWVQKNYMIYNYCSDLKRFSQGLPPECSI  279



>ref|XP_002526229.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36170.1| conserved hypothetical protein [Ricinus communis]
Length=284

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 223/265 (84%), Gaps = 7/265 (3%)
 Frame = -3

Query  1050  NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAG  871
             NF N+    WG    KIL NG+LLTL+LD+ASGSGF+S N+Y++GKIDM+IKLVPGNSAG
Sbjct  21    NFYNDFDITWGDGRAKILNNGELLTLTLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  80

Query  870   TVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHT  691
             TVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DFHT
Sbjct  81    TVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFHT  140

Query  690   YSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTD  511
             YSILWNP  IIFSVDGTPIR+FKNME++G+PFPK+QPM +YSSLW+A+DWATRGGLVKTD
Sbjct  141   YSILWNPHRIIFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLVKTD  200

Query  510   WSQAPFIASYRNYSAQACVYGSASSTSSC-----TKNPSANPWLSQSLDISGQQRIKWVQ  346
             WSQAPF ASYRN++A ACV  S++  SSC         + N WLSQ LD + Q+R++WVQ
Sbjct  201   WSQAPFTASYRNFNANACV--SSNGASSCGTNSSPSTSNTNSWLSQELDSTSQERLQWVQ  258

Query  345   KNYMIYNYCTDAKRFPQGFPPECSL  271
             KNYMIYNYCTDAKRFPQG P EC+L
Sbjct  259   KNYMIYNYCTDAKRFPQGLPTECNL  283



>ref|XP_003542166.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Glycine max]
Length=285

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 225/268 (84%), Gaps = 7/268 (3%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AG+   +    WG    KIL +G+LLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  20    AGDLNKDFDITWGDGRSKILNHGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNS  79

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS GST DEID+EFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DF
Sbjct  80    AGTVTAYYLSSKGSTWDEIDYEFLGNLSGDPYILHTNVFSQGKGDREQQFYLWFDPTADF  139

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSI+WNPQ IIFSVDGTPIR+FKN EA G+PFPK+QPM +YSSLW+A+DWATRGGLVK
Sbjct  140   HTYSIMWNPQRIIFSVDGTPIREFKNSEAIGVPFPKNQPMRIYSSLWNADDWATRGGLVK  199

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTK-----NPSANPWLSQSLDISGQQRIKW  352
             TDW+QAPF ASYRN++A+AC++ S +  SSC K        +  WLSQ LD +G QR+KW
Sbjct  200   TDWTQAPFTASYRNFNAEACIWSSGA--SSCAKTSSTPTSGSGSWLSQELDATGHQRLKW  257

Query  351   VQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             VQKNYMIYNYCTD KRFPQG PPEC+++
Sbjct  258   VQKNYMIYNYCTDTKRFPQGLPPECNIS  285



>ref|XP_011043998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 isoform X1 [Populus euphratica]
Length=289

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 229/278 (82%), Gaps = 5/278 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LL+ +L+ A  +A NF N+    WG     IL NG+LLTL+LD+ASGSGF+S  +Y++GK
Sbjct  14    LLVASLTVA--SASNFYNDFDITWGDGRANILSNGELLTLNLDKASGSGFQSRKEYLFGK  71

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  72    IDMQLKLVPGNSAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  131

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +YSSLW+
Sbjct  132   QFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWN  191

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSL  382
             A+DWATRGGLVKTDW+ APF ASYRN++A+ACV  + +S+   T +P A   N W S+ L
Sbjct  192   ADDWATRGGLVKTDWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEEL  251

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWV++NYM+YNYC D  RFPQG PPECS++
Sbjct  252   DSTRQERLKWVRENYMVYNYCKDVNRFPQGLPPECSMS  289



>gb|KHG21666.1| putative xyloglucan endotransglucosylase/hydrolase 23 -like protein 
[Gossypium arboreum]
Length=280

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/262 (73%), Positives = 223/262 (85%), Gaps = 1/262 (0%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +A NF  +I   WG   GKILENG LLTL+LD+ SGSGF+S NQY++GKIDM IKLVPGN
Sbjct  18    SAANFNQDIDVTWGDGRGKILENGNLLTLTLDKFSGSGFQSKNQYLFGKIDMNIKLVPGN  77

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVTTYYL S GST DEIDFEFLGNLSGDPY++HTNV+TQGKG +EQQFYLWFDPTKD
Sbjct  78    SAGTVTTYYLRSEGSTWDEIDFEFLGNLSGDPYIVHTNVYTQGKGDKEQQFYLWFDPTKD  137

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYS+LWNPQ IIF+VDGTPIR+FKN+E +G+ FPK QPM +YSSLW+A+DWATRGGLV
Sbjct  138   FHTYSLLWNPQRIIFAVDGTPIREFKNLETTGVAFPKSQPMSVYSSLWNADDWATRGGLV  197

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             KTDWS+APF A+YRNY A ACV+ S+  +S  + +P  N WLSQ LDI+ Q+R+KWVQKN
Sbjct  198   KTDWSKAPFTAAYRNYKADACVW-SSGKSSCSSTSPFQNSWLSQELDITSQERLKWVQKN  256

Query  339   YMIYNYCTDAKRFPQGFPPECS  274
             YMIYNYCTD KRFPQG P EC+
Sbjct  257   YMIYNYCTDTKRFPQGLPKECT  278



>ref|XP_002270299.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=285

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/276 (71%), Positives = 230/276 (83%), Gaps = 3/276 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
              +L+L+ L  A  + GNF  +    WG    KIL NGQLLTLSLD+ASGSGF+S N+Y++
Sbjct  7     LVLMLSMLVVA--SGGNFNQDFDITWGDGRAKILNNGQLLTLSLDKASGSGFQSRNEYLF  64

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLV GNSAGTVT YYLSS GS HDEIDFEFLGNLSGDPY+LHTNVF+QGKG R
Sbjct  65    GKIDMQLKLVSGNSAGTVTAYYLSSQGSAHDEIDFEFLGNLSGDPYILHTNVFSQGKGNR  124

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIRQFKN+E+ G+ +PK+QPM +YSSL
Sbjct  125   EQQFYLWFDPTADFHTYSILWNPQLIIFSVDGTPIRQFKNLESKGVAYPKNQPMRIYSSL  184

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDWSQAPF ASYRN++A ACV+   +SS S  + + ++N WL Q L
Sbjct  185   WNADDWATRGGLVKTDWSQAPFTASYRNFNANACVWSSGSSSCSKNSSSTTSNAWLYQEL  244

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D S Q+++KWVQKNYMIYNYCTD KRFPQG PPEC+
Sbjct  245   DSSSQEKLKWVQKNYMIYNYCTDTKRFPQGLPPECT  280



>ref|XP_009390494.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/276 (70%), Positives = 222/276 (80%), Gaps = 5/276 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F LL  +L A   +AGNF  +    WG    KIL NG LLTLSLD+ASGSGF+S N+Y++
Sbjct  5     FFLLACSLVAVA-SAGNFYQDFDITWGDGRAKILNNGHLLTLSLDKASGSGFQSKNEYLF  63

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVFTQGKG R
Sbjct  64    GKIDMQIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNR  123

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             E QF LWFDPTKDFHTYSILWNP+ IIF VDGTPIR FKN+E+ GI FPK+QPM +YSSL
Sbjct  124   EMQFKLWFDPTKDFHTYSILWNPRHIIFMVDGTPIRDFKNLESRGIAFPKNQPMRIYSSL  183

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+AEDWATRGGL+KTDW++APF+ASYRN++A AC+   AS  SSCT  P+ + W +Q LD
Sbjct  184   WNAEDWATRGGLIKTDWTKAPFVASYRNFNANACI--KASGRSSCT--PAKSGWWNQELD  239

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              +   R++W QKNYMIYNYC D  RFPQG PPECS+
Sbjct  240   SASHARMRWAQKNYMIYNYCNDVNRFPQGLPPECSI  275



>ref|XP_010039803.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW84794.1| hypothetical protein EUGRSUZ_B01596 [Eucalyptus grandis]
Length=289

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/264 (75%), Positives = 222/264 (84%), Gaps = 3/264 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             +GNF  +    WG    +I  +GQLLTLSLD+ SGSGFRS  QY++GKIDM++KLVPGNS
Sbjct  28    SGNFNKDFDITWGDGRAQIPSSGQLLTLSLDKTSGSGFRSKKQYLFGKIDMQLKLVPGNS  87

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSSLGS HDEIDFEFLGNLSGDPY LHTNVFTQGKG REQQF+LWFDPTKDF
Sbjct  88    AGTVTAYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFHLWFDPTKDF  147

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQSIIFSVDGTPIR+FKN+E+ G+ FPK Q MW+YSSLW+A+DWATRGGLVK
Sbjct  148   HTYSILWNPQSIIFSVDGTPIREFKNLESKGVAFPKSQAMWIYSSLWNADDWATRGGLVK  207

Query  516   TDWSQAPFIASYRNYS-AQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             TDW+QAPF ASYR ++  QACV  S SS+ S +    +  WLSQSLD +GQQRIKWVQKN
Sbjct  208   TDWTQAPFTASYRGFNDEQACVGSSGSSSCSSSSGDKS--WLSQSLDATGQQRIKWVQKN  265

Query  339   YMIYNYCTDAKRFPQGFPPECSLN  268
             YMIYNYC D KRF QGFPPECSL+
Sbjct  266   YMIYNYCADTKRFSQGFPPECSLS  289



>ref|NP_001284442.1| xyloglucan endotransglucosylase/hydrolase protein 22-like precursor 
[Cucumis melo]
 gb|ABI94062.1| xyloglucan endotransglucosylase/hydrolase 2 [Cucumis melo]
Length=287

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/260 (74%), Positives = 219/260 (84%), Gaps = 0/260 (0%)
 Frame = -3

Query  1050  NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAG  871
             NF N+    WG D  KIL NG LLTLSLDR SGSGF+S N Y+YGKIDM++KLVPGNSAG
Sbjct  26    NFYNDFEITWGNDRAKILNNGDLLTLSLDRGSGSGFQSKNVYLYGKIDMQLKLVPGNSAG  85

Query  870   TVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHT  691
             TVTTYYL S GST DEIDFEFLGNLSGDPY LHTNV+TQGKG REQQF+LWFDPT DFHT
Sbjct  86    TVTTYYLKSQGSTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDREQQFHLWFDPTSDFHT  145

Query  690   YSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTD  511
             YSILWNPQ IIFSVDGTPIR+FKN E+SG+ FPK QPM +YSSLW+A+DWATRGGLVKTD
Sbjct  146   YSILWNPQGIIFSVDGTPIRKFKNHESSGVLFPKKQPMRLYSSLWNADDWATRGGLVKTD  205

Query  510   WSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMI  331
             WS+APF ASYRN++A  CV+    S+ S   N     WLS++LDI+ QQR+KWVQ+NYMI
Sbjct  206   WSKAPFTASYRNFNADVCVWSGGVSSCSSGGNVGGRGWLSENLDITRQQRMKWVQRNYMI  265

Query  330   YNYCTDAKRFPQGFPPECSL  271
             YNYCTDAKRFPQG+PPEC++
Sbjct  266   YNYCTDAKRFPQGYPPECAI  285



>ref|XP_011023833.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=317

 Score =   410 bits (1053),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/309 (65%), Positives = 240/309 (78%), Gaps = 8/309 (3%)
 Frame = -3

Query  1182  SKTLASQLI*SSMASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGK  1003
             SK LA      SMA L A+      +  F++  T     G + GNF       WG    K
Sbjct  9     SKQLAKLHFIVSMAFLFAS--SSVPMLLFLVSFTISCLMGSSLGNFYQNFDITWGDGRAK  66

Query  1002  ILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDE  823
             IL NG+LLTL+LD+ASGSGF+S N+Y++GKIDM +KLVPGNSAGTVT YYLSS GST DE
Sbjct  67    ILNNGELLTLNLDKASGSGFQSKNEYLFGKIDMHLKLVPGNSAGTVTAYYLSSKGSTWDE  126

Query  822   IDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDG  643
             IDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDG
Sbjct  127   IDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIFSVDG  186

Query  642   TPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQ  463
             TPIR+FKNME+ G+PFPK+QPM +YSSLW+A+DWATRGGLVKTDWSQAPF ASYRN++A+
Sbjct  187   TPIREFKNMESRGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNAK  246

Query  462   -ACVYGSASSTS-----SCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRF  301
              ACV+ + +S+      +   + + N WLS+ L  + Q+R++WV+KNYMIYNYCTDAKRF
Sbjct  247   DACVWSNGASSCGTNASAAAASSNTNAWLSEELGSTSQERLEWVKKNYMIYNYCTDAKRF  306

Query  300   PQGFPPECS  274
             PQG PPECS
Sbjct  307   PQGLPPECS  315



>ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 235/294 (80%), Gaps = 5/294 (2%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             MA + ++           ++++ L AA  +AGNF  + G  WG    KIL+NG+ LTLSL
Sbjct  1     MAPIYSSSSAVSTALLISVVVSFLMAA--SAGNFYQDFGITWGDGRAKILDNGEFLTLSL  58

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGD  787
             D+ SGSGF+S N+Y++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGD
Sbjct  59    DKTSGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGD  118

Query  786   PYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS  607
             PY+LHTNVF+QGKG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ 
Sbjct  119   PYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESI  178

Query  606   GIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSS  427
             G+P+ K+QPM +YSSLW+A+DWATRGGL+KTDW+QAPF ASYRN++A AC++ S +S+ S
Sbjct  179   GVPYLKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWSSGASSCS  238

Query  426   CTKNPSANP---WLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
                  S +P   W SQ LD + Q+R+KWVQKNYMIYNYCTD KRFPQG PPEC+
Sbjct  239   SNTPTSISPSTDWYSQELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT  292



>ref|XP_010927057.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=279

 Score =   407 bits (1047),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 225/279 (81%), Gaps = 1/279 (0%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +A   LLL      G +AGN   +    WG    KILENGQLLTLSLD+ASGSGF+S N+
Sbjct  1     MALVFLLLAFSLMTGASAGNLYQDFQITWGDGRAKILENGQLLTLSLDKASGSGFQSKNE  60

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF QGK
Sbjct  61    YLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFAQGK  120

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G RE QF+LWFDPTKDFHT+SILWNP+ IIF VDGTPIR FKNME+ G+ FPK+QPM +Y
Sbjct  121   GNREMQFHLWFDPTKDFHTHSILWNPKHIIFMVDGTPIRDFKNMESKGVAFPKNQPMRIY  180

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWAT+GG +KTDW++APF ASYRN++A ACV+ S +S     K+ SA+ W +Q
Sbjct  181   SSLWNADDWATQGGRIKTDWTKAPFTASYRNFNADACVWSSGTSNCPPKKSNSAD-WWNQ  239

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD + Q R++WVQ+NYMIYNYCTD KRFPQG PPECS+
Sbjct  240   DLDSTSQARMRWVQRNYMIYNYCTDQKRFPQGLPPECSM  278



>ref|XP_011043999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 isoform X2 [Populus euphratica]
Length=289

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 187/273 (68%), Positives = 226/273 (83%), Gaps = 5/273 (2%)
 Frame = -3

Query  1080  TLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMK  901
             TL+ A  +A NF N+    WG    KIL NG+LLTL+LD+ASGSGF+S  +Y++GKIDM+
Sbjct  18    TLTVA--SASNFYNDFDVTWGDGRAKILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQ  75

Query  900   IKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYL  721
             +KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYL
Sbjct  76    LKLVPGNSAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYL  135

Query  720   WFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDW  541
             WFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +YSSLW+A+DW
Sbjct  136   WFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDW  195

Query  540   ATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSLDISG  370
             ATRGGLVKTDW+ APF ASYRN++A+ACV  + +S+   T +P A   N W S+ LD + 
Sbjct  196   ATRGGLVKTDWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTR  255

Query  369   QQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q+R+KWV++NYM+YNYC D  RFPQG PPECS+
Sbjct  256   QERLKWVRENYMVYNYCKDVNRFPQGLPPECSM  288



>ref|XP_007014165.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31784.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 194/277 (70%), Positives = 230/277 (83%), Gaps = 5/277 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             L++  L AA  +A NF  +    WG   GKI  NG++L+LSLD+ASGSGF+S ++Y++GK
Sbjct  15    LVIGCLMAA--SASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGSGFQSKDEYLFGK  72

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             ID ++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  73    IDTQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  132

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QF+LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G+PFPK+QPM +YSSLW+
Sbjct  133   QFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNMESLGVPFPKNQPMRIYSSLWN  192

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSL  382
             A+DWATRGGLVKTDW+QAPF ASYRN++A ACV+ + +S+       SA   N W SQ L
Sbjct  193   ADDWATRGGLVKTDWTQAPFTASYRNFNANACVWSNGASSCKSNSPSSASTNNAWFSQEL  252

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             D S QQR++WVQKNYMIYNYCTDAKRFPQG PPEC++
Sbjct  253   DSSSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNM  289



>gb|KHG09882.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=280

 Score =   407 bits (1047),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 226/278 (81%), Gaps = 6/278 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V+  I L+   SAA     NF  +I   WG   GKILENG LLTL+LD+ SGSGF+S NQ
Sbjct  7     VSVVIGLVIVASAA-----NFNQDIDVTWGDGRGKILENGNLLTLTLDKFSGSGFQSKNQ  61

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM IKLVPGNSAGTVTTYYL S GST DEIDFEFLGNLSGDPY++HTNV+TQGK
Sbjct  62    YLFGKIDMNIKLVPGNSAGTVTTYYLRSEGSTWDEIDFEFLGNLSGDPYIVHTNVYTQGK  121

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G +EQQFYLWFDPTKDFHTYS+LWNPQ IIFSVDGTPIR+FKN+E+ G+ FPK QPM +Y
Sbjct  122   GDKEQQFYLWFDPTKDFHTYSLLWNPQRIIFSVDGTPIREFKNLESKGVTFPKSQPMRVY  181

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWSQAPF ASYR + A ACV+ S  S+ S T   S N WLSQ
Sbjct  182   SSLWNADDWATRGGLVKTDWSQAPFTASYRTFKADACVWSSGKSSCSSTSP-SQNSWLSQ  240

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              LDI+ QQR+KWVQKNYMIYNYCTD KRFP G P EC+
Sbjct  241   ELDITSQQRLKWVQKNYMIYNYCTDTKRFPMGLPKECT  278



>ref|XP_008223658.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
 ref|XP_008223659.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
Length=286

 Score =   407 bits (1047),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 194/279 (70%), Positives = 235/279 (84%), Gaps = 7/279 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIA---AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             +FILL+  L+A+ +    AGNF  +    WG    KIL NG+LLTL LD+ASGSGF+S N
Sbjct  9     SFILLIALLAASFMVVANAGNFNQDFQITWGDGRAKILNNGELLTLLLDKASGSGFQSKN  68

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QG
Sbjct  69    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQG  128

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN E++G+PFPK+QPM +
Sbjct  129   KGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNQESNGVPFPKNQPMRI  188

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSASSTSSCTKNPSANPWL  394
             YSSLW+A+DWATRGGL+KTDWS+APF ASYRN++A  ACV  + +S+ S +   ++N WL
Sbjct  189   YSSLWNADDWATRGGLIKTDWSRAPFTASYRNFNANNACVSSNGASSCSSS---TSNAWL  245

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             S+ LD++ Q+R++WVQKNYMIYNYCTDAKRFPQG P EC
Sbjct  246   SEELDLTRQERLRWVQKNYMIYNYCTDAKRFPQGLPTEC  284



>ref|XP_007223211.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
 gb|EMJ24410.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
Length=296

 Score =   408 bits (1048),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 245/301 (81%), Gaps = 18/301 (6%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGI---AAGNFINEIGFNWGQDHGKILENGQLLT  976
             MASL+++        +FILL+  L+A+ +   +AGNF  +    WG    KIL NG+LLT
Sbjct  1     MASLKSSF-------SFILLIALLAASSLVVASAGNFNQDFQITWGDGRAKILNNGELLT  53

Query  975   LSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNL  796
             LSLD+ASGSGF+S N+Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNL
Sbjct  54    LSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNL  113

Query  795   SGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNM  616
             SGDPY+LHTNVF+QGKG REQQFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN 
Sbjct  114   SGDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNQ  173

Query  615   EASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACV-----  454
             E++G+PFPK+QPM +YSSLW+A+DWATRGGL+KTDWS+APF ASYRN++A  ACV     
Sbjct  174   ESNGVPFPKNQPMRIYSSLWNADDWATRGGLIKTDWSRAPFTASYRNFNANNACVSSNGA  233

Query  453   --YGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPE  280
                 S+SS +S +   ++N WLS+ LD++ Q+R++WVQKNYMIYNYCTDAKRFPQG P E
Sbjct  234   SSCSSSSSQNSSSSASTSNAWLSEELDLTRQERLRWVQKNYMIYNYCTDAKRFPQGLPTE  293

Query  279   C  277
             C
Sbjct  294   C  294



>ref|XP_011044000.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=289

 Score =   407 bits (1047),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 186/278 (67%), Positives = 228/278 (82%), Gaps = 5/278 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LL+ +L+ A  +A NF N+    WG     IL NG+LLTL+LD+ASGSGF+S  +Y++GK
Sbjct  14    LLVASLTVA--SASNFYNDFDITWGDGRANILSNGELLTLNLDKASGSGFQSRKEYLFGK  71

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  72    IDMQLKLVPGNSAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  131

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +YSSLW+
Sbjct  132   QFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWN  191

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSL  382
             A+DWATRGGLVKTDW+ APF ASYRN++A+ACV  + +S+   T +P A   N W S+ L
Sbjct  192   ADDWATRGGLVKTDWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEEL  251

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWV++NYM+YNYC D  RFPQG PPEC ++
Sbjct  252   DSTRQERLKWVRENYMVYNYCKDVNRFPQGLPPECGMS  289



>emb|CAN80250.1| hypothetical protein VITISV_036640 [Vitis vinifera]
Length=287

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/282 (69%), Positives = 233/282 (83%), Gaps = 4/282 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             +A+  +L+  LS   +A AGNF  +    WG    KIL NGQLLTLSLD+ASGSGF+S N
Sbjct  1     MASSSILVLMLSMXVVASAGNFNQDFDITWGDGRAKILNNGQLLTLSLDKASGSGFQSRN  60

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QG
Sbjct  61    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQG  120

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ +PK+QPM +
Sbjct  121   KGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVSYPKNQPMRI  180

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY---GSASSTSSCTKNPSANP  400
             YSSLW+A+DWATRGGLVKTDWSQAPF ASYRN++A AC++    S+ S+++ +   ++  
Sbjct  181   YSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNADACIWSSGASSCSSTTPSSTSTSGQ  240

Query  399   WLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             W SQ LD + Q+R+KWVQKNYMIYNYCTD KRFPQG PPEC+
Sbjct  241   WYSQELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT  282



>ref|XP_010047002.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78743.1| hypothetical protein EUGRSUZ_C00184 [Eucalyptus grandis]
Length=287

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/276 (71%), Positives = 231/276 (84%), Gaps = 3/276 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             +LL +L  A  +AGN   E    WG    +IL NG LLTLSLD+ASGSGF+S N+Y++GK
Sbjct  14    ILLKSLMVA--SAGNLNQEFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGK  71

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  72    IDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  131

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+SG+PFPK QPM +YSSLW+
Sbjct  132   QFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESSGVPFPKSQPMRIYSSLWN  191

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSLDI  376
             A+DWATRGGLVKTDWS+APF+ASYRN++A ACV+   +SS  S   +   + WL+Q LD 
Sbjct  192   ADDWATRGGLVKTDWSRAPFMASYRNFNADACVWSSGSSSCGSGAASSDGSSWLTQELDT  251

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             + QQR+KWVQ+NYMIYNYC+D+KRFPQG PPEC+L+
Sbjct  252   TSQQRLKWVQQNYMIYNYCSDSKRFPQGPPPECNLS  287



>ref|XP_002324480.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEF03045.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=286

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 184/266 (69%), Positives = 222/266 (83%), Gaps = 3/266 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +A NF N+    WG    KIL NG+LLTL+LD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  20    SASNFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGN  79

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  80    SAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  139

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  140   FHTYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLV  199

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSLDISGQQRIKWV  349
             KTDW+ APF ASYRN++A+ACV  + +S+   T +P A   N W S+ LD + Q+R+KWV
Sbjct  200   KTDWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWV  259

Query  348   QKNYMIYNYCTDAKRFPQGFPPECSL  271
             ++NYM+YNYC D  RFPQG P ECS+
Sbjct  260   RENYMVYNYCKDVNRFPQGLPTECSM  285



>ref|XP_002308092.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE91615.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=285

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/261 (77%), Positives = 228/261 (87%), Gaps = 1/261 (0%)
 Frame = -3

Query  1053  GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSA  874
             GNF  +    WG    K+L+NGQLLTLSLD+ SGSGF+S NQY++GKIDM++KLVPGNSA
Sbjct  25    GNFNQQFDTTWGDGRAKVLQNGQLLTLSLDKTSGSGFKSKNQYLFGKIDMQLKLVPGNSA  84

Query  873   GTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFH  694
             GTVT YYLSSLGS HDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKDFH
Sbjct  85    GTVTAYYLSSLGSAHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKDFH  144

Query  693   TYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKT  514
             TYS+LWNP SIIFSVDGTPIR+FKNME+ GIP+PK QPMW+YSSLW+A+DWATRGGL+KT
Sbjct  145   TYSVLWNPLSIIFSVDGTPIREFKNMESKGIPYPKSQPMWIYSSLWNADDWATRGGLIKT  204

Query  513   DWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYM  334
             DWSQAPF ASYRN++AQAC + ++ S+S  +   S+N WLSQSL  +GQ RIKWVQKNYM
Sbjct  205   DWSQAPFTASYRNFNAQACTW-TSGSSSCSSSGSSSNSWLSQSLGSTGQGRIKWVQKNYM  263

Query  333   IYNYCTDAKRFPQGFPPECSL  271
             IYNYCTD KRFPQG PPECS+
Sbjct  264   IYNYCTDTKRFPQGPPPECSV  284



>ref|XP_004488032.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=287

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/264 (73%), Positives = 227/264 (86%), Gaps = 3/264 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  ++   WG +  KILENGQ L+LSLD+ASGSGFRS N+Y++GKIDM++KLVPGN
Sbjct  22    SAGNFYQDMEITWGDNRAKILENGQFLSLSLDKASGSGFRSKNEYLFGKIDMQLKLVPGN  81

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVTTYY+S   STHDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKD
Sbjct  82    SAGTVTTYYVSIHWSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKD  141

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQSIIFSVDGTPIR+FKN+E+ G+ +PK+Q M +YSSLW+A+DWATRGGLV
Sbjct  142   FHTYSILWNPQSIIFSVDGTPIREFKNLESKGVGYPKNQAMRIYSSLWNADDWATRGGLV  201

Query  519   KTDWSQAPFIASYRNYSAQACVY---GSASSTSSCTKNPSANPWLSQSLDISGQQRIKWV  349
             KTDW+QAPF ASYRN++AQACV+   GS+ S++    + SA  WL +SLD +G  +I WV
Sbjct  202   KTDWAQAPFTASYRNFNAQACVWTSSGSSCSSNKSPTSSSAQSWLRESLDSNGIAKIHWV  261

Query  348   QKNYMIYNYCTDAKRFPQGFPPEC  277
             QKNYMIYNYCTD KRFPQGFP EC
Sbjct  262   QKNYMIYNYCTDTKRFPQGFPSEC  285



>ref|XP_010927060.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Elaeis 
guineensis]
Length=298

 Score =   407 bits (1047),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 220/279 (79%), Gaps = 6/279 (2%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             AF+++ + +   G   GNF  +    WG    KIL NG LLTLSLD+ SGSGF+S NQY+
Sbjct  19    AFLMVASVM--VGAYGGNFYQDFDITWGDGRAKILNNGHLLTLSLDKVSGSGFQSKNQYL  76

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM+IKLVPGNSAGTVT YYLSS G  HDEIDFEFLGNLSGDPY+LHTNVFTQGKG 
Sbjct  77    FGKIDMQIKLVPGNSAGTVTAYYLSSQGPDHDEIDFEFLGNLSGDPYILHTNVFTQGKGN  136

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPTKDFHTYSILWNP  +IF VDG PIR FKN EA G+PFPK+QPM +YSS
Sbjct  137   REQQFYLWFDPTKDFHTYSILWNPLHVIFLVDGIPIRDFKNKEAIGVPFPKNQPMRLYSS  196

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA----NPWL  394
             LWDAEDWATRGGLVKTDW++APF AS+RN+ A AC++ S  S+    +  SA    + W 
Sbjct  197   LWDAEDWATRGGLVKTDWTKAPFTASFRNFQASACIWSSGKSSCGRRRAGSASTAGDGWF  256

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              Q LD + Q+R++WVQKNYM+YNYCTD KRFPQG PPEC
Sbjct  257   DQELDAASQRRLRWVQKNYMVYNYCTDVKRFPQGLPPEC  295



>ref|NP_001242530.1| uncharacterized protein LOC100785313 precursor [Glycine max]
 gb|ACU21249.1| unknown [Glycine max]
Length=287

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/263 (72%), Positives = 218/263 (83%), Gaps = 3/263 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             AAGNF  +    WG    KIL N  LLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  25    AAGNFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  84

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  85    SAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  144

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK QPM +YSSLW+A+DWATRGG +
Sbjct  145   FHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRI  204

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLDISGQQRIKWVQK  343
             KTDWS+APF ASYRN++A ACV+    ST  C  N PS+N WLSQ LD + QQR+ WVQK
Sbjct  205   KTDWSKAPFTASYRNFNANACVWNRGKST--CKSNSPSSNAWLSQELDSTAQQRLSWVQK  262

Query  342   NYMIYNYCTDAKRFPQGFPPECS  274
             NYMIYNYC+D  RF QG P EC+
Sbjct  263   NYMIYNYCSDKNRFAQGLPLECT  285



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   406 bits (1044),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 228/277 (82%), Gaps = 4/277 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +L+   +S+  +A A NF  +    WG   GKIL NGQLL+LSLD+ASGSGF+S ++Y++
Sbjct  9     LLISIAISSLMVASASNFYQDFDITWGDGRGKILNNGQLLSLSLDKASGSGFQSKSEYLF  68

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG R
Sbjct  69    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDR  128

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYS+LWNPQ I+F VDG+PIR+FKN+E++G+ FPK+QPM +YSSL
Sbjct  129   EQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSL  188

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGL+KTDW+QAPF ASYRN++A ACV+ +  S+ +   N   NPW SQ LD
Sbjct  189   WNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWSNGKSSCNSKNN---NPWFSQELD  245

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              +GQ+R+KWVQKNYMIYNYC D+KRFPQG P EC+ N
Sbjct  246   ATGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN  282



>ref|XP_007154784.1| hypothetical protein PHAVU_003G147700g [Phaseolus vulgaris]
 gb|ESW26778.1| hypothetical protein PHAVU_003G147700g [Phaseolus vulgaris]
Length=284

 Score =   406 bits (1044),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 237/280 (85%), Gaps = 3/280 (1%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
              ++LL   +     A G+F  +    WG    +IL NG+LLTL+LD+ASGSGF+S N+Y+
Sbjct  6     CYMLLFPVILIVAFA-GDFNKDFDLTWGDGRARILNNGELLTLTLDKASGSGFQSKNEYL  64

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G+T DEID+EFLGNLSGDPY+LHTNVF+QGKG 
Sbjct  65    FGKIDMQLKLVPGNSAGTVTAYYLSSKGTTWDEIDYEFLGNLSGDPYILHTNVFSQGKGN  124

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPT DFHTYSI+WNPQ IIFSVDGTPIR+FKN EA G+PFPK+QPM +YSS
Sbjct  125   REQQFYLWFDPTADFHTYSIMWNPQRIIFSVDGTPIREFKNSEAIGVPFPKNQPMRIYSS  184

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY--GSASSTSSCTKNPSANPWLSQ  388
             LW+A+DWATRGGLVKTDW++APF ASYRN++AQAC++  G++S  SS +++   + WLSQ
Sbjct  185   LWNADDWATRGGLVKTDWTRAPFTASYRNFNAQACIWSSGASSCGSSASESTGGSSWLSQ  244

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              +D +GQQR+KWVQ+NYMIYNYC+DAKRFPQGFPPEC+++
Sbjct  245   EMDATGQQRLKWVQRNYMIYNYCSDAKRFPQGFPPECNIS  284



>ref|XP_010046992.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=292

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/282 (69%), Positives = 232/282 (82%), Gaps = 2/282 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
              AA +L++    A   +A NF  +    WG    +IL NG LLTLSLD+ASGSGF+S N+
Sbjct  11    TAALLLIMVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNE  70

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGK
Sbjct  71    YLFGKIDMQLKLVPGNSAGTVTAYYLSSNGSTWDEIDFEFLGNLSGDPYILHTNVFSQGK  130

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++
Sbjct  131   GNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIF  190

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWL  394
             SSLW+A+DWATRGGLVKTDW+QAPF ASYRN++A  ACV+   +SS +S + +   N WL
Sbjct  191   SSLWNADDWATRGGLVKTDWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWL  250

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             S+ LD + Q+R+KWVQ NYMIYNYC+DAKRFPQGFPPEC+++
Sbjct  251   SEELDSTSQERLKWVQSNYMIYNYCSDAKRFPQGFPPECTMS  292



>ref|XP_002324481.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEF03046.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=286

 Score =   406 bits (1044),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 184/266 (69%), Positives = 222/266 (83%), Gaps = 3/266 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +A NF N+    WG    KIL NG+LLTL+LD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  20    SASNFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGN  79

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  80    SAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  139

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  140   FHTYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLV  199

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSLDISGQQRIKWV  349
             KTDW+ APF ASYRN++A+ACV  + +S+   T +P A   N W S+ LD + Q+R+KW 
Sbjct  200   KTDWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPAPTSNAWFSEELDSTRQERLKWA  259

Query  348   QKNYMIYNYCTDAKRFPQGFPPECSL  271
             ++NYM+YNYC D  RFPQG PPECS+
Sbjct  260   RENYMVYNYCKDINRFPQGLPPECSM  285



>ref|XP_010927056.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=277

 Score =   406 bits (1043),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 188/273 (69%), Positives = 225/273 (82%), Gaps = 4/273 (1%)
 Frame = -3

Query  1089  LLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKI  910
             LL     A  +AGNF  E    WG   GKIL+NGQLLTL+LD+ASGSGF+S N+Y++GKI
Sbjct  8     LLACFLMATASAGNFYQEFDITWGDGRGKILDNGQLLTLALDKASGSGFQSKNEYLFGKI  67

Query  909   DMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQ  730
             DM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSG+PY LHTNVFTQGKG RE Q
Sbjct  68    DMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGEPYTLHTNVFTQGKGNREMQ  127

Query  729   FYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDA  550
             F+LWF+PT+DFHTYSILWNP+ +IF VDGTPIR FKNME+ G+ FPK QPM +YSSLW+A
Sbjct  128   FHLWFNPTEDFHTYSILWNPEHVIFMVDGTPIRDFKNMESKGVAFPKSQPMRIYSSLWNA  187

Query  549   EDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISG  370
             +DWAT+GG VKTDW++APF ASYRN++A AC++  +S TSSC  N   + W +Q LD +G
Sbjct  188   DDWATQGGRVKTDWTKAPFTASYRNFNADACIW--SSGTSSC--NSQKSDWWNQELDSTG  243

Query  369   QQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q+R++W Q+NYMIYNYCTD KRFPQG PPECS+
Sbjct  244   QERMRWAQENYMIYNYCTDLKRFPQGLPPECSI  276



>ref|XP_010259807.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=301

 Score =   407 bits (1045),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 196/281 (70%), Positives = 235/281 (84%), Gaps = 10/281 (4%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +L+L +L+    +A NF  +   +WG    KIL NG+LLTLSLD+ASGSGF+S ++Y++G
Sbjct  19    LLVLGSLAIVA-SASNFYQDFDVSWGDGRAKILNNGELLTLSLDKASGSGFQSKHEYLFG  77

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KID+++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  78    KIDIQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  137

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+QPM +YSSLW
Sbjct  138   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLW  197

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSASST------SSCTKNPSANPW  397
             +A+DWATRGGLVKTDW++APF ASYRN++A  AC++ S SS+      +S T NP  + W
Sbjct  198   NADDWATRGGLVKTDWTKAPFTASYRNFNANNACIWSSGSSSCDSKSPTSTTNNP--HQW  255

Query  396   LSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             LSQ LD +GQ+++KWVQKNYMIYNYCTD KRFPQG PPECS
Sbjct  256   LSQELDSAGQEKMKWVQKNYMIYNYCTDTKRFPQGLPPECS  296



>ref|XP_002318936.2| putative xyloglucan endotransglycosylase family protein [Populus 
trichocarpa]
 gb|EEE94859.2| putative xyloglucan endotransglycosylase family protein [Populus 
trichocarpa]
Length=318

 Score =   407 bits (1047),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/309 (65%), Positives = 243/309 (79%), Gaps = 7/309 (2%)
 Frame = -3

Query  1182  SKTLASQLI*SSMASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGK  1003
             SK LA      SMA L A+      +  F++  T  S  G + GNF       WG    K
Sbjct  9     SKQLAKLHFIVSMAFLLAS-SSVPMLLMFLVSFTVSSLMGSSLGNFYQNFDITWGDGRAK  67

Query  1002  ILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDE  823
             IL NG+LLTL+LD+ASGSGF+S N+Y++GKIDM++KLVPGNSAGTVT YYLSS GST DE
Sbjct  68    ILNNGELLTLNLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDE  127

Query  822   IDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDG  643
             IDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDG
Sbjct  128   IDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIFSVDG  187

Query  642   TPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQ  463
             TPIR+FKNME+ G+PFPK+QPM +YSSLW+A+DWATRGGLVKTDWS+APF ASY+N++A+
Sbjct  188   TPIREFKNMESRGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTASYKNFNAK  247

Query  462   -ACVYGSASST-----SSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRF  301
              ACV+ + +S+     S+   + + N WLS+ L  + Q+R++WV+KNYMIYNYCTDAKRF
Sbjct  248   DACVWSNGASSCGTNSSAAAASSTTNAWLSEELGSTSQERLEWVKKNYMIYNYCTDAKRF  307

Query  300   PQGFPPECS  274
             PQG PPECS
Sbjct  308   PQGLPPECS  316



>ref|XP_002274404.1| PREDICTED: brassinosteroid-regulated protein BRU1 [Vitis vinifera]
Length=289

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 229/276 (83%), Gaps = 4/276 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             + +  +L AA  +AGNF  E    WG D  K+L+ GQLLTLSLDRASGSGF+S N+Y++G
Sbjct  16    VYMFCSLMAA--SAGNFYQEFDITWGNDRAKLLDKGQLLTLSLDRASGSGFKSKNEYLFG  73

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YY SSLGSTHDEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  74    KIDMQLKLVPGNSAGTVTAYYFSSLGSTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  133

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT +FHTYS+LWNP +I+FSVDGTPIR FKN+EA GIPFPK QPM +YSSLW
Sbjct  134   QQFYLWFDPTANFHTYSVLWNPHNILFSVDGTPIRVFKNLEAMGIPFPKKQPMRIYSSLW  193

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDWSQAPF ASYRN+ A  ACV+   ASS SS + + S +PW+   L
Sbjct  194   NADDWATRGGLVKTDWSQAPFTASYRNFDASNACVWSSGASSCSSKSPSSSNSPWMKHEL  253

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q R++WVQKNYMIYNYCTD KRFPQ  PPEC+
Sbjct  254   DSTSQARLRWVQKNYMIYNYCTDTKRFPQSPPPECA  289



>ref|NP_001284443.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Cucumis melo]
 gb|ABI94063.1| xyloglucan endotransglucosylase/hydrolase 3 [Cucumis melo]
Length=285

 Score =   405 bits (1042),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 223/280 (80%), Gaps = 1/280 (0%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +    LL +  S   I++ NF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+
Sbjct  5     IMFLTLLFSAASLIAISSANFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSQNE  64

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLV GNSAGTVT YYLSS GST DEIDFEFLGNL+GDPY LHTNVF+QGK
Sbjct  65    YLFGKIDMQLKLVAGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLTGDPYTLHTNVFSQGK  124

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQF+LWFDPT DFHTYSILWNP  I+FSVDGTPIR+FKN E++G+PFPKDQPM +Y
Sbjct  125   GNREQQFHLWFDPTADFHTYSILWNPNRIVFSVDGTPIREFKNWESNGVPFPKDQPMRIY  184

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLS  391
             SSLW+A+DWATRGGLVKTDW++APF ASY+N+ A+ACV  G  SS S      S N WLS
Sbjct  185   SSLWNADDWATRGGLVKTDWTKAPFTASYKNFKAEACVLSGGQSSCSPSAPAGSRNSWLS  244

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             + +D   Q+R+KWVQKNYMIYNYCTD +RFPQG P EC L
Sbjct  245   EEMDSVSQERLKWVQKNYMIYNYCTDTRRFPQGLPTECKL  284



>ref|XP_007014172.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31791.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   405 bits (1042),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 193/281 (69%), Positives = 233/281 (83%), Gaps = 5/281 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAG--NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             F LL++ +    +AA   NF  +    WG   GKI  NG++L+LSLD+ASGSGF+S N+Y
Sbjct  9     FTLLMSLVIGCLMAASASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGSGFQSKNEY  68

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG
Sbjct  69    LFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKG  128

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPT DFHTYSILWN Q IIFS DGTPIR+FKNME+ G+PFPK+QPM +YS
Sbjct  129   NREQQFYLWFDPTADFHTYSILWNSQRIIFSADGTPIREFKNMESLGVPFPKNQPMRIYS  188

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWL  394
             SLW+A+DWATRGGLVKTDW+QAPF ASYRN++A ACV+ + +    ++S + + + N WL
Sbjct  189   SLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACVWSNGASSCKSNSPSSSSTNNAWL  248

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             SQ LD + QQR++WVQKNYMIYNYCTDAKRFPQG PPEC++
Sbjct  249   SQELDSTSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNM  289



>ref|XP_010927058.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=296

 Score =   405 bits (1042),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 225/286 (79%), Gaps = 4/286 (1%)
 Frame = -3

Query  1116  GGGVAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFR  940
              G + A +  L   S   IA AGNF  +    WG    KIL+NGQ LTLSLD+ASGSGF+
Sbjct  10    AGAIMALLFPLLACSLMAIASAGNFHRDFQITWGDGRAKILDNGQHLTLSLDKASGSGFQ  69

Query  939   STNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVF  760
             S N+Y++GKI M++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF
Sbjct  70    SKNEYLFGKIHMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVF  129

Query  759   TQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQP  580
             TQGKG RE QF+LWFDPTKDFHTYSILWNP+ IIF VDG PIR FKN+E+ GI FPK+QP
Sbjct  130   TQGKGNREMQFHLWFDPTKDFHTYSILWNPRHIIFMVDGIPIRDFKNLESRGIAFPKNQP  189

Query  579   MWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTK---NPS  409
             M +YSSLW+A+DWAT+GG VKTDW++APF ASYRN+ A ACV+ SA+S     K   + +
Sbjct  190   MRIYSSLWNADDWATQGGRVKTDWTKAPFTASYRNFKADACVWSSAASNCPSKKSSTDSA  249

Query  408   ANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             ++ W +Q LD + Q+R++WVQ NYMIYNYCTD KRFPQG PPECSL
Sbjct  250   SDDWWNQELDFTSQERMRWVQNNYMIYNYCTDLKRFPQGLPPECSL  295



>gb|KHG04746.1| putative xyloglucan endotransglucosylase/hydrolase 23 -like protein 
[Gossypium arboreum]
Length=281

 Score =   405 bits (1040),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 222/262 (85%), Gaps = 1/262 (0%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +A NF  +I   WG    KILENG LLTL+LD+ SGSGF+S NQY++GKIDM IKLVPGN
Sbjct  19    SAANFNQDIDVTWGDGRVKILENGNLLTLTLDKFSGSGFQSKNQYLFGKIDMNIKLVPGN  78

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVTTYYL S GST DEIDFEFLGNLSGDPY++HTNV+TQGKG +EQQFYLWFDPTKD
Sbjct  79    SAGTVTTYYLRSEGSTWDEIDFEFLGNLSGDPYIVHTNVYTQGKGDKEQQFYLWFDPTKD  138

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYS+LWNPQ IIFSVDGTPIR+FKN+E++G+ FPK QPM +YSSLW+A+DWATRGGLV
Sbjct  139   FHTYSLLWNPQRIIFSVDGTPIREFKNLESTGVAFPKSQPMRVYSSLWNADDWATRGGLV  198

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             KTDWS+APF A+YRNY A ACV+ S  S+ S T   S N WLSQ LDI+ Q+++KWVQKN
Sbjct  199   KTDWSKAPFTAAYRNYKADACVWSSGKSSCSSTSP-SQNSWLSQELDITSQEKLKWVQKN  257

Query  339   YMIYNYCTDAKRFPQGFPPECS  274
             YMIYNYCTD KRFPQG P EC+
Sbjct  258   YMIYNYCTDTKRFPQGLPKECT  279



>ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 230/276 (83%), Gaps = 5/276 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             ++++ L AA  +AGNF  +    WG   GKIL NG+LLTLSLD+ SGSGF+S N+Y++GK
Sbjct  19    VVVSFLMAA--SAGNFYQDFDITWGDGRGKILNNGELLTLSLDKPSGSGFQSKNEYLFGK  76

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  77    IDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  136

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+P+PK+QPM +YSSLW+
Sbjct  137   QFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYPKNQPMRIYSSLWN  196

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQSL  382
             A+DWATRGGLVKTDWSQAPF ASYRN++A AC++ S SS+ S T   S +    W SQ L
Sbjct  197   ADDWATRGGLVKTDWSQAPFTASYRNFNANACLWSSGSSSCSSTSPSSTSTNGGWYSQEL  256

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q+R+KWVQKNYMIYNYC D KRFPQG PPECS
Sbjct  257   DSTSQERMKWVQKNYMIYNYCADTKRFPQGLPPECS  292



>gb|AFK47685.1| unknown [Lotus japonicus]
Length=278

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/275 (71%), Positives = 228/275 (83%), Gaps = 7/275 (3%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LL TT   A  A+GNF  +    WG    KI  +GQLLTLSLD+ASGSGFRS N+Y++GK
Sbjct  9     LLFTTFVIA--ASGNFNQDFEITWGDGRAKIPNDGQLLTLSLDKASGSGFRSRNEYLFGK  66

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLG-STHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             IDM++KLVPGNSAGTVT YYLSS    THDEIDFEFLGNLSGDPY+LHTNVFTQGKG RE
Sbjct  67    IDMQLKLVPGNSAGTVTAYYLSSADWDTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNRE  126

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPTKDFHTYS+LWNPQSIIFSVDGTPIRQF N+E+ G+ FPK Q M ++SSLW
Sbjct  127   QQFYLWFDPTKDFHTYSVLWNPQSIIFSVDGTPIRQFNNLESKGVAFPKKQAMRIFSSLW  186

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDI  376
             +A+DWATRGGLVKTDWSQAPF ASY++++AQACV+ S+ S+ S  +    + W+ +SLD 
Sbjct  187   NADDWATRGGLVKTDWSQAPFTASYKSFNAQACVWTSSGSSCSSNQ----DSWMKESLDS  242

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             +GQ RI+WVQKNYMIYNYCTD K FPQGFPPECS+
Sbjct  243   TGQARIQWVQKNYMIYNYCTDTKSFPQGFPPECSI  277



>ref|XP_011094075.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=281

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/268 (73%), Positives = 225/268 (84%), Gaps = 4/268 (1%)
 Frame = -3

Query  1068  AGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLV  889
             A    GNF  +    WG    KIL+NG+LLTLSLD+ SGSGFRS  QYM+GKIDM+I+LV
Sbjct  15    AAALGGNFNQDFDITWGDGRAKILDNGKLLTLSLDKTSGSGFRSKKQYMFGKIDMQIRLV  74

Query  888   PGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDP  709
             PGNSAGTVT YYLSSLGS HDEIDFEFLGNLSGDPY++HTNV+TQGKGGREQQFYLWFDP
Sbjct  75    PGNSAGTVTAYYLSSLGSNHDEIDFEFLGNLSGDPYIMHTNVYTQGKGGREQQFYLWFDP  134

Query  708   TKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS--GIPFPKDQPMWMYSSLWDAEDWAT  535
             TKDFHTYSILWNPQSII SVDGTPIRQFKN+E+   G+ +PKDQPMW++SSLW+A+DWAT
Sbjct  135   TKDFHTYSILWNPQSIILSVDGTPIRQFKNLESKGVGVAYPKDQPMWIFSSLWNADDWAT  194

Query  534   RGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIK  355
             RGGLVKTDWSQAPF ASY N++A AC   + S++     + S+    S+SLD SG +RIK
Sbjct  195   RGGLVKTDWSQAPFTASYTNFNALACTVSTTSNSCPKNSSSSSW--FSESLDNSGVERIK  252

Query  354   WVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             WVQKNYMIY+YCTD+KRFPQGFPPECS+
Sbjct  253   WVQKNYMIYDYCTDSKRFPQGFPPECSI  280



>ref|XP_010259803.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=295

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 224/280 (80%), Gaps = 8/280 (3%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
              + LL +   A  +A  F  +    WG    KIL NG+LLTLSLD+ASGSGF+S  +Y++
Sbjct  14    IVALLASSFMATSSARTFYQDFDLTWGDGRAKILNNGKLLTLSLDKASGSGFQSKREYLF  73

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             G IDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG R
Sbjct  74    GSIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNR  133

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDG PIR+FKN+E+ G+PFPK+QPM +YSSL
Sbjct  134   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGIPIREFKNLESIGVPFPKNQPMRIYSSL  193

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN------PW  397
             W+A+DWATRGGL+KTDW++ PF ASYRN+ A+ACV+ S +  SSC     A+       W
Sbjct  194   WNADDWATRGGLIKTDWTKVPFTASYRNFKAKACVWSSGA--SSCNSQSLASTRNYNKAW  251

Query  396   LSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             LS+ LD + Q++++W Q+NYMIYNYCTD KRFPQG PPEC
Sbjct  252   LSRQLDSTSQEKMRWAQRNYMIYNYCTDTKRFPQGLPPEC  291



>ref|XP_002270416.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=296

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 222/265 (84%), Gaps = 3/265 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             + GN   +    WG    KIL NGQLLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  27    SVGNLYQDFDLTWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  86

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  87    SAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  146

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  147   FHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLV  206

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQSLDISGQQRIKWV  349
             KTDW+QAPF ASYRN++A ACV+ S SS+ S T   S +    W SQ LD + Q+R+KWV
Sbjct  207   KTDWTQAPFTASYRNFNANACVWSSRSSSCSSTSPSSTSTNGGWYSQELDSTSQERMKWV  266

Query  348   QKNYMIYNYCTDAKRFPQGFPPECS  274
             QKNYMIYNYCTD KRFPQG PPEC+
Sbjct  267   QKNYMIYNYCTDTKRFPQGLPPECT  291



>ref|XP_010046996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/278 (70%), Positives = 230/278 (83%), Gaps = 2/278 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LL+    A   +A NF  +    WG    +IL NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  14    LLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFG  73

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  74    KIDMQLKLVPGNSAGTVTAYYLSSNGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  133

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++SSLW
Sbjct  134   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESVGVPFPKAQPMRIFSSLW  193

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDW+QAPF ASYRN++A  ACV+   +SS +S + +   N WL++ L
Sbjct  194   NADDWATRGGLVKTDWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWLAEEL  253

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWVQ NYMIYNYCTDAKRFPQGFPPECS++
Sbjct  254   DSTSQERLKWVQSNYMIYNYCTDAKRFPQGFPPECSMS  291



>ref|XP_003625289.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES81507.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AFK49301.1| unknown [Medicago truncatula]
Length=282

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 230/279 (82%), Gaps = 3/279 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V   ++L++T++ A  +AGNF  +    WG    KIL NGQLLTLSLD++SGSGF+S N+
Sbjct  6     VTFLVILISTVAIA--SAGNFYQDFDITWGDGRAKILNNGQLLTLSLDKSSGSGFQSKNE  63

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS G   DEIDFEFLGNLSGDPY+LHTNVF+QGK
Sbjct  64    YLFGKIDMQLKLVPGNSAGTVTAYYLSSKGGAWDEIDFEFLGNLSGDPYILHTNVFSQGK  123

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNPQ I+FSVDG+PIR+FKNME++G+PFPK QPM +Y
Sbjct  124   GNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESNGVPFPKSQPMRIY  183

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWS APF ASYRN++A AC   S +S+ S T++ + N W S+
Sbjct  184   SSLWNADDWATRGGLVKTDWSNAPFTASYRNFNANACTVSSGTSSCSSTQS-NKNSWFSE  242

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD +  +R+KWVQKNYMIYNYCTD KRFPQG P EC +
Sbjct  243   ELDSTSHERLKWVQKNYMIYNYCTDTKRFPQGLPQECMM  281



>gb|ABM91066.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-6 [Populus 
tremula]
Length=281

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 227/261 (87%), Gaps = 1/261 (0%)
 Frame = -3

Query  1053  GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSA  874
             GNF  +    WG    ++L+NGQLLTLSLD+ SGSGF+S +QY++GKIDM++KLVPGNSA
Sbjct  21    GNFNQQFDTTWGDGRARVLQNGQLLTLSLDKTSGSGFKSKSQYLFGKIDMQLKLVPGNSA  80

Query  873   GTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFH  694
             GTVT YYLSSLGS HDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKDFH
Sbjct  81    GTVTAYYLSSLGSAHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKDFH  140

Query  693   TYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKT  514
             TYS+LWNP SII SVDGTPIR+FKNME+ GIP+PK QPMW+YSSLW+A+DWATRGGL+KT
Sbjct  141   TYSVLWNPLSIILSVDGTPIREFKNMESKGIPYPKSQPMWIYSSLWNADDWATRGGLIKT  200

Query  513   DWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYM  334
             DWSQAPF ASYRN++AQAC + ++ S+S  +   S+N WLSQSL  +GQ RIKWVQKNYM
Sbjct  201   DWSQAPFTASYRNFNAQACTW-TSGSSSCSSSGSSSNSWLSQSLGSTGQGRIKWVQKNYM  259

Query  333   IYNYCTDAKRFPQGFPPECSL  271
             IYNYCTD KRFPQG PPECS+
Sbjct  260   IYNYCTDTKRFPQGSPPECSM  280



>ref|XP_010656826.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 232/283 (82%), Gaps = 5/283 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAA--GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRST  934
             V +  LL++ +++  +AA  GNF  +    WG    KIL NG+LLTLSLD+ SGSGF+S 
Sbjct  10    VVSTALLISVVASFLMAASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKTSGSGFQSK  69

Query  933   NQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQ  754
             N+Y++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+Q
Sbjct  70    NEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQ  129

Query  753   GKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMW  574
             GKG REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ +PK+QPM 
Sbjct  130   GKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVSYPKNQPMR  189

Query  573   MYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY---GSASSTSSCTKNPSAN  403
             +YSSLW+A+DWATRGGLVKTDWSQAPF ASYRN++A AC++    S+ S+++ T   +  
Sbjct  190   IYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNADACIWSSGASSCSSNTPTSTSTNT  249

Query  402   PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              W SQ LD + Q+R+KWVQKNYMIYNYC+D KRFPQG PPEC+
Sbjct  250   EWYSQELDSTSQERMKWVQKNYMIYNYCSDTKRFPQGLPPECT  292



>ref|XP_010048560.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW80839.1| hypothetical protein EUGRSUZ_C02203 [Eucalyptus grandis]
Length=292

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 222/261 (85%), Gaps = 2/261 (1%)
 Frame = -3

Query  1050  NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAG  871
             NF  +    WG    KIL +GQLLTLS+D+ SGSGFRS  QY++GKIDM++KLVPGNSAG
Sbjct  30    NFNEDFDITWGDGRAKILNSGQLLTLSMDKTSGSGFRSKKQYLFGKIDMQLKLVPGNSAG  89

Query  870   TVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHT  691
             TVT YYLSSLGS HDEIDFEFLGNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKDFHT
Sbjct  90    TVTAYYLSSLGSAHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKDFHT  149

Query  690   YSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTD  511
             YSILWNPQSI+FSVDGTPIR+FKN+E+ G+ FPK Q MW+YSSLW+A+DWATRGGLVKTD
Sbjct  150   YSILWNPQSIVFSVDGTPIREFKNLESKGVAFPKSQAMWIYSSLWNADDWATRGGLVKTD  209

Query  510   WSQAPFIASYRNYS-AQACVY-GSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
             W+QAPF ASYR ++ AQAC++   +SS SS + +   N WLSQSLD +G+QRIKWVQKNY
Sbjct  210   WTQAPFTASYRGFNDAQACIWSSGSSSCSSSSSSSGNNSWLSQSLDATGEQRIKWVQKNY  269

Query  336   MIYNYCTDAKRFPQGFPPECS  274
             MIYNYC +  RFPQG PPECS
Sbjct  270   MIYNYCANTNRFPQGPPPECS  290



>ref|XP_011069896.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=295

 Score =   404 bits (1037),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 227/268 (85%), Gaps = 4/268 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             ++ NF  +    WG    +IL+NGQLLTLSLD+ASGSGF+S N++++GKIDM++KLVPGN
Sbjct  28    SSANFYQDFDITWGDGRARILDNGQLLTLSLDKASGSGFQSKNEFLFGKIDMQLKLVPGN  87

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNV++QGKGGREQQFYLWFDPT D
Sbjct  88    SAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVYSQGKGGREQQFYLWFDPTAD  147

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ +PK+QPM +YSSLW+A+DWATRGGLV
Sbjct  148   FHTYSILWNPQRIIFSVDGTPIREFKNPESVGVAYPKNQPMRLYSSLWNADDWATRGGLV  207

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP----WLSQSLDISGQQRIKW  352
             KTDWSQAPF ASYRN++A ACV+GS SS+ S +   + N     WL++ LD + Q+R+KW
Sbjct  208   KTDWSQAPFTASYRNFNADACVWGSGSSSCSSSSPSTGNSTNGGWLNEELDATSQERLKW  267

Query  351   VQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             VQKNYMIYNYC DAKRFPQ FPPEC +N
Sbjct  268   VQKNYMIYNYCADAKRFPQQFPPECGIN  295



>ref|XP_003610142.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92339.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=283

 Score =   403 bits (1036),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 229/280 (82%), Gaps = 5/280 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V   ++ ++T++ A  +AGNF  +    WG    KIL +GQLLTLSLD++SGSGF+S N+
Sbjct  7     VTFLVIFISTVAIA--SAGNFYQDFDITWGDGRAKILNSGQLLTLSLDKSSGSGFQSKNE  64

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS G   DEIDFEFLGNLSGDPY+LHTNVF+QGK
Sbjct  65    YLFGKIDMQLKLVPGNSAGTVTAYYLSSKGGAWDEIDFEFLGNLSGDPYILHTNVFSQGK  124

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQ YLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+SG+PFPK+QPM +Y
Sbjct  125   GDREQQIYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNIESSGVPFPKNQPMRIY  184

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSC-TKNPSANPWLS  391
             SSLW+A+DWATRGGLVKTDWS+APF ASYR+++A AC+   +S  SSC +   + N W S
Sbjct  185   SSLWNADDWATRGGLVKTDWSKAPFTASYRHFNANACIV--SSGISSCDSAQSNKNDWFS  242

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             + LD +  +R+KWVQKNYMIYNYC+D KRFPQG P EC +
Sbjct  243   EELDSTSYERLKWVQKNYMIYNYCSDNKRFPQGLPQECRM  282



>ref|XP_010259808.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=301

 Score =   404 bits (1038),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 228/282 (81%), Gaps = 10/282 (4%)
 Frame = -3

Query  1092  LLLTTLSAAGIA----AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             LL+  +S + IA    A NF  +    WG    KIL NGQLLTLSLD+ASGSGF+S N+Y
Sbjct  16    LLVFIISYSLIAIPSLANNFFQDFDVTWGGGRAKILNNGQLLTLSLDKASGSGFQSKNEY  75

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLVPGNSAGT+T YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG
Sbjct  76    LFGKIDMQLKLVPGNSAGTITAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKG  135

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPT DFHTYSILWNPQ+I+FSVDGTPIR+FKN E+ G+PFPK QPM +YS
Sbjct  136   NREQQFYLWFDPTADFHTYSILWNPQNIVFSVDGTPIREFKNSESIGVPFPKSQPMRIYS  195

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-----GSASSTSSCTKNPSANP  400
             SLW+A+DWATRGGLVKTDW+QAPF ASYRN+ A AC++        S + S T N +A  
Sbjct  196   SLWNADDWATRGGLVKTDWTQAPFTASYRNFKADACIWSSSTSSCDSKSPSSTSNTNA-W  254

Query  399   WLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             WLS+ LD   Q+R++WVQKNYMIYNYCTD KRFPQG PPECS
Sbjct  255   WLSEELDSKSQERMRWVQKNYMIYNYCTDIKRFPQGLPPECS  296



>ref|XP_010259798.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=296

 Score =   404 bits (1037),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 224/277 (81%), Gaps = 3/277 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
              L+L +L+ A ++A +F  +    WG    KIL NG LLTLSLD+ASGSGF+S ++Y++G
Sbjct  15    FLVLISLAIATVSASSFNQDFDITWGDGRAKILNNGDLLTLSLDKASGSGFQSRHEYLFG  74

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLV GNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  75    KIDMQLKLVAGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  134

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDG PIR+FKN E+ G+PFPK+Q M +YSSLW
Sbjct  135   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGIPIREFKNSESIGVPFPKNQAMRIYSSLW  194

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQS  385
             +A+DWATRGGLVKTDW++APF ASYRN++A AC+  S SS+       S      WLSQ 
Sbjct  195   NADDWATRGGLVKTDWTKAPFTASYRNFNANACIMSSGSSSCDSKSPTSTTDNLQWLSQE  254

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             LD +GQ+R+KWVQ NYMIYNYCTD KRFPQG PPECS
Sbjct  255   LDSAGQERMKWVQNNYMIYNYCTDTKRFPQGLPPECS  291



>ref|XP_010046998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   403 bits (1036),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 230/280 (82%), Gaps = 2/280 (1%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             A +LL+    A   +A NF  +    WG   G+IL NG LLTLSLD+ASGSGF+S N+Y+
Sbjct  12    AALLLMVVSWATSASARNFYQDFDITWGDGRGQILNNGDLLTLSLDKASGSGFQSKNEYL  71

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG 
Sbjct  72    FGKIDMQLKLVPGNSAGTVTAYYLSSNGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGN  131

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++SS
Sbjct  132   REQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIFSS  191

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWLSQ  388
             LW+A+DWATRGGLVKTDW+QAPF ASY N++A  ACV+   +SS +S + +   N WLS+
Sbjct  192   LWNADDWATRGGLVKTDWTQAPFTASYSNFNADNACVWSSGSSSCTSSSSSSDGNAWLSE  251

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              LD + Q+ +KWVQ NYMIYNYCTDAKRFPQGFPPECS++
Sbjct  252   ELDSTSQESLKWVQSNYMIYNYCTDAKRFPQGFPPECSMS  291



>ref|XP_007138740.1| hypothetical protein PHAVU_009G233200g [Phaseolus vulgaris]
 gb|ESW10734.1| hypothetical protein PHAVU_009G233200g [Phaseolus vulgaris]
Length=277

 Score =   402 bits (1034),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 191/260 (73%), Positives = 221/260 (85%), Gaps = 7/260 (3%)
 Frame = -3

Query  1053  GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSA  874
             G+F  +    WG    KILENGQLLTL+LD+ASGSGFRS N+Y++GKIDM++KLVPGNSA
Sbjct  23    GSFFQDFELTWGGGRAKILENGQLLTLTLDKASGSGFRSKNEYLFGKIDMQLKLVPGNSA  82

Query  873   GTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFH  694
             GTVT YYLSSLG THDEIDFEFLGNLSGDPY LHTNVF+QGKG REQQF+LWFDPTKDFH
Sbjct  83    GTVTAYYLSSLGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKDFH  142

Query  693   TYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKT  514
             TYS+ WNP SIIFSVDGTPIR+FKN+E  G+PFPK QPM +YSSLWDAEDWATRGGLVKT
Sbjct  143   TYSVQWNPASIIFSVDGTPIREFKNLETKGVPFPKKQPMRIYSSLWDAEDWATRGGLVKT  202

Query  513   DWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYM  334
             DWSQAPF+ASYRN++A+ACV+ S+ S+S  + +        QSLD +GQ +I+WVQKNYM
Sbjct  203   DWSQAPFMASYRNFNAEACVWSSSGSSSCASSS-------GQSLDATGQAKIRWVQKNYM  255

Query  333   IYNYCTDAKRFPQGFPPECS  274
             +YNYCTD +RF QG PPECS
Sbjct  256   VYNYCTDTRRFSQGLPPECS  275



>ref|XP_002274827.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
 emb|CAN77531.1| hypothetical protein VITISV_019831 [Vitis vinifera]
Length=296

 Score =   403 bits (1035),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 193/265 (73%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             + GN   +    WG    KIL NGQLLTLSLD+ASGSGFRS N+Y++GKIDM++KLVPGN
Sbjct  27    SVGNLYQDFDITWGDGRAKILNNGQLLTLSLDKASGSGFRSNNEYLFGKIDMQLKLVPGN  86

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  87    SAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  146

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYS+LWNPQ IIFSVDGTPIR+FKN E+ G+P+PK+QPM +YSSLW+A+DWATRGGLV
Sbjct  147   FHTYSVLWNPQRIIFSVDGTPIREFKNSESIGVPYPKNQPMRIYSSLWNADDWATRGGLV  206

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQSLDISGQQRIKWV  349
             KTDWSQAPF ASYRN++A ACV+ S SS+ S T   S +    W SQ LD + Q+R+ WV
Sbjct  207   KTDWSQAPFTASYRNFNANACVWSSGSSSCSSTSPSSTSTNGGWYSQELDSTSQERMTWV  266

Query  348   QKNYMIYNYCTDAKRFPQGFPPECS  274
             QKNYMIYNYCTD KRFPQG PPEC+
Sbjct  267   QKNYMIYNYCTDTKRFPQGLPPECT  291



>gb|KCW78732.1| hypothetical protein EUGRSUZ_C00176 [Eucalyptus grandis]
Length=433

 Score =   408 bits (1048),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 231/281 (82%), Gaps = 2/281 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
              AA +L++    A   +A NF  +    WG    +IL NG LLTLSLD+ASGSGF+S N+
Sbjct  152   TAALLLIMVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNE  211

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGK
Sbjct  212   YLFGKIDMQLKLVPGNSAGTVTAYYLSSNGSTWDEIDFEFLGNLSGDPYILHTNVFSQGK  271

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++
Sbjct  272   GNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIF  331

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWL  394
             SSLW+A+DWATRGGLVKTDW+QAPF ASYRN++A  ACV+   +SS +S + +   N WL
Sbjct  332   SSLWNADDWATRGGLVKTDWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWL  391

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             S+ LD + Q+R+KWVQ NYMIYNYC+DAKRFPQGFPPEC++
Sbjct  392   SEELDSTSQERLKWVQSNYMIYNYCSDAKRFPQGFPPECTM  432



>ref|XP_002274858.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Vitis vinifera]
Length=296

 Score =   403 bits (1035),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             + GN   +    WG    KIL NGQLLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  27    SVGNLYQDFDLTWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  86

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  87    SAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  146

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  147   FHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLV  206

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQSLDISGQQRIKWV  349
             KTDWSQAPF ASYRN++A ACV+ S SS+ S T   S +    W SQ LD + Q+R+KWV
Sbjct  207   KTDWSQAPFTASYRNFNANACVWSSGSSSCSSTSPSSTSTNSGWYSQELDSTSQERMKWV  266

Query  348   QKNYMIYNYCTDAKRFPQGFPPECS  274
             QKNYMIYNYCTD KRFPQG  PEC+
Sbjct  267   QKNYMIYNYCTDTKRFPQGLSPECT  291



>gb|KCW78734.1| hypothetical protein EUGRSUZ_C00178 [Eucalyptus grandis]
Length=336

 Score =   404 bits (1039),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 196/278 (71%), Positives = 231/278 (83%), Gaps = 3/278 (1%)
 Frame = -3

Query  1092  LLLTTLS-AAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             LLL  +S A   +A NF  +    WG    +IL NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  59    LLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFG  118

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  119   KIDMQLKLVPGNSAGTVTAYYLSSNGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  178

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++SSLW
Sbjct  179   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESVGVPFPKAQPMRIFSSLW  238

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDW+QAPF ASYRN++A  ACV+   +SS +S + +   N WL++ L
Sbjct  239   NADDWATRGGLVKTDWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWLAEEL  298

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWVQ NYMIYNYCTDAKRFPQGFPPECS++
Sbjct  299   DSTSQERLKWVQSNYMIYNYCTDAKRFPQGFPPECSMS  336



>ref|XP_007014171.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31790.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   402 bits (1034),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 234/282 (83%), Gaps = 5/282 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAG--NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             +ILL++ +    +AA   NF  +    WG   GKI  NG++LTLSLD+ASGSGF+S ++Y
Sbjct  9     YILLMSLVMGCLMAASASNFYQDFDITWGDGRGKIDNNGEVLTLSLDKASGSGFQSKDEY  68

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLV GNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG
Sbjct  69    LFGKIDMQLKLVHGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKG  128

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPT DFHTYSILWN Q IIFSVDGTPIR+FKNME+ G+PFPK+QPM +YS
Sbjct  129   NREQQFYLWFDPTADFHTYSILWNSQRIIFSVDGTPIREFKNMESLGVPFPKNQPMRIYS  188

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWL  394
             SLW+A+DWATRGGLVKTDW+QAPF ASYR ++A ACV+ + +    ++S + + + N WL
Sbjct  189   SLWNADDWATRGGLVKTDWTQAPFTASYREFNANACVWSNGASSCKSNSPSSSSTNNAWL  248

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             SQ LD + QQR++WVQKNYMIYNYCTDAKRFPQG PPEC+++
Sbjct  249   SQELDSTSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>gb|ACD03219.1| xyloglucan endotransglucosylase/hydrolase 9 [Actinidia hemsleyana]
Length=282

 Score =   402 bits (1033),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LL  +L    + A NF       WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++G
Sbjct  9     LLLFVSLLMCSLVACNFNQHFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFG  68

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  69    KIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  128

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFY+WFDPT DFHTYSILWNPQ IIFSVDGTP+R+FKN E+ G+ +PKDQ M +YSSLW
Sbjct  129   QQFYVWFDPTADFHTYSILWNPQRIIFSVDGTPMREFKNSESIGVSYPKDQAMRIYSSLW  188

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDI  376
             +A+DWATRGGLVKTDW+ APF ASYRN++A ACV+ S +S+ S +   + N WL + LD 
Sbjct  189   NADDWATRGGLVKTDWTHAPFTASYRNFNANACVWSSGASSCSSSS--TDNAWLQEELDW  246

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             + Q+R++WVQKNYMIYNYCTD KRFPQG PPECS
Sbjct  247   TSQERLQWVQKNYMIYNYCTDLKRFPQGLPPECS  280



>ref|XP_003595145.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES65396.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|KEH37468.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=294

 Score =   402 bits (1034),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/283 (67%), Positives = 232/283 (82%), Gaps = 5/283 (2%)
 Frame = -3

Query  1113  GGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRST  934
             G +  F+LL+ T      +AGNF+ +    WG+   K+LENGQ L+L+LD++SGSGFRS 
Sbjct  5     GDIGLFLLLVATFLVYA-SAGNFMKDFEITWGESRAKVLENGQSLSLTLDKSSGSGFRSK  63

Query  933   NQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQ  754
              +Y++GKIDM++KLV GNSAG VT YYLSSLGSTHDEIDFEFLGNLSGDPY+LHTNVFTQ
Sbjct  64    YEYLFGKIDMQLKLVAGNSAGIVTAYYLSSLGSTHDEIDFEFLGNLSGDPYILHTNVFTQ  123

Query  753   GKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMW  574
             GKG REQQFYLWFDPTKDFHTYS+ WNP+SIIFSVDG PIR+FKN+E+ G+PFPK+Q M 
Sbjct  124   GKGNREQQFYLWFDPTKDFHTYSLRWNPKSIIFSVDGRPIREFKNLESKGVPFPKNQAMR  183

Query  573   MYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY----GSASSTSSCTKNPSA  406
             +YSSLW+A++WATRGG+VKTDW+ APFIASYRN++A+AC++     S SS  S   + ++
Sbjct  184   IYSSLWNADNWATRGGIVKTDWTNAPFIASYRNFNAKACIWTSSGSSCSSNKSPLSSSTS  243

Query  405   NPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
               WL +SLD  G ++I+WVQKNYMIYNYCTD KRFPQGFP EC
Sbjct  244   QSWLRESLDSKGIRKIRWVQKNYMIYNYCTDYKRFPQGFPAEC  286



>ref|XP_003549488.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Glycine max]
Length=287

 Score =   402 bits (1033),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/276 (70%), Positives = 221/276 (80%), Gaps = 4/276 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             L L +      AAGN   +    WG    KIL N  LLTLSLD+ASGSGF+S N+Y+YGK
Sbjct  9     LALVSFYIVVCAAGNLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLYGK  68

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  69    IDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  128

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK QPM +YSSLW+
Sbjct  129   QFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWN  188

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYG----SASSTSSCTKNPSANPWLSQS  385
             A+DWATRGGL+KTDWS+APF ASYRN++A ACV+     S  S SS +     N WLSQ 
Sbjct  189   ADDWATRGGLIKTDWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQE  248

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             LD + QQR++WVQKNY+IYNYCTD KRFPQG P EC
Sbjct  249   LDSTAQQRLRWVQKNYLIYNYCTDNKRFPQGLPLEC  284



>ref|XP_010103016.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
 ref|XP_010103017.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
 gb|EXB94583.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
 gb|EXB94584.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
Length=289

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 228/279 (82%), Gaps = 4/279 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +L +  + A   +  N   +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++G
Sbjct  10    VLFVLCIFAIAFSEANLNKDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFG  69

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             +IDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY++HTNVF+QGKG RE
Sbjct  70    QIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYIIHTNVFSQGKGNRE  129

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYS+LWNPQ I+FSVDGTPIR+FKN+E+ G+P+PK+QPM +YSSLW
Sbjct  130   QQFYLWFDPTADFHTYSVLWNPQQIVFSVDGTPIRKFKNLESKGVPYPKNQPMRIYSSLW  189

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY----GSASSTSSCTKNPSANPWLSQ  388
             +A+DWATRGGLVKTDWSQAPF ASYRN+ A ACV+     S SS S+ +    AN WLSQ
Sbjct  190   NADDWATRGGLVKTDWSQAPFTASYRNFKANACVFSSGASSCSSHSASSSTSGANSWLSQ  249

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD +G++++KWVQKNYMIYNYCTDAKRFPQG P EC +
Sbjct  250   ELDSAGEEKLKWVQKNYMIYNYCTDAKRFPQGTPQECKI  288



>ref|XP_003542156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Glycine max]
Length=285

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 228/276 (83%), Gaps = 2/276 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +L+ T +    IA AGNF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++
Sbjct  8     LLICTVIGYFVIASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLF  67

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G+T DEIDFEFLGNLSG+PY+LHTNVF+QGKG R
Sbjct  68    GKIDMQLKLVPGNSAGTVTAYYLSSKGATWDEIDFEFLGNLSGEPYILHTNVFSQGKGNR  127

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQFYLWFDPT DFHTYSILWNPQ I+FSVDG+PIR+FKNME+ G+PFPK+Q M +YSSL
Sbjct  128   EQQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMRIYSSL  187

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS-STSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDW+QAPF ASYRN++A AC   S + S  S   + S N WLS+ L
Sbjct  188   WNADDWATRGGLVKTDWTQAPFTASYRNFNANACTVSSGTSSCGSNNPSSSNNAWLSEEL  247

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q+R+KW+QKNYMIYNYC+D +RFPQG PPEC+
Sbjct  248   DSTNQERLKWLQKNYMIYNYCSDTQRFPQGLPPECN  283



>emb|CAN74784.1| hypothetical protein VITISV_032594 [Vitis vinifera]
Length=295

 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/278 (69%), Positives = 229/278 (82%), Gaps = 5/278 (2%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAA--GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             +LL++ L  + + A  GN   +    WG    KIL+NGQLLTLSLD+ SGSGF+S N+YM
Sbjct  13    LLLVSVLFGSLVIASVGNLHKDFDITWGDGRAKILDNGQLLTLSLDKTSGSGFQSKNEYM  72

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG 
Sbjct  73    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGN  132

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPT DFH+YSILWNPQ IIFSVDGTPIR+FKN E+ G+P+PK+QPM +YSS
Sbjct  133   REQQFYLWFDPTADFHSYSILWNPQRIIFSVDGTPIREFKNSESIGVPYPKNQPMRIYSS  192

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY---GSASSTSSCTKNPSANPWLS  391
             LW+A+DWATRGGLVKTDW QAPF ASYRN++A AC++    S+ S+++ +   ++  W S
Sbjct  193   LWNADDWATRGGLVKTDWXQAPFTASYRNFNADACIWSSGASSCSSTTPSSTSTSGQWYS  252

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             Q LD + Q+R+KWVQKNYMIYNYCTD KRFPQG PPEC
Sbjct  253   QELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPEC  290



>ref|XP_008801540.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=267

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 185/263 (70%), Positives = 217/263 (83%), Gaps = 1/263 (0%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGN        WG    KI+ENGQLLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  5     SAGNLDQNFQITWGDGRAKIIENGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  64

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF QGKG +E QF+LWFDPTKD
Sbjct  65    SAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFAQGKGNKEMQFHLWFDPTKD  124

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNP+ IIF VDG PIR FKNME+ G+ FPK+QPM +YSSLW+A+DWAT+GG +
Sbjct  125   FHTYSILWNPRHIIFMVDGMPIRDFKNMESKGVAFPKNQPMRIYSSLWNADDWATQGGRI  184

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             KTDW++APF ASYRN++A ACV+ S +S     K+ SA  W +Q LD + QQR++WVQKN
Sbjct  185   KTDWAKAPFTASYRNFNADACVWSSGASNCPSKKSNSAG-WWNQELDSTSQQRMRWVQKN  243

Query  339   YMIYNYCTDAKRFPQGFPPECSL  271
             YMIYNYCTD KRFPQG PPECS+
Sbjct  244   YMIYNYCTDLKRFPQGLPPECSI  266



>ref|XP_010536923.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=289

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/278 (69%), Positives = 221/278 (79%), Gaps = 5/278 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGI----AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             +LL  L  AG+       NF   +   WG   G+I  NG+LLTLSLDRASGSGF+S N+Y
Sbjct  10    MLLLPLLVAGVLLSSVHANFYQNVEITWGDGRGQINNNGELLTLSLDRASGSGFQSKNEY  69

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG
Sbjct  70    LFGKIDMQIKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKG  129

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G+ FPK QPM MYS
Sbjct  130   NREQQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGVLFPKSQPMRMYS  189

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTS-SCTKNPSANPWLSQ  388
             SLW+A+DWATRGGLVKTDWSQAPF ASYR ++  ACV+ +  ST  + +   ++  WLSQ
Sbjct  190   SLWNADDWATRGGLVKTDWSQAPFTASYRGFNEDACVWSNGKSTCPNGSSQGTSGSWLSQ  249

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              LD +GQ+R++WVQ+N+MIYNYC D KRFPQG P EC+
Sbjct  250   ELDTTGQERMRWVQRNFMIYNYCADTKRFPQGVPRECT  287



>ref|XP_004507927.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=284

 Score =   401 bits (1031),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/275 (71%), Positives = 226/275 (82%), Gaps = 1/275 (0%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
              LL         A NF  +    WG   GKI  NG+LLTLSLD+ASGSGF+S +QY++GK
Sbjct  9     FLLIAFLVEATFASNFYQDFNIKWGDGRGKIFNNGKLLTLSLDKASGSGFQSKSQYLFGK  68

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM+IKLVPGNSAGTVTTYYLSSLG  HDEIDFEFLGNLSGDPY++HTN++T GKG REQ
Sbjct  69    IDMQIKLVPGNSAGTVTTYYLSSLGDAHDEIDFEFLGNLSGDPYIVHTNIYTLGKGNREQ  128

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPTKDFHTYSILWNP SII+ VDGTPIR+FKN+E+ GIPFP  Q M +YSSLWD
Sbjct  129   QFYLWFDPTKDFHTYSILWNPLSIIYYVDGTPIREFKNLESKGIPFPSSQAMSIYSSLWD  188

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN-PWLSQSLDI  376
             A++WATRGGLVKTDW++APF ASY N++ QACV+ S+S +S  +KNPS+N  WL QSLD 
Sbjct  189   ADNWATRGGLVKTDWAKAPFTASYSNFNIQACVWTSSSGSSCSSKNPSSNQSWLKQSLDS  248

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             +GQ RI+WVQK+YMIYNYCTD KRFPQG PPEC L
Sbjct  249   TGQARIRWVQKHYMIYNYCTDTKRFPQGLPPECPL  283



>ref|XP_009394877.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   401 bits (1031),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 221/280 (79%), Gaps = 5/280 (2%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LL ++L+     A  F  +    WG    KIL NGQLLTLSLDR SGSGF+S  ++++G
Sbjct  7     LLLCSSLAMTMAVAATFYQDFDLTWGDGRAKILNNGQLLTLSLDRTSGSGFQSKKEFLFG  66

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNL+GDPY LHTNV+TQGKG RE
Sbjct  67    KIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLTGDPYTLHTNVYTQGKGNRE  126

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
              QF LWFDPTKDFH YS+LWNP+ +IF VDGTPIR FKN+E+ GIPFPK+QPM +YSSLW
Sbjct  127   MQFKLWFDPTKDFHAYSVLWNPRHVIFMVDGTPIRDFKNLESRGIPFPKNQPMRIYSSLW  186

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP-----WLS  391
             +A+DWATRGGLVKT+W+ APF ASYRN++A ACV+ S  S+ +   + SA P     W S
Sbjct  187   NADDWATRGGLVKTNWNNAPFTASYRNFNADACVWSSGISSCAPRNSSSAVPAAARGWWS  246

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q LD   Q R++WVQKNYMIY+YCTD KRFPQGFPPECS+
Sbjct  247   QELDTPSQDRMRWVQKNYMIYHYCTDLKRFPQGFPPECSM  286



>ref|XP_010046993.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046995.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78736.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78737.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78738.1| hypothetical protein EUGRSUZ_C00181 [Eucalyptus grandis]
Length=291

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/278 (70%), Positives = 228/278 (82%), Gaps = 2/278 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LLL    AA   A NF  +    WG    +IL +G LLTLSLD+ASGSGF+S N+Y++G
Sbjct  14    LLLLVVSWAASAFARNFYQDFDITWGDGRAQILNSGDLLTLSLDKASGSGFQSKNEYLFG  73

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  74    KIDMQLKLVPGNSAGTVTAYYLSSNGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  133

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++SSLW
Sbjct  134   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIFSSLW  193

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACV-YGSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDW+QAPF ASYRN++A  ACV    +SS +S + +   N WLS+ L
Sbjct  194   NADDWATRGGLVKTDWTQAPFTASYRNFNADNACVSSSGSSSCTSSSSSSDGNAWLSEEL  253

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWVQ NYMIYNYCTDAKRFPQG PPEC+++
Sbjct  254   DSTSQERLKWVQSNYMIYNYCTDAKRFPQGVPPECTMS  291



>ref|NP_001237075.1| syringolide-induced protein 19-1-5 precursor [Glycine max]
 dbj|BAB86890.1| syringolide-induced protein 19-1-5 [Glycine max]
 gb|KHN17580.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   401 bits (1030),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/276 (69%), Positives = 229/276 (83%), Gaps = 3/276 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             LL+ T+    IA AGNF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++G
Sbjct  8     LLICTVGYFVIASAGNFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFG  67

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G+T DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  68    KIDMQLKLVPGNSAGTVTAYYLSSKGATWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  127

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ I+FSVDG+PIR+FKNME+ G+PFPK+Q M +YSSLW
Sbjct  128   QQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMRIYSSLW  187

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY--GSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDW+QAPF ASYRN++A AC    G++S  S+   + + N WLS+ L
Sbjct  188   NADDWATRGGLVKTDWTQAPFTASYRNFNANACTMSSGTSSCGSNNPSSSNNNVWLSEEL  247

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q+R+KWVQKNYMIYNYC+D +RFPQG P EC+
Sbjct  248   DSTDQERLKWVQKNYMIYNYCSDTQRFPQGLPSECN  283



>ref|XP_010259797.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=290

 Score =   401 bits (1030),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 228/280 (81%), Gaps = 7/280 (3%)
 Frame = -3

Query  1101  AFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             A +++L++L+ + ++ GNF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+++
Sbjct  13    ACLVILSSLTVSALS-GNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEFL  71

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG 
Sbjct  72    FGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGN  131

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPT DFHTYSILWNPQ I+FSVDG PIR+F N E+ G+PFPK QPM +YSS
Sbjct  132   REQQFYLWFDPTADFHTYSILWNPQRIVFSVDGIPIREFNNSESIGVPFPKSQPMRIYSS  191

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS-----STSSCTKNPSANPW  397
             LW+A+DWATRGGLVKTDW+QAPF ASYRN+ A AC++ S +      + S T N +A  W
Sbjct  192   LWNADDWATRGGLVKTDWTQAPFTASYRNFKADACIWSSGASSCDSRSPSSTSNANA-WW  250

Query  396   LSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             LSQ LD + Q+R+ WVQKNYMIYNYCTD KRFPQG P EC
Sbjct  251   LSQELDSTSQERMGWVQKNYMIYNYCTDTKRFPQGLPLEC  290



>ref|XP_009390493.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=275

 Score =   400 bits (1029),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 222/279 (80%), Gaps = 5/279 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +A   +L      A  AAGN   +    WG    KIL NGQLLTLSLD+ SGSGF+S N+
Sbjct  1     MAVLFVLGLCALVAVAAAGNLYQDFDVTWGDGRAKILNNGQLLTLSLDKTSGSGFQSKNE  60

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVFTQGK
Sbjct  61    YLFGKIDMQIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGK  120

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G RE QF LWFDPT+DFHTYSILWNP+ +IF VDGTPIR FKN+E+ GI FPK+QPM +Y
Sbjct  121   GNREMQFKLWFDPTEDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPKNQPMRIY  180

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWS+APF+ASYRN++A ACV GS+    S     + + W +Q
Sbjct  181   SSLWNADDWATRGGLVKTDWSKAPFVASYRNFNADACVRGSSKCGGS-----TKSGWWNQ  235

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD+S Q R++WVQKNYMIYNYC DAKRFPQG PPEC++
Sbjct  236   ELDLSSQGRMRWVQKNYMIYNYCNDAKRFPQGLPPECAI  274



>ref|XP_010046997.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   401 bits (1030),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 195/278 (70%), Positives = 229/278 (82%), Gaps = 3/278 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             LLL  +S    A A NF  +    WG    +IL NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  14    LLLVVVSWGTFASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFG  73

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  74    KIDMQLKLVPGNSAGTVTAYYLSSNGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  133

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK QPM ++SSLW
Sbjct  134   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIFSSLW  193

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDW+QAPF ASYRN++A  ACV+   +SS +S + +   N WL++ L
Sbjct  194   NADDWATRGGLVKTDWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWLAEEL  253

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWVQ NYMIYNYCTDAKRFPQGFPPECS++
Sbjct  254   DSTSQERLKWVQSNYMIYNYCTDAKRFPQGFPPECSMS  291



>gb|KHN17579.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   401 bits (1030),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 221/276 (80%), Gaps = 4/276 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             L L +      AAGN   +    WG    KIL N  LLTLSLD+ASGSGF+S N+Y++GK
Sbjct  9     LALVSFYIVVCAAGNLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLFGK  68

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  69    IDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  128

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK QPM +YSSLW+
Sbjct  129   QFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWN  188

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYG----SASSTSSCTKNPSANPWLSQS  385
             A+DWATRGGL+KTDWS+APF ASYRN++A ACV+     S  S SS +     N WLSQ 
Sbjct  189   ADDWATRGGLIKTDWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQE  248

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             LD + QQR++WVQKNY+IYNYCTD KRFPQG P EC
Sbjct  249   LDSTAQQRLRWVQKNYLIYNYCTDNKRFPQGLPLEC  284



>ref|XP_004507835.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=293

 Score =   401 bits (1030),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 186/278 (67%), Positives = 225/278 (81%), Gaps = 3/278 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +L+ + +     A GN        WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++G
Sbjct  15    LLVSSLMGMVVFANGNLNQHFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFG  74

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G+T DEID+EFLGN+SG+PY+LHTNVF+QGKG RE
Sbjct  75    KIDMQLKLVPGNSAGTVTAYYLSSKGATWDEIDYEFLGNVSGEPYILHTNVFSQGKGNRE  134

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSI+WNPQ IIFSVDGTPIR+FKN E  G+PFPK QPM +YSSLW
Sbjct  135   QQFYLWFDPTADFHTYSIIWNPQRIIFSVDGTPIREFKNSETIGVPFPKKQPMRIYSSLW  194

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQS  385
             +A+DWATRGGLVKTDW+QAPF ASYRN++A+AC++ S +S+   +    A+    W SQ 
Sbjct  195   NADDWATRGGLVKTDWTQAPFTASYRNFNAEACIWSSGASSCGSSSVSDASAKGSWFSQE  254

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD++GQ R+KWVQKNYMIYNYC D KRFPQG PPEC++
Sbjct  255   LDVTGQGRLKWVQKNYMIYNYCNDTKRFPQGLPPECNI  292



>ref|XP_007014183.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31802.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=296

 Score =   401 bits (1030),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 228/285 (80%), Gaps = 6/285 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             V+  +L+   +SA+ IA AGNF  +    WG    +IL NG+LLTLSLD+ASGSGF+S N
Sbjct  10    VSLTLLISVCVSASIIASAGNFYQDFDITWGDGRAQILNNGELLTLSLDKASGSGFQSKN  69

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             ++++GKI M++KLVPGNSAGTVT YYL S GS  DEIDFEFLGNLSGDPY+LHTNVF+ G
Sbjct  70    EFLFGKIGMQLKLVPGNSAGTVTAYYLRSEGSAWDEIDFEFLGNLSGDPYILHTNVFSLG  129

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT  FHTYSILWNPQ IIFSVDGTPIR+FKN+E+ G+PFPK+QPM +
Sbjct  130   KGDREQQFYLWFDPTAAFHTYSILWNPQRIIFSVDGTPIREFKNLESMGVPFPKNQPMRI  189

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSC----TKNPSAN  403
              SSLW+A+DWATRGGLVKTDWSQAPF A+YRN+SA AC+  S  S S C        + N
Sbjct  190   QSSLWNADDWATRGGLVKTDWSQAPFTATYRNFSADACIRSSGQS-SVCNSNSPAANNNN  248

Query  402   PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              WLS+ LD + Q+R+KWVQKNYMIYNYC+D KRFPQG PPEC+ N
Sbjct  249   AWLSEELDSTAQERLKWVQKNYMIYNYCSDTKRFPQGLPPECAAN  293



>ref|XP_002532673.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF29701.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=258

 Score =   399 bits (1026),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/241 (78%), Positives = 213/241 (88%), Gaps = 3/241 (1%)
 Frame = -3

Query  984  LLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFL  805
             L LS   A+ +GFRS NQY++GKIDM++KLVPGNSAGTVT YYLSS+GSTHDEIDFEFL
Sbjct  17   FLALSFLVAATAGFRSKNQYLFGKIDMQLKLVPGNSAGTVTAYYLSSIGSTHDEIDFEFL  76

Query  804  GNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQF  625
            GNLSGDPY+LHTNVFTQGKG REQQFYLWFDPTKDFH YSILWNPQSIIF VD TPIR+F
Sbjct  77   GNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKDFHAYSILWNPQSIIFFVDNTPIREF  136

Query  624  KNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGS  445
            KN+E++GIPFPK QPMW+YSSLW+AEDWATRGGLVKTDWSQAPF+ASYRN+SAQAC++ S
Sbjct  137  KNLESNGIPFPKSQPMWIYSSLWNAEDWATRGGLVKTDWSQAPFVASYRNFSAQACIWSS  196

Query  444  ASSTSSCTKNPSA---NPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
            + S SS   + S+   NPWL+QSLD +G  RIKWVQ+NYMIYNYCTD KRFPQG PPECS
Sbjct  197  SGSGSSSCSSNSSSSDNPWLTQSLDTTGHARIKWVQQNYMIYNYCTDTKRFPQGLPPECS  256

Query  273  L  271
            L
Sbjct  257  L  257



>gb|ACD03232.1| xyloglucan endotransglucosylase/hydrolase 8 [Malus domestica]
Length=289

 Score =   400 bits (1029),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 191/275 (69%), Positives = 224/275 (81%), Gaps = 2/275 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             + L +   A  +A +   +    WG    KIL NG+LLTLSLD+ASGSGF+S ++Y++GK
Sbjct  13    IFLLSFVVAPASAADLNQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKHEYLFGK  72

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  73    IDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  132

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWN Q IIFSVDGTPIR+FKN E++G+PFPK QPM +YSSLW+
Sbjct  133   QFYLWFDPTADFHTYSILWNSQRIIFSVDGTPIREFKNQESNGVPFPKSQPMRIYSSLWN  192

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN--PWLSQSLD  379
             A+DWATRGGLVKTDWSQAPF ASYRN+SA+ACV+ S +S+ S   + +AN   WLSQ LD
Sbjct  193   ADDWATRGGLVKTDWSQAPFTASYRNFSAEACVWTSGASSCSSATSSNANNGAWLSQDLD  252

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              + Q R+KWVQ NYMIYNYC D KRFPQG P EC+
Sbjct  253   STSQDRLKWVQTNYMIYNYCADTKRFPQGLPVECT  287



>ref|XP_009417487.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=275

 Score =   400 bits (1027),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/276 (68%), Positives = 221/276 (80%), Gaps = 6/276 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+LL++++ A  IA+  F       WG+ H K L+NGQLLTLSLD+ASG+GF+S ++Y++
Sbjct  5     FLLLVSSMVA--IASAGFPQNFDITWGEGHAKFLDNGQLLTLSLDKASGAGFQSKDEYLF  62

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM+IKLVPGNSAGTVT YYLSS G  HDEIDFEFLGNLSGDPY LHTNVF QGKG R
Sbjct  63    GKIDMQIKLVPGNSAGTVTAYYLSSEGPAHDEIDFEFLGNLSGDPYTLHTNVFAQGKGNR  122

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             E QF LWFDPTK FHTYSILWNP+ IIF VDGTPIR FKN+E+ G+ FPKDQPM +YSSL
Sbjct  123   EMQFKLWFDPTKQFHTYSILWNPRHIIFMVDGTPIRDFKNLESRGVAFPKDQPMRIYSSL  182

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDW++APF+ASYRN++A ACV   AS  S C    S   W +Q LD
Sbjct  183   WNADDWATRGGLVKTDWTKAPFVASYRNFNADACV--PASGRSRCDSANSG--WWNQELD  238

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              +   R++WVQKNYMIYNYC D KRFPQG PPECS+
Sbjct  239   SASHARMRWVQKNYMIYNYCNDVKRFPQGLPPECSI  274



>ref|XP_004507837.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=285

 Score =   400 bits (1028),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 221/279 (79%), Gaps = 1/279 (0%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
              AF+L L +  A   AA NF  +    WG    KIL N QLLTLSLD+ASGSGF+S NQY
Sbjct  6     VAFLLFLISTVAIASAANNFYQDFQITWGDGRAKILNNDQLLTLSLDKASGSGFQSKNQY  65

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLV GNSAGTVT YYLSS G   DEIDFEFLGNLSG PY LHTNVF+QGKG
Sbjct  66    LFGKIDMQLKLVSGNSAGTVTAYYLSSKGGAWDEIDFEFLGNLSGQPYTLHTNVFSQGKG  125

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF+LWFDPT DFHTYSILWNPQ I+F VDGTPIR+FKNME++G+PFPK+QPM +YS
Sbjct  126   NREQQFHLWFDPTADFHTYSILWNPQQIVFYVDGTPIREFKNMESNGVPFPKNQPMRIYS  185

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA-NPWLSQ  388
             SLW+A+DWATRGGLVKTDWS+APF ASYRN++A AC + S  S+ S +   +  N W S+
Sbjct  186   SLWNADDWATRGGLVKTDWSKAPFTASYRNFNANACTWSSGKSSCSSSTQSNTNNAWFSE  245

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD S  +R+KWVQKNYMIYNYCTD KRFPQG P EC +
Sbjct  246   ELDSSSHERLKWVQKNYMIYNYCTDIKRFPQGLPQECKM  284



>ref|XP_010670334.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   399 bits (1026),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 227/285 (80%), Gaps = 3/285 (1%)
 Frame = -3

Query  1119  GGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFR  940
              G    AF+L  + ++ A  +AGNF  +    WG   GKI+ NGQLLTLSLD+ SGSGF+
Sbjct  2     AGTKTIAFLLFASFIAIA--SAGNFYKDFDITWGDGRGKIINNGQLLTLSLDKTSGSGFQ  59

Query  939   STNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVF  760
             S N+Y++GKIDM++KLV GNSAGTVT YYLSS G++HDEIDFEFLGN+SG PY LHTNVF
Sbjct  60    SKNEYLFGKIDMQLKLVGGNSAGTVTAYYLSSQGASHDEIDFEFLGNVSGQPYTLHTNVF  119

Query  759   TQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQP  580
             +QGKGGREQQF LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+QP
Sbjct  120   SQGKGGREQQFRLWFDPTTDFHTYSILWNPQRIIFSVDGTPIREFKNSESMGMPFPKNQP  179

Query  579   MWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA-N  403
             M +YSSLW+A+DWAT+GG VKTDWS+APF ASYRN++A ACV+    S+   +   S  N
Sbjct  180   MRIYSSLWNADDWATQGGRVKTDWSKAPFTASYRNFNANACVWSKGKSSCKSSSVASKIN  239

Query  402   PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             PW +Q +D + Q R+KWVQKNYMIYNYCTD +RFPQG P EC +N
Sbjct  240   PWFTQEMDSTSQARMKWVQKNYMIYNYCTDRQRFPQGLPKECRVN  284



>ref|XP_008796499.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Phoenix dactylifera]
Length=280

 Score =   399 bits (1025),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 221/273 (81%), Gaps = 6/273 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             L+LTTL  A  A+ NF+ ++   WG   GKILENG LL LSLD+ASGSGF+S  +Y++ +
Sbjct  11    LILTTLVVA--ASANFLADVDLTWGSGRGKILENGNLLQLSLDKASGSGFQSKQEYLFAR  68

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             +DM++KLVPGNSAGTVTT YLSS GSTHDEIDFEFLGNLSG PY LHTN++TQGKG REQ
Sbjct  69    MDMRMKLVPGNSAGTVTTLYLSSQGSTHDEIDFEFLGNLSGQPYTLHTNIYTQGKGDREQ  128

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QF+LWFDP  DFHTYSILWNPQ I+F VDGTPIR F+NMEA G+P+PK+QPM +YSSLW+
Sbjct  129   QFHLWFDPRMDFHTYSILWNPQQILFYVDGTPIRVFRNMEAKGVPYPKNQPMRLYSSLWN  188

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDIS  373
             A+DWAT GG VKTDWSQAPF+ASYR +SA ACV+    ST S +K      W +QSLD  
Sbjct  189   ADDWATMGGRVKTDWSQAPFVASYRGFSADACVWAGGKSTCSASK----GTWWAQSLDSP  244

Query  372   GQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             G Q++KWV++ YMIY+YC D KRFPQGFPPECS
Sbjct  245   GAQKLKWVRQKYMIYDYCKDPKRFPQGFPPECS  277



>ref|XP_010667998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   399 bits (1026),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/276 (67%), Positives = 227/276 (82%), Gaps = 2/276 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             IL++ +L+AA  AA  F       WG    KIL+NGQLLTLSLD+ SGSGF+S NQY++G
Sbjct  12    ILVVVSLTAAASAASGFNQNFDITWGDGRAKILKNGQLLTLSLDKTSGSGFQSKNQYLFG  71

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+IKLVPGNSAGTVT YYLSS G THDE+DFEFLGN++G PY LHTN+FT+GKGGRE
Sbjct  72    KIDMQIKLVPGNSAGTVTAYYLSSQGPTHDEVDFEFLGNVTGQPYTLHTNIFTEGKGGRE  131

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQF LWFDPT DFHTYS+LWNPQ IIFSVDGTPIR++KN+E+ G+ FPK Q M +YSSLW
Sbjct  132   QQFRLWFDPTTDFHTYSVLWNPQRIIFSVDGTPIREYKNLESVGVLFPKKQAMRIYSSLW  191

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDI  376
             DAEDWAT+GG +KTDW++APF+ASYRN++A ACV+  ++  SSC  + S + W++Q LD 
Sbjct  192   DAEDWATQGGRIKTDWNKAPFMASYRNFNANACVW--SNGKSSCRGSGSISAWMNQQLDN  249

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             + QQR++WVQKN+MIYNYCTD +RFPQG P EC +N
Sbjct  250   TNQQRLRWVQKNFMIYNYCTDTQRFPQGLPKECKVN  285



>gb|KDO46534.1| hypothetical protein CISIN_1g023431mg [Citrus sinensis]
Length=282

 Score =   399 bits (1025),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 219/275 (80%), Gaps = 3/275 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
               L+L TL  A  +AG+F  +    WG    KIL NGQLLTLSLD+ASGSGF+S N+Y+Y
Sbjct  7     LFLVLGTLMVA--SAGSFYKDFDITWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLY  64

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG R
Sbjct  65    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDR  124

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDP+  FHTYSILWNPQ I+F VDGTPIR+ KN E+ G+PFPK+QPM +YSSL
Sbjct  125   EQQFHLWFDPSAAFHTYSILWNPQRIVFFVDGTPIRELKNSESIGVPFPKNQPMRIYSSL  184

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSASSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDW+ APF ASYRN+ A  ACV+ +  S+ + T   S N WLSQ L
Sbjct  185   WNADDWATRGGLVKTDWTHAPFTASYRNFKANNACVWSNGKSSCASTSFRSRNSWLSQEL  244

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             D + Q R+KWVQKNYMIYNYCTD KRFP+G P EC
Sbjct  245   DSTSQNRLKWVQKNYMIYNYCTDTKRFPRGIPKEC  279



>ref|XP_008801408.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=283

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 223/280 (80%), Gaps = 4/280 (1%)
 Frame = -3

Query  1101  AFILLLTTLS-AAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             AF LLL   S  AG +AGNF  +    WG+   +ILENGQLLTLSLD+ASGSGF+S N+Y
Sbjct  2     AFSLLLLVCSLMAGASAGNFHQDFQITWGEGRAQILENGQLLTLSLDKASGSGFQSKNEY  61

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF  GKG
Sbjct  62    LFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFGLGKG  121

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              RE QF+LWFDPT DFHTYSILWNP+ IIF VD  PIR FKNME+ G+ FP++QPM +YS
Sbjct  122   NREMQFHLWFDPTNDFHTYSILWNPKHIIFMVDDIPIRDFKNMESRGVAFPRNQPMRIYS  181

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WL  394
             SLW+A+DWAT+GG VKTDW+ APF ASYRN+ A AC++ S +S     K+ +A+    W 
Sbjct  182   SLWNADDWATQGGRVKTDWTNAPFTASYRNFHADACIWSSGASNCPAKKSSTASTNSDWW  241

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             +Q LD + Q+R++WVQKNYMIY+YCTD KRFPQG PPECS
Sbjct  242   NQELDSTSQERMRWVQKNYMIYDYCTDLKRFPQGLPPECS  281



>emb|CAN80252.1| hypothetical protein VITISV_036642 [Vitis vinifera]
Length=287

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 225/276 (82%), Gaps = 5/276 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LLL +   A +  GN   +    WG    KIL NG+LLTLSLD+ SGSGF+S N+Y++GK
Sbjct  9     LLLGSFVVASV--GNLXQDFXITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLFGK  66

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  67    IDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  126

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ +PK+QPM +YSSLW+
Sbjct  127   QFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVSYPKNQPMRIYSSLWN  186

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY---GSASSTSSCTKNPSANPWLSQSL  382
             A+DWATRGGLVKTDWSQAPF ASYRN++A AC++    S+ S+++ T   +   W SQ L
Sbjct  187   ADDWATRGGLVKTDWSQAPFTASYRNFNADACIWSSGASSCSSNTPTSTSTNTEWYSQEL  246

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q+R+KWVQKNYMIYNYC+D KRFPQG PPEC+
Sbjct  247   DSTSQERMKWVQKNYMIYNYCSDTKRFPQGLPPECT  282



>ref|XP_007154781.1| hypothetical protein PHAVU_003G147400g [Phaseolus vulgaris]
 gb|ESW26775.1| hypothetical protein PHAVU_003G147400g [Phaseolus vulgaris]
Length=282

 Score =   398 bits (1022),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 226/277 (82%), Gaps = 4/277 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
              +LL++ +    IA A NF  +    WG    KIL NG+LLTLSLD++SGSGF+S N+Y+
Sbjct  6     LVLLISIVGYFLIASAANFYQDFDITWGDGRAKILNNGELLTLSLDKSSGSGFQSKNEYL  65

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +GKIDM++KLVPGNSAGTVT YYLSS G+T DEIDFEFLGNLSGDPY+LHTNVF+QGKG 
Sbjct  66    FGKIDMQLKLVPGNSAGTVTAYYLSSKGATWDEIDFEFLGNLSGDPYILHTNVFSQGKGN  125

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQFYLWFDPT DFHTYSILWNPQ I+FSVDG+PIR+FKNME+ G+PFPK+Q M +YSS
Sbjct  126   REQQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMRIYSS  185

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQAC-VYGSASSTSSCTKNPSANPWLSQS  385
             LW+A+DWATRGGLVKTDWSQAPF ASYRN++A AC V    SS S+   +P  N WLS+ 
Sbjct  186   LWNADDWATRGGLVKTDWSQAPFTASYRNFNANACTVSSGTSSCSNSASSP--NAWLSEE  243

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             LD + Q+++KWVQ NYMIYNYCTD KRFPQ  P EC+
Sbjct  244   LDSTSQEKLKWVQNNYMIYNYCTDTKRFPQALPTECN  280



>dbj|BAE06063.1| xyloglucan endotransglucosylase/hydrolase [Sagittaria pygmaea]
Length=304

 Score =   399 bits (1024),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/303 (63%), Positives = 226/303 (75%), Gaps = 11/303 (4%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAG-------NFINEIGFNWGQDHGKILENG  988
             MA   + H+    + A  +L    SAAG + G       +F N+    WG   GKIL NG
Sbjct  1     MALRPSLHKQFALLVAASVLAFCCSAAGRSVGLAPASPSSFNNDFDITWGDGRGKILNNG  60

Query  987   QLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEF  808
             QLL+LSLD+ SGSGF+S NQY++G IDM++KLVPGNSAGTVT YYLSS G THDEIDFEF
Sbjct  61    QLLSLSLDKTSGSGFQSKNQYLFGNIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEF  120

Query  807   LGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQ  628
             LGN+SG PY LHTNVF+QGKG REQQF LWFDPTKDFHTYSILWNP  I+F VDGTPIR 
Sbjct  121   LGNVSGQPYTLHTNVFSQGKGNREQQFRLWFDPTKDFHTYSILWNPSHIVFYVDGTPIRD  180

Query  627   FKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYG  448
             F+N EA G+PFPK QPM +YSSLW+A+DWAT+GG +KTDW+QAPF ASYR + A AC  G
Sbjct  181   FRNNEARGVPFPKAQPMRIYSSLWNADDWATQGGRIKTDWTQAPFTASYRGFKADACAVG  240

Query  447   SASSTSSC----TKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPE  280
             S  S+S C    T   + N W+ Q LD +GQ+R++WVQ+N+MIYNYCTD  RFPQG P E
Sbjct  241   STGSSSKCAALQTTAGNTNWWIRQELDATGQERMRWVQRNHMIYNYCTDVNRFPQGLPTE  300

Query  279   CSL  271
             CS+
Sbjct  301   CSV  303



>ref|XP_003610153.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92350.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=288

 Score =   398 bits (1022),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 222/268 (83%), Gaps = 3/268 (1%)
 Frame = -3

Query  1068  AGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLV  889
                 AGNF  +    WG    KIL N  LLTLSLD+ASGSGF+S N+Y++GKIDM+IKLV
Sbjct  19    VACVAGNFNKDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLV  78

Query  888   PGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDP  709
             PGNSAGTVT YYLSS G   DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDP
Sbjct  79    PGNSAGTVTAYYLSSKGGAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDP  138

Query  708   TKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRG  529
             T DFHTYSILWNPQ I+FSVDGTPIR+FKNME++G+PFPK+QPM +YSSLW+A+DWATRG
Sbjct  139   TADFHTYSILWNPQRIVFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRG  198

Query  528   GLVKTDWSQAPFIASYRNYSA-QACVY--GSASSTSSCTKNPSANPWLSQSLDISGQQRI  358
             GLVKTDWS+APF ASYRN++A  AC++  G +S  SS   + S+  WLSQ LD +GQQR+
Sbjct  199   GLVKTDWSKAPFTASYRNFNANNACIWNGGKSSCKSSSKPSASSASWLSQQLDSTGQQRL  258

Query  357   KWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             +WVQKNYMIYNYC+D KRFPQG P EC+
Sbjct  259   RWVQKNYMIYNYCSDKKRFPQGLPVECT  286



>ref|NP_001276139.1| uncharacterized protein LOC102661404 precursor [Glycine max]
 gb|ACU20918.1| unknown [Glycine max]
Length=285

 Score =   398 bits (1022),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 189/276 (68%), Positives = 228/276 (83%), Gaps = 3/276 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             LL+ T+    IA AGNF  +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++G
Sbjct  8     LLICTVGYFVIASAGNFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFG  67

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G+T DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  68    KIDMQLKLVPGNSAGTVTAYYLSSKGATWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  127

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ I+FSVDG+PIR+FKNME+ G+PFPK+Q M +YSSLW
Sbjct  128   QQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMRIYSSLW  187

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY--GSASSTSSCTKNPSANPWLSQSL  382
             +A+DW TRGGLVKTDW+QAPF ASYRN++A AC    G++S  S+   + + N WLS+ L
Sbjct  188   NADDWVTRGGLVKTDWTQAPFTASYRNFNANACTMSSGTSSCGSNNPSSSNNNVWLSEEL  247

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q+R+KWVQKNYMIY+YC+D +RFPQG P EC+
Sbjct  248   DSTDQERLKWVQKNYMIYDYCSDTQRFPQGLPSECN  283



>ref|XP_006453413.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
 gb|ESR66653.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
Length=317

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 225/289 (78%), Gaps = 5/289 (2%)
 Frame = -3

Query  1125  HRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSG  946
             H     +    L+L +L AA  +AGNF  +    WG    K+L NG LLTLSLD+ASGSG
Sbjct  31    HMSMASMLHLFLVLGSLMAA--SAGNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSG  88

Query  945   FRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTN  766
             F+S N+Y+YGKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGN SGDPY LHTN
Sbjct  89    FQSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNSSGDPYTLHTN  148

Query  765   VFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKD  586
             VFT GKG REQQF+LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+
Sbjct  149   VFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKN  208

Query  585   QPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA  406
             QPM +YSSLW+A+DWATRGGLVKTDW+ APF ASYRN++A+ACV+ +  S+ +     S 
Sbjct  209   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASST  268

Query  405   N---PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             +    W SQ LD + Q R+KWVQKNYMIYNYCTD KRFPQG P EC ++
Sbjct  269   SSNGAWFSQELDSTNQNRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  317



>gb|KHN24614.1| Brassinosteroid-regulated protein BRU1 [Glycine soja]
Length=316

 Score =   398 bits (1023),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 217/289 (75%), Gaps = 18/289 (6%)
 Frame = -3

Query  1137  LEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRA  958
             + + H     +  F LL+         AG+F  +    WG +  KI ENG LLTLSLDRA
Sbjct  45    ISSYHHQMKNIGLFFLLVVATFVVAATAGSFYQDFEITWGGERAKIYENGNLLTLSLDRA  104

Query  957   SGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYV  778
             SGSGFRS  +Y++GKIDM++KLVPGNSAGTVT YYLSSLG THDEIDFEFLGNLSGDPY 
Sbjct  105   SGSGFRSKKEYLFGKIDMQLKLVPGNSAGTVTAYYLSSLGPTHDEIDFEFLGNLSGDPYT  164

Query  777   LHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIP  598
             LHTNVF+QGKG REQQF+LWFDPTKDFHTYS+ WNP SIIFSVDGTPIR+FKN+E  G+P
Sbjct  165   LHTNVFSQGKGNREQQFHLWFDPTKDFHTYSVQWNPASIIFSVDGTPIREFKNLETKGVP  224

Query  597   FPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTK  418
             FPK QPM +YSSLW+AEDWATRGGLVKTDWS+APF ASYRN+                  
Sbjct  225   FPKSQPMRIYSSLWNAEDWATRGGLVKTDWSKAPFTASYRNF------------------  266

Query  417   NPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             N   +    QSLD +GQ +I+WVQKNYMIYNYCTD +RFPQG PPECS+
Sbjct  267   NSQTSSSTGQSLDATGQAKIRWVQKNYMIYNYCTDIRRFPQGLPPECSI  315



>ref|XP_009798276.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Nicotiana sylvestris]
Length=286

 Score =   397 bits (1020),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 226/293 (77%), Gaps = 11/293 (4%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             MASL A +          L L +L    +A  NF  +    WG    K+L NG+LLTLSL
Sbjct  1     MASLLAQY-------LVFLALCSLQYHSLAYNNFNQDFDVTWGDGRAKVLNNGKLLTLSL  53

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGD  787
             D+ASGSG +S  +Y++G+IDM++KLV GNSAGTVTTYYLSS G+THDEIDFEFLGNLSGD
Sbjct  54    DKASGSGIQSKREYLFGRIDMQLKLVRGNSAGTVTTYYLSSQGATHDEIDFEFLGNLSGD  113

Query  786   PYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS  607
             PY++HTNV+TQGKG +EQQFYLWFDPT  FHTYSILWNPQ+IIF VDGTPIR FKNM++ 
Sbjct  114   PYIIHTNVYTQGKGDKEQQFYLWFDPTAGFHTYSILWNPQTIIFYVDGTPIRAFKNMKSR  173

Query  606   GIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSS  427
             GIP+P  QPM +Y+SLW+A+DWATRGGL+KTDWS APFIAS+RN+ A ACV+      SS
Sbjct  174   GIPYPNKQPMRVYASLWNADDWATRGGLIKTDWSNAPFIASFRNFKANACVW--EFGKSS  231

Query  426   CTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             C  N S NPW  Q LD + Q +++WVQKNYM+YNYCTD KRFPQGFP EC+ N
Sbjct  232   C--NSSTNPWFFQELDSTSQAKLQWVQKNYMVYNYCTDIKRFPQGFPLECNFN  282



>ref|XP_009381589.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Musa acuminata subsp. malaccensis]
Length=282

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/278 (67%), Positives = 222/278 (80%), Gaps = 5/278 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
              AA   L   LS+  +A GNF  ++   WG    KIL++GQLL LSLD+ SGSGF+S NQ
Sbjct  8     TAACFFLALCLSSIALA-GNFYQDVDITWGDARAKILDDGQLLMLSLDKYSGSGFQSRNQ  66

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y+YGK DM++KLVPG+SAGTV T+YLSS G+THDEIDFEFLGNLSGDPYV+HTN++TQGK
Sbjct  67    YLYGKFDMQLKLVPGDSAGTVATFYLSSQGNTHDEIDFEFLGNLSGDPYVVHTNLYTQGK  126

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYS+LWNP+ I+FSVDGTPIR+F+N E++G+P+PK Q M  Y
Sbjct  127   GDREQQFYLWFDPTMDFHTYSVLWNPRHIVFSVDGTPIREFRNRESAGVPYPKSQAMRAY  186

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             +SLWDA+DWATRGGLVKTDWS+APF ASYRNY+A  CV+ S +  SSC     +N W+ Q
Sbjct  187   ASLWDADDWATRGGLVKTDWSKAPFTASYRNYTANGCVWNSGA--SSCAM--GSNSWMWQ  242

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              LD +   R+ WVQKNYMIYNYCTD KRFPQG P EC+
Sbjct  243   ELDSNAMNRLNWVQKNYMIYNYCTDPKRFPQGLPRECN  280



>ref|XP_002274552.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=296

 Score =   397 bits (1020),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/265 (71%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             + GN   ++   WG    KIL+NGQLLTLSLD+ASGSGF+S ++Y++GKIDM++KLVPGN
Sbjct  27    SVGNLYQDLDITWGDGRAKILDNGQLLTLSLDKASGSGFQSQDEYLFGKIDMQLKLVPGN  86

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  87    SAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  146

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYS+LWNPQ IIFSVDGTPIR+FKN E+ G+P+PK+QPM +YSSLW+A+DWATRGGLV
Sbjct  147   FHTYSVLWNPQRIIFSVDGTPIREFKNSESIGVPYPKNQPMRIYSSLWNADDWATRGGLV  206

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQSLDISGQQRIKWV  349
             KTDWS APF ASYRN++A ACV+ S SS+ S     S +    W SQ LD + Q+R+KWV
Sbjct  207   KTDWSLAPFTASYRNFNANACVWSSGSSSCSSNSPSSTSTNGGWYSQELDSTSQERMKWV  266

Query  348   QKNYMIYNYCTDAKRFPQGFPPECS  274
             QKNYMIYNYCTD KRFPQG P EC+
Sbjct  267   QKNYMIYNYCTDTKRFPQGLPLECT  291



>ref|XP_006474159.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X2 [Citrus sinensis]
Length=286

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 223/279 (80%), Gaps = 5/279 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
               L+L +L AA  +AGNF  +    WG    K+L NG LLTLSLD+ASGSGF+S N+Y+Y
Sbjct  9     LFLVLGSLMAA--SAGNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGFQSKNEYLY  66

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGN SGDPY LHTNVFT GKG R
Sbjct  67    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNSSGDPYTLHTNVFTNGKGDR  126

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+PFPK+QPM +YSSL
Sbjct  127   EQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSL  186

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQ  388
             W+A+DWATRGGLVKTDW+ APF ASYRN++A+ACV+ +     +++S +   S   W SQ
Sbjct  187   WNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASSTSSNGAWFSQ  246

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD + Q R+KWVQKNYMIYNYCTD KRFPQG P EC +
Sbjct  247   ELDSTNQSRLKWVQKNYMIYNYCTDTKRFPQGLPAECRI  285



>dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
Length=281

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/278 (65%), Positives = 226/278 (81%), Gaps = 3/278 (1%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             + F+L+ TTL  + +A  NF +E    +G    ++L NG  LTLSLD+ SGSGFRS N+Y
Sbjct  5     SIFLLIATTLVGSTLA--NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSKNEY  62

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAG+VTTYYLSSLG THDEIDFEFLGN++G+PY LHTNVF QGKG
Sbjct  63    LFGKIDMQIKLVPGNSAGSVTTYYLSSLGPTHDEIDFEFLGNVTGEPYTLHTNVFAQGKG  122

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF+LWFDPT +FHTYSILWNPQ I+FSVDG P+R+FKNME+ G+ FPK+QPM +YS
Sbjct  123   NREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPMRVYS  182

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWAT+GG VK DWS+APF+AS++ Y+A ACV+GS SST        +N WL++ 
Sbjct  183   SLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCKSGSRSRSN-WLTEE  241

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD +G +R+KWVQKNYM+YNYC D +RFPQG P EC++
Sbjct  242   LDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTECTI  279



>ref|XP_004293370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/278 (66%), Positives = 224/278 (81%), Gaps = 2/278 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V +   L+ +L A   +A NF  +    WG    KIL N +LL L LDR SGSGF+S  +
Sbjct  8     VFSIAFLIGSLMAVISSASNFNQDFEITWGDGRAKILNNNELLVLFLDRISGSGFQSKYE  67

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGNLSGDPY +HTNV++QGK
Sbjct  68    YLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSAWDEIDFEFLGNLSGDPYTIHTNVYSQGK  127

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQF+LWFDPT DFHTYSILWNP+SI+F VDGTPIR+FKN+E+ G+PFPKDQPM ++
Sbjct  128   GDREQQFHLWFDPTTDFHTYSILWNPRSIVFYVDGTPIREFKNLESIGVPFPKDQPMRLH  187

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW A+DWATRGGLVKTDW++APFIASYRN++A AC++  +S TSSCT   +   WLSQ
Sbjct  188   SSLWSADDWATRGGLVKTDWTKAPFIASYRNFNANACIW--SSGTSSCTSPSTKGEWLSQ  245

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              +D++ +Q++K VQ+ +MIYNYCTD KRFPQGFP ECS
Sbjct  246   EMDLASKQKLKMVQEKFMIYNYCTDTKRFPQGFPKECS  283



>ref|XP_004293368.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Fragaria vesca subsp. vesca]
Length=286

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 226/279 (81%), Gaps = 3/279 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             VA  I+ L  +S+  +A AGN   +    WG    KIL +GQLLTLSLD+ASGSGF STN
Sbjct  8     VALLIIPLLVVSSFMVASAGNLNQDFKITWGDGRAKILNDGQLLTLSLDKASGSGFESTN  67

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY+LHTN+F+QG
Sbjct  68    EYLFGKIDMQLKLVAGNSAGTVTAYYLKSEGSTWDEIDFEFLGNLSGDPYILHTNIFSQG  127

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN E++G+PF K Q M +
Sbjct  128   KGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNQESNGVPFLKSQAMRI  187

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             +SSLW+A+DWATRGGLVKTDWS APF ASYRN++A+AC++ S +S+ S T   +   WLS
Sbjct  188   HSSLWNADDWATRGGLVKTDWSAAPFTASYRNFNAEACIWSSGASSCSSTS--ANGDWLS  245

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             Q LD + Q+R+KWVQKNYMIYNYC D KRFPQG P ECS
Sbjct  246   QELDNTSQERMKWVQKNYMIYNYCADVKRFPQGLPVECS  284



>ref|XP_008799439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Phoenix dactylifera]
Length=286

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 223/271 (82%), Gaps = 4/271 (1%)
 Frame = -3

Query  1083  TTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDM  904
             T+  A+   AGNF  ++   WG    KIL NG+LLTLSLD+ SGSGF+S  +Y+YGKIDM
Sbjct  19    TSYLASIAFAGNFYQDVDITWGDGRAKILNNGKLLTLSLDKPSGSGFQSKKEYLYGKIDM  78

Query  903   KIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFY  724
             ++KLVPGNSAGTVT YYLSS G+ HDEIDFEFLGNLSGDPY++HTNV+TQGKG RE +FY
Sbjct  79    QLKLVPGNSAGTVTAYYLSSQGAAHDEIDFEFLGNLSGDPYIVHTNVYTQGKGNREMRFY  138

Query  723   LWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAED  544
             LWFDPTKDFH YS+LWNP+ I+F VDGTPIR+FKN E++G+P+PK+QPM +YSSLW+A+D
Sbjct  139   LWFDPTKDFHNYSVLWNPRHIVFYVDGTPIREFKNRESAGVPYPKNQPMKVYSSLWNADD  198

Query  543   WATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQ  364
             WATRGGLVKTDWS+APF AS+RN++A  CV   +S TS C+   + + W+ Q+LD +  +
Sbjct  199   WATRGGLVKTDWSKAPFTASFRNFNANGCV--GSSGTSPCSL--ANHSWMRQALDSTSLE  254

Query  363   RIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             R++WVQKNYMIYNYCTD  RFPQG PPECS+
Sbjct  255   RLRWVQKNYMIYNYCTDVHRFPQGLPPECSM  285



>ref|XP_002270182.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=362

 Score =   399 bits (1025),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 226/276 (82%), Gaps = 5/276 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LLL +   A +  GN   +    WG    KIL NG+LLTLSLD+ SGSGF+S N+Y++GK
Sbjct  84    LLLGSFVVASV--GNLYQDFEITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLFGK  141

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  142   IDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  201

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ +PK+QPM +YSSLW+
Sbjct  202   QFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVSYPKNQPMRIYSSLWN  261

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY---GSASSTSSCTKNPSANPWLSQSL  382
             A+DWATRGGLVKTDWSQAPF ASYRN++A AC++    S+ S+++ +   ++  W SQ L
Sbjct  262   ADDWATRGGLVKTDWSQAPFTASYRNFNADACIWSSGASSCSSTTPSSTSTSGQWYSQEL  321

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             D + Q+R+KWVQKNYMIYNYCTD KRFPQG PPEC+
Sbjct  322   DSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT  357



>ref|NP_001267579.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87536.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87534.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65441.1| hypothetical protein Csa_1G422990 [Cucumis sativus]
Length=291

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/277 (67%), Positives = 219/277 (79%), Gaps = 2/277 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ LL T      +A NF       WG    +IL NG LL+LSLD+ASGSGF+S N+Y+Y
Sbjct  12    FLSLLFTSFFLPSSASNFHQSTDITWGDGRAQILNNGDLLSLSLDKASGSGFQSRNEYLY  71

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM+IKLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY +HTNVF+QGKG R
Sbjct  72    GKIDMQIKLVPGNSAGTVTAYYLRSEGSTWDEIDFEFLGNLSGDPYTVHTNVFSQGKGNR  131

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSILWNPQ I+F VDGTPIR+FKNME+ G+ FPK+QPM + SSL
Sbjct  132   EQQFHLWFDPTADFHTYSILWNPQRIVFYVDGTPIREFKNMESIGVAFPKNQPMRLQSSL  191

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN--PWLSQS  385
             W+A+DWATRGGL+KTDW+QAPF ASYRN++  AC++ S  S+     +P+A+  PW SQ 
Sbjct  192   WNADDWATRGGLIKTDWTQAPFTASYRNFNENACIWSSGQSSCGSNSSPAASDKPWYSQE  251

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             LD   + ++KWVQKNYMIYNYCTD  RFPQG PPEC+
Sbjct  252   LDTDSEGKLKWVQKNYMIYNYCTDVNRFPQGLPPECN  288



>ref|XP_010103020.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
 gb|EXB94587.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
Length=286

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 226/277 (82%), Gaps = 2/277 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             ++ L   S   + AGNF  +   +WG + GKIL NG+LLTLSLDR SGSGF+S N+YMYG
Sbjct  6     VMPLLFCSILAVEAGNFYQDFDISWGDNRGKILNNGELLTLSLDRTSGSGFQSKNEYMYG  65

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+IKLVPGNSAGTVT YYLSS G T DEIDFEFLGNLSGDPY +HTNV+TQGKG RE
Sbjct  66    KIDMQIKLVPGNSAGTVTAYYLSSEGPTWDEIDFEFLGNLSGDPYTIHTNVYTQGKGDRE  125

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQF+LWFDP  DFHTYSILWNPQ IIF VDGTPIR+FKNME+ GIPFPK QPM +YSSLW
Sbjct  126   QQFHLWFDPASDFHTYSILWNPQRIIFYVDGTPIREFKNMESIGIPFPKTQPMRIYSSLW  185

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQ-ACVYGSASSTSSCTKNPSAN-PWLSQSL  382
             +A+DWATRGGLVKTDWS APF ASYRN+ A+ +CV+ +  S+   + + S +  WL++ L
Sbjct  186   NADDWATRGGLVKTDWSNAPFTASYRNFDAKTSCVWSAGKSSCGSSDSNSKDRAWLTEDL  245

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             D + Q+R++WVQ+N+MIY+YCTD+ RFPQGFP EC++
Sbjct  246   DATSQERLRWVQRNFMIYDYCTDSNRFPQGFPRECNV  282



>ref|XP_010525738.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24 [Tarenaya hassleriana]
Length=280

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 181/265 (68%), Positives = 222/265 (84%), Gaps = 4/265 (2%)
 Frame = -3

Query  1062  IAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPG  883
             ++A +F  E+   WG   GKIL NG+LLTLSLD++SGSGF+S N++++GKIDM+IKLVPG
Sbjct  19    VSAADFGREVDITWGNGRGKILNNGELLTLSLDKSSGSGFQSKNEFLFGKIDMQIKLVPG  78

Query  882   NSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTK  703
             NSAGTVTT+YL S GST DEIDFEFLGNLSGDPY+LHTNV+TQGKG +EQQFYLWFDPT 
Sbjct  79    NSAGTVTTFYLKSPGSTWDEIDFEFLGNLSGDPYILHTNVYTQGKGNKEQQFYLWFDPTA  138

Query  702   DFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGL  523
             +FHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ FPK+Q M MY+SLW+A+DWATRGGL
Sbjct  139   NFHTYSILWNPQRIIFSVDGTPIREFKNFESIGVLFPKNQAMRMYASLWNADDWATRGGL  198

Query  522   VKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQK  343
             VKTDWS++PF ASY++   +ACV+  ++  SSC   PS+  W +Q +D + Q R++WVQK
Sbjct  199   VKTDWSKSPFTASYKSLRVEACVW--SNGRSSCNSKPSS--WFTQEMDSTSQARLRWVQK  254

Query  342   NYMIYNYCTDAKRFPQGFPPECSLN  268
             NYMIYNYCTD KRFPQG P ECS++
Sbjct  255   NYMIYNYCTDGKRFPQGLPRECSMS  279



>gb|KDP36436.1| hypothetical protein JCGZ_08705 [Jatropha curcas]
Length=294

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 220/283 (78%), Gaps = 10/283 (4%)
 Frame = -3

Query  1095  ILLLTTLSAAGI---AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             +L+L  L  A +   +A    N+I   WG   G+IL NG+LLTLSLDR SGSGF+S N+Y
Sbjct  12    VLILPVLIIASLVFASASKIYNDIDITWGDGRGQILNNGELLTLSLDRTSGSGFQSKNEY  71

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKL+PGNSAGTVT Y+L S GS  DEIDFEFLGNLSGDPY+LHTNVFTQGKG
Sbjct  72    LFGKIDMEIKLIPGNSAGTVTAYFLCSQGSAWDEIDFEFLGNLSGDPYILHTNVFTQGKG  131

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPT DFHTY+ILWNP  ++F+VD  PIR+FKN+EA G+PFPK+Q M +YS
Sbjct  132   NREQQFYLWFDPTADFHTYTILWNPHRVLFAVDNIPIREFKNLEAMGVPFPKNQQMRIYS  191

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPS-----ANP  400
             SLW+A+DWATRGGL+K DWSQAPF ASYRN+ A ACV+  ++  SSC  N S      N 
Sbjct  192   SLWNADDWATRGGLIKIDWSQAPFTASYRNFKANACVW--SNGVSSCDTNSSPFRLKTNY  249

Query  399   WLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             W SQ LD   Q+R+ WVQKNYMIYNYC D KRFPQG PPEC L
Sbjct  250   WFSQQLDTISQERLLWVQKNYMIYNYCDDVKRFPQGLPPECYL  292



>ref|XP_010259800.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=325

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 222/277 (80%), Gaps = 7/277 (3%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
              L+L++L+ A     NF  +    WG    +IL NG+LLTLSLD+ASGSGF+S ++Y++G
Sbjct  48    FLVLSSLAMAS----NFNQDFDITWGDGRAQILNNGELLTLSLDKASGSGFQSKHEYLFG  103

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLV GNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  104   KIDMQLKLVAGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  163

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDG PIR+FKN E+ G+PFPK+Q M +YSSLW
Sbjct  164   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGIPIREFKNSESIGVPFPKNQAMRIYSSLW  223

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQS  385
             +A+DWATRGGLVKTDW++APF ASYRN++A ACV  S SS+       S      WLSQ 
Sbjct  224   NADDWATRGGLVKTDWTKAPFTASYRNFNANACVMSSGSSSCDSKSPTSTTDNLQWLSQE  283

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             LD +GQ+R+KWVQ NYMIYNYC D KRFPQG PPECS
Sbjct  284   LDSAGQERMKWVQNNYMIYNYCADTKRFPQGLPPECS  320



>ref|XP_003533750.1| PREDICTED: brassinosteroid-regulated protein BRU1 [Glycine max]
 gb|KHN35839.1| Brassinosteroid-regulated protein BRU1 [Glycine soja]
Length=266

 Score =   395 bits (1015),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 218/279 (78%), Gaps = 18/279 (6%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +  F+L++         AG+F  +    WG +  KI ENG LLTLSLDRASGSGFRS  +
Sbjct  5     IGLFLLVVVATFVVAATAGSFYQDFEITWGGERAKIYENGNLLTLSLDRASGSGFRSKKE  64

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVT YYLSSLG THDEIDFEFLGNLSGDPY LHTNVF+QGK
Sbjct  65    YLFGKIDMQLKLVPGNSAGTVTAYYLSSLGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGK  124

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQF+LWFDPTKDFHTYS+ WNP SIIFSVDGTPIR+FKN+E  G+PFPK+QPM +Y
Sbjct  125   GNREQQFHLWFDPTKDFHTYSVQWNPASIIFSVDGTPIREFKNLETKGVPFPKNQPMRIY  184

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+AEDWATRGGLVKTDWS+APF ASYRN++A          TSS T          Q
Sbjct  185   SSLWNAEDWATRGGLVKTDWSKAPFTASYRNFNAL---------TSSST---------GQ  226

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             SLD +G  +I WVQKNYMIYNYCTD +RFPQG PPECS+
Sbjct  227   SLDATGLAKIHWVQKNYMIYNYCTDIRRFPQGLPPECSI  265



>ref|NP_194311.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
[Arabidopsis thaliana]
 sp|Q38910.1|XTH23_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 23; Short=At-XTH23; Short=XTH-23; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB18367.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 emb|CAB39602.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 emb|CAB79436.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 gb|AEE85117.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
[Arabidopsis thaliana]
Length=286

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 218/274 (80%), Gaps = 2/274 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             + LL +     ++A NF  ++   WG   G+I  NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  11    VALLASFMICSVSA-NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFG  69

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+IKLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG RE
Sbjct  70    KIDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDRE  129

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQF LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSLW
Sbjct  130   QQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLW  189

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSLD  379
             +AE+WATRGGLVKTDWS+APF ASYR ++ +ACV     SS  + +   S   WLSQ LD
Sbjct  190   NAEEWATRGGLVKTDWSKAPFTASYRGFNEEACVVINGQSSCPNVSGQGSTGSWLSQELD  249

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              +GQ++++WVQ NYMIYNYCTDAKRFPQG P EC
Sbjct  250   STGQEQMRWVQNNYMIYNYCTDAKRFPQGLPREC  283



>gb|AII99392.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 179/278 (64%), Positives = 226/278 (81%), Gaps = 3/278 (1%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             + ++L+ TTL  + +A  NF +E    +G    ++L NG  LTLSLD+ SGSGFRS N+Y
Sbjct  5     SIYLLIATTLVGSTLA--NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSKNEY  62

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAG+VTTYYLSSLG THDEIDFEFLGN++G+PY LHTNVF QGKG
Sbjct  63    LFGKIDMQIKLVPGNSAGSVTTYYLSSLGPTHDEIDFEFLGNVTGEPYTLHTNVFAQGKG  122

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF+LWFDPT +FHTYSILWNPQ I+FSVDG P+R+FKNME+ G+ FPK+QPM +YS
Sbjct  123   NREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPMRVYS  182

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWAT+GG VK DWS+APF+AS++ Y+A ACV+GS SST        +N WL++ 
Sbjct  183   SLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCKSGSRSRSN-WLTEE  241

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD +G +R+KWVQKNYM+YNYC D +RFPQG P EC++
Sbjct  242   LDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTECTI  279



>ref|XP_010103019.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
 gb|EXB94586.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
Length=288

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/259 (73%), Positives = 221/259 (85%), Gaps = 4/259 (2%)
 Frame = -3

Query  1035  IGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTY  856
             +   WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++G+IDM++KLVPGNSAGTVT Y
Sbjct  29    LTITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGQIDMQLKLVPGNSAGTVTAY  88

Query  855   YLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILW  676
             YLSS GST DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DFHTYSILW
Sbjct  89    YLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILW  148

Query  675   NPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAP  496
             NPQ I+FSVDGTPIR+FKN+E+ G+P+PK QPM +YSSLW+A+DWATRGGLVKTDWSQAP
Sbjct  149   NPQHIVFSVDGTPIRKFKNLESMGVPYPKSQPMRIYSSLWNADDWATRGGLVKTDWSQAP  208

Query  495   FIASYRNYSAQACVY----GSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIY  328
             F +SYRN+ A ACV+     S SS S+ +    AN WLSQ LD +G++++KWVQKNYMIY
Sbjct  209   FTSSYRNFKANACVFSSGASSCSSHSASSSTSGANSWLSQELDSAGEEKLKWVQKNYMIY  268

Query  327   NYCTDAKRFPQGFPPECSL  271
             NYCTDAKRFPQGFP EC +
Sbjct  269   NYCTDAKRFPQGFPLECKV  287



>gb|AII99393.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   395 bits (1015),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 180/278 (65%), Positives = 225/278 (81%), Gaps = 3/278 (1%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             + F+L+ TTL  + +A  NF +E    +G    ++L NG  LTLSLD+ SGSGFRS N+Y
Sbjct  5     SIFLLIATTLVGSTLA--NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSKNEY  62

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++GKIDM+IKLVPGNSAG+VTTYYLSSLG THDEIDFEFLGN++G+PY LHTNVF QGKG
Sbjct  63    LFGKIDMQIKLVPGNSAGSVTTYYLSSLGPTHDEIDFEFLGNVTGEPYTLHTNVFAQGKG  122

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF+LWFDPT +FHTYSILWNPQ I+FSVDG P+R+FKNME+ G+ FPK QPM +YS
Sbjct  123   NREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKSQPMRVYS  182

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQS  385
             SLW+A+DWAT+GG VK DWS+APF+AS++ Y+A ACV+GS SST        +N WL++ 
Sbjct  183   SLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTYKSGSRSRSN-WLTEE  241

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             LD +G +R+KWVQKNYM+YNYC D +RFPQG P EC++
Sbjct  242   LDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTECTI  279



>ref|XP_011070177.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Sesamum indicum]
Length=301

 Score =   396 bits (1017),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 223/280 (80%), Gaps = 0/280 (0%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V  FILLL   S     AGN   +    WG    K+L+NG+LLTLSLD+ASGSG +S ++
Sbjct  16    VEFFILLLLLGSCTLSFAGNLNQDFDITWGDGRAKLLDNGKLLTLSLDKASGSGIQSKHE  75

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKID ++KLVPGNSAGTVT YYLSS G  HDEIDFEFLGNLSGDPY++HTNV+TQGK
Sbjct  76    YLFGKIDFQLKLVPGNSAGTVTAYYLSSQGPMHDEIDFEFLGNLSGDPYLVHTNVYTQGK  135

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNPQ+IIF VDGTPIR FKN+E+ GIPFPK+Q M +Y
Sbjct  136   GDREQQFYLWFDPTADFHTYSILWNPQTIIFYVDGTPIRVFKNLESRGIPFPKNQAMRVY  195

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWSQAPF  S RN+ A ACV+ S  S+ S   + S  PWLS+
Sbjct  196   SSLWNADDWATRGGLVKTDWSQAPFTVSLRNFRANACVWKSTKSSCSANNSSSTKPWLSE  255

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              LD +   R+KWVQ+NYM+YNYC DAKR+PQG PPEC++N
Sbjct  256   ELDAASASRLKWVQENYMVYNYCADAKRYPQGLPPECTVN  295



>ref|XP_006600497.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Glycine max]
 gb|KHN17576.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=293

 Score =   395 bits (1016),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 223/265 (84%), Gaps = 3/265 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AG+   +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  5     AGDLNKDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNS  64

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS GST DEID+EFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DF
Sbjct  65    AGTVTAYYLSSKGSTWDEIDYEFLGNLSGDPYILHTNVFSQGKGDREQQFYLWFDPTADF  124

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSI WNPQ IIFSVDGTPIR+FKN+E  G+PFPK+QPM MYSSLW+A+DWATRGGLVK
Sbjct  125   HTYSITWNPQRIIFSVDGTPIREFKNLEPIGVPFPKNQPMRMYSSLWNADDWATRGGLVK  184

Query  516   TDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQSLDISGQQRIKWVQ  346
             TDW+QAPF ASYRN++A+ C++ S +   + +S T   S+  WLSQ LD +G QR+KWVQ
Sbjct  185   TDWTQAPFTASYRNFNAETCIWSSGASSCAKTSSTSTTSSGSWLSQELDSAGHQRLKWVQ  244

Query  345   KNYMIYNYCTDAKRFPQGFPPECSL  271
             KNYMIYNYCTD KRFPQG PPEC++
Sbjct  245   KNYMIYNYCTDTKRFPQGLPPECNI  269



>ref|XP_008453618.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Cucumis melo]
Length=346

 Score =   397 bits (1021),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 218/277 (79%), Gaps = 2/277 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ LL +      +A NF   I   WG    +IL NG LLTLSLD+ SGSGF+S N+Y+Y
Sbjct  67    FLSLLFSPFFITSSASNFHQSIDITWGDGRAQILNNGDLLTLSLDKPSGSGFQSRNEYLY  126

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM+IKLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY +HTNVF+QGKG R
Sbjct  127   GKIDMQIKLVPGNSAGTVTAYYLRSEGSTWDEIDFEFLGNLSGDPYTVHTNVFSQGKGNR  186

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSILWNPQ I+F VDGTPIR+FKNME+ G+ FPK+QPM + SSL
Sbjct  187   EQQFHLWFDPTADFHTYSILWNPQRIVFYVDGTPIREFKNMESIGVAFPKNQPMRLQSSL  246

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN--PWLSQS  385
             W+A+DWATRGGLVKTDW+QAPF ASYRN++  AC++ S  S+     +P+A   PW SQ 
Sbjct  247   WNADDWATRGGLVKTDWTQAPFTASYRNFNENACIWSSGQSSCGSNSSPAAEDKPWYSQE  306

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             LD   Q ++KWVQKNYMIYNYCTD  RFPQG PPEC+
Sbjct  307   LDTDSQGKLKWVQKNYMIYNYCTDVNRFPQGLPPECN  343



>ref|XP_009409758.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 225/279 (81%), Gaps = 1/279 (0%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             V  F L+  +L+A    AGNF  +    WG    KILE GQLLTL+LD+ +GSGF+S N+
Sbjct  2     VIRFFLIACSLAAIA-TAGNFYRDFDITWGDGRAKILEGGQLLTLTLDKTTGSGFQSRNE  60

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVFTQGK
Sbjct  61    YLFGKIDMQIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGK  120

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G RE QF LWFDPTKDFHTYSILWNP+ +IF VDGTPIR FKN+E+ GI FPK+QPM +Y
Sbjct  121   GNREMQFKLWFDPTKDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPKNQPMRIY  180

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWS+A F ASYR++ A ACV  SA+S  +    P  + W +Q
Sbjct  181   SSLWNADDWATRGGLVKTDWSKAAFTASYRDFRADACVPSSAASRCASNAAPGNSGWWNQ  240

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD++GQQR+KWVQ+NYM+YNYC+D KRFPQG PPECS+
Sbjct  241   ELDLTGQQRMKWVQRNYMVYNYCSDLKRFPQGLPPECSI  279



>gb|ADV41673.1| endo-xyloglucan transferase [Nicotiana tabacum]
Length=286

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 226/293 (77%), Gaps = 11/293 (4%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             MASL A +          L L +L    +A  NF  +    WG    K+L NG+LLTLSL
Sbjct  1     MASLLAQY-------LVFLALCSLQYHSLAYNNFNQDFDVTWGDGRAKVLNNGKLLTLSL  53

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGD  787
             D+ASGSG +S  +Y++G+IDM++KLV GNSAGTVTTYYLSS G+THDEIDFEFLGNLSGD
Sbjct  54    DKASGSGIQSKREYLFGRIDMQLKLVRGNSAGTVTTYYLSSQGATHDEIDFEFLGNLSGD  113

Query  786   PYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS  607
             PY++HTNV+TQGKG +EQQFYLWFDPT  FHTYSILWNPQ+IIF VDGTPIR FKNM++ 
Sbjct  114   PYIIHTNVYTQGKGDKEQQFYLWFDPTAGFHTYSILWNPQTIIFYVDGTPIRVFKNMKSR  173

Query  606   GIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSS  427
             GIP+P  QPM +Y+SLW+A+DWATRGGL+KTDWS APFIAS+RN+ A ACV+      SS
Sbjct  174   GIPYPNKQPMRVYASLWNADDWATRGGLIKTDWSNAPFIASFRNFKANACVW--EFGKSS  231

Query  426   CTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             C  N S NPW  Q LD + Q +++WVQKNYM+YNYCTD KRFPQGFP +C+ N
Sbjct  232   C--NSSTNPWFFQELDSTSQAKLQWVQKNYMVYNYCTDIKRFPQGFPLKCNFN  282



>ref|XP_008799438.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=280

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/278 (66%), Positives = 221/278 (79%), Gaps = 3/278 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
              +   LLL     A  +AGNF  E    WG   GKIL+NGQLLTLSL++ASGSGF S N+
Sbjct  2     ASVLFLLLACHLMAIASAGNFYQEFDITWGDGRGKILDNGQLLTLSLNKASGSGFESKNE  61

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++G+IDM++KLVPGNSAGTVT YYLSS G +HDEI+FEFLGNLSGDPY LHTNVFTQGK
Sbjct  62    YLFGEIDMQLKLVPGNSAGTVTAYYLSSQGPSHDEINFEFLGNLSGDPYTLHTNVFTQGK  121

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G RE QF+LWFDPT+DFHTYSILWNP+ +IF VDG PIR FKN+E+ GI FPK QPM +Y
Sbjct  122   GNREMQFHLWFDPTRDFHTYSILWNPRHVIFMVDGIPIRDFKNLESRGIAFPKSQPMGIY  181

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP-WLS  391
             SSLW+A+DWAT+GG VKTDW++APF ASYRN++A AC++  +S TS+C    S N  W +
Sbjct  182   SSLWNADDWATQGGRVKTDWTKAPFTASYRNFNADACIW--SSGTSNCPSQKSDNAGWWN  239

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             Q LD + Q+R++W Q+NYMIYNYC D KRFPQG PPEC
Sbjct  240   QELDSTSQERMRWAQQNYMIYNYCNDLKRFPQGLPPEC  277



>ref|XP_010929299.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=299

 Score =   395 bits (1016),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 181/267 (68%), Positives = 214/267 (80%), Gaps = 3/267 (1%)
 Frame = -3

Query  1068  AGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLV  889
              G   GNF  +    WG    KIL+ GQL+TLSLD+ SGSGF+S NQY++GKIDM+IKLV
Sbjct  30    VGAHGGNFYQDFDITWGDGRAKILDGGQLVTLSLDKTSGSGFQSKNQYLFGKIDMQIKLV  89

Query  888   PGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDP  709
             PGNSAGTVT YYLSS G  HDEIDFEFLGNLSGDPY+LHTN+FT+GKG REQQFYLWFDP
Sbjct  90    PGNSAGTVTAYYLSSQGPNHDEIDFEFLGNLSGDPYILHTNLFTEGKGDREQQFYLWFDP  149

Query  708   TKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRG  529
             TKDFHTYS++WNP ++I+ VDG PIR FKN EA G+PFP+ QPM +YSSLWDAEDWATRG
Sbjct  150   TKDFHTYSVIWNPLNVIYLVDGIPIRVFKNNEAIGVPFPEKQPMRLYSSLWDAEDWATRG  209

Query  528   GLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCT---KNPSANPWLSQSLDISGQQRI  358
             GLVKTDWS+APF AS+RN+ A AC++ S  S+   T     P++N W  Q LD + Q+ +
Sbjct  210   GLVKTDWSKAPFTASFRNFQANACIWSSGKSSCGRTTTGSGPTSNGWFDQELDATSQRWL  269

Query  357   KWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             +WV+KNYM+YNYCTD KRFPQG PPEC
Sbjct  270   RWVRKNYMVYNYCTDVKRFPQGLPPEC  296



>ref|XP_010668001.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   395 bits (1015),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 181/259 (70%), Positives = 213/259 (82%), Gaps = 2/259 (1%)
 Frame = -3

Query  1050  NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAG  871
             NF       WG    KI+ NG LLTLSLD+ASGSGF+S N+Y++GKIDM+IKLVPGNSAG
Sbjct  25    NFYQNFDITWGDGRAKIMNNGLLLTLSLDKASGSGFKSKNEYLFGKIDMQIKLVPGNSAG  84

Query  870   TVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHT  691
             TVTTYYLSS G  HDEIDFEFLGN +G PY LHTNVF QGKG REQQF LWFDPT DFHT
Sbjct  85    TVTTYYLSSQGPNHDEIDFEFLGNATGQPYTLHTNVFAQGKGDREQQFRLWFDPTADFHT  144

Query  690   YSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTD  511
             YSILWNPQ IIF+VDGTPIR+FKNMEA G+ FPK Q M MYSSLWDAEDWAT+GG +KTD
Sbjct  145   YSILWNPQRIIFAVDGTPIREFKNMEAIGVSFPKSQAMRMYSSLWDAEDWATQGGRIKTD  204

Query  510   WSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMI  331
             WS+APF+ASYRN++A ACV+  ++  SSC  + +++ W++Q LD + QQR++WVQ+NYMI
Sbjct  205   WSKAPFVASYRNFNANACVW--SNGRSSCRGSGASSAWMNQQLDGTSQQRLQWVQRNYMI  262

Query  330   YNYCTDAKRFPQGFPPECS  274
             YNYCTD +RFPQG P EC+
Sbjct  263   YNYCTDIQRFPQGLPKECT  281



>gb|AHB60658.1| xyloglucan endotransglucosylase/hydrolase [Eleutherococcus senticosus]
Length=290

 Score =   395 bits (1014),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 227/281 (81%), Gaps = 3/281 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +   I L+        AAGN   +    WG    KIL +G+LLTLSLD+ASGSGF+S  +
Sbjct  10    IQPMIALMVGAFLVASAAGNLNQDFDITWGDGRAKILNSGELLTLSLDKASGSGFQSKKE  69

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKID+++KLVPGNSAGTVT YYLSS GSTHDEIDFEFLGNLSGDPY+LHTN+F+QGK
Sbjct  70    YLFGKIDIQLKLVPGNSAGTVTAYYLSSQGSTHDEIDFEFLGNLSGDPYILHTNIFSQGK  129

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWF+PT DFHTYSILWNPQ IIFSVDGTPIR++KN E+ G+P+PK+QPM +Y
Sbjct  130   GNREQQFYLWFNPTADFHTYSILWNPQRIIFSVDGTPIREYKNAESIGVPYPKNQPMRLY  189

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNP--SANPWL  394
             SSLW+A+DWATRGGLVKTDW+QAPF ASYRN++A ACV  S+ ++SS   +   +AN W 
Sbjct  190   SSLWNADDWATRGGLVKTDWTQAPFTASYRNFNADACVQSSSGASSSSCASSSNTAN-WF  248

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             S+ LD + Q+R+KWVQ NYMIYNYCTD KRFPQG  PEC++
Sbjct  249   SEELDTTRQERLKWVQNNYMIYNYCTDIKRFPQGLLPECNM  289



>gb|AAL32550.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 gb|AAM13251.1| xyloglucan endo-1, 4-beta-D-glucanase [Arabidopsis thaliana]
Length=286

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 218/274 (80%), Gaps = 2/274 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             + LL +     ++A NF  ++   WG   G+I  NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  11    VALLASFMICSVSA-NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFG  69

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+I+LV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG RE
Sbjct  70    KIDMQIELVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDRE  129

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQF LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSLW
Sbjct  130   QQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLW  189

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSLD  379
             +AE+WATRGGLVKTDWS+APF ASYR ++ +ACV     SS  + +   S   WLSQ LD
Sbjct  190   NAEEWATRGGLVKTDWSKAPFTASYRGFNEEACVVINGQSSCPNVSGQGSTGSWLSQELD  249

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              +GQ++++WVQ NYMIYNYCTDAKRFPQG P EC
Sbjct  250   STGQEQMRWVQNNYMIYNYCTDAKRFPQGLPREC  283



>ref|XP_004235156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Solanum lycopersicum]
Length=286

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 227/277 (82%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAG-NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA G  F  E    WG    KIL NG LLTLSLD+ SGSGF+S N+Y++
Sbjct  9     LVMCFMISAFGIAIGAKFDQEFDITWGDGRAKILNNGDLLTLSLDKISGSGFQSKNEYLF  68

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  69    GKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  128

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSI WNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  129   EQQFHLWFDPTADFHTYSITWNPQRIIFYVDGTPIREYKNSESIGVSYPKNQPMRIYSSL  188

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN+SA AC+  S+SS SS +   ++N WL++ LD
Sbjct  189   WNADDWATRGGLVKTDWSQAPFSASYRNFSANACIPTSSSSCSSNSAASTSNSWLNEELD  248

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+YNYCTD+KRFPQGFP +C  N
Sbjct  249   NTSQERLKWVQKNYMVYNYCTDSKRFPQGFPADCVQN  285



>ref|XP_006453420.1| hypothetical protein CICLE_v10008778mg [Citrus clementina]
 gb|ESR66660.1| hypothetical protein CICLE_v10008778mg [Citrus clementina]
Length=353

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 228/303 (75%), Gaps = 5/303 (2%)
 Frame = -3

Query  1167  SQLI*SSMASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENG  988
             + LI + +      H          L+L +L  A  +AGNF  +    WG    K+L NG
Sbjct  53    TMLIQTLLVPRLLKHMSMASTLHLFLVLGSLMVA--SAGNFYKDFDITWGDGRAKMLNNG  110

Query  987   QLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEF  808
              LLTLSLD+ASGSGF+S N+Y+YGKIDM++KLVPGNSAGTVT YYL S GST DEIDFEF
Sbjct  111   DLLTLSLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEF  170

Query  807   LGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQ  628
             LGNLSGDPY LHTNVFT GKG REQQF+LWFDP  DFHTYSILWNPQ I+FSVDGTPIR+
Sbjct  171   LGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPAADFHTYSILWNPQRIVFSVDGTPIRE  230

Query  627   FKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYG  448
             FKN E+ G+PFPK+QPM +YSSLW+A+DWATRGGLVKTDW+ APF ASYRN++A+ACV+ 
Sbjct  231   FKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWS  290

Query  447   SASSTSSCTKNPSAN---PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             +  S+ +     S +    W SQ LD + Q R+KWVQKNYMIYNYCTD KRFPQG P EC
Sbjct  291   NGKSSCASNSASSTSSNGAWFSQELDSTNQNRLKWVQKNYMIYNYCTDTKRFPQGLPAEC  350

Query  276   SLN  268
              ++
Sbjct  351   RIS  353



>emb|CAN80251.1| hypothetical protein VITISV_036641 [Vitis vinifera]
Length=287

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 234/291 (80%), Gaps = 8/291 (3%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             MA+  +  RG  G+    L+++ L+AA  +AGNF  +    WG    KIL NG+LLTLSL
Sbjct  1     MAAFCSFRRGLAGLQV-SLIISFLAAA--SAGNFYQDFDITWGDGRAKILNNGELLTLSL  57

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLG-STHDEIDFEFLGNLSG  790
             D+ASGSGF+S N+Y++GKIDM+IKLVPGNSAGTVT YYLSS    THDEIDFEFLGNLSG
Sbjct  58    DKASGSGFQSKNEYLFGKIDMQIKLVPGNSAGTVTAYYLSSKEWETHDEIDFEFLGNLSG  117

Query  789   DPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEA  610
             DPY+LHTNV+ QG+G RE+QFYLWFDPT DFH YSILWNPQ ++F VDG PIR+FKN+E+
Sbjct  118   DPYILHTNVYIQGQGXREKQFYLWFDPTADFHNYSILWNPQCVVFWVDGIPIREFKNLES  177

Query  609   SGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTS  430
             +G+ FPK QPM +YSSLW+A+DWATRGGLVKT+WSQAPF+ASYR+++A AC+    S TS
Sbjct  178   AGVXFPKSQPMRIYSSLWNADDWATRGGLVKTNWSQAPFVASYRSFNADACIL--YSGTS  235

Query  429   SCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             SC+ +  + PWLSQ LD + QQ++KWV+ NYMIYNYCTDA+RF QG P EC
Sbjct  236   SCSWD--SPPWLSQVLDSTDQQKMKWVEDNYMIYNYCTDAERFSQGLPTEC  284



>ref|XP_008223656.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Prunus mume]
Length=284

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/267 (73%), Positives = 224/267 (84%), Gaps = 5/267 (2%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGN   +    WG   GKIL NGQLLTLSLDRASGSGF+S ++Y++GKIDM+IKLVPGNS
Sbjct  16    AGNLNEDFDITWGDGRGKILNNGQLLTLSLDRASGSGFQSKHEYLFGKIDMQIKLVPGNS  75

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYLSS  ST DEID EFLGNLSGDPY+LHTN++TQGKG REQQFYLWFDPT +F
Sbjct  76    AGTVTTYYLSSKRSTWDEIDLEFLGNLSGDPYILHTNIYTQGKGDREQQFYLWFDPTSNF  135

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEAS-GIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             HTYSILWNPQ II SVDGTPIR+FKN+EAS G+PFPK QPM ++SSLW+A+DWATRGGLV
Sbjct  136   HTYSILWNPQRIILSVDGTPIREFKNLEASIGVPFPKSQPMRIFSSLWNADDWATRGGLV  195

Query  519   KTDWSQAPFIASYRNYSAQACVY----GSASSTSSCTKNPSANPWLSQSLDISGQQRIKW  352
             KTDWSQAPF ASYRN++A ACV+     S SS+SS T  P++  WL++ LD S Q+R+KW
Sbjct  196   KTDWSQAPFAASYRNFNANACVWSSGASSCSSSSSSTSRPTSKSWLTEVLDTSKQERLKW  255

Query  351   VQKNYMIYNYCTDAKRFPQGFPPECSL  271
             VQKNYMIYNYC D KRFPQG PPEC +
Sbjct  256   VQKNYMIYNYCIDIKRFPQGLPPECRI  282



>ref|XP_009121735.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Brassica rapa]
Length=287

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/273 (70%), Positives = 219/273 (80%), Gaps = 3/273 (1%)
 Frame = -3

Query  1089  LLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKI  910
             LL  +    ++A NF  ++   WG   G+I  NG LLTLSLD++SGSGF+S N+Y++GKI
Sbjct  13    LLAAIMIYSVSA-NFHQDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFQSKNEYLFGKI  71

Query  909   DMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQ  730
             DM+IKLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG REQQ
Sbjct  72    DMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQ  131

Query  729   FYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDA  550
             F LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSLW+A
Sbjct  132   FKLWFDPTIDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNA  191

Query  549   EDWATRGGLVKTDWSQAPFIASYRNYSAQACVY--GSASSTSSCTKNPSANPWLSQSLDI  376
             EDWATRGGLVKTDWS+APF ASYR +S +ACV   G +S ++   +   +  WLSQ LD 
Sbjct  192   EDWATRGGLVKTDWSKAPFTASYRGFSEEACVVSNGKSSCSNGSAQGSGSGSWLSQELDS  251

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             +GQ+R++WVQ NYMIYNYCTDAKRFPQG P EC
Sbjct  252   TGQERMRWVQSNYMIYNYCTDAKRFPQGLPREC  284



>gb|AFK33537.1| unknown [Medicago truncatula]
Length=288

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
              AGNF  +    WG    KIL N  LLTLSLD+ASGSGF+S N+Y++GKIDM+IKLVPGN
Sbjct  22    VAGNFNKDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVPGN  81

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS G   DEIDFEFLGNLSGDPY+LHTNV +QGKG REQQFYLWFDPT D
Sbjct  82    SAGTVTAYYLSSKGGAWDEIDFEFLGNLSGDPYILHTNVSSQGKGNREQQFYLWFDPTAD  141

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKNME++G+PFPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  142   FHTYSILWNPQRIVFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLV  201

Query  519   KTDWSQAPFIASYRNYSA-QACVY--GSASSTSSCTKNPSANPWLSQSLDISGQQRIKWV  349
             KTDWS+APF ASYRN++A  AC++  G +S  SS   + S+  WLSQ LD +GQQR++WV
Sbjct  202   KTDWSKAPFTASYRNFNANNACIWNGGKSSCKSSSKPSASSASWLSQQLDSTGQQRLRWV  261

Query  348   QKNYMIYNYCTDAKRFPQGFPPECS  274
             QKNYMIYNYC+D KRFPQG P EC+
Sbjct  262   QKNYMIYNYCSDKKRFPQGLPVECT  286



>ref|XP_002869654.1| hypothetical protein ARALYDRAFT_354208 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45913.1| hypothetical protein ARALYDRAFT_354208 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/274 (69%), Positives = 219/274 (80%), Gaps = 2/274 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             + LL +     ++A NF  ++   WG   G+I  NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  11    VALLASFMICSVSA-NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFG  69

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+IKLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG RE
Sbjct  70    KIDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDRE  129

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQF LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSLW
Sbjct  130   QQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLW  189

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVY-GSASSTSSCTKNPSANPWLSQSLD  379
             +AEDWATRGGLVKTDWS+APF ASYR ++ +ACV     SS  + +   S+  WLSQ LD
Sbjct  190   NAEDWATRGGLVKTDWSKAPFTASYRGFNEEACVVINGQSSCPNGSGQGSSGSWLSQELD  249

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              +GQ++++WVQ NYMIYNYCTDAKRFPQG P EC
Sbjct  250   STGQEQMRWVQNNYMIYNYCTDAKRFPQGLPREC  283



>ref|XP_008799440.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=299

 Score =   394 bits (1013),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -3

Query  1143  ASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLD  964
             +SL +  R G   +   LL       G   GNF  +    WG    KIL +GQLLTLSLD
Sbjct  3     SSLRSCSRWGLFTSLLALLSAASLMVGAHGGNFYQDFDITWGDGRAKILNDGQLLTLSLD  62

Query  963   RASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDP  784
             +ASGSGF+S NQY++GKIDM+IKLVPGNSAGTVT YYLSS G  HDEIDFEFLGNLSGDP
Sbjct  63    KASGSGFQSKNQYLFGKIDMQIKLVPGNSAGTVTAYYLSSQGPNHDEIDFEFLGNLSGDP  122

Query  783   YVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASG  604
             Y+LHTNVFTQGKG REQQFYLWFDPTKDFHTYS+LWNP ++I  VDG PIR FKN EA G
Sbjct  123   YILHTNVFTQGKGNREQQFYLWFDPTKDFHTYSVLWNPLNVIILVDGIPIRVFKNNEAIG  182

Query  603   IPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASS----  436
             +PFP+ QPM +YSSLWDAE+WATRGGLVKTDWS+APF AS+RN+ A AC++ S  S    
Sbjct  183   VPFPEKQPMRLYSSLWDAENWATRGGLVKTDWSKAPFTASFRNFQANACIWSSGKSSCGR  242

Query  435   -TSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              T++     + N W  Q LD + Q+ ++W +KNYM+YNYCTD KRFP G PPEC
Sbjct  243   RTTTAGSGSTGNGWFDQELDAASQKWVRWARKNYMVYNYCTDVKRFPLGLPPEC  296



>gb|ACU23404.1| unknown [Glycine max]
Length=293

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/267 (71%), Positives = 221/267 (83%), Gaps = 7/267 (3%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AG+   +    WG    KIL NG+LLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  5     AGDLNKDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNS  64

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS GST DEID+EFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT DF
Sbjct  65    AGTVTAYYLSSKGSTWDEIDYEFLGNLSGDPYILHTNVFSQGKGDREQQFYLWFDPTADF  124

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSI WNPQ IIFSVDGTPIR+FKN+E  G+PFPK+QPM MY SLW+A+DWATRGGLVK
Sbjct  125   HTYSITWNPQRIIFSVDGTPIREFKNLEPIGVPFPKNQPMRMYFSLWNADDWATRGGLVK  184

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTK-----NPSANPWLSQSLDISGQQRIKW  352
             TDW+QAPF ASYRN++A+ C++   +  SSC K       S+  WLSQ LD +G QR+KW
Sbjct  185   TDWTQAPFTASYRNFNAETCIWFFGA--SSCAKTFSTSTTSSGSWLSQELDFAGHQRLKW  242

Query  351   VQKNYMIYNYCTDAKRFPQGFPPECSL  271
             VQKNYMIYNYCTD KRFPQG PPEC++
Sbjct  243   VQKNYMIYNYCTDTKRFPQGLPPECNI  269



>ref|XP_006358261.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X3 [Solanum tuberosum]
Length=286

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 228/277 (82%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFIN-EIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA GN ++ E    WG    KIL NG LLTLSLD+ SGSGF+S N+Y++
Sbjct  9     LVMCFMVSAFGIAIGNTLDQEFEITWGDGRAKILNNGDLLTLSLDKISGSGFQSKNEYLF  68

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLV GNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  69    GKIDMQLKLVSGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  128

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSI WNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  129   EQQFHLWFDPTADFHTYSITWNPQRIIFYVDGTPIREYKNSESMGVSYPKNQPMRIYSSL  188

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN+SA AC+  S+SS +S T   ++N WL++ LD
Sbjct  189   WNADDWATRGGLVKTDWSQAPFSASYRNFSANACIPSSSSSCNSNTTTSTSNSWLNEELD  248

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+YNYCTD+KRFPQGFP +C  N
Sbjct  249   STSQERLKWVQKNYMVYNYCTDSKRFPQGFPVDCVQN  285



>ref|XP_006845719.1| hypothetical protein AMTR_s00019p00242980 [Amborella trichopoda]
 gb|ERN07394.1| hypothetical protein AMTR_s00019p00242980 [Amborella trichopoda]
Length=286

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/281 (67%), Positives = 225/281 (80%), Gaps = 3/281 (1%)
 Frame = -3

Query  1110  GVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             G+A   ++  +L  A  A  NF ++I   WG D  KI+ NG++L LSLDR SGSGF+S N
Sbjct  8     GLALTFVIWGSLIVASKA--NFYSDIDITWGNDRAKIVNNGEILQLSLDRYSGSGFQSKN  65

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++G I MKIKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVFTQG
Sbjct  66    EYLFGNIHMKIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFTQG  125

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT+DFHTYSILWNP  IIF+VDG PIR FKN E  G+P+PKDQPM +
Sbjct  126   KGNREQQFYLWFDPTQDFHTYSILWNPSQIIFTVDGIPIRVFKNAETIGVPYPKDQPMRL  185

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSLW+A+DWATRGGL+KTDWSQAPF ASYR++ A  CV+    S+   + + S + W +
Sbjct  186   YSSLWNADDWATRGGLIKTDWSQAPFTASYRDFRASGCVWLGGKSSCGASSSSSKD-WRT  244

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             Q+LD S ++++KWVQKNYMIY+YC D KRFPQGFPPECSL+
Sbjct  245   QALDPSKEEKLKWVQKNYMIYDYCKDLKRFPQGFPPECSLS  285



>ref|NP_001234472.1| xyloglucan endotransglucosylase-hydrolase XTH3 precursor [Solanum 
lycopersicum]
 gb|AAS46241.1| xyloglucan endotransglucosylase-hydrolase XTH3 [Solanum lycopersicum]
Length=287

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 227/277 (82%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAG-NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA G  F  E    WG    KIL NG LLTLSLD+ SGSGF+S N+Y++
Sbjct  10    LVMCFMISAFGIAIGAKFDQEFDITWGDGRAKILNNGDLLTLSLDKISGSGFQSKNEYLF  69

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  70    GKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  129

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSI WNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  130   EQQFHLWFDPTADFHTYSITWNPQRIIFYVDGTPIREYKNSESIGVSYPKNQPMRIYSSL  189

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN+SA AC+  S+SS SS +   ++N WL++ LD
Sbjct  190   WNADDWATRGGLVKTDWSQAPFSASYRNFSANACIPTSSSSCSSNSAASTSNSWLNEELD  249

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+Y+YCTD+KRFPQGFP +C  N
Sbjct  250   NTSQERLKWVQKNYMVYDYCTDSKRFPQGFPADCVQN  286



>emb|CAA10231.1| xyloglucan endotransglycosylase 1 [Fagus sylvatica]
Length=292

 Score =   394 bits (1011),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 181/264 (69%), Positives = 218/264 (83%), Gaps = 3/264 (1%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGN   +    WG     IL NG+LLTLSLD+ASGSGF+S NQ+++GKID +IKLVPGNS
Sbjct  25    AGNLHQDFDITWGDGRAMILNNGELLTLSLDKASGSGFQSKNQFLFGKIDTQIKLVPGNS  84

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS GST DEID+EFLGNLSGDPY +HTN++TQGKG REQQF+LWFDPT +F
Sbjct  85    AGTVTAYYLSSKGSTWDEIDYEFLGNLSGDPYTIHTNIYTQGKGNREQQFHLWFDPTANF  144

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNPQ+IIFSVDGTPIR+FKN E+ G+P PK QPM +YSSLW+A+DWATRGGL+K
Sbjct  145   HTYSILWNPQAIIFSVDGTPIREFKNSESIGVPIPKKQPMRLYSSLWNADDWATRGGLLK  204

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSC---TKNPSANPWLSQSLDISGQQRIKWVQ  346
             TDW++ PF ASYRN++A+AC++ S  ST +    +   + N WL + LD + Q+R+KWVQ
Sbjct  205   TDWARTPFTASYRNFNARACLWSSGESTCTANSQSSTSNNNAWLKEDLDFTRQERLKWVQ  264

Query  345   KNYMIYNYCTDAKRFPQGFPPECS  274
             KNYMIYNYCTD KRFPQGFPPEC+
Sbjct  265   KNYMIYNYCTDTKRFPQGFPPECA  288



>ref|XP_006474154.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X1 [Citrus sinensis]
 gb|KDO36926.1| hypothetical protein CISIN_1g023204mg [Citrus sinensis]
Length=286

 Score =   393 bits (1010),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/277 (68%), Positives = 220/277 (79%), Gaps = 5/277 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
               L+L +L  A  +AGNF  +    WG    K+L NG LLTLSLD+ASGSGF+S N+Y+Y
Sbjct  9     LFLVLGSLMVA--SAGNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGFQSKNEYLY  66

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG R
Sbjct  67    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDR  126

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDP  DFHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+PFPK+QPM +YSSL
Sbjct  127   EQQFHLWFDPAADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSL  186

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQ  388
             W+A+DWATRGGLVKTDW+ APF ASYRN++A+ACV+ +     +++S +   S   W SQ
Sbjct  187   WNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASSTSSNGAWFSQ  246

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              LD + Q R+KWVQKNYMIYNYC D KRFPQG P EC
Sbjct  247   ELDSTNQSRLKWVQKNYMIYNYCADTKRFPQGLPAEC  283



>ref|XP_007014176.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31795.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=293

 Score =   393 bits (1010),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 231/279 (83%), Gaps = 4/279 (1%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +  F+++ T + A+   AGNF  ++   WG   GKIL +GQLLTLSLD+ASGSGF+S N+
Sbjct  15    LITFLIVETFMVAS---AGNFYQDVDITWGDGRGKILNSGQLLTLSLDKASGSGFQSRNE  71

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y+YGK DM++KLVPGNSAGTVT YY+ S GS+ DEIDFEFLGNLSGDPY++HTNV+T+GK
Sbjct  72    YLYGKFDMQLKLVPGNSAGTVTAYYVKSQGSSWDEIDFEFLGNLSGDPYIVHTNVYTKGK  131

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G REQQFYLWFDPT DFHTYSILWNP+ IIF VDG PIR+FKN++ +G+P+PK+QPM +Y
Sbjct  132   GDREQQFYLWFDPTTDFHTYSILWNPEHIIFYVDGRPIREFKNLKPAGVPYPKNQPMKLY  191

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWSQAPF AS+RN++A AC++ +  S+ S   + S N W SQ
Sbjct  192   SSLWNADDWATRGGLVKTDWSQAPFTASFRNFNANACIWSNGVSSCSSNSS-SNNAWFSQ  250

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD SGQ+ +KWVQ+NYM+YNYC DAKRFPQGFP EC++
Sbjct  251   ELDSSGQKVLKWVQRNYMVYNYCKDAKRFPQGFPVECTV  289



>ref|XP_010259802.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=300

 Score =   394 bits (1011),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 229/278 (82%), Gaps = 5/278 (2%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +L+L +L+    +A +F  +    WG    KIL  G+LLTLSLD+ASGSGF+S ++Y++G
Sbjct  19    LLVLGSLAIVA-SASSFYQDFDVTWGDGRAKILNTGELLTLSLDKASGSGFQSKHEYLFG  77

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  78    KIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  137

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNP+ IIFSVDGTPIR+FKN E+ G+PFPK+QPM +YSSLW
Sbjct  138   QQFYLWFDPTADFHTYSILWNPRRIIFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLW  197

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSASSTSSC---TKNPSANPWLSQ  388
             +A+DWATRGGLVKTDW++APF ASYRN++A  AC++ S SS+      T   + + WLSQ
Sbjct  198   NADDWATRGGLVKTDWTKAPFTASYRNFNANNACIWSSGSSSCDSKSPTSTTNDSQWLSQ  257

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              LD +GQ++++WVQKNYMIYNYCTD KRFP+G P EC+
Sbjct  258   ELDSAGQEKMRWVQKNYMIYNYCTDTKRFPRGLPSECA  295



>ref|XP_010911439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=281

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 221/268 (82%), Gaps = 5/268 (2%)
 Frame = -3

Query  1068  AGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLV  889
             AG +AGNF  +    WG +  KILENGQLLTLSLD+ SGSGF+S N+Y++GKIDM++KLV
Sbjct  14    AGASAGNFDQDFQITWGDERAKILENGQLLTLSLDKPSGSGFQSKNEYLFGKIDMQLKLV  73

Query  888   PGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDP  709
             PGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG RE QF+LWFDP
Sbjct  74    PGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREMQFHLWFDP  133

Query  708   TKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRG  529
             TKDFHTYSILWNP+ IIF VDG PIR FKNME+ G+ FP++QPM +YSSLW+A+DWAT+G
Sbjct  134   TKDFHTYSILWNPKHIIFMVDGIPIRDFKNMESRGVAFPRNQPMRIYSSLWNADDWATQG  193

Query  528   GLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSC---TKNPSANPWLSQSLDISGQQRI  358
             G +KTDW+ APF ASYRN++A AC++  +S TS+C   +   +++ W +Q LD + Q+R+
Sbjct  194   GRIKTDWTNAPFTASYRNFNADACIW--SSGTSNCPSTSTASASSDWWNQELDSTSQERM  251

Query  357   KWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             +WVQ NYMIYNYC D KRFPQG PPECS
Sbjct  252   RWVQTNYMIYNYCADLKRFPQGPPPECS  279



>ref|XP_010929301.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=281

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 180/280 (64%), Positives = 220/280 (79%), Gaps = 1/280 (0%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             +A+ +  L   S   IA AGNF  +    WG+   KIL+N QLLTLSLD++SGSGF+S N
Sbjct  1     MASVLFPLLACSLMTIAWAGNFYQDFDITWGEGRAKILDNAQLLTLSLDKSSGSGFQSKN  60

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYLSS G +HDEIDFEFLGNL GDPY LHTNVFTQG
Sbjct  61    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPSHDEIDFEFLGNLGGDPYTLHTNVFTQG  120

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG RE QF+LWFDPTKDFHTYSILWNP+ +IF VDG PIR FKN+E+ G+ FPK QPM +
Sbjct  121   KGNREMQFHLWFDPTKDFHTYSILWNPRHVIFMVDGIPIRDFKNLESRGVAFPKSQPMRI  180

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLS  391
             YSSLW+A+DWAT+GG +KTDW+ APF ASYRN++A AC++ S +S    ++      W +
Sbjct  181   YSSLWNADDWATQGGRIKTDWTNAPFTASYRNFNADACIWSSGTSNCPNSQKSDNAGWWN  240

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q LD + QQR++W Q+NYMIYNYCTD  RFPQG PPECS+
Sbjct  241   QELDSASQQRMRWAQQNYMIYNYCTDLNRFPQGLPPECSI  280



>ref|XP_010677922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 220/279 (79%), Gaps = 7/279 (3%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAA--GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             I+ +T   A  IA    NF N+    WG    KIL NG  LTLSLD+ASGSGF+S N+Y+
Sbjct  6     IVFVTIFLATLIATTRANFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYL  65

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +G IDM++KLVPGNSAGTVT YYLSSLGSTHDEIDFEFLGN SG PY LHTNVF QGKG 
Sbjct  66    FGNIDMQLKLVPGNSAGTVTAYYLSSLGSTHDEIDFEFLGNASGQPYTLHTNVFAQGKGN  125

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPTKDFHTYSILWNPQ I+FSVDG PIR+F NME+ G+ FPK+QPM +YSS
Sbjct  126   REQQFHLWFDPTKDFHTYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSS  185

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLS  391
             LW+A+DWAT+GG VK DW+ APF ASYRN++A ACV+  AS +SSC  +PSA+    WL+
Sbjct  186   LWNADDWATQGGRVKIDWTHAPFTASYRNFNANACVW--ASGSSSCGLSPSADSGSDWLN  243

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             Q LD +  +R++WVQ NYM+YNYC D +RFPQG P EC+
Sbjct  244   QELDSASLERMRWVQTNYMVYNYCADLQRFPQGLPTECT  282



>ref|XP_006474155.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X2 [Citrus sinensis]
Length=286

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 224/280 (80%), Gaps = 5/280 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
               L+L +L  A  +AGNF  +    WG    K+L NG LLTLSLD+ASGSGF+S N+Y+Y
Sbjct  9     LFLVLGSLMVA--SAGNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGFQSKNEYLY  66

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG R
Sbjct  67    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDR  126

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDP  DFHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+ FPK+QPM +YSSL
Sbjct  127   EQQFHLWFDPAADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSL  186

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQ  388
             W+A+DWATRGGLVKTDW+ APF ASYRN++A ACV+ +     ++SS +   S++ W SQ
Sbjct  187   WNADDWATRGGLVKTDWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQ  246

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              LD + Q+R+KWVQKNYMIYNYCTD KRFPQG P EC ++
Sbjct  247   ELDSTSQERLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  286



>gb|KHG05436.1| putative xyloglucan endotransglucosylase/hydrolase 21 -like protein 
[Gossypium arboreum]
 gb|KHG17444.1| putative xyloglucan endotransglucosylase/hydrolase 21 -like protein 
[Gossypium arboreum]
Length=297

 Score =   393 bits (1010),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 189/292 (65%), Positives = 227/292 (78%), Gaps = 3/292 (1%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             M +L       G +    L++ T   A  +AGNF  ++   WG   GKIL NGQLLTLSL
Sbjct  1     MDTLSILSNALGMLLITFLMVETFMVA--SAGNFNKDVDITWGDSRGKILNNGQLLTLSL  58

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGD  787
             D+ASGSGF+S N+Y+YGK DM++KLVPGNSAGTVT YYL S GS+ DEIDFEFLGNLSGD
Sbjct  59    DKASGSGFQSRNEYLYGKFDMQLKLVPGNSAGTVTAYYLKSQGSSWDEIDFEFLGNLSGD  118

Query  786   PYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEAS  607
             PY++HTNV+T+GKG REQQFYLWFDPT DFHTYSILWNP  +IF VDG PIR+FKN+E+ 
Sbjct  119   PYIVHTNVYTKGKGDREQQFYLWFDPTADFHTYSILWNPGHVIFYVDGRPIREFKNLESL  178

Query  606   GIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSS  427
             G+P+PK+QPM MY SLW+A+DWATRGGLVKTDWSQAPF AS+RN++A AC   S   +S 
Sbjct  179   GVPYPKNQPMRMYCSLWNADDWATRGGLVKTDWSQAPFTASFRNFTANACAL-SNGVSSC  237

Query  426   CTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              T + S N W SQ LD S Q+ +KWVQKNYM+YNYC DAKRFP+G P EC++
Sbjct  238   STNSSSNNAWFSQELDSSSQKVLKWVQKNYMVYNYCKDAKRFPKGLPVECTV  289



>ref|XP_009344503.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Pyrus x bretschneideri]
Length=289

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/262 (70%), Positives = 214/262 (82%), Gaps = 1/262 (0%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  E    WG    KIL NG+LLTLSLD+ SGS F S N+Y++GKIDM+IKLVPGN
Sbjct  26    SAGNFNQEFEITWGDGRAKILNNGELLTLSLDKVSGSAFESKNEYLFGKIDMQIKLVPGN  85

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS GS  DEIDFEFLGNL+GDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  86    SAGTVTAYYLSSKGSAWDEIDFEFLGNLTGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  145

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNP  IIFSVDGTPIR+FKN E+ G+PFPK QPM ++SSLW+A+DWATRGGL+
Sbjct  146   FHTYSILWNPHCIIFSVDGTPIREFKNFESVGVPFPKHQPMRIHSSLWNADDWATRGGLI  205

Query  519   KTDWSQAPFIASYRNYSA-QACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQK  343
             KTDWS+APF ASYRN++A  ACV+ S  ++S  +    +N WLS+ LD  G++R+ WVQ 
Sbjct  206   KTDWSRAPFTASYRNFTADNACVWPSNGASSCKSSPSQSNAWLSEELDSIGKKRLSWVQN  265

Query  342   NYMIYNYCTDAKRFPQGFPPEC  277
             NYMIYNYCTD KRFPQ FP EC
Sbjct  266   NYMIYNYCTDGKRFPQEFPVEC  287



>ref|XP_007224386.1| hypothetical protein PRUPE_ppa021675mg [Prunus persica]
 gb|EMJ25585.1| hypothetical protein PRUPE_ppa021675mg [Prunus persica]
Length=299

 Score =   393 bits (1009),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 227/285 (80%), Gaps = 6/285 (2%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             +   +L     S   +A A NF  +    WG   GKIL N +LL LSLD+ SGSGF+STN
Sbjct  13    LVVLVLCFIVGSLVAVASASNFNQDFEITWGDGRGKILNNNELLMLSLDKGSGSGFQSTN  72

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM++KLVPGNSAGTVT YYL+S G T DEIDFEFLGNLSGDPY+LHTNV++QG
Sbjct  73    EYLFGKIDMQLKLVPGNSAGTVTAYYLASEGLTWDEIDFEFLGNLSGDPYILHTNVYSQG  132

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E+ G+PFPK+QPM +
Sbjct  133   KGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKNQPMRL  192

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSAS----STSSCTKNPSA  406
             YSSLW+A+DWATRGGLVKTDW++APF ASYRN++A  ACV+ S +    S S  + + + 
Sbjct  193   YSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNAINACVWSSGASSCTSKSPSSTSSAG  252

Query  405   NPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             N WLSQ  D++ Q+++K VQ+NYMIYNYC D KRFPQGFP EC+L
Sbjct  253   NTWLSQEFDLASQEKLKSVQRNYMIYNYCKDTKRFPQGFPQECAL  297



>ref|XP_010677921.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 220/279 (79%), Gaps = 7/279 (3%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAA--GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYM  922
             I+  T   A+ IA    NF N+    WG    KIL NG  LTLSLD+ASGSGF+S N+Y+
Sbjct  6     IVFATIFLASLIATTRANFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYL  65

Query  921   YGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGG  742
             +G IDM++KLVPGNSAGTVT YYLSSLG+THDEIDFEFLGN SG PY LHTNVF QGKG 
Sbjct  66    FGSIDMQLKLVPGNSAGTVTAYYLSSLGTTHDEIDFEFLGNASGQPYTLHTNVFAQGKGN  125

Query  741   REQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSS  562
             REQQF+LWFDPTKDFHTYSILWNPQ I+FSVDG PIR+F NME+ G+ FPK+QPM +YSS
Sbjct  126   REQQFHLWFDPTKDFHTYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSS  185

Query  561   LWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLS  391
             LW+A+DWAT+GG VK DW+ APF ASYRN++A ACV+  AS +SSC  +PSA+    WL+
Sbjct  186   LWNADDWATQGGRVKIDWTHAPFTASYRNFNANACVW--ASGSSSCGLSPSADSGSDWLN  243

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             Q LD +  +R++WVQ NYM+YNYC D +RFPQG P EC+
Sbjct  244   QELDSASLERMRWVQTNYMVYNYCADLQRFPQGLPTECT  282



>gb|ABM91073.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-17 [Populus 
tremula x Populus tremuloides]
Length=286

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 217/266 (82%), Gaps = 3/266 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +A NF N+    WG    KIL +G LLTL+LD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  20    SASNFYNDFDITWGDGRAKILSDGDLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGN  79

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YY+SS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  80    SAGTVTAYYVSSKGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  139

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN+E+  +P PK+QPM + SSLW+A+DWATRGGLV
Sbjct  140   FHTYSILWNPQRIVFSVDGTPIREFKNLESMEVPCPKNQPMRICSSLWNADDWATRGGLV  199

Query  519   KTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA---NPWLSQSLDISGQQRIKWV  349
             KTDW+ APF ASYRN++A+ACV  +  S+   T +P A   N W S+ LD + Q+R+KWV
Sbjct  200   KTDWALAPFTASYRNFNAEACVLSNGVSSCGTTTSPPASTSNAWFSEELDSTRQERLKWV  259

Query  348   QKNYMIYNYCTDAKRFPQGFPPECSL  271
             ++NYM+YNYC D  RFPQG P ECS+
Sbjct  260   RENYMVYNYCHDVNRFPQGLPTECSM  285



>ref|XP_009120273.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=283

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 220/277 (79%), Gaps = 5/277 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ L  +L      + NF  ++   WG   G+I  NG+LLTLSLD++SGSGF+S N+Y++
Sbjct  6     FLPLFISLIVISSVSANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLF  65

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVTT YL S G+T DEIDFEFLGNLSGDPY LHTNV+TQGKG +
Sbjct  66    GKIDMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDK  125

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF LWFDPT DFHTY+ILWNPQ IIF+VDGTPIR+FKNME+ G  FPK+QPM MYSSL
Sbjct  126   EQQFKLWFDPTADFHTYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSL  185

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANP---WLSQ  388
             W+A+DWATRGGLVKTDWS+APF ASYR ++ +ACV+  ++  SSC       P   WLSQ
Sbjct  186   WNADDWATRGGLVKTDWSKAPFTASYRGFNQEACVW--SNGKSSCPNGSGQGPTGSWLSQ  243

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              LD + Q+R++WVQKNYMIYNYCTD KRFPQG P EC
Sbjct  244   ELDSTAQERMRWVQKNYMIYNYCTDTKRFPQGLPKEC  280



>ref|XP_010932220.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=280

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/275 (68%), Positives = 224/275 (81%), Gaps = 8/275 (3%)
 Frame = -3

Query  1089  LLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKI  910
             LLTTL  A  A+ NF+ ++   WG   GKILENG LL LSLD+ASGSGF+S  +Y++G+I
Sbjct  12    LLTTLIVA--ASANFLADVDLTWGSGRGKILENGNLLQLSLDKASGSGFQSKQEYLFGRI  69

Query  909   DMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQ  730
             DM++KLVPGNSAGTVTT YLSS G THDEID+EFLGN+SG PY LHTN++TQGKG +EQQ
Sbjct  70    DMRMKLVPGNSAGTVTTLYLSSQGPTHDEIDYEFLGNISGQPYTLHTNIYTQGKGNKEQQ  129

Query  729   FYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDA  550
             F LWFDP  DFHTYSILWNPQ I+F VDGTP+R F+NME  G+P+PK+Q M +YSSLW+A
Sbjct  130   FRLWFDPRLDFHTYSILWNPQQILFYVDGTPVRVFRNMEGMGLPYPKNQAMRLYSSLWNA  189

Query  549   EDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN-PWLSQSLDIS  373
             +DWAT GG VKTDWSQAPF+ASYR +SA ACV+  A   SSC   P+A   W +QSLD  
Sbjct  190   DDWATMGGRVKTDWSQAPFVASYRGFSANACVW--AGGRSSC---PAAKGTWWAQSLDSP  244

Query  372   GQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             G Q++KWV++NYMIY+YCTD+KRFPQGFPPECSL+
Sbjct  245   GAQKLKWVRQNYMIYDYCTDSKRFPQGFPPECSLS  279



>ref|XP_010676725.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=280

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/261 (70%), Positives = 216/261 (83%), Gaps = 5/261 (2%)
 Frame = -3

Query  1053  GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSA  874
             GN        WG    KIL NGQLLTLSLD+ASGSGF+S N+Y++GKIDM+IKLV GNSA
Sbjct  23    GNLNQNFDITWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSA  82

Query  873   GTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFH  694
             GTVT YYLSS G THDEIDFEFLGN+SG PY LHTNVF+QGKGGREQQF LWFDPT DFH
Sbjct  83    GTVTAYYLSSQGPTHDEIDFEFLGNVSGQPYTLHTNVFSQGKGGREQQFRLWFDPTSDFH  142

Query  693   TYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKT  514
             TYSILWNPQ I+FSVDGTP+R+F+NME+ G+ FPK+QPM +YSSLW+A+DWAT+GG VKT
Sbjct  143   TYSILWNPQRIVFSVDGTPLREFRNMESMGVAFPKNQPMRIYSSLWNADDWATQGGRVKT  202

Query  513   DWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYM  334
             DWS+APF ASYRN++A ACV  S++  SSC    SA+ W++Q LD + Q+R++ +QKNYM
Sbjct  203   DWSKAPFTASYRNFNADACV--SSNGRSSCN---SASSWMNQELDATSQRRMQQMQKNYM  257

Query  333   IYNYCTDAKRFPQGFPPECSL  271
             IYNYCTD  RFPQGFP EC++
Sbjct  258   IYNYCTDTPRFPQGFPKECTV  278



>ref|XP_011043991.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Populus euphratica]
Length=292

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/290 (64%), Positives = 230/290 (79%), Gaps = 7/290 (2%)
 Frame = -3

Query  1131  ATHRGGGGVAAFILLLTTLSAAGIA--AGNFINEIGFNWGQDHGKILENGQLLTLSLDRA  958
             A+++   G+  F+L+    S+  ++  A  F  E   +WG   GKIL NG LLTLSLD+ 
Sbjct  7     ASYKSSTGILNFLLISLLDSSLIVSCIASKFNQEFDISWGNGRGKILNNGDLLTLSLDKT  66

Query  957   SGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYV  778
             SGSGF+S N+Y++GKIDM++KLVPGNSAGTVTTYYL S G++ DE+DFEFLGNLSGDPY 
Sbjct  67    SGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTTYYLKSPGNSWDEMDFEFLGNLSGDPYT  126

Query  777   LHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIP  598
             LHTNV++QGKG REQQF LWFDPT DFHTYSILWNP+ IIFSVDG PIR+FKN+E+ G+P
Sbjct  127   LHTNVYSQGKGDREQQFRLWFDPTADFHTYSILWNPKLIIFSVDGKPIREFKNLESIGVP  186

Query  597   FPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTK  418
             FPK Q M +YSSLW+A+DWATRGGL+KTDW++APF ASYRN+ A AC++  +S  ++C  
Sbjct  187   FPKKQQMRIYSSLWNADDWATRGGLIKTDWTRAPFTASYRNFKADACIW--SSGRAAC--  242

Query  417   NPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              PS   WL Q LD +  QR+KWVQKN+MIYNYCTD KRFP GFPPECS+N
Sbjct  243   -PSRKSWLWQKLDATSFQRLKWVQKNFMIYNYCTDTKRFPLGFPPECSVN  291



>ref|XP_007226935.1| hypothetical protein PRUPE_ppa015713mg [Prunus persica]
 gb|EMJ28134.1| hypothetical protein PRUPE_ppa015713mg [Prunus persica]
Length=284

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/267 (73%), Positives = 223/267 (84%), Gaps = 5/267 (2%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGN   +    WG   GKIL NGQLLTLSLDRASGSGF+S ++Y++GKIDM+IKLVPGNS
Sbjct  16    AGNLNGDFDITWGDGRGKILNNGQLLTLSLDRASGSGFQSKHEYLFGKIDMQIKLVPGNS  75

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVTTYYLSS  ST DEID EFLGNLSGDPY+LHTN++TQGKG REQQFYLWFDPT +F
Sbjct  76    AGTVTTYYLSSKRSTWDEIDLEFLGNLSGDPYILHTNIYTQGKGDREQQFYLWFDPTSNF  135

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEAS-GIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             HTYSILWNPQ II SVDGTPIR+FKN+EAS G+PFPK QPM ++SSLW+A+DWATRGGLV
Sbjct  136   HTYSILWNPQRIILSVDGTPIREFKNLEASIGVPFPKSQPMRIFSSLWNADDWATRGGLV  195

Query  519   KTDWSQAPFIASYRNYSAQACVY----GSASSTSSCTKNPSANPWLSQSLDISGQQRIKW  352
             KTDWSQAPF ASY+N++A ACV+     S SS+SS T  P++  WL + LD S Q+R+KW
Sbjct  196   KTDWSQAPFTASYQNFNANACVWSSGASSCSSSSSSTSRPTSKSWLKEVLDTSKQERLKW  255

Query  351   VQKNYMIYNYCTDAKRFPQGFPPECSL  271
             VQKNYMIYNYC D KRFPQG PPEC +
Sbjct  256   VQKNYMIYNYCIDIKRFPQGLPPECRI  282



>ref|XP_009793860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nicotiana sylvestris]
Length=272

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/276 (66%), Positives = 225/276 (82%), Gaps = 12/276 (4%)
 Frame = -3

Query  1095  ILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             ++L   +SA  +A AG F +     WG+   K+L NG+LLTLSLD+ SGSGF+S N+Y++
Sbjct  8     LVLALIVSAFAVAIAGTFDDNFEITWGEGRAKMLNNGELLTLSLDKISGSGFQSKNEYLF  67

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  68    GKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  127

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSILWNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  128   EQQFHLWFDPTADFHTYSILWNPQRIIFYVDGTPIREYKNSESIGVSYPKNQPMRIYSSL  187

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGL+KTDWS+APF ASYRN+        SA+STS+     ++N WL++ LD
Sbjct  188   WNADDWATRGGLIKTDWSKAPFSASYRNFK-------SATSTSAA----NSNSWLNEELD  236

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              + Q+R+KWVQKNYM+YNYC D+KRFPQGFP +C++
Sbjct  237   NTSQERLKWVQKNYMVYNYCNDSKRFPQGFPADCAM  272



>ref|XP_010545425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=290

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 217/277 (78%), Gaps = 5/277 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGI----AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             +LL  L  AG+       NF   +   WG   G+I  NG LLTLSLD+ SGSGF+S N+Y
Sbjct  11    MLLFPLLLAGVLLPSVVANFYQNVEITWGDGRGQIKNNGDLLTLSLDKPSGSGFQSKNEY  70

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             +YGKIDM++KLV GNSAGTVT YYL S G+T DEIDFEFLGNLSGDPY LHTNVFTQGKG
Sbjct  71    LYGKIDMQLKLVAGNSAGTVTAYYLKSPGTTWDEIDFEFLGNLSGDPYTLHTNVFTQGKG  130

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF LWFDPT DFH+YSILWNPQ IIFSVDGTPIR+FKNME+ G+ FPK+QPM MYS
Sbjct  131   NREQQFKLWFDPTADFHSYSILWNPQRIIFSVDGTPIREFKNMESQGVLFPKNQPMRMYS  190

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSA-SSTSSCTKNPSANPWLSQ  388
             SLW+A+DWATRGGLVKTDWSQAPF ASYRN+   ACV+ +  SS  + +   ++  WLSQ
Sbjct  191   SLWNADDWATRGGLVKTDWSQAPFTASYRNFKEDACVWSNGKSSCPNGSSQGTSGSWLSQ  250

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              LD + Q+R++WVQK+YMIYNYCTD  RFPQG P EC
Sbjct  251   ELDTTSQERMRWVQKSYMIYNYCTDTNRFPQGLPKEC  287



>ref|XP_007014179.1| Xyloglucan endotransglycosylase 6 isoform 1 [Theobroma cacao]
 gb|EOY31798.1| Xyloglucan endotransglycosylase 6 isoform 1 [Theobroma cacao]
Length=282

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 222/283 (78%), Gaps = 4/283 (1%)
 Frame = -3

Query  1122  RGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGF  943
             R   G+   +L+   L A+   A NF  +    WG   GKIL NGQLLTL+LD+ SGSGF
Sbjct  2     RSSFGLLVAMLVSFVLVAS---AANFYQDFDLTWGDARGKILNNGQLLTLTLDKFSGSGF  58

Query  942   RSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNV  763
             +S N+Y++GKIDM++KLVPGNSAGTVT YYL S  ST DEIDFEFLGNLSG+PY++HTNV
Sbjct  59    QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLRSQESTWDEIDFEFLGNLSGEPYIVHTNV  118

Query  762   FTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQ  583
             F+QGKG REQQFYLWFDPTKDFHTYS+LWNPQ IIFSVDG PIR+FKN+E+ G+PFPK Q
Sbjct  119   FSQGKGDREQQFYLWFDPTKDFHTYSVLWNPQRIIFSVDGIPIREFKNLESIGVPFPKKQ  178

Query  582   PMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSAN  403
             PM +YSSLW+A+DWATRGGLVKTDWS+APF ASYRN+ A ACV+ S   +S  + + S  
Sbjct  179   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTASYRNFKADACVW-SQGKSSCSSTSGSRY  237

Query  402   PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              WLSQ LD + QQR+KWVQ+ YMIYNYC D KRF Q  P EC+
Sbjct  238   AWLSQELDTASQQRLKWVQEKYMIYNYCKDTKRFSQSLPKECT  280



>ref|XP_010656825.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=287

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 233/291 (80%), Gaps = 8/291 (3%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSL  967
             MA+  +  RG  G+    L+++ L+AA  +AGNF  +    WG    KIL NG+LLTLSL
Sbjct  1     MAAFCSFRRGLAGLQV-SLIISFLAAA--SAGNFYQDFDITWGDGRAKILNNGELLTLSL  57

Query  966   DRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLG-STHDEIDFEFLGNLSG  790
             D+ASGSGF+S N+Y++GKI M+IKLVPGNSAGTVT YYLSS    THDEIDFEFLGNLSG
Sbjct  58    DKASGSGFQSKNEYLFGKIAMQIKLVPGNSAGTVTAYYLSSKEWETHDEIDFEFLGNLSG  117

Query  789   DPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEA  610
             DPY+LHTNV+ QG+G RE+QFYLWFDPT DFH YSILWNPQ ++F VDG PIR+FKN+E+
Sbjct  118   DPYILHTNVYIQGQGKREKQFYLWFDPTADFHNYSILWNPQCVVFWVDGIPIREFKNLES  177

Query  609   SGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTS  430
             +G+ FPK QPM +YSSLW+A+DWATRGGLVKT+WSQAPF+ASYR+++A AC+    S TS
Sbjct  178   AGVLFPKSQPMRIYSSLWNADDWATRGGLVKTNWSQAPFVASYRSFNADACIL--YSGTS  235

Query  429   SCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             SC+ +  + PWLSQ LD + QQ++KWV+ NYMIYNYCTDA+RF QG P EC
Sbjct  236   SCSWD--SPPWLSQVLDSTDQQKMKWVEDNYMIYNYCTDAERFSQGLPTEC  284



>gb|AGT29355.1| xyloglucan endotransglucosylase/hydrolase 5 [Diospyros kaki]
Length=287

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/276 (68%), Positives = 228/276 (83%), Gaps = 2/276 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LL + L  A  ++ +   ++   WG    +IL+NGQLLTLSLD+ASGSGF+S NQY++G 
Sbjct  13    LLCSLLFMATSSSADLNQDVDITWGDGRARILDNGQLLTLSLDKASGSGFQSKNQYLFGN  72

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             I M++KLVPGNSAGTVT YYLSS G+THDEIDFEFLGNLSGDPY+LHTNVF+QGKG REQ
Sbjct  73    IHMQLKLVPGNSAGTVTAYYLSSQGTTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQ  132

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+ G+ +PK+QPM +YSSLW+
Sbjct  133   QFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESVGVAYPKNQPMRIYSSLWN  192

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSASSTSSCTKNPSANPWLSQSLDI  376
             A+DWATRGGLVKTDW+QAPF ASYRN+ A  ACV+ S +S+   +   +++  LSQ LD 
Sbjct  193   ADDWATRGGLVKTDWTQAPFTASYRNFKADDACVWSSGASSCGSSSGSTSSW-LSQELDS  251

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             + Q+R++W+QKNYMIYNYC DAKRFPQG PPECSL+
Sbjct  252   TSQERLRWLQKNYMIYNYCADAKRFPQGPPPECSLS  287



>ref|XP_006413268.1| hypothetical protein EUTSA_v10025720mg [Eutrema salsugineum]
 gb|ESQ54721.1| hypothetical protein EUTSA_v10025720mg [Eutrema salsugineum]
Length=323

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/261 (71%), Positives = 212/261 (81%), Gaps = 2/261 (1%)
 Frame = -3

Query  1053  GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSA  874
              NF  ++   WG   G+I  NG LLTLSLD++SGSGFRS N+Y++GKIDM+IKLV GNSA
Sbjct  60    ANFQRDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFRSKNEYLFGKIDMQIKLVAGNSA  119

Query  873   GTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFH  694
             GTVT YYL S GST DE+DFEFLGNLSGDPY LHTNVFTQGKG REQQF LWFDPT DFH
Sbjct  120   GTVTAYYLKSPGSTWDEVDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  179

Query  693   TYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKT  514
             TYSILWNPQ IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSLW+AEDWATRGGLVKT
Sbjct  180   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  239

Query  513   DWSQAPFIASYRNYSAQACVY--GSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKN  340
             DWS+APF ASYR ++ +ACV   G +S  +   +  S+  WLSQ LD +GQ+R++WVQ N
Sbjct  240   DWSKAPFTASYRGFNEEACVMSNGKSSCPNGSGQGSSSGSWLSQELDSTGQERMRWVQSN  299

Query  339   YMIYNYCTDAKRFPQGFPPEC  277
             YMIYNYCTD KRFPQG P EC
Sbjct  300   YMIYNYCTDIKRFPQGLPQEC  320



>gb|AFK47205.1| unknown [Lotus japonicus]
Length=291

 Score =   391 bits (1005),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 225/283 (80%), Gaps = 7/283 (2%)
 Frame = -3

Query  1101  AFILLLTTLSAAGI---AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTN  931
             + +LL+  L ++ I   +AGNF  +    WG    KIL N  LLTLSLD+ASGSGF S N
Sbjct  7     SLMLLIPLLVSSYIVLSSAGNFNKDFQITWGDGRAKILNNDNLLTLSLDKASGSGFESKN  66

Query  930   QYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQG  751
             +Y++GKIDM+IKLVPGNSAGTVT YYLSS GST DEIDFEFLGNLSGDPY LHTNVF+QG
Sbjct  67    EYLFGKIDMQIKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYTLHTNVFSQG  126

Query  750   KGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWM  571
             KG REQQF+LWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN+E++G+PFPK+QPM +
Sbjct  127   KGNREQQFHLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESAGVPFPKNQPMRL  186

Query  570   YSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVYGSAS---STSSCTKNPSAN  403
              SSLW+A+DWATRGGLVKTDWS+APF ASYRN++A  ACV+        ++S +    + 
Sbjct  187   TSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNANNACVWSGGKSSCKSNSPSSASGSA  246

Query  402   PWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              WL Q LD +G QR++WVQKNYM+YNYC D KRFPQG P EC+
Sbjct  247   SWLKQELDSTGYQRLRWVQKNYMVYNYCADKKRFPQGLPTECT  289



>ref|XP_009341028.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Pyrus x bretschneideri]
 ref|XP_009341029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Pyrus x bretschneideri]
Length=289

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 214/262 (82%), Gaps = 1/262 (0%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  E    WG    KIL NG+LLTLSLD+ SGS F S N+Y++GKIDM+IKLVPGN
Sbjct  26    SAGNFNQEFEITWGDGRAKILNNGELLTLSLDKVSGSAFESKNEYLFGKIDMQIKLVPGN  85

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYLSS GS  DEIDFEFLGNL+GDPY+LHTNVF+QGKG REQQFYLWFDPT D
Sbjct  86    SAGTVTAYYLSSKGSAWDEIDFEFLGNLTGDPYILHTNVFSQGKGNREQQFYLWFDPTAD  145

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNP  IIFSVDGTPIR+FKN ++ G+PFPK QPM ++SSLW+A+DWATRGGL+
Sbjct  146   FHTYSILWNPHCIIFSVDGTPIREFKNFDSVGVPFPKHQPMRIHSSLWNADDWATRGGLI  205

Query  519   KTDWSQAPFIASYRNYSA-QACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQK  343
             KTDWS+APF ASYRN++A  ACV+ S  ++S  +    +N WLS+ LD  G++R+ WVQ 
Sbjct  206   KTDWSRAPFTASYRNFTADNACVWPSNGASSCKSSPSQSNAWLSEELDSIGKKRLSWVQN  265

Query  342   NYMIYNYCTDAKRFPQGFPPEC  277
             NYMIYNYCTD KRFPQ FP EC
Sbjct  266   NYMIYNYCTDGKRFPQEFPVEC  287



>ref|XP_004235158.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Solanum lycopersicum]
Length=286

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/277 (68%), Positives = 226/277 (82%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAG-NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA G  F  E    WG    KIL NG LLTLSLD+ SGSGF+  N+Y++
Sbjct  9     LVMCFMISAFGIAIGAKFDQEFDITWGDGRAKILNNGDLLTLSLDKISGSGFQPKNEYLF  68

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  69    GKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  128

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSI WNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  129   EQQFHLWFDPTADFHTYSITWNPQRIIFYVDGTPIREYKNSESIGVSYPKNQPMRIYSSL  188

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN+SA AC+  S+SS SS +   ++N WL++ LD
Sbjct  189   WNADDWATRGGLVKTDWSQAPFSASYRNFSANACIPTSSSSCSSISATSTSNSWLNEELD  248

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+Y+YCTD+KRFPQGFP +C  N
Sbjct  249   NTSQERLKWVQKNYMVYDYCTDSKRFPQGFPADCVQN  285



>ref|XP_002325067.2| hypothetical protein POPTR_0018s10290g [Populus trichocarpa]
 gb|EEF03632.2| hypothetical protein POPTR_0018s10290g [Populus trichocarpa]
Length=292

 Score =   391 bits (1004),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/263 (69%), Positives = 214/263 (81%), Gaps = 5/263 (2%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             A  F  E   +WG   GKIL NG LLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGNS
Sbjct  34    ASKFYQEFDISWGNGRGKILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNS  93

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYL S G++ DEIDFEFLGNLSGDPY LHTNV++QGKG REQQF LWFDPT DF
Sbjct  94    AGTVTAYYLKSSGNSWDEIDFEFLGNLSGDPYTLHTNVYSQGKGDREQQFRLWFDPTADF  153

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYSILWNP+ IIFSVDG PIR+FKN+E+ G+PFPK Q M +YSSLW+A+DWATRGGL+K
Sbjct  154   HTYSILWNPKLIIFSVDGKPIREFKNLESIGVPFPKKQQMRIYSSLWNADDWATRGGLIK  213

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
             TDW++APF ASYRN++A AC++ S  +  S     S N WL +  D +  QR+KWVQKN+
Sbjct  214   TDWTRAPFTASYRNFNADACIWSSGRAACS-----SKNSWLWKQFDATSFQRLKWVQKNF  268

Query  336   MIYNYCTDAKRFPQGFPPECSLN  268
             MIYNYCTD KRFP GFPPECS+N
Sbjct  269   MIYNYCTDTKRFPLGFPPECSVN  291



>dbj|BAH36875.1| xyloglucan endotransglucosylase/hydrolase [Rosa hybrid cultivar]
 gb|AFR46572.1| xyloglucan endotransglucosylase/hydrolase 3 [Rosa x borboniana]
Length=285

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 221/273 (81%), Gaps = 3/273 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             LL+++   A  +AGNF  +    WG     IL +GQLLTLSLD+ASGSGF S N+Y++GK
Sbjct  14    LLISSFMVA--SAGNFNQDFKITWGDGRANILNDGQLLTLSLDKASGSGFESQNEYLFGK  71

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM++KLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY+LHTN+F+QGKG REQ
Sbjct  72    IDMQLKLVAGNSAGTVTAYYLKSEGSTWDEIDFEFLGNLSGDPYILHTNIFSQGKGNREQ  131

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QFYLWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+PF K Q M ++SSLW+
Sbjct  132   QFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNQESKGVPFLKSQAMRIHSSLWN  191

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDIS  373
             A+DWATRGGLVKTDWS APF ASYRN++A+AC++ S +S+ S T   +   WLSQ LD +
Sbjct  192   ADDWATRGGLVKTDWSAAPFTASYRNFNAEACIWSSGASSCSSTSTNNGG-WLSQELDST  250

Query  372   GQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              Q+R++WVQKNYMIYNYC D KRFPQG P ECS
Sbjct  251   SQERMRWVQKNYMIYNYCADVKRFPQGLPVECS  283



>gb|KDO46535.1| hypothetical protein CISIN_1g023581mg [Citrus sinensis]
Length=280

 Score =   390 bits (1002),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 216/274 (79%), Gaps = 3/274 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
               L+L TL    ++AG+F  E    WG    KI  NGQ LTLSLD+ASGSGF+S N+Y++
Sbjct  7     LFLVLGTLMV--VSAGSFYQEFDITWGDGRAKIHNNGQFLTLSLDKASGSGFQSKNEYLF  64

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG R
Sbjct  65    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGNR  124

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT  FHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+PFPK+QPM +YSSL
Sbjct  125   EQQFHLWFDPTAAFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSL  184

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDW+ APF ASYRN+ A AC++ S   +S  +    +  W SQ LD
Sbjct  185   WNADDWATRGGLVKTDWTHAPFTASYRNFKADACLW-SNGKSSCASSKSRSRAWFSQELD  243

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              S Q ++KWVQKNYMIYNYCTD KRFPQG P EC
Sbjct  244   SSSQNKLKWVQKNYMIYNYCTDTKRFPQGLPVEC  277



>ref|XP_011069899.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Sesamum indicum]
Length=291

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 174/267 (65%), Positives = 215/267 (81%), Gaps = 1/267 (0%)
 Frame = -3

Query  1074  SAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIK  895
             S+  ++  N   +    WG+  GKILENG+LLTLSLD  SGSGF+S  ++++GKIDM++K
Sbjct  23    SSTAVSGSNHFQDFDITWGEGRGKILENGELLTLSLDNYSGSGFQSKKEFLFGKIDMQLK  82

Query  894   LVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWF  715
             LVPGNSAGTVT +YLSS G  HDEIDFEFLGNLSG+PY +HTNV+ QGKG REQQF+LWF
Sbjct  83    LVPGNSAGTVTAFYLSSGGLNHDEIDFEFLGNLSGEPYTVHTNVYAQGKGEREQQFHLWF  142

Query  714   DPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWAT  535
             DPT DFHTYS+LWNPQ+I+FSVD TP+R+FKN+E  G+PFPK QPM +YSS+W+A+ WAT
Sbjct  143   DPTADFHTYSVLWNPQTIVFSVDNTPLREFKNLEKLGVPFPKTQPMKLYSSIWNADQWAT  202

Query  534   RGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKN-PSANPWLSQSLDISGQQRI  358
             RGGL+KTDW+QAPF+ASYRN++A ACV   A   + CT +     PW SQ LDI  ++++
Sbjct  203   RGGLIKTDWTQAPFVASYRNFNADACVVSDAPGAAYCTSSLADTTPWESQKLDILSEEKL  262

Query  357   KWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             KWVQ+NYMIYNYC DA RFPQGFP EC
Sbjct  263   KWVQRNYMIYNYCNDADRFPQGFPLEC  289



>gb|ACK36945.1| xyloglucan endotransglycosylase [Annona cherimola]
Length=292

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 217/274 (79%), Gaps = 1/274 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LLL    +    AG+        WG    KIL NG+LLTLSLD+ASGSGFRS N+Y++G
Sbjct  15    LLLLAATFSIPAYAGSIDQNFEITWGDGRAKILNNGELLTLSLDKASGSGFRSKNEYLFG  74

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLV GNSAGTVT YYLSS GST DE+D EFLGNLSGDPY+LHTNVFTQGKG RE
Sbjct  75    KIDMQLKLVQGNSAGTVTAYYLSSQGSTWDELDIEFLGNLSGDPYILHTNVFTQGKGNRE  134

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVD TPIR FKN+E+ G+PFPK+QPM +YSSLW
Sbjct  135   QQFYLWFDPTADFHTYSILWNPQQIIFSVDHTPIRIFKNLESKGVPFPKNQPMRIYSSLW  194

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDI  376
             +A+DWATRGGLVKTDWSQAPF ASYRN+ A ACV  S  S+ +     S + W  Q LD 
Sbjct  195   NADDWATRGGLVKTDWSQAPFTASYRNFHADACVSSSGQSSCNSNSR-SQDSWFGQELDS  253

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             + + +I+ VQ+ YMIYNYCTD+KRFPQGFPPECS
Sbjct  254   ASEGKIRQVQEKYMIYNYCTDSKRFPQGFPPECS  287



>ref|XP_003610141.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92338.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=289

 Score =   390 bits (1003),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/279 (67%), Positives = 219/279 (78%), Gaps = 4/279 (1%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIA---AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRST  934
             A F+ ++T+L         AGN   ++G  WG   GKI+ NGQLLTLSLDR SGSGF+S 
Sbjct  6     AFFVHVITSLICTIFIVAFAGNLYQDVGITWGDGRGKIVNNGQLLTLSLDRTSGSGFQSN  65

Query  933   NQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQ  754
             NQY+YGKIDM+IKLVPGNSAGTVT YYL S GS  DEIDFEFLGNLSGDPY++HTNV+TQ
Sbjct  66    NQYLYGKIDMQIKLVPGNSAGTVTAYYLRSEGSLWDEIDFEFLGNLSGDPYIVHTNVYTQ  125

Query  753   GKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMW  574
             GKG REQQFYLWFDPT  FHTYS LWNP  ++FS+DG PIR+FKN+E+ G+P+PK QPM 
Sbjct  126   GKGDREQQFYLWFDPTTSFHTYSFLWNPAHVVFSIDGRPIREFKNLESEGVPYPKKQPMR  185

Query  573   MYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWL  394
             +YSSLW+A+DWATRGGLVKTDW+QAPF AS+RN+ A  CV  S   +S  + + S N WL
Sbjct  186   LYSSLWNADDWATRGGLVKTDWNQAPFTASFRNFKANGCVL-SNGISSCKSNSSSDNAWL  244

Query  393   SQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              Q LD + Q+R+KWVQKNYMIYNYC D KRFPQG P EC
Sbjct  245   YQQLDSTNQKRLKWVQKNYMIYNYCNDLKRFPQGLPLEC  283



>ref|XP_009120272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Brassica rapa]
Length=283

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 220/275 (80%), Gaps = 1/275 (0%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ L  +L      + NF  ++   WG   G+I  NG+LLTLSLD++SGSGF+S N+Y++
Sbjct  6     FLPLFISLIVISSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLF  65

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVTT YL S G+T DEIDFEFLGNLSGDPY LHTNV+TQGKG +
Sbjct  66    GKIDMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDK  125

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF LWFDPT DFHTY+ILWNPQ IIF+VDGTPIR+FKNME+ G  FPK+QPM MYSSL
Sbjct  126   EQQFKLWFDPTADFHTYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSL  185

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSA-SSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDWS+APF ASYR ++ +ACV+ +  SS  + +   +   WLSQ L
Sbjct  186   WNADDWATRGGLVKTDWSKAPFTASYRGFNQEACVWSNGKSSCPNGSGQGTTGSWLSQEL  245

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             D + Q+R++WVQKNYMIYNYCTD KRFPQG P EC
Sbjct  246   DSTAQERMRWVQKNYMIYNYCTDTKRFPQGLPKEC  280



>ref|XP_006401194.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
 dbj|BAJ34580.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42647.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
Length=282

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 225/275 (82%), Gaps = 2/275 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             F+ L  +L  + ++A NF  ++   WG   G+I  NG+LLTLSLD++SGSGF+S N+Y++
Sbjct  6     FLPLFLSLIISSVSA-NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLF  64

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVTT YL S G+T DEIDFEFLGNLSGDPY LHTNV+TQGKG +
Sbjct  65    GKIDMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDK  124

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF LWFDPT DFHTY+ILWNPQ IIF+VDGTPIR+FKNME+ G  FPK++PM MYSSL
Sbjct  125   EQQFKLWFDPTADFHTYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNRPMRMYSSL  184

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSA-SSTSSCTKNPSANPWLSQSL  382
             W+A+DWATRGGLVKTDWS+APF ASYR ++ +ACV+ +  SS  S +K  +   WLSQ L
Sbjct  185   WNADDWATRGGLVKTDWSKAPFTASYRGFNQEACVWSNGKSSCPSGSKQGTTGSWLSQEL  244

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             D + Q+R++WVQ+NYMIYNYCTD+KRFP+G P EC
Sbjct  245   DSTAQERMRWVQRNYMIYNYCTDSKRFPRGLPKEC  279



>ref|XP_006474156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X3 [Citrus sinensis]
Length=285

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/266 (70%), Positives = 218/266 (82%), Gaps = 3/266 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  +    WG     IL NGQLLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  19    SAGNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  78

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG +EQQF+LWFDPT D
Sbjct  79    SAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTAD  138

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+ FPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  139   FHTYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLV  198

Query  519   KTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQSLDISGQQRIKWV  349
             KTDW+ APF ASYRN++A ACV+ +     ++SS +   S++ W SQ LD + Q+R+KWV
Sbjct  199   KTDWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWV  258

Query  348   QKNYMIYNYCTDAKRFPQGFPPECSL  271
             QKNYMIYNYCTD KRFPQG P EC +
Sbjct  259   QKNYMIYNYCTDTKRFPQGLPAECRI  284



>ref|XP_010047000.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   390 bits (1002),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/278 (67%), Positives = 225/278 (81%), Gaps = 2/278 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             +LL+    A   +A NF  +    WG    +IL NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  14    LLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFG  73

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM++KLVPG+S+GTVT YYLSS GS  DEIDFEFLGNLSGDPY+LHTNVF+QGKG RE
Sbjct  74    KIDMQLKLVPGDSSGTVTAYYLSSNGSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNRE  133

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKN E+  +PFPK QPM ++SSLW
Sbjct  134   QQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESISVPFPKAQPMRIFSSLW  193

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANPWLSQSL  382
             +A+DWATRGGLVKTDW+QAPF ASYRN++A   C++   +SS +S + +   N WLS+ L
Sbjct  194   NADDWATRGGLVKTDWTQAPFTASYRNFNADNTCIWSSGSSSCTSSSSSSDGNAWLSEEL  253

Query  381   DISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
             D + Q+R+KWVQ NYMIYNYCTDAKRFPQG P EC+++
Sbjct  254   DSTSQERLKWVQSNYMIYNYCTDAKRFPQGLPRECAMS  291



>ref|XP_006358262.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Solanum tuberosum]
Length=286

 Score =   390 bits (1002),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 225/277 (81%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFIN-EIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA GN ++ E    WG    KIL NG LLTLSLD+ SGSGF+S N+Y++
Sbjct  9     LVMCFMVSAFGIAIGNTLDQEFEITWGDGRAKILNNGDLLTLSLDKISGSGFQSKNEYLF  68

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLV GNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  69    GKIDMQLKLVTGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  128

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             +QQF+LWFDPT DFHTYSI WNPQ IIF VDG PIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  129   DQQFHLWFDPTADFHTYSITWNPQRIIFYVDGMPIREYKNSESMGVSYPKNQPMRIYSSL  188

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN++A AC+  S SS +S T   + + WL++ LD
Sbjct  189   WNADDWATRGGLVKTDWSQAPFSASYRNFNANACIPNSPSSCNSNTTTSTNSSWLNEELD  248

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+YNYCTD+KRFPQGFP +C  N
Sbjct  249   NTSQERLKWVQKNYMVYNYCTDSKRFPQGFPADCLQN  285



>ref|XP_008801539.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=284

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 219/273 (80%), Gaps = 4/273 (1%)
 Frame = -3

Query  1089  LLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKI  910
             LL +   A  +AGNF       WG   GKIL+NGQLLTL+LD ASGSGF+S N+Y++GKI
Sbjct  15    LLASFLIATASAGNFYQGFDITWGDGRGKILDNGQLLTLALDEASGSGFQSKNEYLFGKI  74

Query  909   DMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQ  730
             DM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSG+PY LHTNVF QGKG RE Q
Sbjct  75    DMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGEPYTLHTNVFAQGKGNREMQ  134

Query  729   FYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDA  550
             F+LWFDPT+DFHTYSILWNP  +I+ VDG PIR FKN+E+ GI FPK+QPM +YSSLW+A
Sbjct  135   FHLWFDPTEDFHTYSILWNPGHVIYMVDGIPIRDFKNLESRGIAFPKNQPMRIYSSLWNA  194

Query  549   EDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISG  370
             +DWAT+GG +KTDW++APF ASYRN++A AC++ S +  SSC  N   + W +Q LD + 
Sbjct  195   DDWATQGGRIKTDWTKAPFTASYRNFNADACIWSSGA--SSC--NSQKSDWWNQELDSTS  250

Query  369   QQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
             Q+R++W Q+NYMIYNYCTD KRFPQG P ECS+
Sbjct  251   QERMRWAQENYMIYNYCTDLKRFPQGLPLECSV  283



>ref|XP_004235157.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Solanum lycopersicum]
Length=287

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/277 (68%), Positives = 226/277 (82%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAG-NFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA G  F  E    WG    KIL NG LLTLSLD+ SGSGF+S N+Y++
Sbjct  10    LVMCFMISAFGIAIGAKFDQEFDITWGDGRAKILNNGDLLTLSLDKISGSGFQSKNEYLF  69

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVP NSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  70    GKIDMQLKLVPRNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  129

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTY+I WNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  130   EQQFHLWFDPTADFHTYAITWNPQRIIFYVDGTPIREYKNSESIGVSYPKNQPMRIYSSL  189

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN+SA AC+  S+SS SS +   ++N WL++ LD
Sbjct  190   WNADDWATRGGLVKTDWSQAPFSASYRNFSANACIPTSSSSCSSISATSTSNSWLNEELD  249

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+Y+YCTD+KRFPQGFP +C  N
Sbjct  250   NTSQERLKWVQKNYMVYDYCTDSKRFPQGFPADCVQN  286



>ref|XP_010536922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=293

 Score =   390 bits (1002),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 218/273 (80%), Gaps = 2/273 (1%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             ++L  L  + ++A NF   +   WG   G+I  NG+LLTLSLD+ SGSGF+S N++++GK
Sbjct  19    VILAGLLVSSVSA-NFYRNVEITWGDGRGQIKNNGELLTLSLDKPSGSGFQSKNEFLFGK  77

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM+IKLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG REQ
Sbjct  78    IDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQ  137

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QF LWFDPT DFH+YSI WNPQ IIFSVDGTPIR+FKNME+ G+ FPK QPM MYSSLW+
Sbjct  138   QFKLWFDPTSDFHSYSITWNPQRIIFSVDGTPIREFKNMESQGVLFPKSQPMRMYSSLWN  197

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSA-SSTSSCTKNPSANPWLSQSLDI  376
             A+DWATRGGLVKTDWSQAPF ASYR ++  ACV+ +  SS  + +   +   WLSQ LD 
Sbjct  198   ADDWATRGGLVKTDWSQAPFTASYRGFNEDACVWSNGKSSCPNGSSQGTGGSWLSQELDT  257

Query  375   SGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             +GQ+R++WV++NYMIYNYCTD +RFPQG P EC
Sbjct  258   AGQERMRWVERNYMIYNYCTDTQRFPQGLPKEC  290



>ref|XP_010927059.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=282

 Score =   389 bits (1000),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 218/262 (83%), Gaps = 4/262 (2%)
 Frame = -3

Query  1056  AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGNS  877
             AGNF  ++   WG    KIL NG+LLTLSLDR+SGSGF+S  +Y+YGKIDM+IKLVPGNS
Sbjct  24    AGNFYQDVDITWGDGRAKILNNGELLTLSLDRSSGSGFQSKQEYLYGKIDMQIKLVPGNS  83

Query  876   AGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKDF  697
             AGTVT YYLSS G+THDEIDFEFLGNLSGDPYV+HTN++TQGKG RE QFYLWFDPT DF
Sbjct  84    AGTVTAYYLSSQGATHDEIDFEFLGNLSGDPYVVHTNLYTQGKGDREMQFYLWFDPTMDF  143

Query  696   HTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLVK  517
             HTYS+LWNP+ ++F VDGTPIR+F+N E+SG+ +PK+QPM +YSSLW+A+DWATRGGLVK
Sbjct  144   HTYSVLWNPKHVVFYVDGTPIREFRNRESSGVAYPKNQPMRVYSSLWNADDWATRGGLVK  203

Query  516   TDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLDISGQQRIKWVQKNY  337
             TDWS+APF AS+RN++A  CV GS +S+ S       N W+ Q  D +  QR++WVQ+NY
Sbjct  204   TDWSKAPFTASFRNFTAVGCVGGSGASSCSSAN----NTWMWQEFDSNSLQRLRWVQQNY  259

Query  336   MIYNYCTDAKRFPQGFPPECSL  271
             MIYNYCTD +RFP+G PPECSL
Sbjct  260   MIYNYCTDVRRFPRGLPPECSL  281



>ref|XP_006280918.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
 gb|EOA13816.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
Length=284

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/277 (64%), Positives = 217/277 (78%), Gaps = 0/277 (0%)
 Frame = -3

Query  1107  VAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             +   + L  +L      + NF  ++   WG   G+I  NG+LLTLSLD++SGSGF+S N+
Sbjct  5     IGYLLPLFLSLIIISSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSRNE  64

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             Y++GKIDM++KLVPGNSAGTVTT YL S G+T DEIDFEFLGN SG+PY LHTNV+TQGK
Sbjct  65    YLFGKIDMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNSSGEPYTLHTNVYTQGK  124

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G +EQQF LWFDPT DFHTYSILWNPQ IIF+VDGTPIR+FKNME+ G  FPK++PM MY
Sbjct  125   GDKEQQFKLWFDPTADFHTYSILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNKPMRMY  184

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             SSLW+A+DWATRGGLVKTDWS+APF ASYR +  +ACV+ +  S+    +  +   WLSQ
Sbjct  185   SSLWNADDWATRGGLVKTDWSKAPFTASYRGFKQEACVWSNGKSSCGSKQRTTTGSWLSQ  244

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              LD + QQR++WVQ+NYMIYNYCTD KRFPQG P EC
Sbjct  245   QLDSTAQQRMRWVQRNYMIYNYCTDTKRFPQGLPKEC  281



>ref|XP_009759293.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Nicotiana sylvestris]
 ref|XP_009767490.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Nicotiana sylvestris]
Length=272

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/276 (66%), Positives = 225/276 (82%), Gaps = 12/276 (4%)
 Frame = -3

Query  1095  ILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             ++L   +SA  +A AG F +     WG+   K+L NG+LLTLSLD+ SGSGF+S ++Y++
Sbjct  8     LVLALIVSAFAVAIAGTFDDNFEITWGEGRAKMLNNGELLTLSLDKISGSGFQSKDEYLF  67

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  68    GKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  127

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSILWNPQ IIF VDGTPIR++KN E+ G+ +PK+QPM +YSSL
Sbjct  128   EQQFHLWFDPTADFHTYSILWNPQRIIFYVDGTPIREYKNSESIGVSYPKNQPMRIYSSL  187

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGL+KTDWS+APF ASYRN+        SA+STS+     ++N WL++ LD
Sbjct  188   WNADDWATRGGLIKTDWSKAPFSASYRNFK-------SATSTSAA----NSNSWLNEELD  236

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              + Q+R+KWVQKNYM+YNYC D+KRFPQGFP +C++
Sbjct  237   NTSQERLKWVQKNYMVYNYCNDSKRFPQGFPADCAI  272



>ref|XP_006453414.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
 ref|XP_006474157.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|ESR66654.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
Length=285

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/264 (70%), Positives = 217/264 (82%), Gaps = 3/264 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  +    WG     IL NGQLLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  19    SAGNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  78

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG +EQQF+LWFDPT D
Sbjct  79    SAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTAD  138

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+ FPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  139   FHTYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLV  198

Query  519   KTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQSLDISGQQRIKWV  349
             KTDW+ APF ASYRN++A ACV+ +     ++SS +   S++ W SQ LD + Q+R+KWV
Sbjct  199   KTDWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWV  258

Query  348   QKNYMIYNYCTDAKRFPQGFPPEC  277
             QKNYMIYNYC DAKRFPQG P EC
Sbjct  259   QKNYMIYNYCADAKRFPQGLPAEC  282



>ref|XP_006453421.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
 gb|ESR66661.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
Length=285

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/264 (70%), Positives = 217/264 (82%), Gaps = 3/264 (1%)
 Frame = -3

Query  1059  AAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGKIDMKIKLVPGN  880
             +AGNF  +    WG     IL NGQLLTLSLD+ASGSGF+S N+Y++GKIDM++KLVPGN
Sbjct  19    SAGNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGN  78

Query  879   SAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQQFYLWFDPTKD  700
             SAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG +EQQF+LWFDPT D
Sbjct  79    SAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTAD  138

Query  699   FHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWDAEDWATRGGLV  520
             FHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+ FPK+QPM +YSSLW+A+DWATRGGLV
Sbjct  139   FHTYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLV  198

Query  519   KTDWSQAPFIASYRNYSAQACVYGSAS---STSSCTKNPSANPWLSQSLDISGQQRIKWV  349
             KTDW+ APF ASYRN++A ACV+ +     ++SS +   S++ W SQ LD + Q+R+KWV
Sbjct  199   KTDWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWV  258

Query  348   QKNYMIYNYCTDAKRFPQGFPPEC  277
             QKNYMIYNYC DAKRFPQG P EC
Sbjct  259   QKNYMIYNYCADAKRFPQGLPAEC  282



>ref|XP_006858036.1| hypothetical protein AMTR_s00062p00016540 [Amborella trichopoda]
 gb|ERN19503.1| hypothetical protein AMTR_s00062p00016540 [Amborella trichopoda]
Length=287

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 226/280 (81%), Gaps = 6/280 (2%)
 Frame = -3

Query  1104  AAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             A  +L+   L+ A +A  NF ++    WG D  ++L NG+ L LSLD+ SGSGF+S N+Y
Sbjct  10    ALTLLIWGLLAVASMA--NFYSDFDITWGND--RVLNNGEQLHLSLDKYSGSGFQSKNEY  65

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++G I M++KLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QG+G
Sbjct  66    LFGNIHMRLKLVPGNSAGTVTAYYLSSQGQTHDEIDFEFLGNLSGDPYTLHTNVFSQGRG  125

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQF+LWFDPTKDFHTYSILWNP  I FSVDGTPIR FKN E  G+PFPK+QPM +YS
Sbjct  126   NREQQFHLWFDPTKDFHTYSILWNPNHIKFSVDGTPIRVFKNAEHLGVPFPKNQPMKLYS  185

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSC-TKNPSANPWLSQ  388
             SLW+A+DWATRGGL+KTDWSQAPF+ASY N+ A ACV   +S++SS   K  S + WLSQ
Sbjct  186   SLWNADDWATRGGLIKTDWSQAPFVASYSNFEADACVASKSSASSSSPCKEASGSAWLSQ  245

Query  387   -SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              +LD +GQ+++KWVQKNYM+YNYCTD KRFPQG PPECSL
Sbjct  246   EALDTNGQEKLKWVQKNYMVYNYCTDTKRFPQGLPPECSL  285



>ref|XP_006425209.1| hypothetical protein CICLE_v10010858mg [Citrus clementina]
 ref|XP_006474162.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Citrus sinensis]
 gb|ESR38449.1| hypothetical protein CICLE_v10010858mg [Citrus clementina]
Length=280

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 216/274 (79%), Gaps = 3/274 (1%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
               L+L TL  A  +AG+F  +    WG    KI  NGQ LTLSLD+ASGSGF+S N+Y++
Sbjct  7     LFLVLGTLMVA--SAGSFYQDFDITWGDGRAKIHNNGQFLTLSLDKASGSGFQSKNEYLF  64

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLVPGNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFT GKG R
Sbjct  65    GKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGNR  124

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT  FHTYSILWNPQ I+FSVDGTPIR+FKN E+ G+PFPK+QPM +YSSL
Sbjct  125   EQQFHLWFDPTAAFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSL  184

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDW+ APF ASYRN+ A AC++ S   +S  +    +  W SQ LD
Sbjct  185   WNADDWATRGGLVKTDWTHAPFTASYRNFKADACLW-SNGKSSCASSKSRSRAWFSQELD  243

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              S Q ++KWVQKNYMIYNYCTD KRFPQG P EC
Sbjct  244   SSSQNKLKWVQKNYMIYNYCTDTKRFPQGLPVEC  277



>ref|XP_006358260.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X2 [Solanum tuberosum]
Length=286

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/277 (68%), Positives = 226/277 (82%), Gaps = 1/277 (0%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFIN-EIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +++   +SA GIA GN ++ E    WG    KIL NG LLTLSLD+ SGSGF+S N+Y++
Sbjct  9     LVMCFMVSAFGIAIGNTLDQEFEITWGDGRAKILNNGDLLTLSLDKISGSGFQSKNEYLF  68

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM++KLV GNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNVF+QGKG R
Sbjct  69    GKIDMQLKLVSGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNR  128

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSI WNPQ IIF VDGTPIR++KN E+ G+ +PK+Q M +YSSL
Sbjct  129   EQQFHLWFDPTADFHTYSITWNPQRIIFYVDGTPIREYKNSESMGVSYPKNQAMRIYSSL  188

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A+DWATRGGLVKTDWSQAPF ASYRN+SA AC+  S+SS SS T   ++N WL++ LD
Sbjct  189   WNADDWATRGGLVKTDWSQAPFSASYRNFSANACIPSSSSSCSSNTTTSTSNSWLNEELD  248

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSLN  268
              + Q+R+KWVQKNYM+YNYCTD+KRF QGFP +C  N
Sbjct  249   NTSQERLKWVQKNYMVYNYCTDSKRFSQGFPADCVQN  285



>ref|XP_010536006.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/276 (65%), Positives = 218/276 (79%), Gaps = 5/276 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
              IL L    A   + GNF  ++   WG   GK+LENG LL LSLD+ SGSGF+S N+++Y
Sbjct  12    LILSLLATHALEASVGNFERDVQITWGNGRGKVLENGNLLALSLDQFSGSGFQSKNEFLY  71

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             G+++ +IKLVPGNSAGTVTT+YL S G+T DEIDFEFLGNLSG PY LHTNV+TQGKG +
Sbjct  72    GRVEAQIKLVPGNSAGTVTTFYLKSPGATWDEIDFEFLGNLSGHPYTLHTNVYTQGKGDK  131

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPT DFHTYSI WNPQ IIF+VDG PIR+FKN+E+ G+PFPK+QPM +Y+SL
Sbjct  132   EQQFHLWFDPTADFHTYSITWNPQRIIFTVDGIPIREFKNLESIGVPFPKNQPMRLYASL  191

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQSLD  379
             W+A++WATRGGLVK DWS+APF ASYRNY+A  CV+  +S  SSC   P+  PW SQ LD
Sbjct  192   WEADEWATRGGLVKIDWSRAPFTASYRNYNANGCVW--SSGRSSC---PANKPWFSQELD  246

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              +G+ R+KWVQ  YM+YNYCTD KR PQG PPEC +
Sbjct  247   FNGKNRMKWVQSRYMVYNYCTDRKRSPQGAPPECKM  282



>ref|XP_010433588.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Camelina sativa]
Length=287

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 218/277 (79%), Gaps = 6/277 (2%)
 Frame = -3

Query  1098  FILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
              +LL+  L    ++A NF  ++   WG   G+I  NG LLTL+LD+ASGSGF+S N+Y++
Sbjct  11    LVLLVAALIICSVSA-NFQRDVEVTWGDGRGQITNNGDLLTLALDKASGSGFQSKNEYLF  69

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             GKIDM+IKLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG R
Sbjct  70    GKIDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDR  129

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF LWFDPT DFHTYSILWN Q IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSL
Sbjct  130   EQQFKLWFDPTSDFHTYSILWNSQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSL  189

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSC---TKNPSANPWLSQ  388
             W+AEDWATRGGLVKTDWS+APF ASYR ++ +ACV    +  SSC   ++  S+  WLSQ
Sbjct  190   WNAEDWATRGGLVKTDWSKAPFTASYRGFNVEACVL--VNDQSSCPNGSEQGSSGSWLSQ  247

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              LD +GQ++++ VQ NYMIYNYCTD  RFPQG P EC
Sbjct  248   ELDSTGQEQMRRVQNNYMIYNYCTDTNRFPQGLPREC  284



>ref|XP_010259801.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=293

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/278 (66%), Positives = 221/278 (79%), Gaps = 6/278 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIA--AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMY  919
             +LL  L++  +A  A  F  +    WG    KI  NG+LLTLSLD+ASG GF+S  +Y++
Sbjct  12    MLLVLLASFFMATSASTFFQDFDITWGDGRAKIFNNGKLLTLSLDKASGCGFQSKREYLF  71

Query  918   GKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGR  739
             G IDM++KLVPGNSAGTVT YYLSS G  HDEIDFEFLGNLSGDPY+LHTNVF+QGKG R
Sbjct  72    GSIDMQLKLVPGNSAGTVTAYYLSSQGPNHDEIDFEFLGNLSGDPYILHTNVFSQGKGNR  131

Query  738   EQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSL  559
             EQQF+LWFDPTKDFHTYSILWNPQSIIFSVD  PIR+FKN+E  G+PFPK+QPM +YSSL
Sbjct  132   EQQFFLWFDPTKDFHTYSILWNPQSIIFSVDRIPIREFKNLEPIGVPFPKNQPMRIYSSL  191

Query  558   WDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA----NPWLS  391
             W+A+DWATRGGL+KTDW++APF ASYRN+ A ACV+ S +S+ S     S       WLS
Sbjct  192   WNADDWATRGGLIKTDWTKAPFTASYRNFKANACVWSSGASSCSSQSLVSTVNYNKAWLS  251

Query  390   QSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             + LD + Q++++WVQ+NYMIYNYCTD KRFPQG PPEC
Sbjct  252   RQLDSTSQEKMRWVQRNYMIYNYCTDTKRFPQGLPPEC  289



>ref|XP_002302146.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE81419.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   388 bits (997),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/277 (66%), Positives = 216/277 (78%), Gaps = 4/277 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAA---GNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQY  925
             +LL T L A  + A   GNF  +    WG    KIL  GQLLTLSLD+ASGSGF+S N+Y
Sbjct  12    MLLFTLLFACLMGASKGGNFFQDFDITWGDQRAKILNGGQLLTLSLDKASGSGFQSKNEY  71

Query  924   MYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKG  745
             ++G+IDM+IKLV GNSAGTVT YYLSS GSTHDEIDFEFLGN +G+PY+LHTNVF+QGKG
Sbjct  72    LFGQIDMQIKLVAGNSAGTVTAYYLSSQGSTHDEIDFEFLGNATGEPYILHTNVFSQGKG  131

Query  744   GREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYS  565
              REQQFYLWFDPTK FHTYSI+WN Q IIF VD  PIR F N+E+ G+PFP  Q M ++S
Sbjct  132   NREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESIGVPFPNKQAMRIHS  191

Query  564   SLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNP-SANPWLSQ  388
             SLW+A+DWATRGGLVKTDW+QAPF ASYRN+ A AC++ SAS  +S + N    N W  Q
Sbjct  192   SLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSSASPCTSTSPNSVQDNAWQVQ  251

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             +LD  G+ R++WVQ+ YMIYNYCTD KRFPQG PPEC
Sbjct  252   ALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPEC  288



>ref|XP_009341025.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
 ref|XP_009341027.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
 ref|XP_009341030.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=293

 Score =   388 bits (997),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 231/282 (82%), Gaps = 4/282 (1%)
 Frame = -3

Query  1113  GGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRST  934
             G +  F L++T+L  A  +AGNF  +I   WG   GKIL NG+LLTLSLD++SGSGF+ST
Sbjct  9     GYILLFSLMVTSLMVA--SAGNFYQDIQVTWGDGRGKILNNGELLTLSLDKSSGSGFQST  66

Query  933   NQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQ  754
             NQY++GKIDM+IK VPGNSAGTVTTYYL S GS+ DEIDFEFLGNLSGDPY++HTN+F+Q
Sbjct  67    NQYLFGKIDMQIKFVPGNSAGTVTTYYLRSEGSSWDEIDFEFLGNLSGDPYIVHTNIFSQ  126

Query  753   GKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMW  574
             GKG +EQQFYLWFDPT DFHTYSILWN Q I+  VDGTPIR+FKN+E+ G+P+PK Q M 
Sbjct  127   GKGNKEQQFYLWFDPTADFHTYSILWNAQHIVLYVDGTPIREFKNLESIGVPYPKKQSMR  186

Query  573   MYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSA-QACVY-GSASSTSSCTKNPSANP  400
             +YSSLW+A+DWATRGGLVKTDWSQAPF ASYRN++A  AC++  S S++ S   N +++ 
Sbjct  187   IYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNADNACIWRSSGSTSCSSNSNSTSSV  246

Query  399   WLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
              LSQ LD + ++R++WVQKNYM+YNYC D KRFPQG P EC+
Sbjct  247   LLSQQLDSTSKERLQWVQKNYMVYNYCADTKRFPQGLPVECT  288



>ref|XP_002274154.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=310

 Score =   389 bits (999),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 224/295 (76%), Gaps = 9/295 (3%)
 Frame = -3

Query  1152  SSMASLEATHRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTL  973
             +SMAS  +T      V  F++ L   S   ++AG    +I   WG D  KIL NGQLLTL
Sbjct  16    TSMASFSST------VLLFLISLMAASFIAVSAGTLYEDIDIKWGDDRAKILNNGQLLTL  69

Query  972   SLDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLS  793
             SLDR  G+GF+S N+Y++GKI+M++KLVPGNSAGTVT +YLSS G T DEIDFEFLGNLS
Sbjct  70    SLDRTCGAGFQSKNEYLFGKIEMQLKLVPGNSAGTVTAFYLSSPGPTRDEIDFEFLGNLS  129

Query  792   GDPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNME  613
             GDPY +HTNV+TQGKG REQQF+LWFDPT DFHTYS  WNP+ IIFSVD TPIR+FKN+E
Sbjct  130   GDPYTVHTNVYTQGKGEREQQFHLWFDPTADFHTYSFTWNPKHIIFSVDDTPIREFKNLE  189

Query  612   ASGIPFPKDQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASST  433
             + G+ +PK+Q M +YSSLWDAEDWATRGGLVKTDWSQAPF ASYRN++A  C++ +  S+
Sbjct  190   SIGVQYPKNQAMSLYSSLWDAEDWATRGGLVKTDWSQAPFTASYRNFNANGCIWSAGKSS  249

Query  432   SSCTKNP---SANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              S   +    + N WL+  LD   Q+++ WVQ+NYMIYNYCTD KRFP GFP EC
Sbjct  250   CSSVSSSLILADNSWLAPELDARSQEKLMWVQRNYMIYNYCTDTKRFPGGFPAEC  304



>ref|XP_008223719.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Prunus mume]
Length=301

 Score =   388 bits (997),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 231/299 (77%), Gaps = 7/299 (2%)
 Frame = -3

Query  1146  MASLEATHRGGGGVAAFILLLTTLSAAGIA-AGNFINEIGFNWGQDHGKILENGQLLTLS  970
             MAS     +    +   +L     S   +A A NF  +    WG   GKIL+N +LL LS
Sbjct  1     MASSSPPSKYRFSLVCLVLCFIVGSLVAVASASNFNQDFEITWGDGRGKILDNNELLMLS  60

Query  969   LDRASGSGFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSG  790
             LD+ SGSGF+STN+Y++GKIDM++KLVPGNSAGTVT YYL+S G T DEIDFEFLGNLSG
Sbjct  61    LDKGSGSGFQSTNEYLFGKIDMQLKLVPGNSAGTVTAYYLASEGLTWDEIDFEFLGNLSG  120

Query  789   DPYVLHTNVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEA  610
             DPY+LHTNV++QGKG REQQFYLWFDPT DFHTYSILWN Q I+FSVDGTPIR+FKN+E+
Sbjct  121   DPYILHTNVYSQGKGNREQQFYLWFDPTADFHTYSILWNSQRIVFSVDGTPIREFKNLES  180

Query  609   SGIPFPKDQPMWMYSSLWDAEDWATRGG-LVKTDWSQAPFIASYRNYSA-QACVYGSAS-  439
              G+PFPK+QPM +YSSLW+A+DWATRGG LVKTDW++APF+A YRN++A  ACV+ S + 
Sbjct  181   IGVPFPKNQPMRLYSSLWNADDWATRGGLLVKTDWTKAPFVAFYRNFNAINACVWSSGAS  240

Query  438   ---STSSCTKNPSANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
                S S  + + + N WLSQ  D++ Q+++KWVQ+NYMIYNYC D KRFPQG P EC+L
Sbjct  241   SCTSKSPSSTSSAGNTWLSQEFDLASQEKLKWVQRNYMIYNYCKDTKRFPQGVPQECAL  299



>ref|XP_006284247.1| hypothetical protein CARUB_v10005412mg [Capsella rubella]
 gb|EOA17145.1| hypothetical protein CARUB_v10005412mg [Capsella rubella]
Length=287

 Score =   388 bits (996),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 217/274 (79%), Gaps = 2/274 (1%)
 Frame = -3

Query  1095  ILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYG  916
             + L+  L    ++A NF  ++   WG   G+I  NG LLTLSLD+ASGSGF+S N+Y++G
Sbjct  12    VPLVAALMICSVSA-NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSRNEYLFG  70

Query  915   KIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGRE  736
             KIDM+IKLV GNSAGTVT YYL S GST DEIDFEFLGNLSGDPY LHTNVFTQGKG RE
Sbjct  71    KIDMQIKLVAGNSAGTVTAYYLISPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDRE  130

Query  735   QQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLW  556
             QQF LWFDPT DFHTYSILWNPQ IIFSVDGTPIR+FKNME+ G  FPK+QPM MYSSLW
Sbjct  131   QQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGNLFPKNQPMRMYSSLW  190

Query  555   DAEDWATRGGLVKTDWSQAPFIASYRNYSAQAC-VYGSASSTSSCTKNPSANPWLSQSLD  379
             +AEDWATRGGLVKTDWS+APF ASYR ++ +AC V    SS  + ++  S   WLSQ LD
Sbjct  191   NAEDWATRGGLVKTDWSKAPFTASYRGFNEEACVVVNGQSSCPNGSEQGSRGSWLSQELD  250

Query  378   ISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
              +GQ++++ VQ NYMIYNYCTDA RFPQG P EC
Sbjct  251   STGQEQMRRVQSNYMIYNYCTDANRFPQGLPREC  284



>ref|XP_010525737.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/279 (64%), Positives = 220/279 (79%), Gaps = 8/279 (3%)
 Frame = -3

Query  1098  FILLLTTLSAAGIA---AGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQ  928
             F+  + +L A  +    AGNF  ++   WG   GKIL+NG LL LSLD+ SGSGF+S N+
Sbjct  9     FVFFMLSLMATHVLVAFAGNFQRDVQITWGDGRGKILDNGNLLALSLDQFSGSGFQSKNE  68

Query  927   YMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGK  748
             ++YGK++ +IKLVPGNSAGTVTT+YL S GST DEIDFEFLGNLSG PY LHTNV+TQG+
Sbjct  69    FLYGKVEAQIKLVPGNSAGTVTTFYLKSPGSTWDEIDFEFLGNLSGHPYTLHTNVYTQGR  128

Query  747   GGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMY  568
             G +EQQF+LWFDPT DFHTYSI WNPQ IIF+VDG PIR+FKN E+ G+PFPKDQPM +Y
Sbjct  129   GDKEQQFHLWFDPTADFHTYSITWNPQRIIFTVDGIPIREFKNFESIGVPFPKDQPMRLY  188

Query  567   SSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSANPWLSQ  388
             +SLW+A++WATRGGLVKTDWS APF+ASYRNY+   CV+  ++  SSC   P+   W SQ
Sbjct  189   ASLWEADEWATRGGLVKTDWSHAPFMASYRNYNENGCVW--SNGRSSC---PADKAWFSQ  243

Query  387   SLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECSL  271
              LD  G+ R+KWVQ+ YM+Y+YCTD KR+PQG PPEC +
Sbjct  244   ELDFKGKNRVKWVQRRYMVYDYCTDRKRYPQGAPPECKM  282



>gb|AES92349.2| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=275

 Score =   387 bits (994),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 213/285 (75%), Gaps = 15/285 (5%)
 Frame = -3

Query  1128  THRGGGGVAAFILLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGS  949
             TH          LL+        AAGNF       WG    KIL+NGQLLTLSLD+ASGS
Sbjct  4     THNCSMITVLLSLLVFATFMTTYAAGNFYQNFDITWGDGRAKILDNGQLLTLSLDKASGS  63

Query  948   GFRSTNQYMYGKIDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHT  769
             GF+S N+Y++G IDM++KLVPGNSAGTVT YYLSS GS  DEIDFEFLGN+SG+PY LHT
Sbjct  64    GFQSKNEYLFGNIDMQLKLVPGNSAGTVTAYYLSSKGSNWDEIDFEFLGNVSGEPYTLHT  123

Query  768   NVFTQGKGGREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPK  589
             NVF QGKG REQQF+LWFDPT DFHTYSILWNPQ I+FSVDGTPIR+FKNME+ G+ FPK
Sbjct  124   NVFCQGKGNREQQFHLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNMESKGVAFPK  183

Query  588   DQPMWMYSSLWDAEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPS  409
             +QPM +YSSLW+A+DWATRGGLVKTDW+ APF ASYRN++A+                 S
Sbjct  184   NQPMRIYSSLWNADDWATRGGLVKTDWTNAPFTASYRNFNAETT---------------S  228

Query  408   ANPWLSQSLDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPECS  274
             +N W +Q LD + QQR+  VQKNYMIYNYCTD KRFPQG P EC+
Sbjct  229   SNAWFTQQLDSTSQQRLSEVQKNYMIYNYCTDIKRFPQGLPTECT  273



>ref|XP_010102170.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
 gb|EXB92420.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
Length=289

 Score =   388 bits (996),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/276 (66%), Positives = 217/276 (79%), Gaps = 5/276 (2%)
 Frame = -3

Query  1092  LLLTTLSAAGIAAGNFINEIGFNWGQDHGKILENGQLLTLSLDRASGSGFRSTNQYMYGK  913
             L + +   A   AGNF  +    WG    +IL  GQLLTL+LD+ASGSGF+S N+Y++G+
Sbjct  9     LFMVSWLMAAATAGNFYQDFDITWGDHRAQILNGGQLLTLNLDKASGSGFQSKNEYLFGR  68

Query  912   IDMKIKLVPGNSAGTVTTYYLSSLGSTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGGREQ  733
             IDM+IKLVPGNSAGTVT YYLSS G THDEIDFEFLGNLSGDPY LHTNV +QGKG REQ
Sbjct  69    IDMQIKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYTLHTNVLSQGKGNREQ  128

Query  732   QFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIRQFKNMEASGIPFPKDQPMWMYSSLWD  553
             QF+LWFDPTK FHTYSI+WN Q IIF VD  PIR F N+E++G+PFPK QPM +YSSLW+
Sbjct  129   QFHLWFDPTKAFHTYSIVWNKQRIIFLVDNIPIRVFNNLESTGVPFPKSQPMRIYSSLWN  188

Query  552   AEDWATRGGLVKTDWSQAPFIASYRNYSAQACVYGSASSTSSCTKNPSA----NPWLSQS  385
             A+DWATRGGLVKTDW++APF ASYRN+ A ACV+ SA  +S  +K+ SA      W  Q 
Sbjct  189   ADDWATRGGLVKTDWTKAPFTASYRNFKANACVW-SAGKSSCDSKSTSAAFEDATWQDQG  247

Query  384   LDISGQQRIKWVQKNYMIYNYCTDAKRFPQGFPPEC  277
             LD +G+ R++WVQ+ YM+YNYCTD+KRFPQG PPEC
Sbjct  248   LDAAGRNRLRWVQQKYMVYNYCTDSKRFPQGLPPEC  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3133188702855